3UAIC

Structure of the shq1-cbf5-nop10-gar1 complex from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
PPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA ribonucleoprotein complex subunit 4
publication title Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase/chaperone
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3uaiC00
2EQNA 2HVYB 3U28C 3MQKC 2EY4C 2V3MA 2RFKC 3UAIC
chains in the Genus database with same CATH superfamily
3RUOA 5T3HA 1OP2A 1CVWH 1EKBB 1DM4B 3QZQA 1VJ9U 1KMHB 5E0GA 2VU8E 1UK3A 3LOXA 1KXCA 1BJUA 4IBLH 1UTPA 1WUNH 3H7OA 4P00A 3ZV8A 1QRXA 2PSXA 3VB6A 5DN6D 3NK8A 1QRZA 4YT6H 3MU4A 1C1PA 1SOTA 2Z9LA 3WW7A 2ZC9H 2STBE 5DP6A 1NS3A 4I31A 2PUXB 1RGQA 1GBEA 2YMSC 3U8OH 3M7UA 5JPMH 1GBBA 2VNTA 3RM0H 1P0SH 1EZXC 2WUCA 3TJUA 3PLBA 1YPMH 1TGTA 2W7UA 3S0NA 3KQEA 2A1DB 1JIMA 1GI4A 1T4UH 1B5GH 3SI4H 3PMHB 1YY3A 3SW2B 1EJNA 4OS4A 4Y10E 1ESBA 2DE9A 2PTCE 1W14U 3OEED 3SV7A 1T7CA 3UWIA 1NO9H 5A0CA 1W7GH 1ELBA 2B5TB 5JBBS 3OU0A 4ABDA 4U01A 3UNSA 2QGRA 1TABE 1DITH 2AMDA 1A5IA 1BBRK 2BD2A 1G9IE 3U8RH 1IQEA 1GVKB 1CT0E 1TPOA 1NFYA 1C4U2 3KQ5A 3I78A 3KHVA 1HV7A 4P02A 4CR9A 3E16B 5EODA 4BTUB 3SU0A 3UNRA 5B6LA 1OYQA 4Q2KA 2VINA 2ZFSA 1Y3YA 2PUQH 3TJVA 1GHYH 1C5OH 1O3AA 1E36B 4WY3A 1BMFD 2ZCHP 3MH4A 1DS2E 1D3DB 1P2KA 3TGJE 2QXIA 1IHSH 2RFKC 1A0JA 2G52A 4CBOA 1W13U 1CGIE 1UCYK 5GWZA 1T32A 1INCA 2A2XH 2IOTA 2Q1JA 3SJOA 1D3PB 1NFXA 5JBTA 4X8SH 3SJIA 5TJXA 1NPMA 1OOKB 1LPKB 1XXDA 4TY6A 4LXBH 2XCFA 4F48B 1FX0B 3A83A 1ELDE 3S9BA 3E91A 4H42U 2NU1E 1FY4A 1WQVH 1GCTC 1OWEA 1YLNA 3OEHD 3BSQA 1GDQA 1GJ4H 1GBIA 4B76A 4AFZA 4MG3A 1NBME 1QB9A 2BVXH 3HKIB 4R0IA 1P9SA 3KQCA 4FVDA 4PROA 2FO9A 3M5OA 2GDEH 4CRFA 1RRKA 4QT8C 3MNXA 1MTUA 3TITA 5L30H 1C2FA 4JZ1A 1MU6B 1EAIA 5L2YH 1LVMA 2PGQB 2OINA 5AF9H 2ZU3A 1ELGA 3BTEE 4H4FA 2DE8A 5ESBA 2BDBA 3SUFA 3O8CA 1HRTH 2ZF0H 4FU7A 5F6MA 1PPFE 1PQ7A 3SHAH 2OQUA 5C1XA 1XUFA 4HG6A 4KKDA 4ACBA 1GBLA 1IHTH 2ODQA 1C1RA 1TPSA 1O2IA 5C5OA 5FPYA 1AHTH 1O36A 1ZTJA 3MO6A 1QNJA 1SHYA 4E7RG 1E0FD 4THNH 5A8XA 1Z8GA 4MNXA 1GL0E 4VGCB 3HGNA 3MU0A 1HB0B 1W8BH 3AAVA 4GUXA 1K1MA 2BDHA 1YGCH 1KXFA 3OY6U 1THPB 5DP5A 1NT1A 1OSSA 3T2NA 3UAIC 4Q7XA 4JK5A 4JYUH 1SGYE 1E1RD 4JZIA 1UVSH 2Y81A 4Y76A 3Q00A 1AUJA 3ENSB 4ZKSU 3ZZAA 4NGAH 2FI4E 2GMTC 3AAUA 1NRSH 4FUEA 4ABJA 1W0JD 1RFNA 3IG6B 4ZKRU 3TNSA 1HUTH 2XWBI 3MNCA 2WPKS 2BY6X 2XOKD 3RDZA 1CSOE 1GMHF 4JYVH 4AFQA 2OBQA 1CGHA 1P05A 3TK5A 1H1BA 8LPRA 1FUJA 2FOBA 1AQ7A 2PSYA 1N1LA 1HGTH 3ATMA 1RD3B 1GHXH 1P2NA 2VB0A 5GCHF 2FOGA 1F0RA 1K9OE 1HAHH 3K2UA 5L6NH 3PV2A 2BD5A 2BY8X 4IMQA 2WYJA 2A4QA 5CHBA 2IJD1 5TCCA 1YPHC 3SU4A 1E79D 1NY22 1GWAA 2GV6A 2WPJS 3V0XA 4JK6A 1GHBG 3ZVDA 2OLGA 2EA3A 5GXPA 1HAGE 3VG8A 1WYKA 1Y3XA 4E05H 3CNRA 3RXEA 1SL3A 3QK1A 1GMCG 1TMBH 3A87A 1Z7KA 1OX1A 1GJCB 2HPQH 4FXGH 1JIRA 4ZXXH 3VGCC 1EFRD 4ASUD 2GV7A 2KFWA 2RA0A 4M7GA 5DP9A 1OS8A 2QA9E 4X6NA 1T4VH 3T27A 1G30B 1VGCC 1P57B 2FMJA 1K1PA 2V3OH 3N7DA 1F7ZA 1GI1A 1GG6B 2P59A 5F53A 3SV9A 2A7HA 2ZCLP 1BHXB 3TGIE 1ZTLA 2QAAA 2ZGHA 9ESTA 3LGVA 1J16A 1GVLA 1AE8H 2XCNA 2Z7FE 2P3TB 1ZYOA 2LPRA 4NFFA 5LH8A 4XBDA 3DSPA 2UUKB 2C3SA 3W1EA 5DP4A 4RT0A 4X1NU 2FZZA 3L3TA 3ATIA 8KME2 5DO4H 1HAPH 1AB9B 3QGJA 5DPAA 6GCHG 3RU4E 1WU1A 1HJAB 3TVJB 1O5FH 3RXRA 1C9TA 4JMYA 4TYDA 1VJAU 2FI5E 3ZVGA 1UCYH 4B75A 1IQJA 1EJMA 2XC4A 2H5DA 3JZ2B 1VCPA 1PJPA 2FS9A 4A1XA 1TPPA 3BTME 3FAOA 1A0LA 4YZUA 3N7OA 1ANBA 3E3TA 1FN8A 4AFUA 4DW2U 2V35A 3SUEA 1EZUC 5EPYA 4MNVA 2VJ1A 4X8TH 2XNIA 2F9PA 1GJ6A 3P8FA 4NA7A 2FIRH 1YPJH 3PRBA 3QO6A 2FOFA 5E0JA 2J94A 4Y7AA 4AX9H 2W3IA 1GHZA 1O5CB 1ZHRA 3M37A 1EPTA 2ZDNA 4TWYA 2C8ZB 4Y79A 4UFFH 2STAE 4A6LA 5FCKA 1AGJA 1RXPA 1C2HA 5A8YA 2KR7A 4D7FA 2JH6D 3OSYA 1H8DH 3D65E 1C5NH 5ETXA 1KYNA 2M5TA 3KCGH 4JZEH 1ELTA 3MI4A 4OS1A 2J98B 2ZTYA 2RDLA 3MU5A 1UMAH 4YLQH 4MLFB 5DSFA 3BG8A 3SO3A 4DOQA 2QF0A 5I46H 1JRSA 3TPIZ 3GY5A 1BRUP 3ZZ4A 4A92A 3DD2H 4MNYA 4Q80A 2BZ6H 3EA8A 4CRAA 1C5RA 1LQEA 1GJAB 2PWXA 1SGFG 1C2MA 4RN6A 1N8OB 5IYTA 4B6EA 2GVFA 1AU8A 2BLOA 3MU1A 3EDXB 1TE0A 3ZVAA 1BIOA 3H5CB 1HAOH 1O37A 2ZWLH 3I29A 1C4V2 3VB7A 1EOJA 4NIVA 1FY5A 1XUJA 2VIPA 2VIDA 3GCNA 3BTFE 2F9NA 3A8CA 2DUCA 2SGPE 1YYY1 1EP6A 1SPJA 5GDSH 1B0FA 1EB1H 2FS8A 3AK5A 1AVWA 3M5MA 3K6ZA 1FN6A 3NPSA 2C8YB 3E0NB 2G00A 1F0SA 1PQ5A 1O2SA 1EPTC 1TX6A 2GTBA 1C5YB 4K5ZA 3BIUH 1M9UA 3RXDA 2F3CE 3LT3A 3FOAA 1V2TT 2BZAA 2JDID 1W0ZU 1GJ7B 1O2VA 1SGQE 2HVXA 4RKJB 5K7RA 1F5LA 1ZJDA 2H6MA 1TNGA 1H4WA 4INLA 4RT1A 3RC4A 2XBXA 1GHBF 2SGQE 5E0HA 4LOYH 3F2FA 1KTSB 4OS6A 3BEFB 1QL8A 4HZHA 1GMCF 1K28D 3E1XB 1HAZB 2A4GA 1SGNE 2ZFTA 4O3UA 3ZZ9A 4B2CA 4UFEH 2CHAC 4MVNA 4WH8A 1TA2A 1NRRH 1SGEE 3BTQE 1DLEA 3NWUA 1GI0A 3GY3A 3M5LA 4OS5A 4D8NA 3VXEH 2FI3E 3FKSD 3RXQA 4FUIA 2F9OA 4XBCA 5HM9A 3ZVCA 2ANYA 2V0BA 1D6WA 3ATLA 1SFQB 2KM0A 2YNBA 2KX4A 3PLKA 2J5UA 3SV8A 2ZEBA 5HXFA 3PRDA 3RU4T 4H6TA 1CE5A 3QTOH 1MAYA 2VWLA 3RMOH 2PKAB 1RTLA 1QGFA 4IC6A 4YXWD 2F91A 3SNEA 5FX5A 3F9GA 5FAHA 2GCTC 1BITA 3P8NA 3RXIA 1FV9A 3RXLA 1O33A 3TNTA 2KAIB 1GI2A 3PWBA 3KYFA 4NWLA 1C5SA 3O8RA 1D9IA 2OP9A 2C4FH 3FN8A 4KTCA 4F55A 1BT7A 3T5FH 4YLUA 1S81A 1C1OA 1O2KA 6GCHF 2WSSD 1HPGA 1EUFA 3LH3A 1MCTA 1GI9B 1S82A 3RXAA 1GGDB 1P04A 4MQAA 5KGOA 4MNWA 1VKYA 1QQUA 1COWD 2BDCA 1HAVB 1L1GA 5DP3A 1P06A 2A5IA 3TU7H 3S9CA 