3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
molecule keywords Disks large homolog 1
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
2A36A 4L9WA 4PQFA 3AVOA 4BFWA 5KDDA 5KPDA 1SVSA 2LJ0A 1MO5A 1E9EA 1IN6A 1DBSA 1Z22A 2HV8A 2R6AA 5AUQA 1Z6YA 3OIYA 4J9IA 1SVKA 2XSZD 4HAWA 3CQTA 2D62A 4KFRA 4JLMA 4TYPA 2O2OA 1N5JA 2VIIA 1SXJE 1QZXA 4OQNA 4C30A 1Q1BA 3OAAA 4C0SA 1XTRA 2D7DA 3CWQA 2GTOA 3LDAA 4HZUB 4EFMA 1K76A 1JEGA 3BXZA 4PHGA 1UG1A 4UNSA 4WA7A 3C15C 4TYQA 4Z8XA 2ZXUA 3VMFA 3PUXA 2RF0A 2JM8A 1VHLA 1VG1A 4EPXA 4D25A 2FOLA 2Q9CA 1ZM2A 3LAWA 1NI3A 2ATXA 2V54A 4BFYA 4BWYA 2C98A 3SHFA 3AGQA 4NHOA 4BPBA 1IXSB 1QWEA 2AKAB 2CSQA 4C7OB 2Z0MA 1COWA 3SBEA 1NN1A 2XTNA 4MGIR 4OK6A 1JB1A 2V1UA 4Q02A 1HUQA 2JLQA 2QN6A 1ABOA 3VNUA 5GVRA 2HSPA 5KSPA 4EJSA 2VBCA 4HVUA 2RGAA 4JJZA 3EPJA 5H8WA 1J8MF 4YXWD 3GLGA 4QOSA 3FHTA 2DHRA 2XZLA 1A82A 1ZD8A 2ZRDA 1T3LA 4HAUA 3BERA 1GOTA 3QKUA 3SZRA 1SRMA 1UJYA 4LI0A 4HVWA 1CR0A 1G20E 2CHGA 2D7CA 1CBUA 3HYRA 2CK3A 3VRZA 3IIKA 4Q21A 1OFIA 3SE0A 4KITB 3C41J 1ZSGA 1KK0A 2W2XA 2HUPA 2YOFA 4URZR 5FOXA 2CUDA 2QEQA 1T0JA 1KNQA 3CLVA 3K0FA 4MUBA 3VS2A 1DG1G 1E9FA 2BBWA 4NYIQ 4P4TA 4R2IA 3U7FB 4C7OA 3UWKA 1CJKC 2M0YA 1F6BA 2MMGA 2RKOA 1VECA 2WJVA 3BH6A 4QHTA 3M1IA 3WMEA 2P67A 2UZIR 2O8DA 1LS1A 4F93B 2J6FA 5JLJA 1E2EA 2MSEB 1Z6AA 5GJVC 2Q3FA 2ZQ5A 1J3TA 3NIBA 4Q9KA 3NXSA 4RTXA 4P4SB 3KJEA 521PA 4F7WA 4O2RA 2ZIAA 1YRAA 2O8DB 2J5XA 3DMDA 4G5QA 5TARA 3UMRA 2CVHA 4HVVA 3ZGXA 2D06A 1QG4A 2A3RA 5JRZA 1GILA 4KV9A 1Q1QA 2ZRHA 3NVAA 4DCSA 4HLCA 5H1YA 4AWXA 1JU5C 4QJ5A 1R10A 2UZ3A 1LB1B 2EYXA 3M0PA 1II8B 2MOXA 2GVDC 2WKPA 4QC2A 4QGHA 1Z0AA 2QAGB 5BWMA 1FP6A 2EQIA 2WKRA 4D4MA 4JLPA 4Z1MA 2V6IA 3OAAD 3CRMA 3VX4A 2WWWA 1D2EA 4KBGA 4CC3A 3GLFB 5GADl 1XX6A 4I81A 4DB2A 2ROLA 4GMXA 1XZQA 3T12A 2V7QA 1GUAA 3GJ3A 5BW8A 1JAHA 2ASEA 2BJWA 1X27A 3MWJA 2IT1A 2XXAA 1OFTA 2QAJA 3L8YA 1W2HA 1SKQA 3K70D 3N70A 4A2WA 4DXAA 3JZMA 1C9KA 2VF8A 1OIXA 2LQNA 3CPJB 1H3HA 2OILA 3KKPA 2FPDA 2FZ4A 3H86A 4OHXA 4QJ4A 2OT3B 4V0NA 3REGA 3M0QA 1E79D 3C5HA 3C16C 2AKLA 4ITRC 5CJ2A 3TNFA 3OF5A 3NMZC 3BWDD 3TSOA 4HZIA 3FGNA 2FMXA 1SHFA 4DLYA 3V4FA 1P6XA 1Z0KA 1WRBA 2J0VA 2DFKB 1JECA 2LJ1A 2DWOA 3NKVA 4B35A 2PCLA 2PEZA 1UFQA 2OLKA 1CTQA 2F55A 2B8TA 4KCGA 4BFVA 5DGXA 2H7VA 2IXEA 3EXAA 1Z2CA 4BLPA 3ETLA 3O8RA 2XJ4A 1YN8A 1ZRHA 1DARA 1SHGA 1Z6XA 2R44A 1S2MA 2WKQA 1KI3A 3TBKA 5DSZA 2WMOB 1PZNA 3PEWA 4WVFA 3W3ZB 4ERNA 1O87A 2VP4A 1WP9A 2XJ9A 2LWIA 4YDSA 2ZRAA 1DE0A 1PLKA 2A7QA 1ZC4A 2QQ0A 2FEIA 4L9SA 1XXHA 3H41A 4DSTA 2JLRA 1EWQA 3RSOA 3GFOA 4MKIA 3X1ZA 4BFZA 2QAGA 4LHWA 2DB3A 2FSFA 4ON9A 3WRXC 4PAMA 2DL5A 2JATA 2VP5A 5JZVA 2LQWA 1RI9A 3CO5A 5LB2A 3T1QA 3BIFA 1W36B 1ONBA 5KSYA 1GKIA 3RRZA 2ZR9A 5TMPA 4M2LA 2KXDA 3I92A 4Q9HA 4DUGA 1JPNA 2X77A 5CYOA 2A5GA 1VHTA 1UKYA 3NPFA 2C8VA 3BRWD 1KO5A 1ZINA 4OJKA 3CNNA 2J05A 2G0TA 1IJEA 3SS8A 1WYXA 4M4ZA 1QHXA 2L3SA 1U8YA 4JVMA 4TTPA 4YONB 4C0HA 1K9AA 2WICA 3SDZA 5FTKA 4RD2A 4EPTA 1W48A 4NZYA 4D4LA 3SEMA 1VYUA 3GLGE 3PUWA 2ANBA 4QBIA 2PNIA 4OMPA 2MIOA 1AZEA 1R6BX 1VMAA 1OKKD 4ZDWA 2ZRNA 1Z63A 2AXPA 3P26A 3VR6A 5FTLA 2RGNA 2RQTA 2C78A 1U5SA 2J0SA 4C4PA 5ANRB 4AD8A 5JBQA 1TAGA 2V1RA 4DLUA 3EA0A 4XSHA 1S1NA 4ORZA 2GEDA 4XVUA 2R6CA 4JLAA 4DZZA 1VG0B 1HYQA 4LV6A 4F4IA 3GBQA 1TQ4A 2LKCA 2VO1A 5JCZA 2GBLC 1DAIA 4F4CA 1BYUA 2C9OA 2ZE6A 3IGFA 3OIUA 1G9XA 3DDCA 4ZI3A 4Q1DA 1E2KA 3N2EA 2V9PA 3T1VA 4ZDIA 4TTQA 4M1OA 2GTJA 4PPNA 2XTMA 4P4UA 3GLHA 5B2ZA 3BS4A 2H57A 3TR5A 1I07A 4PC2A 1KIKA 3KL4A 3VKWA 5SZKB 4B74A 2L3PA 2J7KA 2D2EA 2YOGA 3ZD6A 4RTTA 5GJBA 4L16A 2OLJA 2VWFA 2KXCA 1OW3B 2PL3A 1AJEA 1I4TD 1TU4A 4G0NA 4QG7A 2HJVA 4ASUD 1YR6A 1SGWA 2NO1A 3I32A 3LRPA 5CLQA 2NUZA 3PQCA 2FH5B 4X8HA 3KKNA 1CJVC 4DVGA 4PFSA 3L82B 1EK0A 2R8RA 1XPOA 2J7PA 1KSGA 4S2EA 1XMIA 2WWYA 1F2UA 5AJZA 2ZSBA 3WYFA 2PMDA 5J5CA 2ZJBA 3PVSA 2DLPA 3GEIA 1FTSA 3LH5A 3NG1A 2H16A 4LHZA 3U3RA 1CLUA 4QXAA 4C0AC 3P32A 5EP2A 3AKDA 2KB0A 3KDSE 1U8AA 5JWOA 4HLUA 2HCBA 4YQFA 1GKYA 4RD4A 5FOVA 4AKIA 2DCUA 4B73A 3U44B 4IDQA 5JS7A 2IS2A 2QORA 4D0GA 4RCYA 2KRSA 5JHHB 5L3SA 721PA 1U06A 1X1RA 2FN4A 2AX4A 3KXLA 2FRWA 1FOEB 2CE7A 3VS5A 1LY1A 5LD2C 1Z0DA 4A4DA 2FFAA 1KI6A 2LCFA 3MWYW 4M1WA 1XEFA 4PQYA 4M1MA 2PLFA 3EHRA 1S1CA 1WXBA 1RW4A 2RGEA 4DDUA 3LV8A 3FHOA 4KFSA 1OIWA 5G53C 3ASYA 1UM8A 1XXHB 4AI6A 2PZEA 2R6FA 3TSZA 4V0OA 2IYUA 2WWHA 1TTTA 5AUNB 4G5SA 2XB2A 4MGZR 5C2JB 2M51A 2F2VA 2ZRCA 2GTPA 3I5SA 1AKYA 1R7RA 4MRVA 