3UAIC

Structure of the shq1-cbf5-nop10-gar1 complex from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
PPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase/chaperone
molecule keywords H/ACA ribonucleoprotein complex subunit 4
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3uaiC00
2EY4C 2RFKC 3UAIC 2EQNA 3U28C 2HVYB 2V3MA 3MQKC
chains in the Genus database with same CATH superfamily
5FPYA 4GVUA 1S84A 3CNRA 1QL9A 1PPFE 1C2GA 2A2XH 1WOFA 2ZU5A 4ABJA 1GDQA 4JMYA 1K1LA 3SV8A 2XYAA 1HJAB 3FZDA 4B74A 3ZZ9A 1GJ5H 1GJBB 4ABHA 1SLVB 3VGCB 2UUJB 2O8TA 4WMFA 2W7UA 1JIMA 4I8LA 4E7NA 1NU9A 1Y3YA 1GHZA 1QBNA 1BMFD 2VIWA 5L6NH 3GOVB 1DICA 1EZSC 1VCWA 1RIWB 3PV2A 2HLCA 1SB1H 1P2IA 2J34A 1UK3A 2WPDD 1P03A 1D9IA 1UTMA 1O5GH 1EB1H 1NT1A 1P2KA 3BTFE 4UFEH 5C0TA 2HGTH 2Z9GA 4FUGA 1IQFA 3E3TA 4CBOA 1XMNB 1PQ8A 2STAE 3NCLA 1VITG 3LOXA 2Y81A 1GMHF 1W8BH 2WUBA 1IQGA 4A6LA 3SHCH 3S69A 3TJVA 1QL8A 2HNTF 1A2CH 1XUFA 3ZVAA 3F2HA 1C2DA 3RXHA 7KMEH 6GCHF 1G3BA 1HXFH 3VB3A 5A0AE 1AWHB 3ITIA 5DP6A 1HAGE 2OQ5A 4AG1A 4B71A 1GI8B 1YYY1 3TGIE 2ZGBH 4PROA 3GYMA 1EFRD 4Y10E 1AKSA 1FNIA 1X7AC 1O2IA 3BTGE 3PTBA 3FP6E 1C1NA 1TPAE 1F5RA 1BMLA 1SLXB 4RSPA 4Q7ZA 5EJZA 5HKKD 2C8WB 1QRXA 5AFYH 5DSFA 1H1BA 1VITH 1DWEH 3SBKA 4FU9A 1GBDA 2ZIQH 2W6ID 4XBDA 2A4GA 2A7HA 3BTDE 2BLVA 3RXBA 4I7YH 4CRGA 3QZRA 1DANH 1ZZZA 2CV3A 4JYUH 1HLTH 5EU8A 4MNWA 3MH7A 7ESTE 5HIZA 4F49A 3STIA 1YKTA 1TX7A 1AMHA 2IOTA 2ZPSA 1MCVA 2FOAA 2GVFA 4E05H 1SI5H 1DWDH 1TA6A 2XW9A 3WWBA 3SV6A 3ATMA 1QJ1B 4X8UH 1A0JA 1C5MD 1O2XA 2CHAB 4INKA 3SI4H 5FAHA 3SZEA 2V6NA 4ABAA 2BD7A 2DE8A 2WYJA 1V2KT 1E35B 1QR3E 2H9HA 4R8TB 3TJNA 1YC0A 3HK6B 1H8ED 2AGEX 2FS8A 4YOJA 1ZOMA 2D2DA 1C2MA 1QURH 1UW7A 3P8GA 3UOUA 4MG3A 4K1SA 3GICB 1PPBH 4ZKNU 2Z7FE 2XWAA 3GCHB 3I29A 2AIPA 2VU8E 1GHAF 1GI1A 4K2YA 3CP7A 1QHRB 4Y6DA 4B1TA 4SGBE 4E06H 3O8DA 4CH2B 1O2HA 1MKWH 2ZDKA 5EXLA 1SGFA 1XX9A 2FXRA 3PMAB 4ACAA 2GD4B 5TJXA 1NROH 1KXCA 4UD9H 3RXMA 2HALA 4UE7H 1GG6B 1LPGB 3UTUH 1QFKH 1ZMJA 5C1YA 3GY4A 2H9TH 3W1EA 1AB9C 2XTTB 3F9EA 3DHKH 1ZPZA 2J98B 2B9LA 3PMJA 4Z0KA 3RXKA 1QJ7B 1WUNH 4AB8A 1SLWB 1V2PT 1TLDA 1TOCB 3U28C 1SC8U 1LMWB 1S83A 3RXPA 2PKAB 3FP8E 2OC1A 1PPZA 4DT7B 1GJ6A 2O8WA 1GL1A 2BY9X 1DUAA 4ISLA 4YZUA 3LC3A 1OXGA 3BEIB 3OAAD 1P2QA 2BD2A 5B6LA 2GCHF 4DIHH 5GPIB 1Q2WA 1ZPCA 4TPIZ 5CHBA 1V2MT 1UK4A 1BHXB 2B0FA 2CJIA 2RDLA 4E7RG 4DURA 4TY7A 1N6XA 5DJ7A 3JZ2B 3TNTA 1NFUA 1LHGH 2Q6DA 4FUDA 3P8NA 1MKXK 3TITA 1QA0A 2PR3A 3SNDA 1ETSH 1EP5A 1P9SA 1TRYA 1WTHD 2ODPA 5FHTA 2SGFE 3M3SA 1GI6A 5CDFE 4I31A 1C5RA 1AWFH 2TPIZ 2ZI2H 1IHSH 3QK1A 1HAYB 1QB6A 4Q7YA 1H4WA 1ANBA 3LGTA 5L2YH 2JH0D 1K1IA 3SU5A 1GL0E 1QA7A 1CE5A 1K22H 3KEEA 4H6SB 4I8JA 3A82A 1MD8A 3LT3A 1UTJA 1C5UA 1UTQA 3ZZ8A 1BTWA 1K2I1 3SO3A 2P95A 2XC5A 3MU4A 1O2WA 9LPRA 1W0KD 2XNDD 2ZKSA 1HBTH 4I8KA 1DS2E 5LPFA 4ASHA 1D6WA 4TPYA 4XBBA 5I25A 4DY7B 1DE7H 3VB7A 1BTHH 4B6EA 1CGHA 4X6PA 1Z6JH 3BTQE 1ELFA 1SGCA 4NIXA 1F92A 1G2MA 1CU1A 3CS0A 4CRFA 1O39A 2ESTE 1O3AA 2W7SA 4VGCB 2A2QH 4YT7H 3KQBA 4UFGH 4BTIB 3NKKA 3EE7A 1N1LA 1NRRH 5ESBA 4U32A 2BX3A 4KKDA 1EPTC 3RM2H 2QN5T 4Q4LA 3VG8A 3AVZA 3SU6A 1ZJDA 2BY8X 4YT6H 1YPJH 3MH5A 2ZEBA 1AI8H 3F0OA 4AFZA 2G5VA 1S6LA 2VWMA 4ZCNA 2VINA 3DA9B 5EPNA 4D7FA 2W5EA 1OYQA 4FU8A 4JZEH 5EJLA 1BIOA 1OWEA 1QBVH 2FO9A 1EAXA 4K8YA 4INHA 2PV9B 4YOGA 2ZC9H 4OS7A 3IWMA 2KR7A 4MQAA 4MDSA 2OQUA 4M7GA 5DGJA 2FOFA 2JH6D 3T26A 1N6YA 2A0QB 1FONA 1CA8B 2TIOA 2ZFRH 1KIGH 1IAUA 8GCHF 1C1SA 1C9TA 2RA3A 1YF4A 1C5NH 4I33A 2HLDD 2RDEA 3SUDA 3N7DA 1O2YA 4GHTA 1SQOA 1NY22 1HDTH 3A8CA 3F2FA 3NRLA 1BITA 3DFJA 1OWIA 2XBXA 4X2XA 4FOUC 2ZWLH 5JB8S 4U01A 3F2GA 2GJGA 1LKBA 1HYLA 1P3EA 2BLQA 1Z8IB 3SNEA 1HIAA 3ZVDA 2QF4A 3ZZAA 1V2RT 3UUZA 1SFIA 1C5SA 2Y7XA 2WV4A 1FY5A 2QV1A 1D6RA 2KAIB 1L0ZA 1GHBG 1AGJA 2FOMB 1DSTA 1INCA 3TLOA 6LPRA 2J98A 1ELCA 4THNH 4TWYA 1F5LA 1DXPA 2YMSD 2C3SA 3KL6A 1OS8A 4NCYA 1ABIH 3K6ZA 1YCPM 2ZFSA 5LPEA 2IN2A 1IQKA 4FETA 3M7UA 3SUFA 1C2EA 2P16A 3M5MA 1FJSA 3ZZ4A 1NRSH 1C1QA 1GHWH 4JK5A 1PYTD 3O8RA 3MH6A 3V0XA 1MQ5A 2HRVA 2GP9B 1D3DB 1RFNA 2BY7X 3L6PA 1HJ9A 1C1PA 4D9QA 3ZZ5A 4NSVA 3UIRA 5C3NA 1AUTC 3KIDU 2BX4A 2KX4A 1FZZA 1DWBH 4UFDH 1EB2A 1HNEE 1FV9A 1A5IA 1UHBA 4OM9A 5A8ZA 3LDXH 3PWBA 3UOPA 1SG8B 2BDYA 1KDQA 2PKSC 3TPIZ 2NWNA 1UCYH 3P6ZB 1GHAG 4X0WU 2SNWA 2QXGA 3P92A 2FDAA 3L33A 2F9VA 2C90B 2RFKC 1YPLH 1AUJA 3A84A 4YLQH 1Y59T 2IPQX 3BSQA 3MHWU 1C5YB 2Y80A 4XD7D 1LVMA 2FI3E 1K1OA 2FLRH 2P8OB 3H7OA 5GCHG 3CENA 5I46H 2QXIA 2AFQB 1AE5A 1UTLM 1TAWA 2W6JD 1SGIB 1WV7H 4DT4A 4WF8A 1RTKA 1UMAH 2HPPH 3B23B 3MNXA 5AFZH 2ANMH 5DPAA 2A5KA 2K1QA 2PSXA 2V3HH 3WWFA 1VCPA 1O2RA 2AHME 2KCAA 1KTTB 1AE8H 3UR9A 3P8FA 2ZU3A 3M36A 1SFQB 1C2LA 2AGGX 1OX1A 1XXFA 3F0PA 5FX5A 2G00A 1GMCG 3VB4A 2O8MA 1RXPA 3MU0A 2ZFTA 4ZAEA 1PYTC 1W13U 1O3KA 3RU4T 1SPJA 3FZZA 1EPTB 2J4IA 1FLEE 5AVDA 1FN8A 1O2GH 2BOKA 1H9LB 1DVAH 4FUJA 1C4Y2 1P02A 3W95A 3QGJA 1O2OA 2PKSB 5JBCS 1DITH 3BIUH 3AK5A 3M7QA 1C5TA 2ZHDA 1SSXA 4X1NU 1C2KA 1KDQB 1S6HA 1TMBH 1C2HA 2OC7A 3U8TH 8LPRA 1MTNB 4BAMB 3HGPA 2PWXA 2TGAA 3FKSD 3PB1E 2BLWA 3OTPA 2A5AA 1KXDA 2GCTB 2P3FH 1V2LT 1O38A 2ZGCA 2OP9A 3DUXH 3K6YA 2FTMA 1ZPBA 4CH8B 1DLKB 1O2PA 3KCGH 1GI2A 1Z1IA 5FCKA 2BY6X 1ZHRA 2DUCA 2GV6A 1SGQE 2WPHS 4RN6A 1TGCA 1W12U 1ELTA 1Z7KA 1O5CB 