3GCTF 4ZXYH 2ZZUH 3VPKA 3F9EA 3ODDA 1UTJA 2W26A 3OTPA 1SQRA 1T8OA 3ZZ7A 1LPGB 1VCQA 1ZSJA 1FDPA 1V2UT 3TJOA 5EW2H 2TGAA 2VGCB 1VITG 1KSNA 1AWFH 1C1VH 1YPEH 2XNDD 2BXUH 8GCHG 4WMFA 1P03A 2WV4A 2HVYB 3G01A 4CR5A 3S7KB 2JJ1D 3GY7A 9LPRA 5EQSA 2F4LA 1O35A 1PQ8A 4OS2A 1BCUH 1TALA 5C1YA 2BLVA 1S6FA 2K1QA 2G51A 3DFLA 1O3MA 4GSOA 5LPRA 2WYGA 1MTNC 4AZ2B 4X6OA 4CH2B 1QBOA 3NRLA 4WWYA 7GCHG 1JWTA 4H6SB 4UDWH 1NU9A 1TMTH 2HNTE 3SU5A 3S7HB 4DGJA 3STIA 3M3VA 1NRNH 1OP0A 2J97A 4ISLA 3RXCA 4TPYA 2HWLB 1ELFA 3HPTB 3A7YA 3GYLB 2BD7A 1FPHH 5EW1H 1P9UA 1FQ3A 1TRNA 3F0PA 2WZQA 3TJNA 1FAXA 2IJOB 1QIXB 1DWDH 1CA0B 1C1UH 2YNAA 5AFYH 1SGCA 1W0YH 1W0KD 4BXSA 1O2RA 1OKXA 1P3CA 1V2KT 3LJJA 2KCAA 3FP7E 4GHQA 4E7NA 1ZMNA 3MH5A 5FXLA 3BG4B 1ZHPA 4GLYA 3DFJA 4ISHH 1DANH 2FYRA 1ZMJA 2D26C 1A61H 1YPGH 2ZHFH 4M9FA 4AYYB 1LHEH 2FOMB 2UWOA 1GBKA 1SSXA 3LC3A 1LHGH 3GOVB 2ZDLA 1O3OA 2FOCA 2SGDE 5SGAE 4X6PA 2TGPZ 3SJ8A 4IMZA 1YF4A 1MTWA 3BF6H 2QV1A 2WPHS 2WV9A 3LU9B 4K8BA 4DIHH 1MQ6A 3BEUA 1DICA 1DWCH 2FTMA 1ETRH 3RLWH 1QFKH 5FPTA 2ZGCA 1JRTA 1ZSLA 3TK6A 2ZDVH 2P3FH 1EAUA 3MNSA 3U9AH 5CDFE 1MQ5A 3UIRA 1OWJA 3K9XB 3ZZDA 3L6PA 3KQDA 3QGNB 2Y5HA 4NZLA 4BTIB 2GZ9A 4TWWA 2BY9X 3QWCH 3PMJA 1SR5C 1SHHB 7ESTE 1E37B 3A88A 5CMXH 4ZHMU 4Q4LA 2WPDD 4O97A 1CHOG 4CBNA 4F4OC 2ZTZA 1UVUH 1UTKA 3A8AA 4NA8A 3RXHA 4ABHA 1MD8A 1KDQB 1FAKH 5FBIA 1K21H 5T6FA 2Z9IA 1E1QD 1AD8H 2P16A 1ELEE 1IOEA 4GAWA 1S6LA 2TPIZ 3AW0A 3Q3XA 5A0AE 1CHGA 3T29A 4ABAA 1ZLRA 5GJ4B 1CBWC 3FZZA 3LPRA 4J1YA 2BD4A 2OTVA 3A81A 2L6OA 3ZVEA 1O2OA 1D3QB 2FWWA 4U30A 2IPQX 2K0QA 4CRGA 3MYWA 1OXGA 2AEIH 5C1UA 1E38B 5C3NA 5C5NA 3E8LA 2VH6A 1BMMH 4O03A 1QURH 1P01A 4AB9A 3PLPA 2HLDD 1Y3UA 2G4UA 1A7SA 2HPPH 3SV2H 1GI5A 2AH4X 3GISB 3P92A 2KAIA 1AUTC 2BD3A 3OE7D 2BVRH 5T6DA 1P3EA 1V2OT 1C5LH 2J2UA 3FZDA 1TIOA 4OGXA 1S83A 1TA6A 2Z3CA 4GCHG 6CHAB 1TBRH 3KF2A 4X1SU 1ZZZA 1V2JT 3SORA 1TBZH 1O5AB 1XVMA 3SJKA 2QCYA 3C1KA 2RDEA 1BRAA 1GBFA 1SQAA 5FCRA 3QX5H 2GT8A 1HAVA 1J8AA 2WHXA 2JKHA 2AGEX 1FJSA 1NRPH 1PPZA 3BIVH 2EI8A 2TIOA 4XD7D 3UREA 1LQDB 3F2HA 2H9TH 1MU8B 3GYMA 5E2OA 2CF9H 5JDUB 3A89A 4Y8ZA 1F5KU 1U6QA 3M36A 2SGAA 2SGEE 1IAUA 5C17A 1O2HA 1G32B 1F5RA 1GL1A 1W11U 1WTGH 3UTUH 1TNLA 3V7TA 1G2LA 1KXAA 1GPZA 2WPLS 5B6OA 1H8ED 1W7XH 2ZGXH 1QZ8A 2OXSA 2A5AA 2OQ5A 2ODYB 1VITF 1GCDA 2PTNA 1AFQB 3V3MA 1OWIA 8GCHF 3SYJA 1E34B 3GCHB 3DCLA 3HK3B 4UD9H 1S85A 2VVCA 4DY7B 1BZXE 2C8WB 3BTGE 3A8BA 2GGVB 1KY9A 2UWLA 5JB8S 3PV4A 2JETC 2Z3EA 1RJXB 2ZIQH 1SI5H 1JOUB 2A31A 1AN1E 1AVXA 2G81E 3BN9A 3FO8D 5HMAA 2BY7X 4ABBA 5L2ZH 1OWHA 1QA7A 2ZECA 2PKSB 5AHGH 5EXNA 1HCGA 3QUMP 1UW7A 2CJIA 1P2QA 1ZSKA 1EASA 3TLOA 1J17T 2C93B 2P8OC 1L4ZA 5F8TA 3RMMH 2EY4C 1YPLH 1P11E 1O2WA 3TGKE 3F6UH 2R3UA 2KCOA 1ZTKA 2W3KA 3GDUA 3RU4D 3NKKA 1C2DA 1PYTD 1C9PA 2HGTH 1UVPA 2PV9B 2NU3E 3RLYH 2H9HA 1WCZA 4FUBA 1FNIA 4AGJA 1UO6A 2VGCC 2AHME 4BTTB 1TOCB 2CGAA 1ZRBA 1PPHE 2LP6A 2G4TA 1A0HB 5CHAC 1QBNA 3PO1C 5F03A 4CRDA 1GI6A 2BLWA 4A1VA 5DG6A 3PM3A 1BB0B 1SGDE 3ZIAD 2BHGA 3HKJB 4WMEA 1B0EA 3SZNA 3ZYDA 4HI3A 3SGQE 5EIYA 1N6XA 4I8LA 3FP6E 3GS9A 4NZQA 2FDAA 1ARCA 5J4SA 1KIGH 4BAOB 2QIQA 1DE7H 1BBRH 2V7QD 1H9LB 1C5QA 1LVYA 1Z8RA 2QE7D 5JYIA 3V13A 1H9HE 4NIWA 2GP9B 1J9CH 3SU1A 5T6GA 2Z9KA 1FPCH 3KQBA 5GPIB 4D76A 2AYWA 2G55A 1C2KA 4KTUA 1V2LT 4WVPE 2PP6A 3U1IB 1CO7E 1Y59T 1CHOF 1FLEE 1HXFH 1KLTA 2R3YA 4NIYA 2O8LA 5F8ZA 2VIOA 1TWXB 1K0HA 4BAQB 3BTDE 2ZHQH 3K65B 1JMOH 2ALPA 3ZV9A 1GBCA 5CE1A 1BDAA 1CGJE 4YOIA 4XBBA 1A46H 3A7XA 3DA9B 1HBTH 3Q3KA 2ZTXA 1ELCA 1HAIH 3A86A 4SGAE 2P95A 4KELA 2Z9JA 4Z0KA 5HYOA 2QC2A 3UOUA 2XW9A 1BTUA 1PPEE 5ABWA 4O3TA 1UHBB 5EQRA 1YCPK 2EQNA 2TGTA 4YT7H 5LPFA 2D1JA 3CS7A 4K69A 3F3BA 1QA0A 1DDJA 1YP9A 4AN7A 4BANB 1J14A 3LDXH 1MTSA 3ZZBA 2ASUB 3TH3H 2FOAA 4B73A 2YMSB 3V12A 4AG1A 1BTZA 4I8JA 4I8GA 1NC6A 2J95A 3BEIB 2QXHA 4GCHF 1BRBE 2PLXA 3MQKC 4CHAB 1LHFH 2BLQA 2FYQA 3D62A 3T26A 4X1RU 4F49A 4Y0YE 1F92A 2FESH 3M3SA 3CP7A 3LH1A 2Z3DA 3URDA 1XUHA 1C1NA 2BY5X 2V3HH 5HIZA 3N99A 3LIWA 2F9VA 2OD3B 1V2ST 2PHBA 3DSOA 1ESAA 1YPHE 1HJ8A 3LKWA 2XXLA 2FLBH 3UB0A 2A2QH 1KXBA 3RXMA 3E6PH 1UTMA 3LC5A 2VIWA 4B6FA 2BDIA 1JBUH 2Y6TA 4X8UH 1BMLA 1UK4A 3E0PB 1LCYA 2J9NA 4ESTE 2OC1A 2FM2A 5HM2A 4Q63A 1K1IA 2A4RA 4ZKOU 2KCPA 1C2JA 4FUJA 3S69A 3A84A 1P2OA 1G3CA 3OX7U 2F9BH 3B9FH 1NN6A 1G2MA 2BX4A 2GJGA 5GIBA 3RXOA 6CHAC 1D3TB 4UE7H 1ARBA 3UFAA 5AFZH 1G3BA 4LZ1H 1ESTA 1L1JA 1SLXB 1TGBA 1SLWB 2OC0A 3MOCA 1C5VA 1O3NA 4I7YH 5FX6A 1XVOA 1A2CH 2ESTE 3L33A 1FIWA 4X0WU 1W2KH 3FVFB 1TMUH 1FMGA 2VVVA 3RXPA 1THRH 4UFGH 5EQQA 2UUYA 1DWEH 1YKTA 4Y11E 2W7SA 1HLTH 1BBRE 3QTVH 1GCTB 1WXRA 1O31A 3A85A 1IQLA 1UTOA 1MBQA 5EXMA 4VGCC 4YTAA 3RMNH 2BMGB 3LGIA 3KN2A 1O3DA 1BOQA 1EX3A 3M7QA 4INHA 3SU6A 2NU4E 1O3PB 2ZHDA 2BDYA 5LPEA 1V6DA 1QL7A 1V2MT 1XKAC 3UQOA 4Z6AH 2F9UA 3MMGA 3EE7A 4YM9A 3F68H 4SGBE 4X1PU 1WBGB 1UCYE 1ZGIA 1HNEE 2B0FA 4UFDH 2PR3A 4GHTA 2W6JD 2SNVA 3BV9B 2R2MB 1HFDA 1THSH 2PGBB 3WWFA 3SNAA 1FI8A 1MAXA 1LMWB 4E06H 1BHXF 1F2SE 1TGSZ 1HAXB 1IQHA 4TY7A 3GY2A 1YC0A 3SUGA 2CF8H 3F0OA 2LELA 4TT3D 4YO9A 4BXWA 4WF8A 1A3EH 1C1SA 1K1OA 5EGMA 1A4WH 3TIUA 3EQ0H 4B2AA 4BAKB 2ZG0H 1Z8IB 3GDVA 1O2GH 1O3KA 3LJOA 1ZPBA 2AMQA 1GHVH 2SNWA 1BTXA 2Y80A 4X1QU 2GD4B 3EAJA 5C0TA 2LNCA 3DT0H 1B7XB 5BRRE 1FZZA 3ODFA 4J2YB 2AS9A 1GJ8B 