5LBIA 5FUYA 1G64A 3MJHA 3SJZA 4QGFA 3E70C 3W34A 1ARKA 4J9HA 2NWMA 2P5TB 2QPOA 4I1UA 1E69A 4BFSA 2IS1A 2GEVA 2G77B 2WZQA 4UKDA 1MOZA 3K9NA 4GT1A 1W70A 3NDBB 1CR4A 2RCNA 3K0CC 1BMFD 1ZCAA 4GOKA 1QHYA 4LUDA 1HE8B 1NIJA 2ZRJA 3JVVA 3HPQA 4BLSA 3X1XA 2KBTA 3EARA 4JLVA 1FFHA 4M21A 2EGCA 3W6OA 3QF7A 4DJTA 4EUNA 2E5KA 1E2PA 1HH4A 4PO1A 1TUIA 3P27A 1HA3A 3DL0A 2VP0A 1JI0A 5AJXA 2QT0A 5JSZA 5ECAA 5JI3E 2EW1A 4QHSA 3VR5A 3JV3A 1ZU5A 2I3BA 1U9IC 4B32A 3ZL7C 4Q4JB 4MYHA 1L2TA 1VCOA 3UG7A 2KE9A 2AHOA 1MO3A 3TLXA 4GPTA 3X1WA 4FI3C 4FMCB 3GLFA 1XJCA 2PX3A 4TZ0A 1Z8FA 1T9HA 1OYYA 4N0DA 1QCFA 1P2VA 2WOOA 4HEJA 4TSFD 4M22A 4DLVA 1Z2AA 2RAPA 2C95A 5IHNA 3CRRA 3KQLA 1EFUA 4D0NA 2XOKA 2ANCA 4TLDA 2A28A 2ZR7A 4GNKA 1MR3F 4F91B 2DFLA 1KSHA 4TQUS 1G3IA 5EJEA 2PT7A 4IDPA 2EPDA 4DEXA 5JRJA 1V1CA 2OFOA 2NO6A 2XNSA 1NN0A 5LPNA 1UJ0A 5TB5A 1A4RA 1SKYB 3A1UA 3BB4A 1AZGB 5KNCA 4GP7A 1J99A 2W6JA 2R62A 2GCNA 5DN6A 1WDTA 5FL7D 3IO3A 1SSHA 4DLTA 2NMVA 1E0SA 3W5IA 2IL1A 4JLBA 1GNPA 5DIFA 2RGGA 5FBQB 5HKKA 3IQLA 4E22A 1LF5A 1Q12A 1KMHA 2YWFA 1Q20A 3P4XA 1SXJC 2GJAA 2AR7A 3MWLA 4LBVA 3TW8B 1WIEA 2XTZA 1II0A 4AKEA 2CCGA 1GCQA 1OT3A 3H2YA 4BLTA 4GP6A 4CIDA 4Q00A 4M1YA 4M4SA 4QNRA 4PHHA 3IBYA 3EW9A 2GA8A 4DT1B 3THOA 1UUEA 2EW3A 5DLQC 3NDPA 4NYJQ 2W0SA 2EGAA 5JEDA 1ZD9A 1XEXA 3TK1A 3GJ4A 3K0FB 3ZIAA 1JJVA 4JJKA 2YHSA 2I4IA 3GCGA 2CK3D 3LVRE 3LBNA 4Q01A 1DAHA 1TF2A 1YR8A 4ILEA 4B47A 5IRCD 2OI3A 2WSMA 3WMFA 4Z51A 2WWGA 1E2JA 2OFXA 1OE0A 4V02A 1ZIOA 1P9RA 4NCJA 2H8HA 1UF9A 3A1TA 4EJSB 1NBMA 4WOPA 2C2HA 5EP4A 2ZE7A 1U81A 2JJ2A 1X43A 2O52A 4GLMA 2VSXA 3ND9A 5BN5A 4GBQA 1P9WA 1G8PA 4YMWA 4UJ5A 3AM1A 2R2AA 2BKUA 2ODBA 4PX9A 1IM2A 421PA 1M3CA 4KBFA 3RWOA 3SJBA 2NO9A 4WZ6A 1MABB 1NVVQ 2QTFA 4RZUA 4G5OA 4LJ7A 4B6FA 1AN0A 4DCVA 1P62B 3E5HA 3LFUA 4JBXA 3KQHA 1QHIA 1MV0B 1BB9A 4LYHA 3MUFA 3B9QA 1Z0IA 4A6XA 1GWNA 4B3XA 4A36A 1F2UB 1E32A 3C5CA 1UPTA 1WF3A 2W10A 2P6UA 2VVKA 1G7CA 4LPKA 5AUOB 4ABYA 5BN4A 1NVXQ 2YJTD 2D3WA 1RLPC 2H18A 5FTJA 1EGAA 3MSXA 2P6NA 4NPHA 1UDLA 4TT3D 3FB4A 5C46F 1EFHA 1LCKA 1H8HD 4MDFA 3Q7QA 4RTYA 3H0KA 1T0JB 2P3SA 3MAAC 3JVUA 1KO7A 3VRYA 5CIWA 2C5LA 3E1SA 2QP4A 2KNBB 2LMJA 1G3UA 221PA 2WBLC 1ZM9A 3CW2A 2OAP1 3GLGB 1IY0A 5FPKA 1Q57A 3LA6A 4F4JA 4M1KA 1NL3A 1CS4C 3BFVA 1H65A 4LZZA 3U61B 1FQJA 2FWRA 3H0IA 1UADA 5DI3B 4TYWA 5TDHA 2WWIA 5CDFA 4JZKA 1AZTA 1IQPA 2DNUA 4IIMA 1EX7A 2HLDD 4Q66C 1WXUA 4UNQA 1F60A 3THXA 3QI2A 3UMFA 3FE2A 3NC0C 4P31A 1W4CA 2PEYA 2EGEA 2J87A 2ZI6A 3FKQA 4Q4AB 1L4YA 1TMKA 4WAUA 1NY5A 1DELA 4J9EA 3AB3A 2REBA 3QXSA 4UNPA 2IS6A 1BH2A 4MYCA 1AA9A 1P60A 1GL5A 2IYTA 4BLOA 5EE1A 5F9FA 2JLZA 2JJ1D 4LNPA 1Z3IX 2KE5A 2DBKA 3F3YA 3FFBA 3CR7A 3Q72A 2ZU0C 1KTVA 2RQRA 2ZJ8A 3AKCA 3KTAB 3QKRA 4HB4A 4OI1A 3SU8A 2EVRA 3PVLA 1T0HA 3T06B 1Q3TA 2A78A 1YZUA 4QHYA 4ZNXA 1E9BA 1Z6GA 1N6OA 4Q9IA 2LX7A 3N5CA 2JGNA 2ZUCA 3WRYC 3RC8A 1ZUNB 2A08A 3U3MA 1MRNA 1FX0A 5C4GB 1KFZA 4IRUB 4EIWA 3I9QA 1KNXA 1GDDA 1QRAA 4CYMA 4LGMA 3WP1B 5FTMA 3TQCA 2ZRKA 4Y0VA 2QPTA 4LOAA 3B85A 1ZNYA 3LW8A 1UGVA 2CDTA 4NU0A 2YSQA 1JR3E 2ZAOA 4NCIA 4EFLA 4NH0A 1NLOC 2CLCX 2V4ZA 2VEDA 1IHUA 3O8BA 2FFHA 2BHRA 1WQ1R 2QU8A 5J4KA 1WBDA 2ZS8A 4DIEA 1B07A 1E6GA 5EE0A 1X86B 4CVNA 2EYYA 3CIOA 4JKIA 1SHKA 2GK7A 2JEOA 3DPUA 2CREA 4GZLA 1YZGA 4FCTA 4HUQB 1M7GA 1Q1EA 5HE9A 3IO5A 4QNMA 4RTVA 1E9SA 1VYVA 1SXJB 1WE2A 2AK3A 1TF5A 2XAUA 3MFYA 4JIMA 1SRLA 4PQRA 4FCVA 3RAPR 4B71A 4YMUA 2ZUDA 3EX7C 2XXAB 1A5TA 3TE6A 3NH9A 3U3OA 1ZYUA 4C2UA 2F6RA 2QT1A 1P2SA 4AC9A 1AEYA 3FVQA 2FGKA 4AG6A 3AVVA 1XOVA 1ZBJA 3PIRA 4EPYA 1X2QA 2FPEA 2H5EA 2R6DA 2FNAA 3RABA 2JLVA 2HXSA 5KNDA 5KU1A 2I1QA 5A0FA 1E0AA 4G5GA 1KI8A 1NYGA 5FWCA 1OFHA 3PJRA 2YT6A 5F98A 3AGPA 1IY2A 2GCOA 3H84A 2N46A 3FDIA 3HR8A 4AG5A 4MYTA 3AKYA 1IONA 4LPSA 3T1OA 1PV4A 4EPRA 4F38A 3FPAA 1TNDA 2DPXA 1JNYA 3QXCA 3B13B 1KO8A 1I4LD 3DZDA 3I8SA 4ZDJA 2IYVA 2PBRA 3ZD7A 4M9ZA 5EC7A 3HYTA 4C0QC 5FOWA 4PAOA 3OEHA 4QL3A 2GAAA 2W58A 2IWHA 4HDOB 2O8FA 4X8OA 2GESA 3RDPA 4B44A 2BBSA 5EXSA 1GAJA 2GK6A 3CB4A 4OHWA 4RD0A 1R5NA 1CJMA 2EFEB 1E2DA 4L8GA 4CC4B 1XMVA 4ZCMA 3GJ0A 1W49A 4LJ9A 4NDZA 5A5GA 1UECA 3GJ5A 4TMZA 3LQQA 1VIYA 3GLIB 2LP5A 2H92A 4JJBA 3RRYA 5CDFE 4JYCA 4D2IA 4PXAA 4OJQA 2GNCA 4UJ3A 1I1JA 4W5HA 2ZANA 3VR4A 1MO6A 4DRZA 4KLZA 1S9DA 1SHZA 4DB4A 2WMNB 5FBLB 1JQQA 1CF4A 1KSJA 3MD0A 1FP7A 3KFVA 1NN5A 3PEUA 4PC1A 2GF0A 2VRWA 1CKBA 3A1SA 2QTHA 1G8FA 1YZNA 2OCPA 2HT1A 2YWGA 2GXSA 2O0JA 1OEBA 2C04A 3BB1A 2HBWA 