5EIYA 4DIIH 1ELEE 1ZR0A 1TFXA 1O3IA 2GT8A 3KQCA 4D7GA 2FS9A 1RD3B 1ZGIA 3U8OH 2F9OA 1W7XH 5T1VA 2ZDAH 5GJ4B 3ZVFA 2KAIA 4DCDA 5EXMA 3RC5A 4ISOA 1HAZB 1CHGA 3O8BA 3OYPA 3RXCA 2UUKB 1S0QA 3GDSA 2Y82A 1O2SA 3BEFB 3Q3XA 1MU6B 6GCHG 4X6OA 3URDA 3PRBA 3SHAH 2BMGB 1PQ7A 3OEED 2BD5A 3RLYH 2BDCA 5JDUB 1A1RA 1BTUA 4TY6A 3RXQA 4R0IA 4OGYA 3SU0A 1F7ZA 3QUMP 1AN1E 2JJ1D 4AOQA 5C20A 3T62A 1GCDA 2GV7A 2G4UA 3A83A 3LH3A 1EASA 1LCYA 5GIBA 3SU2A 5A09A 4B6FA 3PTNA 2WPMS 1ZMNA 4WXIA 1GDNA 4CREA 1BMAA 4Y71A 1MTUA 2QC2A 3QTVH 4B76A 2ZGXH 4WVPE 4RT0A 1P9UA 1YPGH 1TMTH 1TRNA 5A2MH 1V2OT 1EKBB 3SNCA 1UK2A 1TBZH 3T28A 2J95A 5C17A 1P8VC 2BZ6H 1TX8A 1W7GH 4X6MA 1G3CA 3EDXB 1TX6A 4O9VA 4KELA 2J9NA 2VBCA 2Z9LA 3RP2A 2Y5HA 3A88A 1O3PB 1PFXC 4GSOA 4YM9A 1NC6A 4MNVA 5IDKA 2LNCA 1A5HA 1O5DH 4D9RA 5LH8A 4ISIH 1O2NA 3OE7D 5BPEA 2V0BA 4XDEA 3MOCA 2H2ZA 1SMFE 5EG4A 1LO6A 1K1JA 1TPOA 1ZLRA 1XUJA 2BDBA 3LKWA 1ACBE 2KM0A 1QY6A 2QF0A 3MU1A 2BQWB 2F43B 2ODYB 2CN0H 3FVFB 1LVOA 2FYQA 1P10A 1N8OB 5DP4A 1FMGA 1YBWA 2BD3A 2FP7B 1OWDA 1P09A 1KMHB 2Z94A 3GY5A 1TA2A 1QQUA 4GAWA 1C5LH 1IOEA 5JPMH 2TGTA 3S9CA 1HUTH 1MAXA 1OOKB 1C5OH 5EJ1A 2XNIA 1AZ8A 5GCHF 5PTPA 2A45B 1WYKA 5T6FA 1IQEA 1GBAA 1O3NA 4KTSA 1FPHH 2ZU2A 2OBOA 4D76A 1GHVH 4HTCH 4MNXA 2O8LA 3A8AA 4F55A 4K5ZA 1K21H 4OS1A 1E79D 3RXTA 4YESB 5DP5A 4J2YB 1LVBA 5JBBS 4ZXXH 3P17H 4ZHLU 1D3PB 3A8DA 4Q7XA 4ZUHA 1O32A 1GHXH 1UCYK 3BEUA 1P04A 1MQ6A 1P11E 1QGFA 5ESTE 1BRUP 1N8OC 1W10U 2AYWA 3NPSA 2C93B 1O3HA 1FX0B 1TNLA 4UFFH 1PQAA 3PO1C 4XFQA 1HAXB 3VXFH 1BRAA 1E1QD 1AU8A 1C1TA 5K0HA 3DSGA 2EI7A 1ZGVA 3MFJA 1F2SE 2D1JA 3OEHD 1YPKH 1LHEH 2XC0A 4AGJA 2C4FH 3U1JB 3LC5A 1QJ6B 1UCYE 3FOAA 3MNCA 2ZECA 1GI7B 4Y7BA 2ZFPH 1TB6H 1OHHD 4MVNA 3EYDA 3HATH 1XXDA 1HFDA 2TGDA 4BAHB 1AFQC 5EPYA 3SU3A 1ZHPA 2CGAA 4I32A 4BXSA 3V13A 1K0HA 1Y3WA 3WY8A 1EZQA 1E36B 1GBBA 3QLPH 1MU8B 1GVKB 1C1UH 4UDWH 3U98H 1F0SA 1KXFA 3SNAA 1O2KA 4WH6A 3UNRA 1HAVB 3VB6A 2Z3DA 1YLDA 1FDPA 2VVCA 5E0GA 2ZHEH 4UEHH 7LPRA 1A5GH 2FOEA 3LGVA 5JBAS 1O3EA 3UNQA 1W3CA 3RMNH 4A7IB 1HXEH 2GGVB 6CHAC 2VJ1A 3LPRA 1PPHE 3ATLA 2WZQA 3EA7A 4RI0A 1DY8A 1B0FA 3A81A 1T8LA 1WAYB 1YPMH 5TCAA 1YM0A 1VZQH 2EY4C 2Q1JA 1U6QA 1QQ4A 2GX4A 4FUCA 1IQJA 4MPUA 1FAXA 4XOJA 1P2OA 3ZZ3A 3UQOA 1VJ9U 2TRMA 1CGJE 3A7ZA 2ZHWH 2H1UA 1TGTA 4CHAB 2XRCA 3FN8A 3SUGA 2P3UB 4JZIA 4Y0ZE 5EOKA 4I86A 4A5TS 2ZTZA 1G30B 1J9CH 2Y5GA 2ZHFH 4XRNA 3GS9A 3BV9B 4BAQB 3LU9B 1XUGA 2NU1E 2HVYB 3PO1B 1BBRE 2VVVA 2G8TA 2AMDA 3MNSA 3M35A 1BTZA 4ESTE 1ANEA 4MPXA 3M7TA 1EOLA 1P01A 8ESTE 4O3UA 3T5FH 3GYLB 5F03A 1D3QB 1ZJKA 2RG3A 4YO9A 4JCNA 1UVPA 5JB9S 2GDDA 1JRSA 1NBME 1T4VH 4HGCA 4P00A 2R2WU 1T8MA 1ESAA 1WQVH 1MABB 3VGCC 1YPHC 4KGAA 1C5ZB 3SV9A 1XVMA 4MNYA 1LHDH 1NS3A 3VEQB 1QBOA 1ESBA 2FEQH 5DN6D 2OCVB 4D8NA 2A4QA 1C4V2 1HV7A 1EP6A 3DSPA 3SI3H 1NESE 1O34A 4FUEA 1HAIH 1PQ5A 1F0TA 1QB9A 3EGKH 3RLWH 2R2MB 3BG4B 1BMNH 1QIXB 6ESTA 1SQRA 5GWZA 2XOKD 1O33A 1BT7A 1J15A 3KNXA 3HKJB 5E2PA 1TIOA 2BB4A 1BCUH 3URCA 1DXWA 2UWPA 1TALA 2F3CE 5AHGH 1NBMD 3QZQA 2ZNKH 3SQHE 1AVWA 1EAIA 3M61U 1O5FH 3H7TA 3QTOH 2A1DB 4JZDH 3C1KA 1AZZA 1RGQA 2V35A 3NUMA 3RXDA 1O3DA 4GPGA 5F8ZA 2C8ZB 3HGNA 1C5QA 2STBE 1FIWA 4AFUA 3GY8A 2I6QA 1COWD 1IQHA 1UTOA 1NO9H 1Y5UT 1L4DA 1FPCH 5L2ZH 5E8EH 2FOBA 1GMHG 4O03A 4RKJB 4F4OC 5F6MA 3LH1A 3RXGA 4AORA 4K3JA 1CA0C 4Y76A 4DGJA 1GCTC 3LGYA 3OFND 2J2UA 2ZG0H 1H8IH 3D49H 1ANDA 4YLUA 1G2LA 4ABIA 3KYGA 2BDGA 3UAIC 3NXPA 2PTCE 1BQYA 1GBCA 1ORFA 3BF6H 2D26C 3PMHB 2Q6FA 1SHYA 1GHBF 1JXPA 2OD3B 3Q3YA 1EZUC 2PLXA 2GTBA 4NA8A 1Z6EA 4YTAA 1XKBC 3ZYDA 3GY2A 1KLIH 1FY8E 1TONA 1OWHA 2FZZA 5AF9H 3P8OA 5KGOA 2Z9JA 3RC4A 5C1UA 2BZAA 1LQDB 2YMSC 4P02A 5C67A 1EOJA 2ZO3H 1O30A 1YLNA 1K9OE 4HFPB 4OS5A 4BAOB 2G52A 1G3EA 4X6NA 2ODQA 3E8LA 1S85A 3DFLA 1AO5A 2J38A 2KFWA 1KXEA 4X8TH 5DP9A 2BD4A 3U8RH 3HK3B 1WTGH 4K60A 2ANYA 4F48B 2W3KA 1MTSA 1S5SA 2ALPA 2BVXH 2NU4E 1GBMA 4OS2A 2NU0E 2KCYA 2EEKA 1W11U 1BBRK 1VGCC 1C2FA 1WBGB 5L30H 4FU7A 1WCZA 4INLA 4CR5A 4FUIA 1XKAC 5G4BA 1CT2E 1EJMA 3VFEA 1TGSZ 2AIQA 3AW0A 1QNJA 1PPGE 3KF2A 4AB9A 1SVPA 4XBCA 1FI8A 1ESTA 1LDTT 2DE9A 1EJAA 3QDZB 1P12E 1UVOA 3Q00A 1P05A 3UWJH 3D23A 2VGCB 1CBWC 3UWIA 1ZTJA 1BUIA 4ZH8A 5DG6A 3OY5U 1O5AB 2EA3A 1LTOA 2HPQH 3RMMH 1MMJN 2A4OA 3AAUA 1NU7B 3E6PH 1Z8GA 2RCEA 4HI3A 2BXTH 1H9HE 3AASA 2XBWA 3RXAA 4QT8C 3RMOH 1GJ7B 3MWIU 2FIRH 1J17T 2GZ7A 3RXRA 1SGNE 2WPLS 3UFAA 1ZTLA 2AMPA 1ARCA 1WSSH 2K0QA 3T2NA 4TWWA 5EQSA 1O37A 2XBVA 4JZFH 2JH5D 1FY3A 2WYGA 1UTKA 1C5XB 4WH8A 4OS6A 3ZIAD 1SHHB 1TNKA 4B73A 2JETC 2ZQ2A 1UVTH 1O2JA 4ZMAH 3UY9A 1ABJH 1L2EA 4AN7A 4NIYA 1GI9B 2YMSB 1Y3XA 1TPPA 2QE7D 2SGAA 1CBWB 3SGAE 4Y8ZA 3KYFA 1QB1A 3SJOA 1MD7A 1C5VA 3TNSA 4Y11E 1A0LA 2OUAA 1THSH 3QO6A 5HM9A 3NWUA 5EW1H 4A1TA 2Q6GA 4GUXA 2Z9IA 5FPSA 1GI3A 4X1SU 1OWKA 2BHGA 4CRBA 4Z1MD 2AERH 4WMDA 1T31A 1ID5H 2QYIA 3AAVA 1BBRH 1HB0B 1FXYA 2V3OH 4ACBA 3SU4A 2FMJA 3M37A 2FESH 2A4RA 1V2TT 1Y8TA 2VB0A 1IHTH 2Y7ZA 2R0KA 1P2JA 1C1WH 1SOZA 2PW8H 3PLPA 5GXPA 3QGNB 3MU8A 4JYTA 1HJ8A 1XUKA 2WPIS 3UR6A 4XE4A 1QL7A 2Z3EA 1LPZB 1FY4A 2KCPA 1O2VA 1NRNH 3JZ1B 3ODFA 1O5EH 1OPHB 1RTLA 1UO6A 5C94A 7GCHF 3E90B 4B75A 1EXFA 2FLBH 2WSSD 1C1RA 3A86A 4X1PU 1S82A 2R9PA 2WV5A 2BM2A 4CRCA 1GBJA 1MAYA 4XSKU 1PPEE 2FM2A 3Q77A 4HG6A 1BB0B 3A89A 1O0DH 2FWWA 3AW1A 