3A7TA 5T1VA 1F0TA 1YLCA 1SBWA 2GMTB 3EA7A 2QXGA 2FPZA 1DSUA 2ZFQH 3M3TA 1O2QA 1AVGH 1FXYA 2P93A 3KNXA 5EJ1A 4K1EA 4D7GA 1A5GH 2GZ7A 5F8XA 1C5PA 5C67A 3U1JB 4ZROA 2BOKA 3MO3A 1TNIA 2GKVE 2OC8A 3B23B 1FONA 4YESB 3U98H 1GG6C 2FX6A 4FUGA 4AGKA 1MKWK 3D49H 2BM2A 3VB3A 3SUDA 4R8TB 4WXVA 5DGJA 1GJBB 1MZDA 1CT4E 2A4OA 2R2WU 4LK4A 1MTVA 1A1RA 2OCVB 1LPZB 1C2LA 1LTOA 2BVSH 3I77A 6ESTA 1AKSB 1HXEH 2QF4A 3FANA 1NTPA 2ZU4A 3P6ZB 2J98A 1CU1A 4IN1A 4XDEA 2ZDAH 4K8YA 1LDTT 4WH6A 5C20A 1P10A 7KMEH 1AB9C 1UTNA 1UTLM 3P17H 1SGFA 3WWBA 1GBDA 1Z1JA 1QQ4A 1HJAC 3IITA 4K3JA 4D9RA 4DJZB 2Q6GA 2UUJB 1O32A 1O3LA 2XWAA 1SLUB 4LZ4B 1P2IA 1VGCB 2BD8A 3QLPH 2XC0A 1UVOA 1KLJH 4K1SA 4OS7A 2VWOA 1GJDB 4K2YA 4MDSA 1PPGE 2R9PA 4FOUC 1GMHG 3TH4H 3P8OA 2A32A 5EOKA 1XM1A 3SI3H 3H09A 7LPRA 1QTFA 1H9IE 1HYLA 4IN2A 5A09A 2OC7A 1ZMLA 2VVUA 5GCHG 1BMNH 1J15A 2J4IA 3STJA 5C94A 2JIZD 4XRNA 2K8IA 2WINI 3MTYA 1YBWA 4JZDH 3RM2H 1WTHD 3VFEA 1A3BH 3FP8E 1IQKA 1OHHD 3GDSA 1V2RT 1PPBH 2Q6DA 1PQAA 2YOLA 3MWIU 4GVUA 1NBMD 3SNBA 1TQ7B 1GJ9B 1TONA 1SQTA 2XTTB 4CHAC 1YLDA 1SGIB 1IQGA 2UUFB 2BB4A 4ABGA 3MNBA 4I86A 1Z8JB 3RXJA 3ZZ8A 1SVPA 2GT7A 1GI8B 3UR6A 1XMNB 4AOQA 1SLVB 4AG2A 1O3CA 5DP7A 5EJLA 5C0UA 3LGWA 2BTCE 3DHKH 4UONA 3DSGA 3TK9A 4HFPB 3SZEA 1T8NA 1D4PB 1C1QA 1F0UA 4NSYA 3ELAH 1N8OC 2ANMH 1Z1IA 2F83A 3PYHA 3ZVBA 3FFGA 1UJ1A 1T8LA 2YMSD 1MABB 3ZYEA 2F43B 3M7TA 1UK2A 2AERH 1DT2A 2ZA5A 1G3DA 4ZUHA 3HATH 4IW4E 1RTFB 2G5VA 3OY5U 1GHAG 1GBJA 3F2GA 3GY8A 3RP2A 4I32A 3T28A 1QHRB 1V2NT 1EJAA 5FHTA 1DWBH 3B8JA 3CS0A 3Q76A 1V2WT 2BQ7B 4JZFH 2EC9H 2ZDMA 1QJ1B 3RXKA 1DVAH 1LVBA 3IWMA 2JH5D 2GZ8A 1TRYA 1O3HA 3MO9A 1RIWB 4WMDA 2ZGBH 2PKAA 2VH0A 5DK1A 2CXVA 3JZ1B 1L2EA 3BTTE 3BTHE 1V3XA 2P3UB 4FUHA 1O3JA 3R0FA 3RXGA 1DY9A 4RSPA 4CREA 1S6HA 4FU8A 1BQYA 1ID5H 3SNCA 2KZ4A 4Y6DA 1V2PT 4ACAA 3RXUA 2HOBA 4BOHA 1AFEH 3SQEE 1WV7H 1S5SA 1NESE 1C1MA 2Y82A 2FXRA 1OPHB 2SGFE 1GJ5H 2FOEA 3W95A 2BYAX 2FLRH 2CN0H 2XBVA 1QB6A 1VZQH 1HDTH 2VWMA 2WPIS 4HTCH 2WUBA 3R3GB 2ZPSA 2AGGX 4IC5A 3URCA 3H7TA 4AFSA 1SGTA 1QY6A 3D23A 1NROH 1OWKA 4X2XA 2W6ID 3A7ZA 2ZDKA 3PB1E 1O2JA 3AW1A 2OUAA 3SN8A 1S0QA 2ZU1A 1EPTB 3A7WA 2ZP0H 4MPWA 2C8XB 2H9EH 3ITIA 3RXFA 2IPHA 2CK3D 1LO6A 2I6QA 1ZJKA 1DUAA 1ANDA 3GICB 3SJ9A 1WOFA 4CRCA 4X2WA 1VCWA 2A7CA 3A82A 1ZPCA 1AKSA 1Y5BT 2BOHB 3TH2H 5DKMA 1FIZA 1PYTC 1TNJA 4NG9H 2XYAA 1TGNA 3ATWA 1C1WH 2B9LA 1ZOMA 1GMDG 2A7JA 1AI8H 1MKWH 1O5DH 7GCHF 2AGIX 1MZAA 1KXDA 3VB4A 1AIXH 2QF5A 1EOLA 4Y71A 3QZRA 3GCOA 2AIQA 1JXPA 1O5EH 2QY0B 1ELAA 1MMJN 2AIPA 2CHAB 2ZCKP 2BDAA 4ZHAA 2H1UA 1XUKA 4RI0A 2J92A 1GGDC 2RG3A 1DPOA 3OTJE 4IS5A 1O2TA 2B8OH 2P94A 1IQIA 3LGTA 1GI3A 5EPNA 1QCPA 1EAWA 1C1TA 2PFEA 3EA9A 1EZQA 1VITH 1BTHH 2R0KA 4ZAEA 1TNKA 2A5KA 3PMBB 1UTQA 3OYPA 4CH8B 1L4DA 1AZZA 2O8MA 1G3EA 5H4IB 5EJZA 1NM6A 3SHCH 1C5TA 2VIVA 2GX4A 4MPUA 4FUFA 2EI6A 3GY4A 2TBSA 4KP0A 1LKBA 1MKXK 1ZR0A 3MU8A 4XOJA 3HGPA 4B74A 1O30A 2VBCA 2GCTB 3SBKA 1WAYB 2WPMS 2HLCA 5PTPA 1HJ9A 4A1TA 1ABIH 2WV5A 2O8WA 3QN7A 1YPKH 4X6MA 4Z1MD 1AE5A 1Y3VA 2B7DH 3SGBE 2IN2A 5JBCS 1AWHB 5G4BA 3KYGA 5TCAA 1DSTA 5DP8A 3Q3YA 2G8TA 1QRWA 1TBQH 1K1NA 5JB9S 1RS0A 1FY1A 2W5EA 1LVOA 2Y7ZA 4TPIZ 1EB2A 1O34A 2O8TA 1DOJA 2R0LA 2V6NA 4O9VA 2I6SA 4K60A 3ZZ6A 5EXLA 3NZIA 1AO5A 4ISNA 4B71A 2TGDA 3VEQB 2HRVA 4AC9A 1W10U 1Z6EA 3NCLA 5IDKA 1KDQA 2ZO3H 4I8KA 3A80A 4Y7BA 1ANEA 3GY6A 5KEDA 1CA0C 1XXFA 4ZCNA 5I25A 4WJG2 1O2LA 5ESTE 1ABJH 3M35A 2JH0D 1O38A 1ETSH 3UPEA 4B1TA 4ZMAH 5JBAS 1C5WB 4ISOA 4Y0ZE 4U2WA 1TPAE 3BG4C 4I33A 1YM0A 4FUDA 1O3BA 1GHAF 1L1NA 1VR1H 2ZPQA 3BTKE 3RXVA 1TAWA 1MTNB 4DT4A 1EP5A 1T8MA 4NIXA 2SFAA 2C90B 3DUXH 3M61U 1TX7A 4AB8A 2BXTH 2OBOA 1O3EA 4I8HA 1FY3A 1G37A 1SB1H 2ZKSA 4A7IB 1ZGVA 1NRQH 3PTNA 3O8BA 1O3GA 1TX8A 4AORA 1CT2E 3RXTA 4Y8YA 3MHWU 1IQNA 3RC6A 3RMLH 1BMAA 2Z9GA 1P2MA 5FL7D 1EAXA 3MFJA 1Y3WA 1O2YA 1ACBE 3KL6A 2ZFFH 1DXPA 2V3MA 2J38A 3GCTG 1QJ6B 2CMYA 2FODA 3C27B 4NCYA 4BNRA 2GCHG 2ZNKH 4GPGA 4MPXA 1Q2WA 1C4Y2 1ZHMA 1K22H 4XFQA 2BQWB 4NWKA 3M5NA 3UY9A 5A2MH 4OM9A 1KXEA 3E90B 2OK5A 3LGYA 2FEQH 1XUGA 2VIQA 2ZU2A 2XBWA 1T31A 4HGCA 2KCYA 5FPSA 1FY8E 1W3CA 1SKYE 5E8EH 1SQOA 1V2QT 2ZGJA 3SQHE 1DY8A 1XUIA 4DG4A 2BX3A 2L74A 3O8DA 1TYNA 4B2BA 2ZFPH 3HK6B 1P02A 4ABFA 1SGRE 3KIDU 1GVZA 4INKA 5HGGA 1DUEA 4D9QA 1WQSA 1DLKB 2EI7A 2THFB 1K1JA 3SGAE 1QBVH 1PPCE 3KEEA 1SGPE 2HNTF 4FETA 4MTBA 4K1TA 1RIWC 1O5GH 2FX4A 1GDUA 2BQ6B 1H8IH 1EATA 1S84A 1O5BB 1HIAB 3T25A 2AMPA 1P8VC 1P12E 5DJ7A 2BD9A 1Z71A 1AZ8A 2UWPA 1EZSC 1OP8A 1BTYA 1TQ0B 2ZU5A 1GMDF 3N7EA 3Q77A 4KGAA 2H2ZA 4YOJA 2HALA 2QXJA 1GBHA 3UQVA 4Y8XA 1O2MA 1WSSH 2Y5FA 3LONA 3SU2A 8ESTE 1C5UA 1HAYB 2D8WA 4IGDA 2Z6BD 1BTWA 3QDZB 1KTTB 1ZRKA 2FTLE 3ATKA 3F9FA 1MCVA 1BJVA 2ANKH 4TSFD 4XSKU 2ALVA 4NSVA 3PWCA 1NFUA 3U8TH 2Z94A 4ISIH 1ZPZA 5HIYA 1CBWB 1TOMH 3A8DA 4ASHA 1KLIH 1MBMA 1WDIA 2Y7XA 3P70B 1GBAA 1P2JA 1C2IA 1IQMA 1SOZA 2ZQ2A 2J34A 2H5CA 4X2YA 1BTPA 1Z6JH 1ANCA 1AY6H 4A5TS 3KGPA 5IK2D 3PV5A 4NFEA 2ZQ1A 5KECA 1NZQH 5E2PA 5J4QA 5FBEA 3ZZCA 1PFXC 2HNTC 2ZFRH 1YCPM 1DFPA 3UNQA 2AFQB 3EYDA 1G36A 3NUMA 1ELVA 3NXPA 1GDNA 2VWNA 2D2DA 1AFQC 1CA8B 5LGOA 2QN5T 3VB5A 1QJ7B 2NWNA 3GCHC 1QL9A 1S0RA 3PROA 5A8ZA 3CENA 4RKOB 5AVDA 3RXSA 2ZHWH 2NU0E 2RA3A 2PW8H 1SFIA 1BRCE 1NU7B 1GHWH 2EEKA 2QYIA 4ABEA 1C5MD 1MKXH 1OYTH 5EU8A 5BPEA 