1OFUX 1M74A 1G21E 4HLQB 4Q7JB 1BBZA 3HR7A 4FN5A 3ZDQA 3NTUA 4GOJA 1AD5A 4IXMA 1S3SA 4P32A 5EE9A 2JXBA 3Q5EA 1XRJA 4R2HA 3U2QA 3H0FA 3THWA 1RYFA 121PA 2F2XA 4PHTA 5TY0A 2JLWA 3J81k 3KB2A 3BH0A 2VH5R 3P4YA 2IYRA 4IW3B 1QBKC 2QMEA 2QNRA 3FTQA 1VPLA 3RC3A 4V0KA 4N0EA 1W6XA 3FYHA 5AJYA 2G9NA 4A1FA 2JDID 2J6KA 2SRCA 4QKQA 1DS6A 2HYIC 5IT5A 3W90A 5HCNA 1QF9A 4QT7A 4ZKDA 1N25A 1XJ0A 3UA6A 1DAFA 4D0LB 5EE3A 1NMYA 3RLFA 1T3SA 3RRMA 3C0CA 1OIVA 2VP2A 4DDTA 3R7WB 3VS3A 2IUSA 1N6IA 2GJSA 2Q3MA 1KI9A 3VU9A 3BGWA 1FQKA 2G3YA 2QSYA 1HY3A 3EWAA 5L3VA 1OHHD 2E87A 3NBYC 2L3QA 4KODA 1RRCA 4A6PA 3PV0A 2J45A 3THYA 2QGNA 1T8UA 4FMDF 4I1VA 5D3QA 1VA7A 4HB2A 3LNCA 3LXXA 5EP1A 4YMTA 3QF4A 5F3WB 3ECCA 3E2IA 5CJPA 1UHFA 3QOFA 3VQTA 1E96A 3EZ9A 3BBPA 5KO2A 2QBYA 3CWZA 1BKDR 1FUUA 3CX7A 1II9A 2Z6VA 1G5TA 4K11A 1PLLA 1HJDA 2WSSD 2YVUA 3WNCA 3RS4A 2ZS9A 3KZ1E 1EFRD 4GL2A 5HZHA 3AP1A 2WAYA 1BYIA 1GRIA 2RHMA 4OL0A 4A2QA 1XCMA 2OCAA 4CRWB 4C0KA 1GZSA 3NWJA 3ZVMA 2RQVA 1UE9A 3QG1A 4OQLA 1PVOA 1SQ5A 3WBJA 4ACAA 2JLYA 1Z9ZA 4Q7MB 4ARZB 4TMWA 4QRHA 4R71A 4NONA 4KVGA 1HSQA 5IXFA 1QHHA 4Q18A 1OB5A 3ZZUA 4B3DA 2DF6A 2QGZA 1E4VA 3TKLA 2AZVA 2IBMA 4IOMA 2ZITA 1DADA 4PR0A 2J41A 3CUEF 3EIHA 2XNDD 2O8FB 4RD3A 4AG1C 3DVLA 2CEAA 1Q0UA 4R98A 1U9IA 1MABA 2VHUA 3MRSA 3VS4A 1KDOA 1G41A 3AP3A 2J1LA 3TAHA 1XD2A 4HXJA 1KSWA 3EWSA 2Q3HA 5DE3A 1N6KA 3I62A 3BK7A 1FUKA 2RQUA 2BZ8A 2FG0A 2RH5A 2O0HA 1XMJA 1YHNA 2BWJA 2DYKA 3U6KA 4AFQC 4RTWA 1W0JD 5JECA 4RUGA 1NMXA 1U98A 2GAOA 2QE7A 4X8LA 2JLUA 1DAKA 1AWWA 4LN2A 2WOJA 2JT4A 5TVKA 3CBQA 1CSKA 2ZRIA 1P61B 1XTJA 1JR3D 2WHXA 3WY9A 3BE4A 2QP3A 1IBRA 5B64A 2ZYVX 2YWHA 1VG8A 1LV7A 3GD7A 4E5UA 2CH4A 5LDDC 2G6BA 4I4LA 4CEIB 1Z9QA 3PE0A 1G8GA 1X6GA 5UKDA 1SXJA 4GMDA 3VAAA 3A37A 3REAB 4Z1MD 2BCGY 4URYR 3Q7PA 2EU8A 4JKYA 4NP6A 1NLPC 2ZSFA 4JJDA 3UKDA 2OXCA 3A4MA 4GSYA 4TL7A 2KWIA 2IEZA 3DO6A 3SI7A 1M6NA 2V55B 3SYNA 2KEAA 1R4AA 4CW7A 1CRPA 3K70B 5JI2E 1G18A 1GKUB 4DIDA 4CF7A 3GP8A 1G4UR 1HQCA 3MMPA 3RS7A 3WXMA 4B76A 2D2FA 3IPYA 3QVVA 5KOYA 2ED1A 1S9HA 4LJ4A 1G6OA 4PANA 1WCV1 1UKVY 1RFLA 3PENA 2W2TA 2K3BA 4LBZA 1AK2A 3U7GA 1BOFA 2A5YB 4NKRA 5J4LA 4OQMA 3U6BA 3FOZA 1E0JA 1NG2A 4N3NA 1F5NA 2DL8A 1C1YA 1GSIA 5DH9A 4TTRA 2O9SA 2AXNA 3G5UA 5HCKA 1M34E 2PJZA 2VSOA 5KPJA 1W36C 4AFUC 1G3QA 3SEAA 2ZREA 3LWNA 1D9ZA 2N1BA 4ZIRB 2JS2A 2KRNA 1OV4A 5GJWB 1FMLA 4PHFA 1WB9A 4F17A 5BQ5A 4JBYA 5DHAA 3EC2A 1G7TA 4Q1CA 4RD1A 1QVAA 2QI9C 3TJZA 1G2BA 3TUJC 2QROA 2R6GA 2DL7A 2YV5A 4FIDA 1AM4D 5JS8A 4U00A 2F1JA 1OLOA 4ESRA 4UXJA 2PZ1A 3W9YA 5EQTA 3FJ5A 1GFDA 1IXRC 1DVRA 3DKPA 1ESMA 1W47A 3AVQA 4Q03A 4OK5A 4HUTA 3AVTA 1US8B 4DEYA 2OM2A 1JR6A 1Q22A 4E09A 3IPXA 4U7DA 2ZVQX 2IYQA 3IQXA 2FPKA 4DSOA 1ZW6A 1J7KA 2L0AA 1W7AA 3QWYA 1HURA 1RYHA 2GRJA 3B8HA 4QBHA 1R0YA 2FF7A 3WNDA 3K0AB 5E4FA 4IOLA 4V0LA 3RNLA 3HPRA 3RWMB 1W1WA 5M04A 3R8FA 2O8EA 2J0UA 3BOSA 4BASA 2QMUA 4M9XA 4ZKEA 1NMZA 1WLPB 5L3QA 1WXTA 1TADA 1N0WA 1XD9A 4DCNA 4ESVA 3SN6A 1US8A 4EDHA 3D7MA 2REOA 5K8TA 3I8XA 2NIPA 4OKSA 3QKSB 5L8VA 4M9QA 4B75A 3U7HB 2KRMA 2ZJZA 2C0TA 3KUDA 3B82A 2OZEA 3AF3A 2ZVPX 2F9MA 2V1QA 4XOIA 1XP8A 1ELOA 3OESA 1F3OA 4P0TA 2KROA 1W2GA 2A5JA 2B7CA 3HWSA 3IDQA 2V7QD 4DLWA 4AY2A 3CONA 3C8UA 3GLHE 2D1XA 2ZRLA 4URUR 5FWBA 1ANKA 1R8SA 4HAXA 2JJ8A 1ZUKA 1NVVR 5JCPA 3RHFA 1J90A 2RN8A 4OHYA 4KO8A 1S8FA 1KGDA 5FOSA 1SVMA 3F0TA 3OEED 3R9WA 1ABQA 1D5CA 1I4DD 1KZ7B 1N5ZA 5L3SB 2J0QA 4Z8YA 2AN9A 4GRAA 2J3EA 3IKJA 2AD1A 2AK2A 1ZNWA 4QGAA 4EQ6B 3M0TA 2NZ8A 2GF9A 4P4SA 1S4QA 4TN1A 4LCBA 1I2DA 3K1JA 4O25A 5I22A 4V03A 1ZAKA 2Z5FA 1P2TA 3AVPA 2X2FA 4TMTA 4WW0A 3UXMA 2KR3A 1R5BA 1GM5A 4OMOA 2AD5A 3OIVA 3MJRA 1C4OA 2AFHE 3CF0A 4J9BA 1IXZA 1HTWA 1PNJA 2CT4A 1U0HC 2DWPA 3M4YA 2IUTA 2ZI5A 4WBSA 4F14A 2EWWA 4JS0A 4LBYA 5CM8B 5ELXA 1OJLA 1KZGB 2QRZA 4ACBA 1CR2A 1Y57A 3SJCA 1SULA 1WA7A 4Z88A 4W7SA 1U2RA 2F3RA 5P21A 4KJZA 1G7RA 1F48A 2BMFA 3CRQA 1CKAA 3EZFA 3ZVNA 2ZSEA 1VG9B 4NCKA 2GCOB 4RTUA 4NMMA 5CITA 4FSSA 2DFTA 5IHKA 5FUVA 2O8BB 4CT4B 2EFGA 1CJUC 5FUXA 2HEQA 3ZS9A 2A2ZA 2RQWA 3B1ZA 2RGCA 1GRNA 4GFDA 3QEOA 5FPHA 4DDVA 1EESA 4Q1FA 1R0XA 4NL4H 4B6EA 1W0JA 4LDJA 3VR2A 1G5PA 2IC5A 4OMQA 3TUZC 4CC7A 2QTVB 1E9CA 5AJVB 3ZQ6A 1E94E 3EC1A 1XMSA 2JDIA 2ORVA 1SVWA 5IK2D 2FPFA 2ZJYA 3LLMA 4W9MC 3TMKA 1QHSA 4RVCA 2CVFA 2VLIA 5SZIA 4ESHA 4JVLA 3EPHA 1QWFA 1KY2A 2CBZA 2XZPA 1TUCA 3HP1A 1H8KA 1F2TB 4LHYA 3CRVA 1G1MA 5KDLA 2ERXA 1E98A 1VTKA 2ZJ2A 2O8EB 1EXMA 4TLAA 1JALA 3EIQA 