1GBLA 1MTWA 5FX6A 2EI6A 2WPKS 3SJKA 2BD9A 2XCNA 3V3MA 1KTSB 1NFWA 3R0FA 3IITA 3SJIA 4A1XA 2L74A 3ZV9A 2RA0A 1THRH 3F3BA 3OTJE 1NN6A 4RT1A 3MYWA 5A0CA 3M5NA 3G01A 5FL7D 5CHAB 2ZDNA 1UTPA 3F9HA 2ZDLA 2F9UA 2ZTYA 1Y3VA 2WPJS 1E1RD 1UHBB 2PGQB 1ELAA 5DP3A 2VH0A 3A7YA 3S9AA 1O2MA 1RS0A 2OC0A 1BZXE 1BTYA 1Y5AT 1TBRH 1TMUH 1O3OA 1BDAA 1GG6C 2GKVE 1ELBA 3F9GA 2QF5A 3BTEE 1SGRE 1V2UT 1TNHA 2ANWA 2YNBA 5FCRA 3NZIA 1VITF 1W0YH 2BXUH 1CHOF 3TH2H 2FI5E 1DY9A 5DP8A 3RC6A 3ZYEA 3P70B 2ZU4A 1SGEE 3SNBA 2FI4E 2GZ8A 3KGPA 2A31A 4IN2A 4IN1A 2D8WA 2NU3E 3E0NB 5E0HA 2KZ4A 3ATWA 3ZZ6A 3SV7A 4K8BA 4LZ1H 3TH4H 2Z3CA 1OP0A 3SYJA 2PGBB 3PLBA 3A87A 1DX5M 1O5BB 3BG4C 3BTWE 5T3HA 2P59A 2ANKH 1YCPK 3RU4E 5FPTA 1BTXA 4I8GA 3K65B 1DLEA 1TBQH 1NM6A 2AH4X 1EZXC 2ZQ1A 3UREA 1E34B 5EGMA 2G4TA 4U2WA 1BRCE 4DVAU 5HXFA 4X2WA 1HCGA 2SGQE 3ZV8A 1J16A 3SOSA 1BRBE 5C1XA 2ZGHA 1HAPH 5GNDA 4DJZB 2CHAC 5JYIA 1G9IE 1NFYA 2B5TB 2VWNA 1A7SA 3F9FA 1P2NA 2HNTE 3BN9A 1UVSH 2SGDE 2BYAX 3PWCA 3RM0H 1EAWA 5E0JA 4AX9H 3S9BA 1YCPH 1MKWK 1ETTH 2TBSA 2LELA 2PP6A 1LQEA 1TGBA 1Z8JB 1MKXH 3LJJA 1A0HB 1CQQA 1T7CA 5K7RA 1B5GH 1GJCB 1AD8H 1T8NA 2EI8A 2ALVA 2ZGJA 1EUFA 3TK5A 4ABBA 4CHAC 1Y5BT 2Y6TA 2PFEA 3WW7A 3MH4A 1Z1JA 1O35A 1GVLA 1NRQH 3MQKC 1GBIA 1KSNA 3VXEH 3S7HB 1AFQB 4ZKRU 5EQQA 3SW2B 1O2LA 4H6TA 5HYOA 3TK6A 1K1NA 1L4ZA 1AIXH 3ZZ7A 1BOQA 2VIPA 2ZCLP 5C2ZA 1G3DA 3MO6A 1QRWA 1IQNA 2VGCC 1XUIA 5E2OA 1IQLA 3TIUA 2H5DA 2VWLA 1XM1A 2Y5FA 5HIYA 3SJ8A 2Z6BD 1DM4B 4NGAH 2ASUB 1GGDB 2WUCA 1GGDC 1LHCH 4A92A 5DO4H 2R3UA 4X2YA 3SJ9A 1ZSJA 3TGKE 1WDIA 1V6DA 1GJ4H 3T29A 5SGAE 2J92A 1SLUB 4AFSA 1Q31A 3MTYA 2M5TA 1KY9A 4ZXYH 3SU1A 1DPOA 3MO3A 3RXVA 1GMDG 4Z6AH 4B2CA 1V2VT 2JKHA 1XUHA 4IW4E 2BOHB 2WINI 3KHVA 1ELDE 1MZDA 4NZLA 3MMGA 1YGCH 1GJDB 1TYNA 4RKOB 4VGCC 1AVGH 2P93A 4X8SH 3DSOA 3BTHE 2OTVA 2QGRA 2FOCA 2QCYA 5FBEA 1TRMA 2P94A 2VH6A 1XVOA 4GCHF 5HM2A 1KXAA 3M3TA 1SGFG 2BDIA 2LP6A 1OYTH 2ZCKP 1TE0A 1TNIA 4FVDA 4ZROA 2ZTXA 1HGTH 1BMMH 3MO9A 1MBMA 2GZ9A 1SKYE 3MI4A 1OSSA 3HPTB 1A3BH 4BANB 1DT2A 2AEIH 3TU7H 4DOQA 1TNJA 1T32A 4AFQA 5TCCA 1GHYH 2PUXB 2O9QA 1OP2A 1O36A 4LOYH 3S0NA 3U69H 1K1PA 2A7JA 1EPTA 4ZHAA 1VGCB 2P3TB 1RJXB 2GDEH 2J94A 4B2BA 1O2TA 2XC4A 4IMQA 4BOHA 4UONA 1ZSLA 2VIVA 3PROA 1L1GA 3V12A 1P2MA 1EQ9A 2OINA 3BTTE 1GMCF 1C9PA 4NZQA 3ENSB 4NSYA 3KQ5A 3E91A 4ABDA 3B9FH 4FUHA 1MBQA 1P06A 5CMXH 3FP7E 1AY6H 5FXLA 4AGKA 3TJOA 1O2QA 1V2JT 2VWOA 4ZHMU 1D4PB 1GPZA 2IJOB 1FY1A 4MPWA 1H9IE 4JYVH 4IC6A 1V2ST 3LIWA 5J4QA 3F68H 3TJUA 1B7XB 2O8UA 4OGXA 4GHQA 1D3TB 2FOGA 2QA9E 4IMZA 5H4IB 4NFEA 1W2KH 3D65E 4CRAA 3T25A 1WQSA 3RUOA 4J1YA 1ZYOA 1MCTA 1KYNA 2OXSA 5KEDA 4BTTB 1LHFH 1A46H 3A7WA 1MTVA 3QX5H 4LK4A 2BVSH 4MLFB 4BNRA 4BXWA 5BRRE 2BLOA 3FAOA 2AGIX 3ZVGA 1CVWH 4X1RU 1DWCH 3ODDA 1SGDE 3GDVA 1ZSKA 1CT0E 1HAVA 1C1OA 1NPMA 4AZ2B 3Q76A 1OP8A 1EX3A 3KN2A 2XCFA 1FUJA 4ASUD 5C5NA 2BTCE 3N7OA 2WV9A 1DDJA 1H8HD 1NTPA 1RTFB 3A7XA 1AB9B 1GJ8B 3ZZDA 1Y3UA 3MNBA 5F53A 3RXJA 4A1VA 2A5IA 4AC9A 1SGTA 4FXGH 1DUEA 3S7KB 8KME2 1EJNA 1ZHMA 3FO8D 3E16B 1TQ0B 3O8CA 4IC5A 3A85A 5A0BA 2HNTC 3V7TA 7GCHG 1CSOE 1ELVA 1Z71A 3RXIA 5GDSH 2YNAA 2F4LA 2H9EH 3A7VA 2F9PA 3RXEA 3BTME 1GBKA 3A8BA 3VB5A 2FTLE 1B0EA 2H5CA 4NA7A 2GCTC 1DFPA 1CO7E 3UNSA 3ZVEA 1C5PA 1BHXF 4O3TA 3ZZBA 3UB0A 2XWBI 4ABFA 1G37A 3ATIA 3CS7A 1MTNC 4ABEA 1PPCE 5EQRA 3RXUA 4NFFA 2F9NA 1S81A 3QN7A 4H42U 4Y8XA 1JBUH 2FX4A 1MH0A 2FPZA 2HOBA 4IBLH 1W14U 3NK8A 2VIQA 4Q80A 5F8XA 5C5OA 3SGBE 4U30A 3F1SB 3PMBB 4KP0A 4NWKA 3GISB 3T27A 2F9BH 2XXLA 3U1IB 1TNGA 1ARBA 3L3TA 1C5WB 3EA9A 3FFGA 1SGYE 3GY7A 1VJAU 2ZPQA 3RMLH 1AQ7A 1GJAB 2ZU1A 1DOJA 8GCHG 3BTKE 4NWLA 1YY3A 4TT3D 2VIDA 9ESTA 1GBTA 2J97A 2ZPRA 1W0ZU 1ZMLA 2QF3A 1A4WH 4FUBA 1AVXA 4JK6A 3STJA 1HRTH 1F0RA 3GY6A 3TK9A 1JRTA 3EE0B 1QTFA 4I8HA 1JIRA 1OKXA 2A7CA 3ATKA 2UUFB 1S0RA 1VKYA 1QCPA 4IGDA 3M3VA 3RXFA 2B7DH 1JMOH 1W0JD 1P3CA 1WU1A 3PYHA 2NU2E 2SFAA 1E0FD 5CHAC 1GWAA 2CK3D 5ABWA 1HAOH 1C1MA 1GDUA 4AG2A 1P0SH 4WJG2 1F0UA 3PV4A 1IQIA 3D62A 1AHTH 4WXVA 2TGPZ 2C8XB 4Y0YE 2ZCHP 3EAJA 2HVXA 2QY0B 1UJ1A 4AYYB 3N99A 3RXOA 1SQTA 1PJPA 1GI5A 4X8VH 1AFEH 3OSYA 4CR9A 3OU0A 4YOIA 1M9UA 1J14A 1YPHE 5EODA 6CHAB 2GMTC 2SGPE 4NIWA 3M5LA 2XBYA 3HKIB 1RIWC 3W94A 2BDAA 3KQEA 2Z9KA 3B8JA 4MPVA 3SQEE 3DCLA 4B2AA 3OX7U 4KTUA 2GMTB 1BJVA 3TVJB 2QXJA 2W3IA 3BIVH 1E38B 2B8OH 1L1JA 2FYRA 4GLYA 1NFXA 1KLJH 4Y79A 4K1TA 5F8TA 2KCOA 2WHXA 1C4U2 2H6MA 4FVBA 1CHOG 5IK2D 1MZAA 2CF9H 2AS9A 2V3MA 2ILNA 1HPGA 4GCHG 1UTNA 1KXBA 1TQ7B 1QRZA 2VIOA 1TOMH 4X2VA 1HJAC 1FIZA 1FQ3A 1ZRBA 2I6SA 2OK5A 4IS5A 1SBWA 2UUYA 2G51A 3SV2H 2W26A 3GCTG 3M5OA 1UVUH 5C0UA 3QWCH 2ZDVH 4HZHA 1O3LA 1VR1H 3H09A 2CXVA 3PV5A 4WWYA 1V2NT 4Y7AA 2GCHG 3E0PB 2PKAA 1Z8RA 2QXHA 2OLGA 3LGUA 5LGOA 1NRPH 1NZQH 4K69A 3A80A 2ZP0H 1SQAA 1FAKH 1GJ9B 3E1XB 1A61H 2JJ2D 3RXSA 1A3EH 1GBHA 1V2WT 5EXNA 3LGWA 3PM3A 3IG6B 2EQNA 2A32A 5A8XA 2CMYA 3ESTA 1F5KU 1ELGA 3SORA 2OC8A 1GVZA 3P95A 3K9XB 5T6GA 1C2JA 1ZTKA 3UPEA 2J5UA 2ZHQH 1GI0A 1SL3A 4X1QU 2JDID 3UQVA 3A7TA 3GCOA 4LZ4B 1VCQA 4Q2KA 2BDHA 3DT0H 4MTBA 5HGGA 3RDZA 3VPKA 1H8DH 1Q3XA 3GCNA 1CT4E 1O3BA 1TGNA 2LPRA 4CRDA 1O3GA 4NA9H 3TH3H 1O3JA 1SOTA 3SUEA 2VVUA 3MU5A 1O3CA 3H5CB 3R3GB 2SNVA 3SZNA 1LVYA 2G81E 1G36A 5CE1A 4WY3A 1LPKB 5DP7A 1P57B 2YOLA 4TYDA 3KQDA 5IYTA 3DD2H 