5C2ZA 2BDGA 4X2VA 1GI7B 3OFND 1Q3XA 5EG4A 1O2XA 2GDDA 1K2I1 1C2GA 2PKSC 3BTWE 4DIIH 1C5ZB 3ZZ5A 1YWUA 1TB6H 3OAAD 1O2ZA 1ORFA 3UWJH 1UVTH 2JJ2D 1O3FA 1Q31A 4FUCA 2QF3A 3UUZA 3SV6A 1O2PA 1MUEB 1EXFA 2NU2E 1N6YA 1TRMA 4ZKNU 4KTSA 1MH0A 4UEHH 1TNHA 5A0BA 1MD7A 3S9AA 3U69H 1O39A 4DVAU 2Q6FA 1E35B 3EE0B 1GBTA 3U28C 1Y5UT 1DXWA 3EGKH 1NFWA 1TLDA 1O3IA 4OGYA 1X7AC 2FP7B 2ULLA 1K1LA 2CV3A 2A45B 3MH6A 1LHDH 4Q7YA 4YOGA 2JETB 3F1SB 4BAMB 1LKAA 1BA8B 1UHBA 4U32A 1CQQA 3T62A 3ZZ3A 3PTBA 4ZH8A 2TRMA 4NA9H 1TFXA 4WXIA 1SMFE 1D6RA 3RXBA 4ABIA 1AMHA 1LHCH 1XX9A 1C5XB 2O8UA 4AYVB 2RCEA 3P8GA 3ZVFA 2ILNA 1QB1A 1ETTH 4BAHB 3A7VA 2ZI2H 3AASA 3SOSA 1C2EA 1DX5M 4XE4A 1A5HA 2ANWA 5HKKD 2P8OB 3W94A 3SNDA 1O2NA 3UR9A 2G5NA 1GBMA 5K0HA 4DT7B 3MH7A 1Y8TA 3UOPA 4FVBA 2O9QA 4X8VH 5GNDA 4MPVA 2A0QB 1YCPH 2ODPA 4JYTA 2GCHF 4DURA 2XC5A 1OWDA 1SG8B 1L0ZA 4ZHLU 6LPRA 1XKBC 1V2VT 2ZPRA 1W12U 3ESTA 4Q7ZA 1EQ9A 3PMAB 2FOHA 1IQFA 4CRBA 2Y5GA 3P95A 4JCNA 2XBYA 4FU9A 1H8HD 3VXFH 1RTKA 3VGCB 5CHAB 3F9HA 3PO1B 2M2AA 1P09A 3WY8A 1O0DH 1Y5AT 3RC5A 4DCDA 2XRCA 1BUIA 2ZHEH 3LGUA 1O2UA 1SC8U 3K6YA 3AVZA 1QR3E 3SU3A 1TGCA 1HIAA
chains in the Genus database with same CATH topology
2EQNA 2HVYB 3U28C 3MQKC 2EY4C 2V3MA 2RFKC 3UAIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQN A;  2HVY B;  3U28 C;  3MQK C;  2EY4 C;  2V3M A;  2RFK C;  3UAI C; 
#chains in the Genus database with same CATH topology
 3RUO A;  5T3H A;  1OP2 A;  1CVW H;  1EKB B;  1DM4 B;  3QZQ A;  1VJ9 U;  1KMH B;  5E0G A;  2VU8 E;  1UK3 A;  3LOX A;  1KXC A;  1BJU A;  4IBL H;  1UTP A;  1WUN H;  3H7O A;  4P00 A;  3ZV8 A;  1QRX A;  2PSX A;  3VB6 A;  5DN6 D;  3NK8 A;  1QRZ A;  4YT6 H;  3MU4 A;  1C1P A;  1SOT A;  2Z9L A;  3WW7 A;  2ZC9 H;  2STB E;  5DP6 A;  1NS3 A;  4I31 A;  2PUX B;  1RGQ A;  1GBE A;  2YMS C;  3U8O H;  3M7U A;  5JPM H;  1GBB A;  2VNT A;  3RM0 H;  1P0S H;  1EZX C;  2WUC A;  3TJU A;  3PLB A;  1YPM H;  1TGT A;  2W7U A;  3S0N A;  3KQE A;  2A1D B;  1JIM A;  1GI4 A;  1T4U H;  1B5G H;  3SI4 H;  3PMH B;  1YY3 A;  3SW2 B;  1EJN A;  4OS4 A;  4Y10 E;  1ESB A;  2DE9 A;  2PTC E;  1W14 U;  3OEE D;  3SV7 A;  1T7C A;  3UWI A;  1NO9 H;  5A0C A;  1W7G H;  1ELB A;  2B5T B;  5JBB S;  3OU0 A;  4ABD A;  4U01 A;  3UNS A;  2QGR A;  1TAB E;  1DIT H;  2AMD A;  1A5I A;  1BBR K;  2BD2 A;  1G9I E;  3U8R H;  1IQE A;  1GVK B;  1CT0 E;  1TPO A;  1NFY A;  1C4U 2;  3KQ5 A;  3I78 A;  3KHV A;  1HV7 A;  4P02 A;  4CR9 A;  3E16 B;  5EOD A;  4BTU B;  3SU0 A;  3UNR A;  5B6L A;  1OYQ A;  4Q2K A;  2VIN A;  2ZFS A;  1Y3Y A;  2PUQ H;  3TJV A;  1GHY H;  1C5O H;  1O3A A;  1E36 B;  4WY3 A;  1BMF D;  2ZCH P;  3MH4 A;  1DS2 E;  1D3D B;  1P2K A;  3TGJ E;  2QXI A;  1IHS H;  2RFK C;  1A0J A;  2G52 A;  4CBO A;  1W13 U;  1CGI E;  1UCY K;  5GWZ A;  1T32 A;  1INC A;  2A2X H;  2IOT A;  2Q1J A;  3SJO A;  1D3P B;  1NFX A;  5JBT A;  4X8S H;  3SJI A;  5TJX A;  1NPM A;  1OOK B;  1LPK B;  1XXD A;  4TY6 A;  4LXB H;  2XCF A;  4F48 B;  1FX0 B;  3A83 A;  1ELD E;  3S9B A;  3E91 A;  4H42 U;  2NU1 E;  1FY4 A;  1WQV H;  1GCT C;  1OWE A;  1YLN A;  3OEH D;  3BSQ A;  1GDQ A;  1GJ4 H;  1GBI A;  4B76 A;  4AFZ A;  4MG3 A;  1NBM E;  1QB9 A;  2BVX H;  3HKI B;  4R0I A;  1P9S A;  3KQC A;  4FVD A;  4PRO A;  2FO9 A;  3M5O A;  2GDE H;  4CRF A;  1RRK A;  4QT8 C;  3MNX A;  1MTU A;  3TIT A;  5L30 H;  1C2F A;  4JZ1 A;  1MU6 B;  1EAI A;  5L2Y H;  1LVM A;  2PGQ B;  2OIN A;  5AF9 H;  2ZU3 A;  1ELG A;  3BTE E;  4H4F A;  2DE8 A;  5ESB A;  2BDB A;  3SUF A;  3O8C A;  1HRT H;  2ZF0 H;  4FU7 A;  5F6M A;  1PPF E;  1PQ7 A;  3SHA H;  2OQU A;  5C1X A;  1XUF A;  4HG6 A;  4KKD A;  4ACB A;  1GBL A;  1IHT H;  2ODQ A;  1C1R A;  1TPS A;  1O2I A;  5C5O A;  5FPY A;  1AHT H;  1O36 A;  1ZTJ A;  3MO6 A;  1QNJ A;  1SHY A;  4E7R G;  1E0F D;  4THN H;  5A8X A;  1Z8G A;  4MNX A;  1GL0 E;  4VGC B;  3HGN A;  3MU0 A;  1HB0 B;  1W8B H;  3AAV A;  4GUX A;  1K1M A;  2BDH A;  1YGC H;  1KXF A;  3OY6 U;  1THP B;  5DP5 A;  1NT1 A;  1OSS A;  3T2N A;  3UAI C;  4Q7X A;  4JK5 A;  4JYU H;  1SGY E;  1E1R D;  4JZI A;  1UVS H;  2Y81 A;  4Y76 A;  3Q00 A;  1AUJ A;  3ENS B;  4ZKS U;  3ZZA A;  4NGA H;  2FI4 E;  2GMT C;  3AAU A;  1NRS H;  4FUE A;  4ABJ A;  1W0J D;  1RFN A;  3IG6 B;  4ZKR U;  3TNS A;  1HUT H;  2XWB I;  3MNC A;  2WPK S;  2BY6 X;  2XOK D;  3RDZ A;  1CSO E;  1GMH F;  4JYV H;  4AFQ A;  2OBQ A;  1CGH A;  1P05 A;  3TK5 A;  1H1B A;  8LPR A;  1FUJ A;  2FOB A;  1AQ7 A;  2PSY A;  1N1L A;  1HGT H;  3ATM A;  1RD3 B;  1GHX H;  1P2N A;  2VB0 A;  5GCH F;  2FOG A;  1F0R A;  1K9O E;  1HAH H;  3K2U A;  5L6N H;  3PV2 A;  2BD5 A;  2BY8 X;  4IMQ A;  2WYJ A;  2A4Q A;  5CHB A;  2IJD 1;  5TCC A;  1YPH C;  3SU4 A;  1E79 D;  1NY2 2;  1GWA A;  2GV6 A;  2WPJ S;  3V0X A;  4JK6 A;  1GHB G;  3ZVD A;  2OLG A;  2EA3 A;  5GXP A;  1HAG E;  3VG8 A;  1WYK A;  1Y3X A;  4E05 H;  3CNR A;  3RXE A;  1SL3 A;  3QK1 A;  1GMC G;  1TMB H;  3A87 A;  1Z7K A;  1OX1 A;  1GJC B;  2HPQ H;  4FXG H;  1JIR A;  4ZXX H;  3VGC C;  1EFR D;  4ASU D;  2GV7 A;  2KFW A;  2RA0 A;  4M7G A;  5DP9 A;  1OS8 A;  2QA9 E;  4X6N A;  1T4V H;  3T27 A;  1G30 B;  1VGC C;  1P57 B;  2FMJ A;  1K1P A;  2V3O H;  3N7D A;  1F7Z A;  1GI1 A;  1GG6 B;  2P59 A;  5F53 A;  3SV9 A;  2A7H A;  2ZCL P;  1BHX B;  3TGI E;  1ZTL A;  2QAA