4KI0A 4B33A 3ZVLA 2P65A 4MYUA 4C0LA 2OV2A 4PZLA 1QHHB 4JPBW 1X3SA 1ZU4A 3H4MA 5J40A 4EKDA 5FH9A 4QM6A 1VCNA 1D9XA 3EIEA 3OEHD 1E9DA 4PPFA 4RFSA 4WZAE 2QZ4A 1AZSC 3A1VA 1N6NA 3F8TA 3I72A 2DR3A 2PTKA 4R0KA 3PUVA 2IF2A 2JLXA 3NBXX 1LVGA 2CLDX 4KYIB 3QXJA 1AS2A 4HSEA 4JYBA 1SPKA 1W0KA 2RGNC 3CR8A 3K09A 4XH9B 2YKGA 1NRJB 3M0UA 3VKGA 2WSSA 2FPLA 1MUZA 1E1RD 1X1SA 1N6HA 1NLZA 1ZJ6A 3DM5A 4TWZA 3SOPA 3T5GA 4IFEA 4OI2A 2QUZA 4NYIR 2JIZD 4KHZA 1DAGA 2QM7A 1KDRA 3KQUA 1KI2A 4US2R 1EFTA 4Q4HA 2A5DA 1UEJA 4TL8A 4JLKA 3BC1A 2JJ1A 4M1SA 4BEJA 2BIFA 3AUYA 1XBTA 1DPFA 1OF1A 3GEHA 4IDHA 3SQWA 1UKEA 3KTAA 1YJ5A 1K0XA 1YVDA 3WYAA 4FD2A 4FMDB 1TG0A 1WI7A 1GRRA 2H1LA 4PPQA 5BYJA 621PA 2EBPA 1RJ9B 4TSFA 2CT3A 4Z54A 1YZQA 3VS1A 4HB3A 2JA1A 1YKSA 4JL5A 4B2PA 1IN5A 1W4BA 4TYYA 3P20A 1SZPA 1WA5A 3RS3A 1RPZA 3SYLA 2ZSDA 4OQFA 1CIPA 1M2OB 2QPAA 3L0PA 2PZGA 2NPIA 2BMJA 3QSYA 1D6JA 4ZPXA 4LV5B 3ZS8A 5JMTA 3K8YA 3TAUA 2IHYA 4LYJA 1P72A 4V0ME 5J4YA 1XFAA 4LY6A 4GDFA 2WJGA 2J9RA 5LD2B 2FRYA 2O5VA 3B1XA 4R9UC 2ZE8A 2B8WA 2EFHB 2WJYA 1NNEA 2Z83A 2NTYC 3GLIE 3V9PA 1X69A 1OXVA 1BIFA 4LUCA 2Z4RA 2F7SA 3VS6A 3AVUA 4PC6A 2HCJB 3KKOA 2IK8A 2OUKA 2ZRMA 5CB6A 4BFTA 1M7HA 5IF9A 3HU1A 4KU4A 2BJVA 4JJCA 1UBEA 2ZPTX 2IIMA 3EAQA 2V1XA 4G01B 4CC2A 3SJAA 5L3RA 4ZIRA 2ENMA 2DRMA 3I61A 3Q3JB 2YUOA 1PLJA 4LK2A 2W6IA 4L15A 5CM9C 1RRFA 3FMOB 2FSGA 1DOAA 2QA5A 4CT5A 2VYFA 2CCJA 1VYTA 1E99A 2X8AA 4UXIA 5C4MA 2O8CA 4QM7A 1KJZA 2PLRA 4YMSA 4HI0E 1X8KA 4IOKA 2KT8A 4PPGA 2P5SA 1UJ2A 1LFDB 5FPTA 3PUZA 4LV8B 1AOJA 4DCTA 4KSCA 4P33A 1AQYA 1L7VC 1VCIA 1N6LA 4LJYA 2RNAA 4DCUA 4MUAA 4BGDA 4KRTA 2EYUA 2F9LA 1DO2A 4CEHB 1RE0A 4BE7B 4LUEA 1KY3A 2KJQA 3PITA 5BYKA 1X2KA 2L2PA 1G291 2CJWB 3IILA 3OIWA 2G88A 2GJ9A 2KI5A 2J59A 1AS3A 4B34A 3OE7D 4C0BA 1XTSA 2WTUA 3PG5A 4TLBA 1NG9A 5EP3A 2CNWA 2D8HA 4WCIA 1TQ2A 1YQTA 2B6HA 1BO6A 2OSBA 3B1YA 4RZ3A 2DRKA 2VP9A 2AWOA 4TQ9A 1AGRA 2JMAA 3AVWA 3CPHA 2XMFA 2K9GA 3KQNA 4EFNA 2G6FX 4G5RA 2QBYB 4HDCA 5FBVB 3IIJA 1KDPA 2FFBA 3BJIC 3K09C 4AK9A 4AFSC 1RVDA 4Y92A 4BFXA 3EPLA 1FW6A 1L4UA 1RLQC 2G83A 2XITA 5FPSA 4U02A 2HCKA 2ECZA 1N0VC 2BDTA 1NLYA 1AWOA 3K9HA 2IX3A 1G7SA 3UPUA 2EKHA 2P2LA 4JL6A 4J9DA 1DEKA 3AQ4A 2BMEA 3AVXA 4DBLC 3IEUA 1D8TA 1KKMA 3U23A 2FSHA 2JCSA 2TMKA 2MMCA 2ZU6A 3IBGA 4JLJA 1A2KC 1T6NA 3WP0A 2B92A 3SFVA 5HZKA 2IYZA 2YNMA 3QE0A 4TMVA 3EG1A 4M9SA 3ND8A 4CEHA 1EWRA 5DNYB 2LJ3A 3ICEA 4Q5IA 3VNVA 2DMOA 1COWD 2CE2X 2IW3A 1TL7C 1W5SA 4DLXA 1KIMA 3ZZ0A 3NHBA 3KX2A 3GFTA 3I3SR 4A2PA 1X6VA 1LF0A 3AKEA 3JZAA 3AEZA 4KLNA 1AWXA 3MWKA 4E07A 4OHZA 1TUEA 1FYNA 2IYLD 1KO1A 5FL3A 5AWFC 1YR9A 1G16A 2PJRA 2ROTA 4OQXA 2O8CB 3L43A 4PZZA 2CXXA 1M30A 1M8PA 1FX0B 2GBQA 1VCMA 1XNJA 3KJHA 3RS2A 4US0R 4BZPA 5CK4A 1Z08A 1GRQA 4JL8A 2K79A 4KSBA 4J9GA 1H8HA 2SHKA 2ZJAA 1S1MA 1ZLMA 1B0UA 2WPDA 2FO0A 3A6PC 2HJGA 3ZLJA 2C99A 1GVNB 1U3OA 3TVDA 1XDBA 2DFNA 1B23P 1E6CA 1V43A 2R9VA 4TMKA 4PC7A 1SEMA 3CH5A 1EFCA 3I5YA 2CL0X 1RRGA 3B9PA 4B3FX 4B43A 5DISB 1E9RA 1QDEA 3QPWA 5JSZB 2YUPA 1NSTA 4URVR 2XOKD 2IS4A 4LJAA 2Z43A 2JTEA 2ORWA 4JVNA 3AF1A 4FMCF 1E3MA 4G3XA 1HT2E 1PKTA 2HDNB 8OHMA 2XGJA 1Z83A 3B1VA 2DX1A 4Q4AA 1GNRA 2ERYA 4QFMA 4RTZA 4RZ2A 2C77A 3K53A 3FWYA 4BZQA 2GGRA 2DBYA 3KJIA 4MRPA 2WVJA 2N42A 1K1ZA 1XCGB 4LJ8A 2X3XD 2OAWA 1KKLA 1OH6A 1DAEA 2QMHA 1W36D 3CX6A 4H1UA 1UFFA 2GXUA 2AFIE 2YC2C 3BFKA 1KAGA 4J0QA 4O2LA 3RSLA 3RS5A 2ZEJA 4W5JA 1N6PA 2VF7A 2CL6X 3PEVA 1WDXA 5TV2A 4PTLA 1TF7A 2GILA 4IEEA 3RS0A 1RIFA 1IY1A 4IXNA 4KFUA 1YU9A 2GJ8A 2WWXA 1Z28A 3T61A 2EYWA 4LYAA 2QQEA 3UF4A 2FG5A 1WX6A 4KFTA 4W5WA 2XZOA 1GFIA 3U60B 2O8BA 3W5JA 2GWHA 1VKJA 3BH7A 4AYTA 2F3TA 3QEJA 1AKEA 2WIBA 3GJXC 3AVYA 3TSWA 4TL9A 5CB8A 4IVQA 3R6NA 1JXOA 3TH5A 1OXUA 2JIZA 1ZUUA 2BZYA 1NP6A 1TX4B 3NBZC 2ESWA 5EXTA 5HE8A 4HDQB 1E4YA 2IYXA 5IH2A 2FEMA 4RSGA 2DM1A 2VHTA 2EVWX 4IEIA 4JT2A 2EQBA 4J9FA 1E2GA 1ZD1A 2HF9A 3RNJA 3PEYA 2LNHB 2DWQA 4D8DA 3NHNA 2IXGA 3T34A 5AR1A 5KSOA 3QXXA 2F1IA 3B1WA 2KYMA 2YINC 3AF0A 1GNQA 1E2IA 3Q85A 4I1OA 5FBRB 4A82A 2D8JA 2ZI4A 3GMTA 4C0JA 3WNBA 2H17A 1M3BA 5CLLA 3SNHA 4FWTA 2JW4A 2YZ2A 2W0ZA 1M27C 5K8UA 1XCPA 1X8LA 4L4UA 4NBSA 2RGXA 4BLRA 1ZM4A 2V8OA 1TU3A 2W6ID 2XX3A 5B57C 1Z6TA 2ZYUX 1FTNA 5L23A 3ADCA 5FOTA 1SVOA 1UBFA 1G8YA 4B48A 1PJRA 1NM7A 4IDOA 4ZV4A 2I0NA 1W0KD 2PT5A 3NBFA 2YUNA 1MO4A 1ZVQA 1GL6A 2J7PD 5DYIA 5FL7A 3W6NA 5DN6D 3UIEA 1EX6A 2F1RA 5H68A 2QDLA 3HU2A 3C14C 2ORIA 2DYBA 2D4HA 3L2OB 3DHWC 4A15A 3K9LA 4A92A 