1SGPE 5DKMA 1E37B 3LONA 2G5NA 2FOHA 2JETB 3K2UA 4OS4A 4BAKB 1V2QT 1EAUA 1BA8B 2K8IA 2BVRH 3FANA 3RU4D 4DW2U 1ETRH 4NG9H 1C1VH 3LJOA 5HMAA 3SGQE 2ZDMA 2BY5X 3PLKA 2UWLA 2PSYA 2QAAA 1S6FA 1J8AA 1T4UH 2C8YB 2JIZD 2QIQA 1BJUA 1GCTB 4WMEA 1EATA 5EW2H 3ZZCA 1SR5C 2IPHA 4CBNA 2BQ7B 2CF8H 4ZKOU 3C27B 4NIVA 1C2IA 4O97A 3I77A 4H4FA 1TABE 4SGAE 3GCTF 1GBFA 2V7QD 2AMQA 1L1NA 1KLTA 1BTPA 2IJD1 1THPB 2ZZUH 5J4SA 2VNTA 2M2AA 4M9FA 1O3FA 3I78A 4ABGA 3GY3A 1TWXB 1RRKA 2ZA5A 1YP9A 4ISHH 2PUQH 2GT7A 1O31A 2PTNA 2F83A 1ZRKA 3ZVBA 2F91A 3BG8A 3RXLA 4AYVB 4BTUB 3TGJE 5T6DA 5ETXA 2SGEE 2OBQA 3EQ0H 2ZF0H 3N7EA 1MUEB 2ZFFH 3LGIA 5LPRA 1GI4A 3SN8A 2ZFQH 2THFB 3Q3KA 5JBTA 1K28D 2FODA 5B6OA 4YXWD 4K1EA 3PRDA 1O2UA 4JZ1A 3GDUA 4ZKSU 2EC9H 1QZ8A 2R3YA 2UWOA 1CA0B 1T8OA 3OY6U 4ISNA 3EA8A 3ELAH 3ZVCA 1O3MA 1CGIE 3F6UH 1WXRA 1TPSA 1LKAA 2BQ6B 1FN6A 3GCHC 4KTCA 1V3XA 1GBEA 2G55A 2HWLB 5FBIA 1HIAB 1IQMA 1K1MA 1YLCA 4Y8YA 5KECA 1JWTA 4LXBH 1GMDF 1AKSB 1G32B 3U9AH 2BD8A 5DK1A 2FX6A 1ANCA 4DG4A 4Q63A 2P8OC 1O2ZA 1DSUA 2ULLA 5A8YA 1HAHH 2R0LA 1YWUA 4TSFD 1YPEH 2PHBA 1JOUB 2L6OA 4FUFA 1OWJA
chains in the Genus database with same CATH topology
2EY4C 2RFKC 3UAIC 2EQNA 3U28C 2HVYB 2V3MA 3MQKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY4 C;  2RFK C;  3UAI C;  2EQN A;  3U28 C;  2HVY B;  2V3M A;  3MQK C; 
#chains in the Genus database with same CATH topology
 5FPY A;  4GVU A;  1S84 A;  3CNR A;  1QL9 A;  1PPF E;  1C2G A;  2A2X H;  1WOF A;  2ZU5 A;  4ABJ A;  1GDQ A;  4JMY A;  1K1L A;  3SV8 A;  2XYA A;  1HJA B;  3FZD A;  4B74 A;  3ZZ9 A;  1GJ5 H;  1GJB B;  4ABH A;  1SLV B;  3VGC B;  2UUJ B;  2O8T A;  4WMF A;  2W7U A;  1JIM A;  4I8L A;  4E7N A;  1NU9 A;  1Y3Y A;  1GHZ A;  1QBN A;  1BMF D;  2VIW A;  5L6N H;  3GOV B;  1DIC A;  1EZS C;  1VCW A;  1RIW B;  3PV2 A;  2HLC A;  1SB1 H;  1P2I A;  2J34 A;  1UK3 A;  2WPD D;  1P03 A;  1D9I A;  1UTM A;  1O5G H;  1EB1 H;  1NT1 A;  1P2K A;  3BTF E;  4UFE H;  5C0T A;  2HGT H;  2Z9G A;  4FUG A;  1IQF A;  3E3T A;  4CBO A;  1XMN B;  1PQ8 A;  2STA E;  3NCL A;  1VIT G;  3LOX A;  2Y81 A;  1GMH F;  1W8B H;  2WUB A;  1IQG A;  4A6L A;  3SHC H;  3S69 A;  3TJV A;  1QL8 A;  2HNT F;  1A2C H;  1XUF A;  3ZVA A;  3F2H A;  1C2D A;  3RXH A;  7KME H;  6GCH F;  1G3B A;  1HXF H;  3VB3 A;  5A0A E;  1AWH B;  3ITI A;  5DP6 A;  1HAG E;  2OQ5 A;  4AG1 A;  4B71 A;  1GI8 B;  1YYY 1;  3TGI E;  2ZGB H;  4PRO A;  3GYM A;  1EFR D;  4Y10 E;  1AKS A;  1FNI A;  1X7A C;  1O2I A;  3BTG E;  3PTB A;  3FP6 E;  1C1N A;  1TPA E;  1F5R A;  1BML A;  1SLX B;  4RSP A;  4Q7Z A;  5EJZ A;  5HKK D;  2C8W B;  1QRX A;  5AFY H;  5DSF A;  1H1B A;  1VIT H;  1DWE H;  3SBK A;  4FU9 A;  1GBD A;  2ZIQ H;  2W6I D;  4XBD A;  2A4G A;  2A7H A;  3BTD E;  2BLV A;  3RXB A;  4I7Y H;  4CRG A;  3QZR A;  1DAN H;  1ZZZ A;  2CV3 A;  4JYU H;  1HLT H;  5EU8 A;  4MNW A;  3MH7 A;  7EST E;  5HIZ A;  4F49 A;  3STI A;  1YKT A;  1TX7 A;  1AMH A;  2IOT A;  2ZPS A;  1MCV A;  2FOA A;  2GVF A;  4E05 H;  1SI5 H;  1DWD H;  1TA6 A;  2XW9 A;  3WWB A;  3SV6 A;  3ATM A;  1QJ1 B;  4X8U H;  1A0J A;  1C5M D;  1O2X A;  2CHA B;  4INK A;  3SI4 H;  5FAH A;  3SZE A;  2V6N A;  4ABA A;  2BD7 A;  2DE8 A;  2WYJ A;  1V2K T;  1E35 B;  1QR3 E;  2H9H A;  4R8T B;  3TJN A;  1YC0 A;  3HK6 B;  1H8E D;  2AGE X;  2FS8 A;  4YOJ A;  1ZOM A;  2D2D A;  1C2M A;  1QUR H;  1UW7 A;  3P8G A;  3UOU A;  4MG3 A;  4K1S A;  3GIC B;  1PPB H;  4ZKN U;  2Z7F E;  2XWA A;  3GCH B;  3I29 A;  2AIP A;  2VU8 E;  1GHA F;  1GI1 A;  4K2Y A;  3CP7 A;  1QHR B;  4Y6D A;  4B1T A;  4SGB E;  4E06 H;  3O8D A;  4CH2 B;  1O2H A;  1MKW H;  2ZDK A;  5EXL A;  1SGF A;  1XX9 A;  2FXR A;  3PMA B;  4ACA A;  2GD4 B;  5TJX A;  1NRO H;  1KXC A;  4UD9 H;  3RXM A;  2HAL A;  4UE7 H;  1GG6 B;  1LPG B;  3UTU H;  1QFK H;  1ZMJ A;  5C1Y A;  3GY4 A;  2H9T H;  3W1E A;  1AB9 C;  2XTT B;  3F9E A;  3DHK H;  1ZPZ A;  2J98 B;  2B9L A;  3PMJ A;  4Z0K A;  3RXK A;  1QJ7 B;  1WUN H;  4AB8 A;  1SLW B;  1V2P T;  1TLD A;  1TOC B;  3U28 C;  1SC8 U;  1LMW B;  1S83 A;  3RXP A;  2PKA B;  3FP8 E;  2OC1 A;  1PPZ A;  4DT7 B;  1GJ6 A;  2O8W A;  1GL1 A;  2BY9 X;  1DUA A;  4ISL A;  4YZU A;  3LC3 A;  1OXG A;  3BEI B;  3OAA D;  1P2Q A;  2BD2 A;  5B6L A;  2GCH F;  4DIH H;  5GPI B;  1Q2W A;  1ZPC A;  4TPI Z;  5CHB A;  1V2M T;  1UK4 A;  1BHX B;  2B0F A;  2CJI A;  2RDL A;  4E7R G;  4DUR A;  4TY7 A;  1N6X A;  5DJ7 A;  3JZ2 B;  3TNT A;  1NFU A;  1LHG H;  2Q6D A;  4FUD A;  3P8N A;  1MKX K;  3TIT A;  1QA0 A;  2PR3 A;  3SND A;  1ETS H;  1EP5 A;  1P9S A;  1TRY A;  1WTH D;  2ODP A;  5FHT A;  2SGF E;  3M3S A;  1GI6 A;  5CDF E;  4I31 A;  1C5R A;  1AWF H;  2TPI Z;  2ZI2 H;  1IHS H;  3QK1 A;  1HAY B;  1QB6 A;  4Q7Y A;  1H4W A;  1ANB A;  3LGT A;  5L2Y H;  2JH0 D;  1K1I A;  3SU5 A;  1GL0 E;  1QA7 A;  1CE5 A;  1K22 H;  3KEE A;  4H6S B;  4I8J A;  3A82 A;  1MD8 A;  3LT3 A;  1UTJ A;  1C5U A;  1UTQ A;  3ZZ8 A;  1BTW A;  1K2I 1;  3SO3 A;  2P95 A;  2XC5 A;  3MU4 A;  1O2W A;  9LPR A;  1W0K D;  2XND D;  2ZKS A;  1HBT H;  4I8K A;  1DS2 E;  5LPF A;  4ASH A;  1D6W A;  4TPY A;  4XBB A;  5I25 A;  4DY7 B;  1DE7 H;  3VB7 A;  1BTH H;  4B6E A;  1CGH A;  4X6P A;  1Z6J H;  3BTQ E;  1ELF A;  1SGC A;  4NIX A;  1F92 A;  1G2M A;  1CU1 A;  3CS0 A;  4CRF A;  1O39 A;  2EST E;  