A;  2ZGH A;  9EST A;  3LGV A;  1J16 A;  1GVL A;  1AE8 H;  2XCN A;  2Z7F E;  2P3T B;  1ZYO A;  2LPR A;  4NFF A;  5LH8 A;  4XBD A;  3DSP A;  2UUK B;  2C3S A;  3W1E A;  5DP4 A;  4RT0 A;  4X1N U;  2FZZ A;  3L3T A;  3ATI A;  8KME 2;  5DO4 H;  1HAP H;  1AB9 B;  3QGJ A;  5DPA A;  6GCH G;  3RU4 E;  1WU1 A;  1HJA B;  3TVJ B;  1O5F H;  3RXR A;  1C9T A;  4JMY A;  4TYD A;  1VJA U;  2FI5 E;  3ZVG A;  1UCY H;  4B75 A;  1IQJ A;  1EJM A;  2XC4 A;  2H5D A;  3JZ2 B;  1VCP A;  1PJP A;  2FS9 A;  4A1X A;  1TPP A;  3BTM E;  3FAO A;  1A0L A;  4YZU A;  3N7O A;  1ANB A;  3E3T A;  1FN8 A;  4AFU A;  4DW2 U;  2V35 A;  3SUE A;  1EZU C;  5EPY A;  4MNV A;  2VJ1 A;  4X8T H;  2XNI A;  2F9P A;  1GJ6 A;  3P8F A;  4NA7 A;  2FIR H;  1YPJ H;  3PRB A;  3QO6 A;  2FOF A;  5E0J A;  2J94 A;  4Y7A A;  4AX9 H;  2W3I A;  1GHZ A;  1O5C B;  1ZHR A;  3M37 A;  1EPT A;  2ZDN A;  4TWY A;  2C8Z B;  4Y79 A;  4UFF H;  2STA E;  4A6L A;  5FCK A;  1AGJ A;  1RXP A;  1C2H A;  5A8Y A;  2KR7 A;  4D7F A;  2JH6 D;  3OSY A;  1H8D H;  3D65 E;  1C5N H;  5ETX A;  1KYN A;  2M5T A;  3KCG H;  4JZE H;  1ELT A;  3MI4 A;  4OS1 A;  2J98 B;  2ZTY A;  2RDL A;  3MU5 A;  1UMA H;  4YLQ H;  4MLF B;  5DSF A;  3BG8 A;  3SO3 A;  4DOQ A;  2QF0 A;  5I46 H;  1JRS A;  3TPI Z;  3GY5 A;  1BRU P;  3ZZ4 A;  4A92 A;  3DD2 H;  4MNY A;  4Q80 A;  2BZ6 H;  3EA8 A;  4CRA A;  1C5R A;  1LQE A;  1GJA B;  2PWX A;  1SGF G;  1C2M A;  4RN6 A;  1N8O B;  5IYT A;  4B6E A;  2GVF A;  1AU8 A;  2BLO A;  3MU1 A;  3EDX B;  1TE0 A;  3ZVA A;  1BIO A;  3H5C B;  1HAO H;  1O37 A;  2ZWL H;  3I29 A;  1C4V 2;  3VB7 A;  1EOJ A;  4NIV A;  1FY5 A;  1XUJ A;  2VIP A;  2VID A;  3GCN A;  3BTF E;  2F9N A;  3A8C A;  2DUC A;  2SGP E;  1YYY 1;  1EP6 A;  1SPJ A;  5GDS H;  1B0F A;  1EB1 H;  2FS8 A;  3AK5 A;  1AVW A;  3M5M A;  3K6Z A;  1FN6 A;  3NPS A;  2C8Y B;  3E0N B;  2G00 A;  1F0S A;  1PQ5 A;  1O2S A;  1EPT C;  1TX6 A;  2GTB A;  1C5Y B;  4K5Z A;  3BIU H;  1M9U A;  3RXD A;  2F3C E;  3LT3 A;  3FOA A;  1V2T T;  2BZA A;  2JDI D;  1W0Z U;  1GJ7 B;  1O2V A;  1SGQ E;  2HVX A;  4RKJ B;  5K7R A;  1F5L A;  1ZJD A;  2H6M A;  1TNG A;  1H4W A;  4INL A;  4RT1 A;  3RC4 A;  2XBX A;  1GHB F;  2SGQ E;  5E0H A;  4LOY H;  3F2F A;  1KTS B;  4OS6 A;  3BEF B;  1QL8 A;  4HZH A;  1GMC F;  1K28 D;  3E1X B;  1HAZ B;  2A4G A;  1SGN E;  2ZFT A;  4O3U A;  3ZZ9 A;  4B2C A;  4UFE H;  2CHA C;  4MVN A;  4WH8 A;  1TA2 A;  1NRR H;  1SGE E;  3BTQ E;  1DLE A;  3NWU A;  1GI0 A;  3GY3 A;  3M5L A;  4OS5 A;  4D8N A;  3VXE H;  2FI3 E;  3FKS D;  3RXQ A;  4FUI A;  2F9O A;  4XBC A;  5HM9 A;  3ZVC A;  2ANY A;  2V0B A;  1D6W A;  3ATL A;  1SFQ B;  2KM0 A;  2YNB A;  2KX4 A;  3PLK A;  2J5U A;  3SV8 A;  2ZEB A;  5HXF A;  3PRD A;  3RU4 T;  4H6T A;  1CE5 A;  3QTO H;  1MAY A;  2VWL A;  3RMO H;  2PKA B;  1RTL A;  1QGF A;  4IC6 A;  4YXW D;  2F91 A;  3SNE A;  5FX5 A;  3F9G A;  5FAH A;  2GCT C;  1BIT A;  3P8N A;  3RXI A;  1FV9 A;  3RXL A;  1O33 A;  3TNT A;  2KAI B;  1GI2 A;  3PWB A;  3KYF A;  4NWL A;  1C5S A;  3O8R A;  1D9I A;  2OP9 A;  2C4F H;  3FN8 A;  4KTC A;  4F55 A;  1BT7 A;  3T5F H;  4YLU A;  1S81 A;  1C1O A;  1O2K A;  6GCH F;  2WSS D;  1HPG A;  1EUF A;  3LH3 A;  1MCT A;  1GI9 B;  1S82 A;  3RXA A;  1GGD B;  1P04 A;  4MQA A;  5KGO A;  4MNW A;  1VKY A;  1QQU A;  1COW D;  2BDC A;  1HAV B;  1L1G A;  5DP3 A;  1P06 A;  2A5I A;  3TU7 H;  3S9C A;  3GCT F;  4ZXY H;  2ZZU H;  3VPK A;  3F9E A;  3ODD A;  1UTJ A;  2W26 A;  3OTP A;  1SQR A;  1T8O A;  3ZZ7 A;  1LPG B;  1VCQ A;  1ZSJ A;  1FDP A;  1V2U T;  3TJO A;  5EW2 H;  2TGA A;  2VGC B;  1VIT G;  1KSN A;  1AWF H;  1C1V H;  1YPE H;  2XND D;  2BXU H;  8GCH G;  4WMF A;  1P03 A;  2WV4 A;  2HVY B;  3G01 A;  4CR5 A;  3S7K B;  2JJ1 D;  3GY7 A;  9LPR A;  5EQS A;  2F4L A;  1O35 A;  1PQ8 A;  4OS2 A;  1BCU H;  1TAL A;  5C1Y A;  2BLV A;  1S6F A;  2K1Q A;  2G51 A;  3DFL A;  1O3M A;  4GSO A;  5LPR A;  2WYG A;  1MTN C;  4AZ2 B;  4X6O A;  4CH2 B;  1QBO A;  3NRL A;  4WWY A;  7GCH G;  1JWT A;  4H6S B;  4UDW H;  1NU9 A;  1TMT H;  2HNT E;  3SU5 A;  3S7H B;  4DGJ A;  3STI A;  3M3V A;  1NRN H;  1OP0 A;  2J97 A;  4ISL A;  3RXC A;  4TPY A;  2HWL B;  1ELF A;  3HPT B;  3A7Y A;  3GYL B;  2BD7 A;  1FPH H;  5EW1 H;  1P9U A;  1FQ3 A;  1TRN A;  3F0P A;  2WZQ A;  3TJN A;  1FAX A;  2IJO B;  1QIX B;  1DWD H;  1CA0 B;  1C1U H;  2YNA A;  5AFY H;  1SGC A;  1W0Y H;  1W0K D;  4BXS A;  1O2R A;  1OKX A;  1P3C A;  1V2K T;  3LJJ A;  2KCA A;  3FP7 E;  4GHQ A;  4E7N A;  1ZMN A;  3MH5 A;  5FXL A;  3BG4 B;  1ZHP A;  4GLY A;  3DFJ A;  4ISH H;  1DAN H;  2FYR A;  1ZMJ A;  2D26 C;  1A61 H;  1YPG H;  2ZHF H;  4M9F A;  4AYY B;  1LHE H;  2FOM B;  2UWO A;  1GBK A;  1SSX A;  3LC3 A;  1LHG H;  3GOV B;  2ZDL A;  1O3O A;  2FOC A;  2SGD E;  5SGA E;  4X6P A;  2TGP Z;  3SJ8 A;  4IMZ A;  1YF4 A;  1MTW A;  3BF6 H;  2QV1 A;  2WPH S;  2WV9 A;  3LU9 B;  4K8B A;  4DIH H;  1MQ6 A;  3BEU A;  1DIC A;  1DWC H;  2FTM A;  1ETR H;  3RLW H;  1QFK H;  5FPT A;  2ZGC A;  1JRT A;  1ZSL A;  3TK6 A;  2ZDV H;  2P3F H;  1EAU A;  3MNS A;  3U9A H;  5CDF E;  1MQ5 A;  3UIR A;  1OWJ A;  3K9X B;  3ZZD A;  3L6P A;  3KQD A;  3QGN B;  2Y5H A;  4NZL A;  4BTI B;  2GZ9 A;  4TWW A;  2BY9 X;  3QWC H;  3PMJ A;  1SR5 C;  1SHH B;  7EST E;  1E37 B;  3A88 A;  5CMX H;  4ZHM U;  4Q4L A;  2WPD D;  