4DSUA 3O8DA 1N0UA 3EG5A 3VU9B 1N6RA 3KXKA 1YZKA 1QLYA 2ZYWX 2BBTA 2BOVA 3B78A 4DC9A 2XEXA 3OHMA 3TR0A 5F9HA 2ZRBA 4HUQA 2CSIA 2ODNA 5FR1A 1AS0A 3NEYA 3REFA 1PUJA 5A4JA 2OXRA 3HJNA 4MGKR 4D80A 2ONKA 4HLDA 4RZXA 3PVQA 4LHXA 1N2CE 1CEEA 4YMVA 4MRNA 1PRMC 3I73A 3T35A 1M8MA 1GBRA 4H9GA 2DE0X 2P4RA 5E3HA 2IEYA 4M1TA 3NHAA 5B30A 4POAA 1WXQA 3B7GA 1IN4A 1ZC3A 5JJKA 5DO9A 3LD9A 1XPUA 4PZYA 4NCNA 3A4NA 3CX8A 1GP2A 1OPLA 1BMFA 1DO0A 2BV3A 3QKTA 5DI3A 2ZSAA 5G3YA 5KUTA 2JS0A 1IAQA 3LLUA 3QNUA 2NQ2C 3O8CA 4KAXA 1QG2A 3M0EA 2BC9A 3RVBA 4BZXA 4IDNA 2OO7A 2WIAA 3PCRB 4BRUA 1X8JA 3O5ZA 4RFVA 2BKEA 1YP5A 4NYJR 3FMFA 3GQBA 2BM0A 2A5FA 2ZRPA 5E7MA 1WMSA 3C7KA 5E7IA 2YOHA 5EXPA 3AH8A 1S0UA 4DWJA 3CM0A 2BEKA 1NKSA 3QJYA 1MV5A 3D3QA 3OFNA 4PC3A 4M8NE 5TXGA 3FMIA 3QKSA 2IYSA 4MKHA 4PSVA 1OH5A 3I5RA 2UKDA 1E6HA 3S1AA 4HYYA 3TUIC 5J4VA 1ZP6A 1G17A 2CHVA 2B21A 2VSFA 4WXRA 4AKGA 2OBMA 1X6BA 3PUYA 2R65A 3ADKA 2FE4A 2GDJA 3MCAA 1NG1A 5BN3A 3W6PA 5D3MB 2VA8A 4XSGA 3A8TA 1R2QA 1ZM7A 2EFDB 3EA5A 3GEEA 2FJUA 2HYDA 4LYFA 4XVQA 1GCPA 4IIOA 1K5DA 4RJLA 1AGPA 2G1JA 4DUGD 2X3WD 5J47A 2KT1A 4O3MA 1M1YE 3KKQA 4RCZA 5KYKA 3THXB 2IXFA 3AF2A 5IDVA 2HXYA 1LW7A 5H70A 1BS1A 1A1VA 3IQWA 2C96A 1D2NA 2AZSA 1Y0MA 3LX5A 3WMGA 4IVRA 4OK3A 2FGJA 3ZH9B 1NF3A 4NYMR 1KOFA 4AURA 1HEIA 3QY0A 4CEIA 3NC1C 2KSQA 1BK2A 2WAXA 3KXIA 2J6OA 1MRSA 1ZM3A 2Q21A 1CP2A 1U0LA 3P1JA 3QBVA 3AP2A 2CMKA 4YC7A 1FPMA 4AKHA 2KBFA 3X2SA 4ZO4A 1PHTA 3EG0A 1N5KA 3IHWA 4F92B 5JJIA 2X2EA 2D0NA 3T1TA 3BFXA 1Z07A 3PR1A 4D81A 1PWTA 1R5OA 4LJ6A 1GCQC 2AK5A 1KI6B 2GZDA 3B5JA 1II8A 4NTZA 4PSAA 2PCJA 4XVRA 2DJQA 1TUDA 3WYGA 1E2LA 4Q1EA 2CCKA 3H1TA 2J46A 1E2HA 1G6HA 5JFGA 3HDTA 3U4QB 2QRNA 1SVLA 2QG6A 1H8EA 4MRSA 2BTTA 2MSDB 1OKKA 4KXFB 5FFMA 2F43A 5CIQA 1NVWQ 2BEJA 1CJTC 2CHQA 2ZE5A 4OYHA 3U44A 3EPKA 3Q5DA 2ATVA 5EUMA 1K5GA 3X1YA 2P6RA 1JR3A 1XJQA 1JO8A 2A9KA 4A8JC 1FZQA 4XTRA 4FW9A 2RB4A 1Y3AA 4OI4A 1IN8A 2ED0A 2WJIA 1P2UA 4Q1BA 5EZ6B 2H8KA 2ZUBA 1LS6A 3T15A 2CL7X 2ZS7A 5FOUA 2ZROA 3QUSA 4JT4A 5IHPA 2FU5C 4X8MA 1MV3A 4LHVA 3ZYCA 3ICQB 5FI0B 3LW7A 4XWAA 1MT0A 2FDCA 1E2MA 4FMBB 5G41A 1W44A 4YLGA 1P3JA 1HT1E 2C0IA 2ABLA 4KYUA 1P7CA 2NGRA 3CF6R 3TGPA 1JBKA 4BFUA 3D8BA 3GJ7A 2IA5A 4HB0A 2IWRA 4CDGA 3TIFA 1I0CA 1NYFA 4A63B 1NSFA 5KNBA 1K6MA 4HCKA 1YRBA 3RANA 4B3BA 3SQXA 2ODEA 3W3AA 1R8QA 3ZZTA 4URWR 2GXAA 2PH1A 4D82A 1E2QA 3K70C 1NJGA 1U0JA 4QJ3A 1LNZA 3QG5A 2Q0HA 1NKTA 4OBEA 4Q4JA 4LX0A 1TEVA 5LB4A 3K0CA 4OMLA 1ZNZA 2A30A 4LBWA 1KK2A 3V4RA 1SKYE 2C03A 1T91A 4XTCS 1KJWA 2V6JA 2DY1A 5BXQC 1P5ZB 3DOFA 4TLCA 4GZMA 1Z06A 3DOEA 5L3QB 2DVJA 5EE5B 2W00A 2DBMA 1WFWA 2HF8A 1HD3A 4R7ZA 4P3YA 2NOAA 1ZUHA 4LSGA 3TVTA 1SXJD 1RRPA 2ECKA 3LVQE 2ZRFA 3F5FA 3CF2A 1YZLA 3VS7A 1ODFA 2Z4SA 3NEJA 4UNNA 3D31A 3KQKA 5DHFA 5D3MA 4XWOA 3B2EA 4PSKA 2JAQA 1DTSA 2WJJA 3THWB 4I99A 1A7JA 2B86A 2CH4W 1N5IA 3PFIA 4K8OA 4PO9A 3QPVA 5EXXA 1NJFA 1FNMA 2HDAA 1E2NA 1OV3A 3UANA 1P4SA 3BD9A 1XTKA 4M53A 3VR3A 1G8HA 4AYXA 3K9GA 1OH8A 3ADDA 5G3ZA 1SVIA 2ZAMA 1TQDA 1UEIA 1S3GA 1GIAA 4GOXA 4MQBA 2Q9BA 2VKNA 1J2JA 1YZTA 2LKDA 4IVPA 3AUXA 3CNOA 4Q4HB 2P0EA 2GXQA 2ZI3A 3L0IB 3M0RA 2Y8EA 2CNWD 1E1QD 1T5IA 3VFDA 5KTYA 3IUYA 4V0MA 3THYB 2X1VA 1R0WA 4N1AA 4UQOA 4OMMA 5E95A 3KFXA 4JSYA 3QVUA 3VS0A 3GPLA 4HATA 2LCSA 3B6EA 2AWNA 1B3QA 1I2MA 2VPPA 3A98A 3EHQA 1E1QA 1UBGA 1Z0FA 1RC8A 4JZ4A 1J70A 1KI1A 2GCPA 2O88A 2XB4A 4TYNA 1XZPA 3FMPB 1W4RA 4RFSB 4MDEA 1XXHE 4A8JB 2ZI9A 3R20A 3ADBA 2O9VA 1NLFA 2OAQ1 3BORA 2J06A 4ZCIA 5K8LA 4MKGA 3FKSD 3GFPA 4CZ2A 3K0SA 2OJ2A 1NBME 1JXMA 2GJKA 1E7OA 4QBFA 2BZXA 2QSZA 2JLSA 5JWHA 4DLSA 3UATA 5HTKA 2MSCB 2HLDA 4FWIB 3WBKA 3GJ6A 4MITA 4NE2A 4B3CA 4Q9LA 1P73A 2J7IA 3MG9A 2OBLA 4OI0A 3Q8XB 1OPXA 3CPEA 4A0RA 4Q7KA 1VIAA 2GQIA 2XNDA 4RD6A 4TZ6A 2IYYA 2ONJA 1GBQA 1XWIA 2E1RA 4MH0R 1JEEA 3ZQJA 2ZRGA 3REBB 5FTNA 5C18A 1J8YF 1OB2A 3IEVA 2I1VB 5GVSA 2AL7A 5DYGA 1O3YA 4DLZA 2YYZA 4DDWA 1MH1A 1DAMA 3SYKA 3EG2A 4LRWA 3SBDA 1AIPA 2QY9A 3T5DA 3CH4B 2E9SA 3LXRA 4IJMA 1M7BA 3NH6A 4E6RA 1W4AA 3LX8A 1ZBDA 2PX0A 4WIAA 4WZBE 2BMDA 4LC0A 1QKWA 2WPDD 1YNZA 2ZYTX 2W83A 4H1VA 1DG3A 3VX3A 4F16A 1S96A 2DILA 4DT1A 5GJCA 3OE7A 5JEEA 3B60A 4L5BA 1G3MA 3CZPA 4B2IA 1GL9B 1XU4A 2CJWA 3U5ZB 1OYWA 2X19A 1KI4A 2RHDA 3A1WA 2YUQA 4K81B 3QPUA 2PZFA 4NYMQ 3UWOA 2XSZA 3L8ZA 3EGUA 4B2LA 1OHHA 1Q44A 5JHGB 2GKSA 1JPJA 1U94A 1UDXA 1UHCA 3I4LA 3R8CA 3CZQA 2GHIA 1Z5ZA 3M6AA 1KYIA 2QM8A 2FZLA 4FCWA 4ZCLA 3HU3A 2KYBA 2F43B 2REXB 