1O3A A;  2W7S A;  4VGC B;  2A2Q H;  4YT7 H;  3KQB A;  4UFG H;  4BTI B;  3NKK A;  3EE7 A;  1N1L A;  1NRR H;  5ESB A;  4U32 A;  2BX3 A;  4KKD A;  1EPT C;  3RM2 H;  2QN5 T;  4Q4L A;  3VG8 A;  3AVZ A;  3SU6 A;  1ZJD A;  2BY8 X;  4YT6 H;  1YPJ H;  3MH5 A;  2ZEB A;  1AI8 H;  3F0O A;  4AFZ A;  2G5V A;  1S6L A;  2VWM A;  4ZCN A;  2VIN A;  3DA9 B;  5EPN A;  4D7F A;  2W5E A;  1OYQ A;  4FU8 A;  4JZE H;  5EJL A;  1BIO A;  1OWE A;  1QBV H;  2FO9 A;  1EAX A;  4K8Y A;  4INH A;  2PV9 B;  4YOG A;  2ZC9 H;  4OS7 A;  3IWM A;  2KR7 A;  4MQA A;  4MDS A;  2OQU A;  4M7G A;  5DGJ A;  2FOF A;  2JH6 D;  3T26 A;  1N6Y A;  2A0Q B;  1FON A;  1CA8 B;  2TIO A;  2ZFR H;  1KIG H;  1IAU A;  8GCH F;  1C1S A;  1C9T A;  2RA3 A;  1YF4 A;  1C5N H;  4I33 A;  2HLD D;  2RDE A;  3SUD A;  3N7D A;  1O2Y A;  4GHT A;  1SQO A;  1NY2 2;  1HDT H;  3A8C A;  3F2F A;  3NRL A;  1BIT A;  3DFJ A;  1OWI A;  2XBX A;  4X2X A;  4FOU C;  2ZWL H;  5JB8 S;  4U01 A;  3F2G A;  2GJG A;  1LKB A;  1HYL A;  1P3E A;  2BLQ A;  1Z8I B;  3SNE A;  1HIA A;  3ZVD A;  2QF4 A;  3ZZA A;  1V2R T;  3UUZ A;  1SFI A;  1C5S A;  2Y7X A;  2WV4 A;  1FY5 A;  2QV1 A;  1D6R A;  2KAI B;  1L0Z A;  1GHB G;  1AGJ A;  2FOM B;  1DST A;  1INC A;  3TLO A;  6LPR A;  2J98 A;  1ELC A;  4THN H;  4TWY A;  1F5L A;  1DXP A;  2YMS D;  2C3S A;  3KL6 A;  1OS8 A;  4NCY A;  1ABI H;  3K6Z A;  1YCP M;  2ZFS A;  5LPE A;  2IN2 A;  1IQK A;  4FET A;  3M7U A;  3SUF A;  1C2E A;  2P16 A;  3M5M A;  1FJS A;  3ZZ4 A;  1NRS H;  1C1Q A;  1GHW H;  4JK5 A;  1PYT D;  3O8R A;  3MH6 A;  3V0X A;  1MQ5 A;  2HRV A;  2GP9 B;  1D3D B;  1RFN A;  2BY7 X;  3L6P A;  1HJ9 A;  1C1P A;  4D9Q A;  3ZZ5 A;  4NSV A;  3UIR A;  5C3N A;  1AUT C;  3KID U;  2BX4 A;  2KX4 A;  1FZZ A;  1DWB H;  4UFD H;  1EB2 A;  1HNE E;  1FV9 A;  1A5I A;  1UHB A;  4OM9 A;  5A8Z A;  3LDX H;  3PWB A;  3UOP A;  1SG8 B;  2BDY A;  1KDQ A;  2PKS C;  3TPI Z;  2NWN A;  1UCY H;  3P6Z B;  1GHA G;  4X0W U;  2SNW A;  2QXG A;  3P92 A;  2FDA A;  3L33 A;  2F9V A;  2C90 B;  2RFK C;  1YPL H;  1AUJ A;  3A84 A;  4YLQ H;  1Y59 T;  2IPQ X;  3BSQ A;  3MHW U;  1C5Y B;  2Y80 A;  4XD7 D;  1LVM A;  2FI3 E;  1K1O A;  2FLR H;  2P8O B;  3H7O A;  5GCH G;  3CEN A;  5I46 H;  2QXI A;  2AFQ B;  1AE5 A;  1UTL M;  1TAW A;  2W6J D;  1SGI B;  1WV7 H;  4DT4 A;  4WF8 A;  1RTK A;  1UMA H;  2HPP H;  3B23 B;  3MNX A;  5AFZ H;  2ANM H;  5DPA A;  2A5K A;  2K1Q A;  2PSX A;  2V3H H;  3WWF A;  1VCP A;  1O2R A;  2AHM E;  2KCA A;  1KTT B;  1AE8 H;  3UR9 A;  3P8F A;  2ZU3 A;  3M36 A;  1SFQ B;  1C2L A;  2AGG X;  1OX1 A;  1XXF A;  3F0P A;  5FX5 A;  2G00 A;  1GMC G;  3VB4 A;  2O8M A;  1RXP A;  3MU0 A;  2ZFT A;  4ZAE A;  1PYT C;  1W13 U;  1O3K A;  3RU4 T;  1SPJ A;  3FZZ A;  1EPT B;  2J4I A;  1FLE E;  5AVD A;  1FN8 A;  1O2G H;  2BOK A;  1H9L B;  1DVA H;  4FUJ A;  1C4Y 2;  1P02 A;  3W95 A;  3QGJ A;  1O2O A;  2PKS B;  5JBC S;  1DIT H;  3BIU H;  3AK5 A;  3M7Q A;  1C5T A;  2ZHD A;  1SSX A;  4X1N U;  1C2K A;  1KDQ B;  1S6H A;  1TMB H;  1C2H A;  2OC7 A;  3U8T H;  8LPR A;  1MTN B;  4BAM B;  3HGP A;  2PWX A;  2TGA A;  3FKS D;  3PB1 E;  2BLW A;  3OTP A;  2A5A A;  1KXD A;  2GCT B;  2P3F H;  1V2L T;  1O38 A;  2ZGC A;  2OP9 A;  3DUX H;  3K6Y A;  2FTM A;  1ZPB A;  4CH8 B;  1DLK B;  1O2P A;  3KCG H;  1GI2 A;  1Z1I A;  5FCK A;  2BY6 X;  1ZHR A;  2DUC A;  2GV6 A;  1SGQ E;  2WPH S;  4RN6 A;  1TGC A;  1W12 U;  1ELT A;  1Z7K A;  1O5C B;  5EIY A;  4DII H;  1ELE E;  1ZR0 A;  1TFX A;  1O3I A;  2GT8 A;  3KQC A;  4D7G A;  2FS9 A;  1RD3 B;  1ZGI A;  3U8O H;  2F9O A;  1W7X H;  5T1V A;  2ZDA H;  5GJ4 B;  3ZVF A;  2KAI A;  4DCD A;  5EXM A;  3RC5 A;  4ISO A;  1HAZ B;  1CHG A;  3O8B A;  3OYP A;  3RXC A;  2UUK B;  1S0Q A;  3GDS A;  2Y82 A;  1O2S A;  3BEF B;  3Q3X A;  1MU6 B;  6GCH G;  4X6O A;  3URD A;  3PRB A;  3SHA H;  2BMG B;  1PQ7 A;  3OEE D;  2BD5 A;  3RLY H;  2BDC A;  5JDU B;  1A1R A;  1BTU A;  4TY6 A;  3RXQ A;  4R0I A;  4OGY A;  3SU0 A;  1F7Z A;  3QUM P;  1AN1 E;  2JJ1 D;  4AOQ A;  5C20 A;  3T62 A;  1GCD A;  2GV7 A;  2G4U A;  3A83 A;  3LH3 A;  1EAS A;  1LCY A;  5GIB A;  3SU2 A;  5A09 A;  4B6F A;  3PTN A;  2WPM S;  1ZMN A;  4WXI A;  1GDN A;  4CRE A;  1BMA A;  4Y71 A;  1MTU A;  2QC2 A;  3QTV H;  4B76 A;  2ZGX H;  4WVP E;  4RT0 A;  1P9U A;  1YPG H;  1TMT H;  1TRN A;  5A2M H;  1V2O T;  1EKB B;  3SNC A;  1UK2 A;  1TBZ H;  3T28 A;  2J95 A;  5C17 A;  1P8V C;  2BZ6 H;  1TX8 A;  1W7G H;  4X6M A;  1G3C A;  3EDX B;  1TX6 A;  4O9V A;  4KEL A;  2J9N A;  2VBC A;  2Z9L A;  3RP2 A;  2Y5H A;  3A88 A;  1O3P B;  1PFX C;  4GSO A;  4YM9 A;  1NC6 A;  4MNV A;  5IDK A;  2LNC A;  1A5H A;  1O5D H;  4D9R A;  5LH8 A;  4ISI H;  1O2N A;  3OE7 D;  5BPE A;  2V0B A;  4XDE A;  3MOC A;  2H2Z A;  1SMF E;  5EG4 A;  1LO6 A;  1K1J A;  1TPO A;  1ZLR A;  1XUJ A;  2BDB A;  3LKW A;  1ACB E;  2KM0 A;  1QY6 A;  2QF0 A;  3MU1 A;  2BQW B;  2F43 B;  2ODY B;  2CN0 H;  3FVF B;  1LVO A;  2FYQ A;  1P10 A;  1N8O B;  5DP4 A;  1FMG A;  1YBW A;  2BD3 A;  2FP7 B;  1OWD A;  1P09 A;  1KMH B;  2Z94 A;  3GY5 A;  1TA2 A;  1QQU A;  4GAW A;  1C5L H;  1IOE A;  5JPM H;  2TGT A;  3S9C A;  1HUT H;  1MAX A;  1OOK B;  1C5O H;  5EJ1 A;  2XNI A;  1AZ8 A;  5GCH F;  5PTP A;  2A45 B;  1WYK A;  5T6F A;  1IQE A;  1GBA A;  1O3N A;  4KTS A;  1FPH H;  2ZU2 A;  2OBO A;  