4O97 A;  1CHO G;  4CBN A;  4F4O C;  2ZTZ A;  1UVU H;  1UTK A;  3A8A A;  4NA8 A;  3RXH A;  4ABH A;  1MD8 A;  1KDQ B;  1FAK H;  5FBI A;  1K21 H;  5T6F A;  2Z9I A;  1E1Q D;  1AD8 H;  2P16 A;  1ELE E;  1IOE A;  4GAW A;  1S6L A;  2TPI Z;  3AW0 A;  3Q3X A;  5A0A E;  1CHG A;  3T29 A;  4ABA A;  1ZLR A;  5GJ4 B;  1CBW C;  3FZZ A;  3LPR A;  4J1Y A;  2BD4 A;  2OTV A;  3A81 A;  2L6O A;  3ZVE A;  1O2O A;  1D3Q B;  2FWW A;  4U30 A;  2IPQ X;  2K0Q A;  4CRG A;  3MYW A;  1OXG A;  2AEI H;  5C1U A;  1E38 B;  5C3N A;  5C5N A;  3E8L A;  2VH6 A;  1BMM H;  4O03 A;  1QUR H;  1P01 A;  4AB9 A;  3PLP A;  2HLD D;  1Y3U A;  2G4U A;  1A7S A;  2HPP H;  3SV2 H;  1GI5 A;  2AH4 X;  3GIS B;  3P92 A;  2KAI A;  1AUT C;  2BD3 A;  3OE7 D;  2BVR H;  5T6D A;  1P3E A;  1V2O T;  1C5L H;  2J2U A;  3FZD A;  1TIO A;  4OGX A;  1S83 A;  1TA6 A;  2Z3C A;  4GCH G;  6CHA B;  1TBR H;  3KF2 A;  4X1S U;  1ZZZ A;  1V2J T;  3SOR A;  1TBZ H;  1O5A B;  1XVM A;  3SJK A;  2QCY A;  3C1K A;  2RDE A;  1BRA A;  1GBF A;  1SQA A;  5FCR A;  3QX5 H;  2GT8 A;  1HAV A;  1J8A A;  2WHX A;  2JKH A;  2AGE X;  1FJS A;  1NRP H;  1PPZ A;  3BIV H;  2EI8 A;  2TIO A;  4XD7 D;  3URE A;  1LQD B;  3F2H A;  2H9T H;  1MU8 B;  3GYM A;  5E2O A;  2CF9 H;  5JDU B;  3A89 A;  4Y8Z A;  1F5K U;  1U6Q A;  3M36 A;  2SGA A;  2SGE E;  1IAU A;  5C17 A;  1O2H A;  1G32 B;  1F5R A;  1GL1 A;  1W11 U;  1WTG H;  3UTU H;  1TNL A;  3V7T A;  1G2L A;  1KXA A;  1GPZ A;  2WPL S;  5B6O A;  1H8E D;  1W7X H;  2ZGX H;  1QZ8 A;  2OXS A;  2A5A A;  2OQ5 A;  2ODY B;  1VIT F;  1GCD A;  2PTN A;  1AFQ B;  3V3M A;  1OWI A;  8GCH F;  3SYJ A;  1E34 B;  3GCH B;  3DCL A;  3HK3 B;  4UD9 H;  1S85 A;  2VVC A;  4DY7 B;  1BZX E;  2C8W B;  3BTG E;  3A8B A;  2GGV B;  1KY9 A;  2UWL A;  5JB8 S;  3PV4 A;  2JET C;  2Z3E A;  1RJX B;  2ZIQ H;  1SI5 H;  1JOU B;  2A31 A;  1AN1 E;  1AVX A;  2G81 E;  3BN9 A;  3FO8 D;  5HMA A;  2BY7 X;  4ABB A;  5L2Z H;  1OWH A;  1QA7 A;  2ZEC A;  2PKS B;  5AHG H;  5EXN A;  1HCG A;  3QUM P;  1UW7 A;  2CJI A;  1P2Q A;  1ZSK A;  1EAS A;  3TLO A;  1J17 T;  2C93 B;  2P8O C;  1L4Z A;  5F8T A;  3RMM H;  2EY4 C;  1YPL H;  1P11 E;  1O2W A;  3TGK E;  3F6U H;  2R3U A;  2KCO A;  1ZTK A;  2W3K A;  3GDU A;  3RU4 D;  3NKK A;  1C2D A;  1PYT D;  1C9P A;  2HGT H;  1UVP A;  2PV9 B;  2NU3 E;  3RLY H;  2H9H A;  1WCZ A;  4FUB A;  1FNI A;  4AGJ A;  1UO6 A;  2VGC C;  2AHM E;  4BTT B;  1TOC B;  2CGA A;  1ZRB A;  1PPH E;  2LP6 A;  2G4T A;  1A0H B;  5CHA C;  1QBN A;  3PO1 C;  5F03 A;  4CRD A;  1GI6 A;  2BLW A;  4A1V A;  5DG6 A;  3PM3 A;  1BB0 B;  1SGD E;  3ZIA D;  2BHG A;  3HKJ B;  4WME A;  1B0E A;  3SZN A;  3ZYD A;  4HI3 A;  3SGQ E;  5EIY A;  1N6X A;  4I8L A;  3FP6 E;  3GS9 A;  4NZQ A;  2FDA A;  1ARC A;  5J4S A;  1KIG H;  4BAO B;  2QIQ A;  1DE7 H;  1BBR H;  2V7Q D;  1H9L B;  1C5Q A;  1LVY A;  1Z8R A;  2QE7 D;  5JYI A;  3V13 A;  1H9H E;  4NIW A;  2GP9 B;  1J9C H;  3SU1 A;  5T6G A;  2Z9K A;  1FPC H;  3KQB A;  5GPI B;  4D76 A;  2AYW A;  2G55 A;  1C2K A;  4KTU A;  1V2L T;  4WVP E;  2PP6 A;  3U1I B;  1CO7 E;  1Y59 T;  1CHO F;  1FLE E;  1HXF H;  1KLT A;  2R3Y A;  4NIY A;  2O8L A;  5F8Z A;  2VIO A;  1TWX B;  1K0H A;  4BAQ B;  3BTD E;  2ZHQ H;  3K65 B;  1JMO H;  2ALP A;  3ZV9 A;  1GBC A;  5CE1 A;  1BDA A;  1CGJ E;  4YOI A;  4XBB A;  1A46 H;  3A7X A;  3DA9 B;  1HBT H;  3Q3K A;  2ZTX A;  1ELC A;  1HAI H;  3A86 A;  4SGA E;  2P95 A;  4KEL A;  2Z9J A;  4Z0K A;  5HYO A;  2QC2 A;  3UOU A;  2XW9 A;  1BTU A;  1PPE E;  5ABW A;  4O3T A;  1UHB B;  5EQR A;  1YCP K;  2EQN A;  2TGT A;  4YT7 H;  5LPF A;  2D1J A;  3CS7 A;  4K69 A;  3F3B A;  1QA0 A;  1DDJ A;  1YP9 A;  4AN7 A;  4BAN B;  1J14 A;  3LDX H;  1MTS A;  3ZZB A;  2ASU B;  3TH3 H;  2FOA A;  4B73 A;  2YMS B;  3V12 A;  4AG1 A;  1BTZ A;  4I8J A;  4I8G A;  1NC6 A;  2J95 A;  3BEI B;  2QXH A;  4GCH F;  1BRB E;  2PLX A;  3MQK C;  4CHA B;  1LHF H;  2BLQ A;  2FYQ A;  3D62 A;  3T26 A;  4X1R U;  4F49 A;  4Y0Y E;  1F92 A;  2FES H;  3M3S A;  3CP7 A;  3LH1 A;  2Z3D A;  3URD A;  1XUH A;  1C1N A;  2BY5 X;  2V3H H;  5HIZ A;  3N99 A;  3LIW A;  2F9V A;  2OD3 B;  1V2S T;  2PHB A;  3DSO A;  1ESA A;  1YPH E;  1HJ8 A;  3LKW A;  2XXL A;  2FLB H;  3UB0 A;  2A2Q H;  1KXB A;  3RXM A;  3E6P H;  1UTM A;  3LC5 A;  2VIW A;  4B6F A;  2BDI A;  1JBU H;  2Y6T A;  4X8U H;  1BML A;  1UK4 A;  3E0P B;  1LCY A;  2J9N A;  4EST E;  2OC1 A;  2FM2 A;  5HM2 A;  4Q63 A;  1K1I A;  2A4R A;  4ZKO U;  2KCP A;  1C2J A;  4FUJ A;  3S69 A;  3A84 A;  1P2O A;  1G3C A;  3OX7 U;  2F9B H;  3B9F H;  1NN6 A;  1G2M A;  2BX4 A;  2GJG A;  5GIB A;  3RXO A;  6CHA C;  1D3T B;  4UE7 H;  1ARB A;  3UFA A;  5AFZ H;  1G3B A;  4LZ1 H;  1EST A;  1L1J A;  1SLX B;  1TGB A;  1SLW B;  2OC0 A;  3MOC A;  1C5V A;  1O3N A;  4I7Y H;  5FX6 A;  1XVO A;  1A2C H;  2EST E;  3L33 A;  1FIW A;  4X0W U;  1W2K H;  3FVF B;  1TMU H;  1FMG A;  2VVV A;  3RXP A;  1THR H;  4UFG H;  5EQQ A;  2UUY A;  1DWE H;  1YKT A;  4Y11 E;  2W7S A;  1HLT H;  1BBR E;  3QTV H;  1GCT B;  1WXR A;  1O31 A;  3A85 A;  1IQL A;  1UTO A;  1MBQ A;  5EXM A;  4VGC C;  4YTA A;  3RMN H;  2BMG B;  3LGI A;  3KN2 A;  1O3D A;  1BOQ A;  1EX3 A;  3M7Q A;  4INH A;  3SU6 A;  2NU4 E;  1O3P B;  2ZHD A;  2BDY A;  5LPE A;  1V6D A;  1QL7 A;  1V2M T;  1XKA C;  3UQO A;  4Z6A H;  2F9U A;  