1U99A 3UK6A 2QP9X 5I11A 3U4QA 4Q9JA 2FSIA 1HV8A 4Z89A 2W2VA 3OZXA 2JJ2D 3WHKA 5HPYB 1D2MA 3CNLA 3C4JA 2OESA 3K0EA 4HAYA 3VHLB 1PRLC 5AK0A 3W8NA 2NG1A 4IOJA 4RKEA 5C1BA 2WJHA 3V00A 2GVZC 1T4GA 1RUWA 1ESNA 2K5UA 3A36A 3BAFA 4E03A 4UXHA 2ZJOA 2IHBA 3TQFA 3QKRB 3ONWA 1OPKA 3UA7A 2C9YA 4OMNA 3LQRA 5SZJA 4A0GA 5AJWA 4GI7A 2RMOA 1XEXB 1YE8A 4EPWA 2WWFA 3R7WA 4C3ZA 4D26A 1E9AA 3SHWA 3LO5A 1TEXA 4EPVA 3THKA 2KGTA 2ZTSA 3GLFE 2VTKA 1G3RA 4BQSA 4CEJA 4JMPA 1W5TA 3ULRB 2F2WA 2Q6TA 3MLEA 4LWZA 4S35A 2RGDA 2V3CC 4HZUA 4EQ6A 1ZUYA 2NO7A 1FNNA 5FR2A 4BEBA 1XTIA 1KJYA 4YXWA 5DI9A 2OHFA 4XJXA 1KO4A 1E2FA 1W46A 1KI7A 1NEBA 3WHLA 3IIMA 3S1AB 1OXXK 4ZI2A 1GL7A 1Q21A 1XB2A 4EAQA 4LE9A 1N5LA 2JASA 1UAAA 1OXTA 3G0HA 1T8TA 1HQYE 4Q4LA 1CRQA 1GFCA 2VQSA 3ASZA 4C9BA 2QENA 3ZVRA 2AKKA 2ZETA 4RKFA 4IKEA 1EG7A 3I35A 2VHQA 4DLRA 1GTVA 2HEIA 1AWJA 4EIKA 2B7BA 2OCYC 4MKFA 6Q21A 2DL3A 3SC3A 3R9XA 1A2BA 1Q3HA 5SZHB 4BRWA 2YDLA 1XF9A 2JMCA 4Q48A 3D6TB 1TQ6A 2VP6A 3DMNA 3PXGA 3VHXA 4AYWA 3I5XA 3EZ7A 3GJ8A 4CGZA 5GJWC 1KAOA 5JWRA 2FA9A 1CULC 1OXSC 2L0XA 2BVNA 4PAQA 2OEPA 1JQJC 1ZUIA 1M3AA 2OFWA 2NZJA 2OE2A 3QBTA 4BECA 3VR1A 1YCSB 5FW9A 2IF0A 1IJFA 3FFAA 1FMKA 4AG2C 2J0UB 4TL6A 3SR0A 4A0FA 4C2TA 2KBEA 3TRFA 1ZMXA 3G82C 3R9IA 2VHJA 2VL7A 1K8RA 1KDTA 2WM9B 3QXHA 2JM9A 1XD8A 1QKXA 2LZ6B 1F2TA 1GITA 2ZR0A 3QENA 1H92A 4IHQA 4US1R 1VDZA 5G40A 1KMQA 2C0OA 5IHIA 5AUPB 4UNRA 2ODWA 5K8IA 5J4HA 4HAZA 3DM9B 4TQAA 3I1FA 4XWKA 5FPYA 2BM1A 4A0HA 1PKSA 4HLUC 2IYWA 1KK1A 2ZI7A 4QGGA 3LY5A 1WBBA 2YC4C 1QHNA 2K2MA 1V5WA 1RKBA 4GBMA 4Y0AA 4J9CA 4EJSC 1YWOA 5FI1B 1R0ZA 1G5RA 4WXPA 1CR1A 2WV9A 4LJ5A 1KHTA 2OG2A 4HAVA 1BU1A 3A58B 4IFBA 1JQLB 2W0MA 5EZ5A 3ZIAD 5JJLA 3DEFA 1CU1A 1LTQA 3U3JA 3QIAA 1K0SA 1YR7A 1NN3A 4JVSB 4XD7A 1KK3A 1ZCBA 3RBBB 3KB1A 3DKVA 2OCBA 3L0OA 4D4JA 2ZJ5A 4I1SA 4XIGS 2BCJQ 1NIPA 4D4KA 4FXPA 2G1KA 4Q1AA 2QE7D 3NGPA 3GLIA 5GJVB 3N2IA 4B3GA 3O47A 3QQ5A 4XD7D 2G0NA 2GETA 4U5XA 1NBMD 1XD2B 2YWEA 2BBOA 3LBHA 1NEGA 4MGYR 1ZNXA 1Z47A 4DHEA 1E0KA 3VKHA 3SFZA 1FL9A 1H8ED 4RY2A 1IOZA 1G4AE 1NVUQ 3EG3A 1UDWA 1W1FA 5E7JA 4KVAA 1T5LA 1P75A 5IK2A 2W6JD 4II7A 1UKZA 4Q7LA 1UBCA 4AFZC 1XTQA 2GNOA 2SEMA 4NCHA 2GEUA 3KJGA 1ZIPA 4AIIA 5HR5A 5KSZA 2AKYA 2GZAA 2EWVA 4PO8A 3DZ8A 2Q9AA 1UTIA 3EZ6A 4M0LA 1RZ3A 1AQUA 2FPMA 2CDNA 1N3BA 2A37A 1OSNA 1U90A 4TMXA 4K46A 3W8RA 2K6DA 2K7AA 3GLHB 4BUJA 4DKXA 5KHOC 4ZDKA 2CUBA 1EFRA 1IN7A 2OBNA 4JSTA 5CYPA 1Z29A 3UG6A 1Z0JA 4TLEA 4Q19A 1OH7A 4JZ3A 2D74A 4TT3A 5KDOA 1IO6A 4A9AA 4URXR 2O31A 1T0HB 3IHLA 1TPZA 4JLDA 5FBWB 1E1RA 3BB3A 1XPRA 1KSFX 3FHCB 2HT6A 2QL6A 2EFCB 4O0MA 2GBLA 3KUCA 5FUWA 4JBWA 2PMKA 3MGCA 1GG2A 2RMKA 2GZHA 1E79A 1JJ7A 2CLSA 3FKSA 3LBIA 3U3KA 1T3HA 2IUUA 3UMSA 4Z8AA 2FV8A 3U7EB 821PA 4FINA 2RGBA 3A4LA 1NY6A 1OOTA 4X1VA 1L8QA 3RRNA 4D6PA 3AF4A 1ETUA 4Q47A 2NPFA 1HE1C 1P9NA 1Y63A 3EZ2A 4MA4A 3CRW1 1Q1ZA 3OEEA 2FEOA 3X1DA 4D8KA 3EASA 1G83A 3K0AA 3OFND 4BLQA 4CEJB 2FX3A 1EFNA 1AVZC 2ZM5A 1QHGA 1KMHB 5HCIA 3H0HA 1CXZA 4A8JA 1JEDA 4JLOA 5EUQB 5HKKD 1QVRA 4DSNA 4ARZA 1PUIA 5B58C 3AV0B 4G1UC 2MCNA 3L0SA 3QWXX 3M0SA 4YDHB 2VHCA 1G19A 1RJ9A 2F1HA 1A0NB 2EYQA 1CKEA 1FMJA 1YWPA 2DA9A 2EYZA 5IXBA 2FFQA 1U8ZA 4LC1A 3KKMA 4QBGB 4JLNA 1ZX6A 1XEWY 2NO0A 3ZJYA 3VTKA 2DL4A 3RYTC 5CK5A 1MKYA 2RPNA 1K4US 5F2EA 3TW4A 4ASUA 3CKLA 4MRRA 2C9CA 4OHVA 2QMOA 1JAIA 3Q9LA 2QAGC 2O0KA 1XEWX 3QF4B 2UVQA
chains in the Genus database with same CATH superfamily
1F0PA 2ADFA 1L3IA 4DNXA 5KDDA 3NKLA 5C8XA 2FHDA 5GMKe 1Y34E 5ARDA 1XRSB 1DEOA 1J9EA 4C5IA 2XMSA 3A6ZA 4O33A 4HAWA 2C4WA 2D62A 1KZ6A 3EWIA 4LZLA 4PGHA 3NKFA 3S5JA 1QCCA 3L7AA 2O2OA 5D87A 3TOVA 4D8TA 2QTLA 4RK1A 5DCLA 3LSTA 1XTRA 2GTOA 4FK8A 4UEWA 3P0RA 3K0KA 1A0OA 4C4XA 1J1ZA 3TSYA 3WXMB 2BFMA 2HCRA 2OK8A 1GAQA 2WJZB 4PHGA 3RS8A 2DBVO 4I2VA 2M9UA 4HAIA 2YRFA 4KNWA 2PKWA 3C15C 1MJNA 2Z9BA 2BFEB 4I1YA 1CY6A 5HJ2A 3RIXA 3WB0A 3K6SA 2FYTA 2EL9A 4YCLA 2O7VA 1BA2A 2X41A 2RF0A 3K9WA 4QPJC 4GKKB 5COQA 3ID6C 3SF0A 4JLSA 2RE8A 4MVYA 2OTCA 1WS6A 1ZM2A 2ZBGA 1M2FA 3SHFA 1CNEA 4BPBA 5LSAA 3PFWO 1IXSB 2AKAB 4IP0A 1BMQA 1ML3A 2H5IA 3ENQA 3HHEA 4KO1S 4K6HA 2XTNA 5HVNA 2J09A 3MN1A 2I62A 3EISA 5IN4A 4IUTA 5LDGA 2V1UA 3V4LA 3TLAA 2OOKA 2HSPA 1Z9BA 3U3KA 3V4OA 4JJZA 4EJSA 5C35A 5IEJA 5H8WA 1J8MF 1NM5C 1Q0HA 3G0OA 3QEKA 1WKVA 2DHRA 1KJQA 4HQRA 4NWIA 5AKLA 1T3LA 4CMJA 3OYBA 1R0RE 4HAUA 2Y68A 3SZRA 3GN1A 3QKUA 1P1JA 3IPAA 4F12A 3BMCB 1SUAA 2RJDA 1IDN1 4KREA 2CHGA 1ZA1B 