4D76 A;  1GHV H;  4HTC H;  4MNX A;  2O8L A;  3A8A A;  4F55 A;  4K5Z A;  1K21 H;  4OS1 A;  1E79 D;  3RXT A;  4YES B;  5DP5 A;  4J2Y B;  1LVB A;  5JBB S;  4ZXX H;  3P17 H;  4ZHL U;  1D3P B;  3A8D A;  4Q7X A;  4ZUH A;  1O32 A;  1GHX H;  1UCY K;  3BEU A;  1P04 A;  1MQ6 A;  1P11 E;  1QGF A;  5EST E;  1BRU P;  1N8O C;  1W10 U;  2AYW A;  3NPS A;  2C93 B;  1O3H A;  1FX0 B;  1TNL A;  4UFF H;  1PQA A;  3PO1 C;  4XFQ A;  1HAX B;  3VXF H;  1BRA A;  1E1Q D;  1AU8 A;  1C1T A;  5K0H A;  3DSG A;  2EI7 A;  1ZGV A;  3MFJ A;  1F2S E;  2D1J A;  3OEH D;  1YPK H;  1LHE H;  2XC0 A;  4AGJ A;  2C4F H;  3U1J B;  3LC5 A;  1QJ6 B;  1UCY E;  3FOA A;  3MNC A;  2ZEC A;  1GI7 B;  4Y7B A;  2ZFP H;  1TB6 H;  1OHH D;  4MVN A;  3EYD A;  3HAT H;  1XXD A;  1HFD A;  2TGD A;  4BAH B;  1AFQ C;  5EPY A;  3SU3 A;  1ZHP A;  2CGA A;  4I32 A;  4BXS A;  3V13 A;  1K0H A;  1Y3W A;  3WY8 A;  1EZQ A;  1E36 B;  1GBB A;  3QLP H;  1MU8 B;  1GVK B;  1C1U H;  4UDW H;  3U98 H;  1F0S A;  1KXF A;  3SNA A;  1O2K A;  4WH6 A;  3UNR A;  1HAV B;  3VB6 A;  2Z3D A;  1YLD A;  1FDP A;  2VVC A;  5E0G A;  2ZHE H;  4UEH H;  7LPR A;  1A5G H;  2FOE A;  3LGV A;  5JBA S;  1O3E A;  3UNQ A;  1W3C A;  3RMN H;  4A7I B;  1HXE H;  2GGV B;  6CHA C;  2VJ1 A;  3LPR A;  1PPH E;  3ATL A;  2WZQ A;  3EA7 A;  4RI0 A;  1DY8 A;  1B0F A;  3A81 A;  1T8L A;  1WAY B;  1YPM H;  5TCA A;  1YM0 A;  1VZQ H;  2EY4 C;  2Q1J A;  1U6Q A;  1QQ4 A;  2GX4 A;  4FUC A;  1IQJ A;  4MPU A;  1FAX A;  4XOJ A;  1P2O A;  3ZZ3 A;  3UQO A;  1VJ9 U;  2TRM A;  1CGJ E;  3A7Z A;  2ZHW H;  2H1U A;  1TGT A;  4CHA B;  2XRC A;  3FN8 A;  3SUG A;  2P3U B;  4JZI A;  4Y0Z E;  5EOK A;  4I86 A;  4A5T S;  2ZTZ A;  1G30 B;  1J9C H;  2Y5G A;  2ZHF H;  4XRN A;  3GS9 A;  3BV9 B;  4BAQ B;  3LU9 B;  1XUG A;  2NU1 E;  2HVY B;  3PO1 B;  1BBR E;  2VVV A;  2G8T A;  2AMD A;  3MNS A;  3M35 A;  1BTZ A;  4EST E;  1ANE A;  4MPX A;  3M7T A;  1EOL A;  1P01 A;  8EST E;  4O3U A;  3T5F H;  3GYL B;  5F03 A;  1D3Q B;  1ZJK A;  2RG3 A;  4YO9 A;  4JCN A;  1UVP A;  5JB9 S;  2GDD A;  1JRS A;  1NBM E;  1T4V H;  4HGC A;  4P00 A;  2R2W U;  1T8M A;  1ESA A;  1WQV H;  1MAB B;  3VGC C;  1YPH C;  4KGA A;  1C5Z B;  3SV9 A;  1XVM A;  4MNY A;  1LHD H;  1NS3 A;  3VEQ B;  1QBO A;  1ESB A;  2FEQ H;  5DN6 D;  2OCV B;  4D8N A;  2A4Q A;  1C4V 2;  1HV7 A;  1EP6 A;  3DSP A;  3SI3 H;  1NES E;  1O34 A;  4FUE A;  1HAI H;  1PQ5 A;  1F0T A;  1QB9 A;  3EGK H;  3RLW H;  2R2M B;  3BG4 B;  1BMN H;  1QIX B;  6EST A;  1SQR A;  5GWZ A;  2XOK D;  1O33 A;  1BT7 A;  1J15 A;  3KNX A;  3HKJ B;  5E2P A;  1TIO A;  2BB4 A;  1BCU H;  3URC A;  1DXW A;  2UWP A;  1TAL A;  2F3C E;  5AHG H;  1NBM D;  3QZQ A;  2ZNK H;  3SQH E;  1AVW A;  1EAI A;  3M61 U;  1O5F H;  3H7T A;  3QTO H;  2A1D B;  4JZD H;  3C1K A;  1AZZ A;  1RGQ A;  2V35 A;  3NUM A;  3RXD A;  1O3D A;  4GPG A;  5F8Z A;  2C8Z B;  3HGN A;  1C5Q A;  2STB E;  1FIW A;  4AFU A;  3GY8 A;  2I6Q A;  1COW D;  1IQH A;  1UTO A;  1NO9 H;  1Y5U T;  1L4D A;  1FPC H;  5L2Z H;  5E8E H;  2FOB A;  1GMH G;  4O03 A;  4RKJ B;  4F4O C;  5F6M A;  3LH1 A;  3RXG A;  4AOR A;  4K3J A;  1CA0 C;  4Y76 A;  4DGJ A;  1GCT C;  3LGY A;  3OFN D;  2J2U A;  2ZG0 H;  1H8I H;  3D49 H;  1AND A;  4YLU A;  1G2L A;  4ABI A;  3KYG A;  2BDG A;  3UAI C;  3NXP A;  2PTC E;  1BQY A;  1GBC A;  1ORF A;  3BF6 H;  2D26 C;  3PMH B;  2Q6F A;  1SHY A;  1GHB F;  1JXP A;  2OD3 B;  3Q3Y A;  1EZU C;  2PLX A;  2GTB A;  4NA8 A;  1Z6E A;  4YTA A;  1XKB C;  3ZYD A;  3GY2 A;  1KLI H;  1FY8 E;  1TON A;  1OWH A;  2FZZ A;  5AF9 H;  3P8O A;  5KGO A;  2Z9J A;  3RC4 A;  5C1U A;  2BZA A;  1LQD B;  2YMS C;  4P02 A;  5C67 A;  1EOJ A;  2ZO3 H;  1O30 A;  1YLN A;  1K9O E;  4HFP B;  4OS5 A;  4BAO B;  2G52 A;  1G3E A;  4X6N A;  2ODQ A;  3E8L A;  1S85 A;  3DFL A;  1AO5 A;  2J38 A;  2KFW A;  1KXE A;  4X8T H;  5DP9 A;  2BD4 A;  3U8R H;  3HK3 B;  1WTG H;  4K60 A;  2ANY A;  4F48 B;  2W3K A;  1MTS A;  1S5S A;  2ALP A;  2BVX H;  2NU4 E;  1GBM A;  4OS2 A;  2NU0 E;  2KCY A;  2EEK A;  1W11 U;  1BBR K;  1VGC C;  1C2F A;  1WBG B;  5L30 H;  4FU7 A;  1WCZ A;  4INL A;  4CR5 A;  4FUI A;  1XKA C;  5G4B A;  1CT2 E;  1EJM A;  3VFE A;  1TGS Z;  2AIQ A;  3AW0 A;  1QNJ A;  1PPG E;  3KF2 A;  4AB9 A;  1SVP A;  4XBC A;  1FI8 A;  1EST A;  1LDT T;  2DE9 A;  1EJA A;  3QDZ B;  1P12 E;  1UVO A;  3Q00 A;  1P05 A;  3UWJ H;  3D23 A;  2VGC B;  1CBW C;  3UWI A;  1ZTJ A;  1BUI A;  4ZH8 A;  5DG6 A;  3OY5 U;  1O5A B;  2EA3 A;  1LTO A;  2HPQ H;  3RMM H;  1MMJ N;  2A4O A;  3AAU A;  1NU7 B;  3E6P H;  1Z8G A;  2RCE A;  4HI3 A;  2BXT H;  1H9H E;  3AAS A;  2XBW A;  3RXA A;  4QT8 C;  3RMO H;  1GJ7 B;  3MWI U;  2FIR H;  1J17 T;  2GZ7 A;  3RXR A;  1SGN E;  2WPL S;  3UFA A;  1ZTL A;  2AMP A;  1ARC A;  1WSS H;  2K0Q A;  3T2N A;  4TWW A;  5EQS A;  1O37 A;  2XBV A;  4JZF H;  2JH5 D;  1FY3 A;  2WYG A;  1UTK A;  1C5X B;  4WH8 A;  4OS6 A;  3ZIA D;  1SHH B;  1TNK A;  4B73 A;  2JET C;  2ZQ2 A;  1UVT H;  1O2J A;  4ZMA H;  3UY9 A;  1ABJ H;  1L2E A;  4AN7 A;  4NIY A;  1GI9 B;  2YMS B;  1Y3X A;  1TPP A;  2QE7 D;  2SGA A;  1CBW B;  3SGA E;  4Y8Z A;  3KYF A;  1QB1 A;  3SJO A;  1MD7 A;  1C5V A;  3TNS A;  4Y11 E;  1A0L A;  2OUA A;  1THS H;  3QO6 A;  5HM9 A;  3NWU A;  5EW1 H;  4A1T A;  2Q6G A;  4GUX A;  2Z9I A;  5FPS A;  1GI3 