3MMG A;  3EE7 A;  4YM9 A;  3F68 H;  4SGB E;  4X1P U;  1WBG B;  1UCY E;  1ZGI A;  1HNE E;  2B0F A;  4UFD H;  2PR3 A;  4GHT A;  2W6J D;  2SNV A;  3BV9 B;  2R2M B;  1HFD A;  1THS H;  2PGB B;  3WWF A;  3SNA A;  1FI8 A;  1MAX A;  1LMW B;  4E06 H;  1BHX F;  1F2S E;  1TGS Z;  1HAX B;  1IQH A;  4TY7 A;  3GY2 A;  1YC0 A;  3SUG A;  2CF8 H;  3F0O A;  2LEL A;  4TT3 D;  4YO9 A;  4BXW A;  4WF8 A;  1A3E H;  1C1S A;  1K1O A;  5EGM A;  1A4W H;  3TIU A;  3EQ0 H;  4B2A A;  4BAK B;  2ZG0 H;  1Z8I B;  3GDV A;  1O2G H;  1O3K A;  3LJO A;  1ZPB A;  2AMQ A;  1GHV H;  2SNW A;  1BTX A;  2Y80 A;  4X1Q U;  2GD4 B;  3EAJ A;  5C0T A;  2LNC A;  3DT0 H;  1B7X B;  5BRR E;  1FZZ A;  3ODF A;  4J2Y B;  2AS9 A;  1GJ8 B;  3A7T A;  5T1V A;  1F0T A;  1YLC A;  1SBW A;  2GMT B;  3EA7 A;  2QXG A;  2FPZ A;  1DSU A;  2ZFQ H;  3M3T A;  1O2Q A;  1AVG H;  1FXY A;  2P93 A;  3KNX A;  5EJ1 A;  4K1E A;  4D7G A;  1A5G H;  2GZ7 A;  5F8X A;  1C5P A;  5C67 A;  3U1J B;  4ZRO A;  2BOK A;  3MO3 A;  1TNI A;  2GKV E;  2OC8 A;  3B23 B;  1FON A;  4YES B;  3U98 H;  1GG6 C;  2FX6 A;  4FUG A;  4AGK A;  1MKW K;  3D49 H;  2BM2 A;  3VB3 A;  3SUD A;  4R8T B;  4WXV A;  5DGJ A;  1GJB B;  1MZD A;  1CT4 E;  2A4O A;  2R2W U;  4LK4 A;  1MTV A;  1A1R A;  2OCV B;  1LPZ B;  1C2L A;  1LTO A;  2BVS H;  3I77 A;  6EST A;  1AKS B;  1HXE H;  2QF4 A;  3FAN A;  1NTP A;  2ZU4 A;  3P6Z B;  2J98 A;  1CU1 A;  4IN1 A;  4XDE A;  2ZDA H;  4K8Y A;  1LDT T;  4WH6 A;  5C20 A;  1P10 A;  7KME H;  1AB9 C;  1UTN A;  1UTL M;  3P17 H;  1SGF A;  3WWB A;  1GBD A;  1Z1J A;  1QQ4 A;  1HJA C;  3IIT A;  4K3J A;  4D9R A;  4DJZ B;  2Q6G A;  2UUJ B;  1O32 A;  1O3L A;  2XWA A;  1SLU B;  4LZ4 B;  1P2I A;  1VGC B;  2BD8 A;  3QLP H;  2XC0 A;  1UVO A;  1KLJ H;  4K1S A;  4OS7 A;  2VWO A;  1GJD B;  4K2Y A;  4MDS A;  1PPG E;  2R9P A;  4FOU C;  1GMH G;  3TH4 H;  3P8O A;  2A32 A;  5EOK A;  1XM1 A;  3SI3 H;  3H09 A;  7LPR A;  1QTF A;  1H9I E;  1HYL A;  4IN2 A;  5A09 A;  2OC7 A;  1ZML A;  2VVU A;  5GCH G;  1BMN H;  1J15 A;  2J4I A;  3STJ A;  5C94 A;  2JIZ D;  4XRN A;  2K8I A;  2WIN I;  3MTY A;  1YBW A;  4JZD H;  3RM2 H;  1WTH D;  3VFE A;  1A3B H;  3FP8 E;  1IQK A;  1OHH D;  3GDS A;  1V2R T;  1PPB H;  2Q6D A;  1PQA A;  2YOL A;  3MWI U;  4GVU A;  1NBM D;  3SNB A;  1TQ7 B;  1GJ9 B;  1TON A;  1SQT A;  2XTT B;  4CHA C;  1YLD A;  1SGI B;  1IQG A;  2UUF B;  2BB4 A;  4ABG A;  3MNB A;  4I86 A;  1Z8J B;  3RXJ A;  3ZZ8 A;  1SVP A;  2GT7 A;  1GI8 B;  3UR6 A;  1XMN B;  4AOQ A;  1SLV B;  4AG2 A;  1O3C A;  5DP7 A;  5EJL A;  5C0U A;  3LGW A;  2BTC E;  3DHK H;  4UON A;  3DSG A;  3TK9 A;  4HFP B;  3SZE A;  1T8N A;  1D4P B;  1C1Q A;  1F0U A;  4NSY A;  3ELA H;  1N8O C;  2ANM H;  1Z1I A;  2F83 A;  3PYH A;  3ZVB A;  3FFG A;  1UJ1 A;  1T8L A;  2YMS D;  1MAB B;  3ZYE A;  2F43 B;  3M7T A;  1UK2 A;  2AER H;  1DT2 A;  2ZA5 A;  1G3D A;  4ZUH A;  3HAT H;  4IW4 E;  1RTF B;  2G5V A;  3OY5 U;  1GHA G;  1GBJ A;  3F2G A;  3GY8 A;  3RP2 A;  4I32 A;  3T28 A;  1QHR B;  1V2N T;  1EJA A;  5FHT A;  1DWB H;  3B8J A;  3CS0 A;  3Q76 A;  1V2W T;  2BQ7 B;  4JZF H;  2EC9 H;  2ZDM A;  1QJ1 B;  3RXK A;  1DVA H;  1LVB A;  3IWM A;  2JH5 D;  2GZ8 A;  1TRY A;  1O3H A;  3MO9 A;  1RIW B;  4WMD A;  2ZGB H;  2PKA A;  2VH0 A;  5DK1 A;  2CXV A;  3JZ1 B;  1L2E A;  3BTT E;  3BTH E;  1V3X A;  2P3U B;  4FUH A;  1O3J A;  3R0F A;  3RXG A;  1DY9 A;  4RSP A;  4CRE A;  1S6H A;  4FU8 A;  1BQY A;  1ID5 H;  3SNC A;  2KZ4 A;  4Y6D A;  1V2P T;  4ACA A;  3RXU A;  2HOB A;  4BOH A;  1AFE H;  3SQE E;  1WV7 H;  1S5S A;  1NES E;  1C1M A;  2Y82 A;  2FXR A;  1OPH B;  2SGF E;  1GJ5 H;  2FOE A;  3W95 A;  2BYA X;  2FLR H;  2CN0 H;  2XBV A;  1QB6 A;  1VZQ H;  1HDT H;  2VWM A;  2WPI S;  4HTC H;  2WUB A;  3R3G B;  2ZPS A;  2AGG X;  4IC5 A;  3URC A;  3H7T A;  4AFS A;  1SGT A;  1QY6 A;  3D23 A;  1NRO H;  1OWK A;  4X2X A;  2W6I D;  3A7Z A;  2ZDK A;  3PB1 E;  1O2J A;  3AW1 A;  2OUA A;  3SN8 A;  1S0Q A;  2ZU1 A;  1EPT B;  3A7W A;  2ZP0 H;  4MPW A;  2C8X B;  2H9E H;  3ITI A;  3RXF A;  2IPH A;  2CK3 D;  1LO6 A;  2I6Q A;  1ZJK A;  1DUA A;  1AND A;  3GIC B;  3SJ9 A;  1WOF A;  4CRC A;  4X2W A;  1VCW A;  2A7C A;  3A82 A;  1ZPC A;  1AKS A;  1Y5B T;  2BOH B;  3TH2 H;  5DKM A;  1FIZ A;  1PYT C;  1TNJ A;  4NG9 H;  2XYA A;  1TGN A;  3ATW A;  1C1W H;  2B9L A;  1ZOM A;  1GMD G;  2A7J A;  1AI8 H;  1MKW H;  1O5D H;  7GCH F;  2AGI X;  1MZA A;  1KXD A;  3VB4 A;  1AIX H;  2QF5 A;  1EOL A;  4Y71 A;  3QZR A;  3GCO A;  2AIQ A;  1JXP A;  1O5E H;  2QY0 B;  1ELA A;  1MMJ N;  2AIP A;  2CHA B;  2ZCK P;  2BDA A;  4ZHA A;  2H1U A;  1XUK A;  4RI0 A;  2J92 A;  1GGD C;  2RG3 A;  1DPO A;  3OTJ E;  4IS5 A;  1O2T A;  2B8O H;  2P94 A;  1IQI A;  3LGT A;  1GI3 A;  5EPN A;  1QCP A;  1EAW A;  1C1T A;  2PFE A;  3EA9 A;  1EZQ A;  1VIT H;  1BTH H;  2R0K A;  4ZAE A;  1TNK A;  2A5K A;  3PMB B;  1UTQ A;  3OYP A;  4CH8 B;  1L4D A;  1AZZ A;  2O8M A;  1G3E A;  5H4I B;  5EJZ A;  1NM6 A;  3SHC H;  1C5T A;  2VIV A;  2GX4 A;  4MPU A;  4FUF A;  2EI6 A;  3GY4 A;  2TBS A;  4KP0 A;  1LKB A;  1MKX K;  1ZR0 A;  3MU8 A;  4XOJ A;  3HGP A;  4B74 A;  1O30 A;  2VBC A;  2GCT B;  3SBK A;  1WAY B;  2WPM S;  2HLC A;  5PTP A;  1HJ9 A;  4A1T A;  1ABI H;  2WV5 A;  2O8W A;  3QN7 A;  1YPK H;  4X6M A;  4Z1M D;  1AE5 A;  1Y3V A;  2B7D