1KYXA 4MPJA 4Q21A 1F20A 2IDKA 3SE0A 3DKIA 4EGSA 4EP1A 5LD2C 1MHPA 1T34A 1ZSGA 3C41J 1M1GA 4OFZA 2QRJA 3T3PB 3UW3A 2YOFA 5DM60 3C87A 3KSAC 2QEQA 4O2RA 1T0JA 5IJAA 3K0FA 4LK3A 1U2DA 2BBWA 2VHZA 2XWJI 4P4TA 3HJUA 2BSXA 1CJKC 2EV9A 3HXLA 1ZCZA 1F6BA 2R4QA 2RKOA 3AIOA 5GAOp 2I87A 3EMKA 3MTJA 4I4TA 4KO3S 1G0NA 3BH6A 3EG9B 3R0XA 2ECPA 2ASVA 3QX8A 3OYDA 3A8HB 5DTRA 4AJNA 2J6FA 2NUPB 4IO1A 3TRJA 1ZITA 5JALA 1H69A 3AYZB 4ZGJB 2FTKE 5HCUA 2Q3FA 4UD6A 2VJPA 3BEDA 3ZWVA 1J3TA 1RI2A 4Q9KA 5C1OA 2IHJA 5AM5A 4RTXA 3V4VB 2DJZA 4F7WA 4C92D 2QD1A 4PINA 4J0GA 4F2HA 3JW8A 2OTJT 2J5XA 3DMDA 5M2QA 2O1EA 2O8DB 4QQGA 3JWGA 2NZ2A 5TARA 2H3HA 3PVCA 4C08A 4XX1A 4HVVA 4CCYB 3S2GA 4YAKA 2D06A 4KQJA 4YUYA 3OZUA 3DEYX 1B8NA 3NZEA 3H1PA 1WJGA 2E6UX 4IQ4A 4JIGA 4YA6A 5CH5A 2PQ2A 1NU6A 4DPLA 3ZWCA 1JDBC 4F8YA 4KR7A 2VJKA 5H1YA 1IOLA 4E13A 4WTOA 5JD6A 1R10A 1U11A 2QQRA 4NDAA 3M0PA 4XWGA 3W1EA 5LCXA 1SIOA 4QC2A 5H83A 4H1HA 1GADO 1K1EA 4M7DD 2ZVJA 5DHSA 5AKZA 3TTWA 5A3RA 5BPFA 4BACA 2QAGB 4I1RA 4B6SA 4JAVC 4P53A 1ONPA 4D4MA 4Z1MA 2V6IA 1CK4A 2C2YA 1WXEA 1D2EA 4MZDA 4O4JA 3WR5A 1LK7A 3QIIA 1ZGJA 5EFZA 4ZMSA 3U7RA 1E4OA 5GAMh 2HPZA 3ZJVA 4DB2A 1NZJA 1SO8A 3BGVA 1RCFA 1JAHA 3MWJA 3MJVA 2E5QA 1M9SA 2GO1A 4QYMA 4R6XA 4ZK2A 4XCVA 4C03A 4J0DA 3L1IA 4ZVRA 3JZMA 1CUWA 1JMVA 1Q7YU 2CLFB 3CPJB 2Q50A 3I12A 2OILA 3KKPA 3B2NA 4QJ4A 5I7AA 2PYIA 1CJSA 3TLYA 3REGA 1U0NA 3DD1A 5KX5B 1E79D 1H1LA 2PUCA 3C16C 3QXEB 1B93A 1QGZA 1WTCA 3HZRA 3TNFA 2IU6A 2RI1A 2NUAA 3DL4A 3FGNA 4DLYA 1HDCA 5CMLA 1TCBA 4F04B 1EVQA 3B6JA 3NKVA 1EBFA 1AV7A 4LXTA 4OB0B 2PCLA 5E9JA 5EYPB 4HWPA 2WSLA 2R47A 2HW8A 1X87A 1U1IA 4FFDA 1R88A 2AOWA 2Z8YM 3AUAA 3NHWA 4LE0A 2Y1DA 2N9UA 4FFWA 4MYDA 5AI9A 3O8RA 3ETLA 2VI5A 4OXRA 4M7DB 1SHGA 1Z6XA 3TEFA 3WKDA 5HM8A 2WKQA 3VHQA 1KI3A 4L27A 1PZNA 3X20B 2PJUA 3QSGA 4YECA 3W3ZB 3PEWA 4ERNA 3KEQA 2RAUA 1R0LA 2RD1A 2VAVA 1Y4UA 2E4WA 1REQB 2XJ9A 3SIXA 3ZDDA 1DE0A 1A3CA 1CCWA 4GYWA 3DBIA 2FZ5A 3PLNA 4CNQA 3ZWYA 3GFGA 1ULBA 1P1FA 1TTQB 2QTRA 3EXHB 3MTIA 3X1ZA 7YASA 1CDOA 4XXHA 4AJOA 1AZWA 1VSUA 3BL8A 4CODB 4KPEC 3D1JA 3JQ8B 4FFOA 3CO5A 2XRZA 3BIFA 5CXQA 5LJ3e 3NNNA 4CMGA 1N2ZA 1Q7RA 1VL8A 3SP1A 1RKVA 1MV8A 2CMDA 3QUTA 5TMPA 2BJHA 5JYDA 1ZX1A 4OGKA 2YR0A 3RARA 2IVWA 1JPNA 2X77A 2I2AA 4IIJA 1VHTA 3MWFA 1UKYA 3L0BA 3VRHA 4C14A 3BRWD 4UHBA 1RKUA 3DTVD 2J05A 2G0TA 3SS8A 4F85A 2L3SA 3A1NA 4TTPA 1E4EB 5AVRA 1AUXA 3LHIA 1WXDA 3SDZA 1GYRA 1WPYA 2EJCA 2YVAA 3PHCA 3UMGA 4EPTA 1CIJA 1XLWA 3SFMA 3SEMA 1VYUA 2XQIA 5DEIA 2ANBA 2CYAA 4QBIA 2PNIA 1AZEA 5ULLA 5KQGA 1HTBA 4JCOA 4K1LA 4MMYB 1YRLA 2ZRNA 1FYFA 5FWNA 1Z63A 1J20A 2RQTA 3NB0A 1FXWF 3VYWA 3KOYA 1XEAA 2C78A 2PUHA 3KO8A 3LI2A 3WNQA 4Z9XA 3M81A 4C4PA 4E94A 4H16A 4GOOD 5ANRB 1EBBA 2V1RA 2I1WA 4Y7CA 3KVRA 2O8VA 4KAAA 2GEDA 4BV8A 1WQ7A 3HCRA 2WU0A 2R6CA 2IRWA 1TM2A 2FWIA 1NGSA 4RMJA 1C8BA 4UAUA 1OWPA 4D1YA 5DN6D 4FOLA 3OICA 4LV6A 1TQ4A 3ANYB 3MCZA 4QVCA 4MQEB 3SZUA 3KSBC 4RSMA 5ED0A 1DAIA 4EEZA 4RPCA 4EENA 1P91A 1GTSA 1BYUA 2C9OA 3AI3A 3FZEA 3IGFA 1TK9A 3OIUA 4JI0B 1G9XA 1W581 4MAAA 5EJIA 4DXDA 3G4ST 4ZDIA 4P3OA 3RROA 3TVYA 5D51S 4M1OA 3VOAA 4RMOA 2GTJA 3GVHA 3NLLA 3RGWS 4P4UA 3GLHA 3TR5A 3BS4A 4E7LA 1CYDA 4HFMA 2HQBA 1L8AA 3OA2A 3HI6A 5MGBA 1VQ8T 2OLJA 2PL3A 2KXCA 1OW3B 2GUGA 1TU4A 4G0NA 3OBBA 4MS4A 1T2VA 3AIMA 1ABFA 1T5BA 1YR6A 4GOLD 1E6EA 4PX5A 5CLQA 1OQKA 4HCCA 2XNKA 1Y7XA 5EVJA 3OW2S 1Y1KE 1BW9A 1R4NB 3KKNA 3STYA 4DVGA 4ZGBA 2R8RA 2J7PA 4XYEA 2JFYA 2K4YA 5DYYA 1PGPA 2IYFA 2FI1A 4R1NA 5IBRA 6LDHA 3ZW9A 2DH6A 5GANh 2ZJBA 4OBXA 3GEIA 1FTSA 2BGRA 3N2GB 4R0NA 3NG1A 3U3RA 4C0AC 4M78C 2AQIA 4JELA 2NUPA 4FFVA 1M8JA 2AE2A 2HCBA 3AU9A 2PTGA 2I3DA 4YX9A 1RWWA 4IFTA 4I55A 4J7CA 1L8OA 2DCUA 3BZBA 2COWA 4RCYA 2KRSA 5JHHB 1Y4SA 2Q5JA 4IIJB 4X71A 1Y4ZA 1XN4A 2LBPA 2RARA 4ZOLF 4YRIA 4QYXA 4TTVA 4OMFB 3VS5A 4BTLA 1A71A 1S72A 3O0DA 3P7MA 3O7WA 1AQ6A 1RHRA 3GEPA 4I4IA 1KI6A 1M1XB 1L9XA 4J1QA 4M1MA 3TZKA 3EHRA 1FVXA 1S1CA 3Q10A 4X1OA 2PMFA 3LV8A 1YJ9Q 3EXHA 4L5JA 1JE1A 4MIEA 5DV9A 5DM70 1RYMA 1AC5A 5K8JB 5LP6B 2QN8A 1X01A 3TSZA 4BY6C 3GUZA 3T9NA 5K2OA 4ENPA 4G5SA 2WP0A 5C2JB 3HSYA 1VOTA 1YA4A 1K97A 5PGMA 3ZU5A 5IJZA 3O91A 1ZL0A 4BC1A 4O4JF 1B0AA 1UFVA 2GTPA 1ZJYA 4NAVA 1AKYA 4EKYA 4TRJA 4H2DA 1S3IA 3MS4A 1EJ0A 3MJHA 3OMXA 5BW4A 3E70C 1B34B 1EZ4A 2QASA 1MDBA 3NFCA 4NESA 3H6ZA 4ZTZB 3G0IA 4UASA 1OPRA 1P33A 2PL9A 4FGZA 4Z9BA 1TA4A 2ZTLA 3KT3A 1B76A 4JB2A 3G6WA 4GT1A 3PGGA 2WYOA 3PSHA 3CT4A 4ISCA 2RCNA 