A;  4X1S U;  1OWK A;  2BHG A;  4CRB A;  4Z1M D;  2AER H;  4WMD A;  1T31 A;  1ID5 H;  2QYI A;  3AAV A;  1BBR H;  1HB0 B;  1FXY A;  2V3O H;  4ACB A;  3SU4 A;  2FMJ A;  3M37 A;  2FES H;  2A4R A;  1V2T T;  1Y8T A;  2VB0 A;  1IHT H;  2Y7Z A;  2R0K A;  1P2J A;  1C1W H;  1SOZ A;  2PW8 H;  3PLP A;  5GXP A;  3QGN B;  3MU8 A;  4JYT A;  1HJ8 A;  1XUK A;  2WPI S;  3UR6 A;  4XE4 A;  1QL7 A;  2Z3E A;  1LPZ B;  1FY4 A;  2KCP A;  1O2V A;  1NRN H;  3JZ1 B;  3ODF A;  1O5E H;  1OPH B;  1RTL A;  1UO6 A;  5C94 A;  7GCH F;  3E90 B;  4B75 A;  1EXF A;  2FLB H;  2WSS D;  1C1R A;  3A86 A;  4X1P U;  1S82 A;  2R9P A;  2WV5 A;  2BM2 A;  4CRC A;  1GBJ A;  1MAY A;  4XSK U;  1PPE E;  2FM2 A;  3Q77 A;  4HG6 A;  1BB0 B;  3A89 A;  1O0D H;  2FWW A;  3AW1 A;  1GBL A;  1MTW A;  5FX6 A;  2EI6 A;  2WPK S;  3SJK A;  2BD9 A;  2XCN A;  3V3M A;  1KTS B;  1NFW A;  3R0F A;  3IIT A;  3SJI A;  4A1X A;  2L74 A;  3ZV9 A;  2RA0 A;  1THR H;  3F3B A;  3OTJ E;  1NN6 A;  4RT1 A;  3MYW A;  5A0C A;  3M5N A;  3G01 A;  5FL7 D;  5CHA B;  2ZDN A;  1UTP A;  3F9H A;  2ZDL A;  2F9U A;  2ZTY A;  1Y3V A;  2WPJ S;  1E1R D;  1UHB B;  2PGQ B;  1ELA A;  5DP3 A;  2VH0 A;  3A7Y A;  3S9A A;  1O2M A;  1RS0 A;  2OC0 A;  1BZX E;  1BTY A;  1Y5A T;  1TBR H;  1TMU H;  1O3O A;  1BDA A;  1GG6 C;  2GKV E;  1ELB A;  3F9G A;  2QF5 A;  3BTE E;  1SGR E;  1V2U T;  1TNH A;  2ANW A;  2YNB A;  5FCR A;  3NZI A;  1VIT F;  1W0Y H;  2BXU H;  1CHO F;  3TH2 H;  2FI5 E;  1DY9 A;  5DP8 A;  3RC6 A;  3ZYE A;  3P70 B;  2ZU4 A;  1SGE E;  3SNB A;  2FI4 E;  2GZ8 A;  3KGP A;  2A31 A;  4IN2 A;  4IN1 A;  2D8W A;  2NU3 E;  3E0N B;  5E0H A;  2KZ4 A;  3ATW A;  3ZZ6 A;  3SV7 A;  4K8B A;  4LZ1 H;  3TH4 H;  2Z3C A;  1OP0 A;  3SYJ A;  2PGB B;  3PLB A;  3A87 A;  1DX5 M;  1O5B B;  3BG4 C;  3BTW E;  5T3H A;  2P59 A;  2ANK H;  1YCP K;  3RU4 E;  5FPT A;  1BTX A;  4I8G A;  3K65 B;  1DLE A;  1TBQ H;  1NM6 A;  2AH4 X;  1EZX C;  2ZQ1 A;  3URE A;  1E34 B;  5EGM A;  2G4T A;  4U2W A;  1BRC E;  4DVA U;  5HXF A;  4X2W A;  1HCG A;  2SGQ E;  3ZV8 A;  1J16 A;  3SOS A;  1BRB E;  5C1X A;  2ZGH A;  1HAP H;  5GND A;  4DJZ B;  2CHA C;  5JYI A;  1G9I E;  1NFY A;  2B5T B;  2VWN A;  1A7S A;  3F9F A;  1P2N A;  2HNT E;  3BN9 A;  1UVS H;  2SGD E;  2BYA X;  3PWC A;  3RM0 H;  1EAW A;  5E0J A;  4AX9 H;  3S9B A;  1YCP H;  1MKW K;  1ETT H;  2TBS A;  2LEL A;  2PP6 A;  1LQE A;  1TGB A;  1Z8J B;  1MKX H;  3LJJ A;  1A0H B;  1CQQ A;  1T7C A;  5K7R A;  1B5G H;  1GJC B;  1AD8 H;  1T8N A;  2EI8 A;  2ALV A;  2ZGJ A;  1EUF A;  3TK5 A;  4ABB A;  4CHA C;  1Y5B T;  2Y6T A;  2PFE A;  3WW7 A;  3MH4 A;  1Z1J A;  1O35 A;  1GVL A;  1NRQ H;  3MQK C;  1GBI A;  1KSN A;  3VXE H;  3S7H B;  1AFQ B;  4ZKR U;  5EQQ A;  3SW2 B;  1O2L A;  4H6T A;  5HYO A;  3TK6 A;  1K1N A;  1L4Z A;  1AIX H;  3ZZ7 A;  1BOQ A;  2VIP A;  2ZCL P;  5C2Z A;  1G3D A;  3MO6 A;  1QRW A;  1IQN A;  2VGC C;  1XUI A;  5E2O A;  1IQL A;  3TIU A;  2H5D A;  2VWL A;  1XM1 A;  2Y5F A;  5HIY A;  3SJ8 A;  2Z6B D;  1DM4 B;  4NGA H;  2ASU B;  1GGD B;  2WUC A;  1GGD C;  1LHC H;  4A92 A;  5DO4 H;  2R3U A;  4X2Y A;  3SJ9 A;  1ZSJ A;  3TGK E;  1WDI A;  1V6D A;  1GJ4 H;  3T29 A;  5SGA E;  2J92 A;  1SLU B;  4AFS A;  1Q31 A;  3MTY A;  2M5T A;  1KY9 A;  4ZXY H;  3SU1 A;  1DPO A;  3MO3 A;  3RXV A;  1GMD G;  4Z6A H;  4B2C A;  1V2V T;  2JKH A;  1XUH A;  4IW4 E;  2BOH B;  2WIN I;  3KHV A;  1ELD E;  1MZD A;  4NZL A;  3MMG A;  1YGC H;  1GJD B;  1TYN A;  4RKO B;  4VGC C;  1AVG H;  2P93 A;  4X8S H;  3DSO A;  3BTH E;  2OTV A;  2QGR A;  2FOC A;  2QCY A;  5FBE A;  1TRM A;  2P94 A;  2VH6 A;  1XVO A;  4GCH F;  5HM2 A;  1KXA A;  3M3T A;  1SGF G;  2BDI A;  2LP6 A;  1OYT H;  2ZCK P;  1TE0 A;  1TNI A;  4FVD A;  4ZRO A;  2ZTX A;  1HGT H;  1BMM H;  3MO9 A;  1MBM A;  2GZ9 A;  1SKY E;  3MI4 A;  1OSS A;  3HPT B;  1A3B H;  4BAN B;  1DT2 A;  2AEI H;  3TU7 H;  4DOQ A;  1TNJ A;  1T32 A;  4AFQ A;  5TCC A;  1GHY H;  2PUX B;  2O9Q A;  1OP2 A;  1O36 A;  4LOY H;  3S0N A;  3U69 H;  1K1P A;  2A7J A;  1EPT A;  4ZHA A;  1VGC B;  2P3T B;  1RJX B;  2GDE H;  2J94 A;  4B2B A;  1O2T A;  2XC4 A;  4IMQ A;  4BOH A;  4UON A;  1ZSL A;  2VIV A;  3PRO A;  1L1G A;  3V12 A;  1P2M A;  1EQ9 A;  2OIN A;  3BTT E;  1GMC F;  1C9P A;  4NZQ A;  3ENS B;  4NSY A;  3KQ5 A;  3E91 A;  4ABD A;  3B9F H;  4FUH A;  1MBQ A;  1P06 A;  5CMX H;  3FP7 E;  1AY6 H;  5FXL A;  4AGK A;  3TJO A;  1O2Q A;  1V2J T;  2VWO A;  4ZHM U;  1D4P B;  1GPZ A;  2IJO B;  1FY1 A;  4MPW A;  1H9I E;  4JYV H;  4IC6 A;  1V2S T;  3LIW A;  5J4Q A;  3F68 H;  3TJU A;  1B7X B;  2O8U A;  4OGX A;  4GHQ A;  1D3T B;  2FOG A;  2QA9 E;  4IMZ A;  5H4I B;  4NFE A;  1W2K H;  3D65 E;  4CRA A;  3T25 A;  1WQS A;  3RUO A;  4J1Y A;  1ZYO A;  1MCT A;  1KYN A;  2OXS A;  5KED A;  4BTT B;  1LHF H;  1A46 H;  3A7W A;  1MTV A;  3QX5 H;  4LK4 A;  2BVS H;  4MLF B;  4BNR A;  4BXW A;  5BRR E;  2BLO A;  3FAO A;  2AGI X;  3ZVG A;  1CVW H;  4X1R U;  1DWC H;  3ODD A;  1SGD E;  3GDV A;  1ZSK A;  1CT0 E;  1HAV A;  1C1O A;  1NPM A;  4AZ2 B;  3Q76 A;  1OP8 A;  1EX3 A;  3KN2 A;  2XCF A;  1FUJ A;  4ASU D;  5C5N A;  2BTC E;  3N7O A;  2WV9 A;  1DDJ A;  1H8H D;  1NTP A;  1RTF B;  3A7X A;  1AB9 B;  1GJ8 B;  3ZZD A;  1Y3U A;  3MNB A;  5F53 A;  3RXJ A;  4A1V A;  2A5I A;  4AC9 A;  1SGT A;  4FXG H;  