H;  3SGB E;  2IN2 A;  5JBC S;  1AWH B;  5G4B A;  3KYG A;  5TCA A;  1DST A;  5DP8 A;  3Q3Y A;  2G8T A;  1QRW A;  1TBQ H;  1K1N A;  5JB9 S;  1RS0 A;  1FY1 A;  2W5E A;  1LVO A;  2Y7Z A;  4TPI Z;  1EB2 A;  1O34 A;  2O8T A;  1DOJ A;  2R0L A;  2V6N A;  4O9V A;  2I6S A;  4K60 A;  3ZZ6 A;  5EXL A;  3NZI A;  1AO5 A;  4ISN A;  4B71 A;  2TGD A;  3VEQ B;  2HRV A;  4AC9 A;  1W10 U;  1Z6E A;  3NCL A;  5IDK A;  1KDQ A;  2ZO3 H;  4I8K A;  3A80 A;  4Y7B A;  1ANE A;  3GY6 A;  5KED A;  1CA0 C;  1XXF A;  4ZCN A;  5I25 A;  4WJG 2;  1O2L A;  5EST E;  1ABJ H;  3M35 A;  2JH0 D;  1O38 A;  1ETS H;  3UPE A;  4B1T A;  4ZMA H;  5JBA S;  1C5W B;  4ISO A;  4Y0Z E;  4U2W A;  1TPA E;  3BG4 C;  4I33 A;  1YM0 A;  4FUD A;  1O3B A;  1GHA F;  1L1N A;  1VR1 H;  2ZPQ A;  3BTK E;  3RXV A;  1TAW A;  1MTN B;  4DT4 A;  1EP5 A;  1T8M A;  4NIX A;  2SFA A;  2C90 B;  3DUX H;  3M61 U;  1TX7 A;  4AB8 A;  2BXT H;  2OBO A;  1O3E A;  4I8H A;  1FY3 A;  1G37 A;  1SB1 H;  2ZKS A;  4A7I B;  1ZGV A;  1NRQ H;  3PTN A;  3O8B A;  1O3G A;  1TX8 A;  4AOR A;  1CT2 E;  3RXT A;  4Y8Y A;  3MHW U;  1IQN A;  3RC6 A;  3RML H;  1BMA A;  2Z9G A;  1P2M A;  5FL7 D;  1EAX A;  3MFJ A;  1Y3W A;  1O2Y A;  1ACB E;  3KL6 A;  2ZFF H;  1DXP A;  2V3M A;  2J38 A;  3GCT G;  1QJ6 B;  2CMY A;  2FOD A;  3C27 B;  4NCY A;  4BNR A;  2GCH G;  2ZNK H;  4GPG A;  4MPX A;  1Q2W A;  1C4Y 2;  1ZHM A;  1K22 H;  4XFQ A;  2BQW B;  4NWK A;  3M5N A;  3UY9 A;  5A2M H;  4OM9 A;  1KXE A;  3E90 B;  2OK5 A;  3LGY A;  2FEQ H;  1XUG A;  2VIQ A;  2ZU2 A;  2XBW A;  1T31 A;  4HGC A;  2KCY A;  5FPS A;  1FY8 E;  1W3C A;  1SKY E;  5E8E H;  1SQO A;  1V2Q T;  2ZGJ A;  3SQH E;  1DY8 A;  1XUI A;  4DG4 A;  2BX3 A;  2L74 A;  3O8D A;  1TYN A;  4B2B A;  2ZFP H;  3HK6 B;  1P02 A;  4ABF A;  1SGR E;  3KID U;  1GVZ A;  4INK A;  5HGG A;  1DUE A;  4D9Q A;  1WQS A;  1DLK B;  2EI7 A;  2THF B;  1K1J A;  3SGA E;  1QBV H;  1PPC E;  3KEE A;  1SGP E;  2HNT F;  4FET A;  4MTB A;  4K1T A;  1RIW C;  1O5G H;  2FX4 A;  1GDU A;  2BQ6 B;  1H8I H;  1EAT A;  1S84 A;  1O5B B;  1HIA B;  3T25 A;  2AMP A;  1P8V C;  1P12 E;  5DJ7 A;  2BD9 A;  1Z71 A;  1AZ8 A;  2UWP A;  1EZS C;  1OP8 A;  1BTY A;  1TQ0 B;  2ZU5 A;  1GMD F;  3N7E A;  3Q77 A;  4KGA A;  2H2Z A;  4YOJ A;  2HAL A;  2QXJ A;  1GBH A;  3UQV A;  4Y8X A;  1O2M A;  1WSS H;  2Y5F A;  3LON A;  3SU2 A;  8EST E;  1C5U A;  1HAY B;  2D8W A;  4IGD A;  2Z6B D;  1BTW A;  3QDZ B;  1KTT B;  1ZRK A;  2FTL E;  3ATK A;  3F9F A;  1MCV A;  1BJV A;  2ANK H;  4TSF D;  4XSK U;  2ALV A;  4NSV A;  3PWC A;  1NFU A;  3U8T H;  2Z94 A;  4ISI H;  1ZPZ A;  5HIY A;  1CBW B;  1TOM H;  3A8D A;  4ASH A;  1KLI H;  1MBM A;  1WDI A;  2Y7X A;  3P70 B;  1GBA A;  1P2J A;  1C2I A;  1IQM A;  1SOZ A;  2ZQ2 A;  2J34 A;  2H5C A;  4X2Y A;  1BTP A;  1Z6J H;  1ANC A;  1AY6 H;  4A5T S;  3KGP A;  5IK2 D;  3PV5 A;  4NFE A;  2ZQ1 A;  5KEC A;  1NZQ H;  5E2P A;  5J4Q A;  5FBE A;  3ZZC A;  1PFX C;  2HNT C;  2ZFR H;  1YCP M;  1DFP A;  3UNQ A;  2AFQ B;  3EYD A;  1G36 A;  3NUM A;  1ELV A;  3NXP A;  1GDN A;  2VWN A;  2D2D A;  1AFQ C;  1CA8 B;  5LGO A;  2QN5 T;  3VB5 A;  1QJ7 B;  2NWN A;  3GCH C;  1QL9 A;  1S0R A;  3PRO A;  5A8Z A;  3CEN A;  4RKO B;  5AVD A;  3RXS A;  2ZHW H;  2NU0 E;  2RA3 A;  2PW8 H;  1SFI A;  1BRC E;  1NU7 B;  1GHW H;  2EEK A;  2QYI A;  4ABE A;  1C5M D;  1MKX H;  1OYT H;  5EU8 A;  5BPE A;  5C2Z A;  2BDG A;  4X2V A;  1GI7 B;  3OFN D;  1Q3X A;  5EG4 A;  1O2X A;  2GDD A;  1K2I 1;  1C2G A;  2PKS C;  3BTW E;  4DII H;  1C5Z B;  3ZZ5 A;  1YWU A;  1TB6 H;  3OAA D;  1O2Z A;  1ORF A;  3UWJ H;  1UVT H;  2JJ2 D;  1O3F A;  1Q31 A;  4FUC A;  2QF3 A;  3UUZ A;  3SV6 A;  1O2P A;  1MUE B;  1EXF A;  2NU2 E;  1N6Y A;  1TRM A;  4ZKN U;  4KTS A;  1MH0 A;  4UEH H;  1TNH A;  5A0B A;  1MD7 A;  3S9A A;  3U69 H;  1O39 A;  4DVA U;  2Q6F A;  1E35 B;  3EE0 B;  1GBT A;  3U28 C;  1Y5U T;  1DXW A;  3EGK H;  1NFW A;  1TLD A;  1O3I A;  4OGY A;  1X7A C;  2FP7 B;  2ULL A;  1K1L A;  2CV3 A;  2A45 B;  3MH6 A;  1LHD H;  4Q7Y A;  4YOG A;  2JET B;  3F1S B;  4BAM B;  1LKA A;  1BA8 B;  1UHB A;  4U32 A;  1CQQ A;  3T62 A;  3ZZ3 A;  3PTB A;  4ZH8 A;  2TRM A;  4NA9 H;  1TFX A;  4WXI A;  1SMF E;  1D6R A;  3RXB A;  4ABI A;  1AMH A;  1LHC H;  1XX9 A;  1C5X B;  2O8U A;  4AYV B;  2RCE A;  3P8G A;  3ZVF A;  2ILN A;  1QB1 A;  1ETT H;  4BAH B;  3A7V A;  2ZI2 H;  3AAS A;  3SOS A;  1C2E A;  1DX5 M;  4XE4 A;  1A5H A;  2ANW A;  5HKK D;  2P8O B;  3W94 A;  3SND A;  1O2N A;  3UR9 A;  2G5N A;  1GBM A;  5K0H A;  4DT7 B;  3MH7 A;  1Y8T A;  3UOP A;  4FVB A;  2O9Q A;  4X8V H;  5GND A;  4MPV A;  2A0Q B;  1YCP H;  2ODP A;  4JYT A;  2GCH F;  4DUR A;  2XC5 A;  1OWD A;  1SG8 B;  1L0Z A;  4ZHL U;  6LPR A;  1XKB C;  1V2V T;  2ZPR A;  1W12 U;  3EST A;  4Q7Z A;  1EQ9 A;  3PMA B;  2FOH A;  1IQF A;  4CRB A;  2Y5G A;  3P95 A;  4JCN A;  2XBY A;  4FU9 A;  1H8H D;  3VXF H;  1RTK A;  3VGC B;  5CHA B;  3F9H A;  3PO1 B;  2M2A A;  1P09 A;  3WY8 A;  1O0D H;  1Y5A T;  3RC5 A;  4DCD A;  2XRC A;  1BUI A;  2ZHE H;  3LGU A;  1O2U A;  1SC8 U;  3K6Y A;  3AVZ A;  1QR3 E;  3SU3 A;  1TGC A;  1HIA A; 
#chains in the Genus database with same CATH homology
 2EQN A;  2HVY B;  3U28 C;  3MQK C;  2EY4 C;  2V3M A;  2RFK C;  3UAI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...