1DUE A;  3S7K B;  8KME 2;  1EJN A;  1ZHM A;  3FO8 D;  3E16 B;  1TQ0 B;  3O8C A;  4IC5 A;  3A85 A;  5A0B A;  2HNT C;  3V7T A;  7GCH G;  1CSO E;  1ELV A;  1Z71 A;  3RXI A;  5GDS H;  2YNA A;  2F4L A;  2H9E H;  3A7V A;  2F9P A;  3RXE A;  3BTM E;  1GBK A;  3A8B A;  3VB5 A;  2FTL E;  1B0E A;  2H5C A;  4NA7 A;  2GCT C;  1DFP A;  1CO7 E;  3UNS A;  3ZVE A;  1C5P A;  1BHX F;  4O3T A;  3ZZB A;  3UB0 A;  2XWB I;  4ABF A;  1G37 A;  3ATI A;  3CS7 A;  1MTN C;  4ABE A;  1PPC E;  5EQR A;  3RXU A;  4NFF A;  2F9N A;  1S81 A;  3QN7 A;  4H42 U;  4Y8X A;  1JBU H;  2FX4 A;  1MH0 A;  2FPZ A;  2HOB A;  4IBL H;  1W14 U;  3NK8 A;  2VIQ A;  4Q80 A;  5F8X A;  5C5O A;  3SGB E;  4U30 A;  3F1S B;  3PMB B;  4KP0 A;  4NWK A;  3GIS B;  3T27 A;  2F9B H;  2XXL A;  3U1I B;  1TNG A;  1ARB A;  3L3T A;  1C5W B;  3EA9 A;  3FFG A;  1SGY E;  3GY7 A;  1VJA U;  2ZPQ A;  3RML H;  1AQ7 A;  1GJA B;  2ZU1 A;  1DOJ A;  8GCH G;  3BTK E;  4NWL A;  1YY3 A;  4TT3 D;  2VID A;  9EST A;  1GBT A;  2J97 A;  2ZPR A;  1W0Z U;  1ZML A;  2QF3 A;  1A4W H;  4FUB A;  1AVX A;  4JK6 A;  3STJ A;  1HRT H;  1F0R A;  3GY6 A;  3TK9 A;  1JRT A;  3EE0 B;  1QTF A;  4I8H A;  1JIR A;  1OKX A;  2A7C A;  3ATK A;  2UUF B;  1S0R A;  1VKY A;  1QCP A;  4IGD A;  3M3V A;  3RXF A;  2B7D H;  1JMO H;  1W0J D;  1P3C A;  1WU1 A;  3PYH A;  2NU2 E;  2SFA A;  1E0F D;  5CHA C;  1GWA A;  2CK3 D;  5ABW A;  1HAO H;  1C1M A;  1GDU A;  4AG2 A;  1P0S H;  4WJG 2;  1F0U A;  3PV4 A;  1IQI A;  3D62 A;  1AHT H;  4WXV A;  2TGP Z;  2C8X B;  4Y0Y E;  2ZCH P;  3EAJ A;  2HVX A;  2QY0 B;  1UJ1 A;  4AYY B;  3N99 A;  3RXO A;  1SQT A;  1PJP A;  1GI5 A;  4X8V H;  1AFE H;  3OSY A;  4CR9 A;  3OU0 A;  4YOI A;  1M9U A;  1J14 A;  1YPH E;  5EOD A;  6CHA B;  2GMT C;  2SGP E;  4NIW A;  3M5L A;  2XBY A;  3HKI B;  1RIW C;  3W94 A;  2BDA A;  3KQE A;  2Z9K A;  3B8J A;  4MPV A;  3SQE E;  3DCL A;  4B2A A;  3OX7 U;  4KTU A;  2GMT B;  1BJV A;  3TVJ B;  2QXJ A;  2W3I A;  3BIV H;  1E38 B;  2B8O H;  1L1J A;  2FYR A;  4GLY A;  1NFX A;  1KLJ H;  4Y79 A;  4K1T A;  5F8T A;  2KCO A;  2WHX A;  1C4U 2;  2H6M A;  4FVB A;  1CHO G;  5IK2 D;  1MZA A;  2CF9 H;  2AS9 A;  2V3M A;  2ILN A;  1HPG A;  4GCH G;  1UTN A;  1KXB A;  1TQ7 B;  1QRZ A;  2VIO A;  1TOM H;  4X2V A;  1HJA C;  1FIZ A;  1FQ3 A;  1ZRB A;  2I6S A;  2OK5 A;  4IS5 A;  1SBW A;  2UUY A;  2G51 A;  3SV2 H;  2W26 A;  3GCT G;  3M5O A;  1UVU H;  5C0U A;  3QWC H;  2ZDV H;  4HZH A;  1O3L A;  1VR1 H;  3H09 A;  2CXV A;  3PV5 A;  4WWY A;  1V2N T;  4Y7A A;  2GCH G;  3E0P B;  2PKA A;  1Z8R A;  2QXH A;  2OLG A;  3LGU A;  5LGO A;  1NRP H;  1NZQ H;  4K69 A;  3A80 A;  2ZP0 H;  1SQA A;  1FAK H;  1GJ9 B;  3E1X B;  1A61 H;  2JJ2 D;  3RXS A;  1A3E H;  1GBH A;  1V2W T;  5EXN A;  3LGW A;  3PM3 A;  3IG6 B;  2EQN A;  2A32 A;  5A8X A;  2CMY A;  3EST A;  1F5K U;  1ELG A;  3SOR A;  2OC8 A;  1GVZ A;  3P95 A;  3K9X B;  5T6G A;  1C2J A;  1ZTK A;  3UPE A;  2J5U A;  2ZHQ H;  1GI0 A;  1SL3 A;  4X1Q U;  2JDI D;  3UQV A;  3A7T A;  3GCO A;  4LZ4 B;  1VCQ A;  4Q2K A;  2BDH A;  3DT0 H;  4MTB A;  5HGG A;  3RDZ A;  3VPK A;  1H8D H;  1Q3X A;  3GCN A;  1CT4 E;  1O3B A;  1TGN A;  2LPR A;  4CRD A;  1O3G A;  4NA9 H;  3TH3 H;  1O3J A;  1SOT A;  3SUE A;  2VVU A;  3MU5 A;  1O3C A;  3H5C B;  3R3G B;  2SNV A;  3SZN A;  1LVY A;  2G81 E;  1G36 A;  5CE1 A;  4WY3 A;  1LPK B;  5DP7 A;  1P57 B;  2YOL A;  4TYD A;  3KQD A;  5IYT A;  3DD2 H;  1SGP E;  5DKM A;  1E37 B;  3LON A;  2G5N A;  2FOH A;  2JET B;  3K2U A;  4OS4 A;  4BAK B;  1V2Q T;  1EAU A;  1BA8 B;  2K8I A;  2BVR H;  3FAN A;  3RU4 D;  4DW2 U;  1ETR H;  4NG9 H;  1C1V H;  3LJO A;  5HMA A;  3SGQ E;  2ZDM A;  2BY5 X;  3PLK A;  2UWL A;  2PSY A;  2QAA A;  1S6F A;  1J8A A;  1T4U H;  2C8Y B;  2JIZ D;  2QIQ A;  1BJU A;  1GCT B;  4WME A;  1EAT A;  5EW2 H;  3ZZC A;  1SR5 C;  2IPH A;  4CBN A;  2BQ7 B;  2CF8 H;  4ZKO U;  3C27 B;  4NIV A;  1C2I A;  4O97 A;  3I77 A;  4H4F A;  1TAB E;  4SGA E;  3GCT F;  1GBF A;  2V7Q D;  2AMQ A;  1L1N A;  1KLT A;  1BTP A;  2IJD 1;  1THP B;  2ZZU H;  5J4S A;  2VNT A;  2M2A A;  4M9F A;  1O3F A;  3I78 A;  4ABG A;  3GY3 A;  1TWX B;  1RRK A;  2ZA5 A;  1YP9 A;  4ISH H;  2PUQ H;  2GT7 A;  1O31 A;  2PTN A;  2F83 A;  1ZRK A;  3ZVB A;  2F91 A;  3BG8 A;  3RXL A;  4AYV B;  4BTU B;  3TGJ E;  5T6D A;  5ETX A;  2SGE E;  2OBQ A;  3EQ0 H;  2ZF0 H;  3N7E A;  1MUE B;  2ZFF H;  3LGI A;  5LPR A;  1GI4 A;  3SN8 A;  2ZFQ H;  2THF B;  3Q3K A;  5JBT A;  1K28 D;  2FOD A;  5B6O A;  4YXW D;  4K1E A;  3PRD A;  1O2U A;  4JZ1 A;  3GDU A;  4ZKS U;  2EC9 H;  1QZ8 A;  2R3Y A;  2UWO A;  1CA0 B;  1T8O A;  3OY6 U;  4ISN A;  3EA8 A;  3ELA H;  3ZVC A;  1O3M A;  1CGI E;  3F6U H;  1WXR A;  1TPS A;  1LKA A;  2BQ6 B;  1FN6 A;  3GCH C;  4KTC A;  1V3X A;  1GBE A;  2G55 A;  2HWL B;  5FBI A;  1HIA B;  1IQM A;  1K1M A;  1YLC A;  4Y8Y A;  5KEC A;  1JWT A;  4LXB H;  1GMD F;  1AKS B;  1G32 B;  3U9A H;  2BD8 A;  5DK1 A;  2FX6 A;  1ANC A;  4DG4 A;  4Q63 A;  2P8O C;  1O2Z A;  1DSU A;  2ULL A;  5A8Y A;  1HAH H;  2R0L A;  1YWU A;  4TSF D;  1YPE H;  2PHB A;  1JOU B;  2L6O A;  4FUF A;  1OWJ A; 
#chains in the Genus database with same CATH homology
 2EY4 C;  2RFK C;  3UAI C;  2EQN A;  3U28 C;  2HVY B;  2V3M A;  3MQK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...