3K0CC 4IZIA 3CY6A 2VQFB 1W96A 1A77A 2ZDQA 4UBNA 3N07A 1NIJA 2ZRJA 3JVVA 3HPQA 2XUIA 1JIKA 2EIXA 3IUJA 4UEQA 5G4KA 2KBTA 4XDGA 1XAGA 3X1XA 5C5DA 5A2QA 1FFHA 3W6OA 2EGCA 4L1KA 4DJTA 1FB5A 2E5KA 3IA7A 4R6WA 3KETA 1ADYA 1PX2A 4LXHA 4F9EA 1HA3A 4EB6A 4QDOA 3CCLQ 3DBVO 3MNFA 4FW8A 5HS4A 4MQFA 5ECAA 3PC2A 1JU3A 4PYLA 3C8HA 2J3HA 3UBMA 1BJTA 4NLLA 3H5LA 2Y9PB 3VOSA 1ZU5A 5AH0A 1U9IC 4W8GA 3LU1A 4UDYX 5K0SA 1L2TA 2AYZA 3TLXA 3W2EA 2NU7B 5AT1B 2MTBA 4DWVA 3V7FA 2P4QA 3T7SA 4QUHA 2IHKA 4HFRA 4EGJA 1YRYE 2HRBA 3IB6A 3RAGA 5A9SA 1OZHA 1Z2AA 2PRJA 4IH4A 5IHNA 3PQ7A 4BXOB 1EFVB 4RAOA 3KQLA 3KKZA 2P9ZA 1EGHA 1JFVA 4Q3NA 5HK9A 5EKTA 3ICVA 1MR3F 1Y9DA 4QUDA 5TNXA 4F91B 3PXUA 4ZFNA 1I3KA 2R1VA 3Q3CA 4MGEA 4TQUS 5A5DA 1AQJA 2AZ4A 4IDPA 1V1CA 4ND7A 1N33B 1ZZEA 1N57A 2FRXA 3ONNA 1G2OA 5TVKA 1J0AA 1JH9A 1SKYB 1AZGB 2C0CA 2DPYA 4GP7A 4U2EA 2GCNA 2M9MA 3S2ZA 1DKPA 3B1JA 1UC8A 4F96A 5BWLA 2NMVA 5DM7R 1RYBA 1W2WB 3CZ5A 4ZVOA 3O2JA 2OB2A 1R1DA 3P5BA 4ZVLA 1LI5A 1N34B 1EA7A 4KQKA 1QLWA 1O75A 1E1LA 2YXDA 4IGFA 4J16C 5F51A 4E22A 1Q12A 2BLNA 4D5EA 3RKRA 4ZN6A 4HVAA 3P4XA 1SXJC 2GJAA 2UZ1B 2JA2A 2F90A 3QELA 3V8VA 1WIEA 2XTZA 2C2GA 2WV7A 1G8AA 1WDLA 1OT3A 3QFCA 4LZAA 3VJMA 4AF8A 5AVTA 1TUBB 4M4SA 4BC0A 4PHHA 3EW9A 2GA8A 1JF8A 3OCXA 5JFTA 4FX5A 5EP1A 1LPAB 3SKYA 1YKFA 5AXAA 4GP9A 3Q3GE 1KQSP 2H5JA 5DLQC 1JW9B 5A3VA 5TT0A 2ZUEA 4ADSG 1FUYB 3E48A 5IDWA 1NJIU 4JLIA 3TOZA 4DMLA 1CQIB 5L53A 4BNWA 4C0WA 4HXEB 1Y42X 5GZ3A 2PUOB 3FXAA 1PQPA 2VWQA 3KB6A 4Y6RA 4UAGA 4PG6A 3B6IA 3L42A 4B47A 5K3DA 1HOTA 1QRDA 1JQAA 4ZYZA 3FROA 4QJIA 2QQBA 3PE6A 4W5OA 5I7EA 2O48X 3PHBE 1RQXA 4ZMRA 2GPBA 1P9RA 4NCJA 2AOVA 1UF9A 1BDIA 1NOIA 4EJSB 1NBMA 1V29B 1DG9A 2C2HA 1JWBB 4L02A 1MAVA 3RIHA 3YASA 4IUYA 4C20A 2UUCB 3VYGA 1OVGA 1Q91A 1TLLA 2O52A 1K89A 4NRDA 4GLMA 3ND9A 5BN5A 1I9CA 2QVGA 1P9WA 1YUNA 3GHYA 4E7IA 3HB4X 5T4EA 1RXWA 4GO1A 1DLIA 1M0EA 3WGOA 2BKUA 2X0DA 2KI7A 4XTVA 1M3CA 3AUSA 5CVIA 2RB6A 3H42B 1DDIA 3IIIA 3LUJA 3ICWA 3I6ZA 3EVFA 3OO0A 3FAKA 4MV8A 5EIAA 1FJGB 1BYMA 5E8RA 4B6FA 4DCVA 4DRXB 1Z82A 2Q5OA 5EIEA 1D0IA 1XAIA 4WBNA 3MUFA 4UFOA 4BQIA 3B9QA 1L5MA 3DAGA 3CCJT 1GWNA 3CPSA 1Z33A 5CURA 2PS9A 4UUBA 2C3UA 4LFCB 5JZMA 2RFLA 2W10A 1IUNA 1HOXA 1ORHA 3HYNA 4LPKA 1VQPA 1KRHA 5CLIA 4HNVA 5KTRA 4H18A 3ZD8A 3RVOA 4CF3A 2QTZA 5KCOA 3LC1O 1EGAA 1V95A 4CMCA 4QYSA 4BLWA 5ER6A 1X2EA 2B5OA 4MS1B 4QPDA 5C46F 1EFHA 1RRMA 1LCKA 5GM1A 4XKJA 3LY7A 3DPIA 1ZHIA 4RTYA 2XVAA 4G63A 3JD3A 1QIGA 2A1IA 4IJVA 1IHDA 4JB8A 2P3SA 5BN1A 2R8YA 1KO7A 1DT5A 1BQEA 2PSHA 4QG3A 4UREA 5IUJC 2P9CA 4RPIA 4TS9A 3ZI7A 4IHAA 2XIJA 5DNEA 5FBHA 3S2YA 4FHCA 5CB4A 1U7WA 2XGOA 5AVYA 4WX2B 4WCFA 2BGJA 3KZKA 2OAP1 3HYSA 2NACA 4IZ6A 2AX3A 2NO5A 4O3FA 4ZOBA 1Q57A 1Q7YC 4KH0A 2JI9A 4ALJA 2IPLA 1QWSA 3ADOA 1NL3A 1Z0UA 3JCMP 3MBIA 4M1KA 4EF5A 5L45A 3BFVA 1BE8A 3WYDA 4IF4A 1FQJA 3I6YA 1J22A 2NP6A 3TQOA 4R0MA 3OYIA 1UADA 2AR0A 4ECAA 1Q0TA 4LF6B 4K9LA 2AFIB 3WDKA 3T5MA 3LLRA 3OBWA 1BD4A 3JATA 4KQ2A 1YI0A 5JV5A 1C1DA 3ETJA 2HLDD 2RKWA 3D3WA 4FN4A 4C92C 5FNVB 3TD2A 3GGJA 1C30B 3FLEA 3THXA 4Q0MA 2PSEA 1Q82C 2QI2A 1L5HB 4UTOA 2PEYA 2BTQB 2J87A 1VQMA 2Q8NA 4Q4AB 3GAAA 5AICA 2SCUA 1TMKA 4GH5A 4Q05A 4WAUA 3V8PA 5H5JA 3X44A 4CR8A 2REBA 1KP9A 1U7UA 2JZ2A 1U2SA 3E23A 1G5IA 3A0UA 3EH2A 3PFNA 4JX8A 3T99A 1JJAA 5I7RA 4JJIA 3PC6A 4Q3DA 5H9VA 2LT1A 1P60A 2BGLA 2FZCB 1E1CB 2GPAA 5F9FA 1C1XB 2JLZA 2FMTA 4LNPA 4GS5A 1VL0A 2DBKA 4TVRA 3FFBA 1D7AA 4MUNA 4CUKA 3CR7A 4IHKA 4FU6A 4NE7A 1V35A 2ZZMA 3K5HA 3U37A 3QKRA 1AMOA 2XY4A 4YRBA 3PVLA 1H2EA 2BSAA 4LZNA 4KH0B 1I30A 4UPVA 3T52A 1JDZA 4ZVKA 2A78A 3UV3A 1FMTA 4WK6A 2VXOA 1C0MA 3JD2A 3L5OA 4IJWA 2QUHA 4KWCA 4EITA 1ZI9A 1UBLS 3DFUA 3L9WA 3DUWA 4Y2XA 5K09A 2BDUA 3UAWA 3WRYC 4YJFA 4F9TA 2YTZA 3RC8A 1RHJA 3NDIA 4FEGA 5GGXA 4D6XA 3M4NA 1MLDA 5G1PA 1LJOA 1FX0A 3BD7A 4EBBA 1GL3A 2NZYA 4PHCA 3QHQA 4EIWA 3I9QA 2O6HA 1K7SN 4O1MA 3TAXA 1GDDA 3QEMB 1N32B 4LGMA 2YZMA 3WP1B 3VI3B 1GSOA 4AJPA 4EY6A 5GMKj 3D81A 5BR4A 2QPTA 1Z56C 1AQLA 1ZNYA 3UF0A 3I56A 1RQGA 4NU0A 1QQ5A 1YDGA 1JR3E 4P3KA 2PKYX 2D1SA 2ZAOA 2FR8A 4C92F 4NCIA 4C04A 4NH0A 2OTLA 1VA4A 4EFLA 4N18A 2CSXA 3UAVA 3QBEA 4TV9A 5AW8A 2R86A 5KOIA 3PDCA 1KD1R 2BHRA 4L4RA 4BZWA 5J4KA 1NR7A 4NSNA 4DIEA 4TN5A 1E6GA 2WUWE 2IXBA 5DBHX 5CFQA 4JKIA 4F7UG 5D1HA 1O2DA 4CM4B 5FJIA 4GZLA 3KZCA 1PNRA 3GC6A 3IEIA 4OUDB 4HUQB 4LDQA 4ZAGA 4RTVA 4RA6B 1BW9B 2I7DA 1E9SA 1VYVA 1SXJB 2QXTA 4I4TB 4IILA 4IWNA 4KQFA 4M76B 4PQRA 1YHZA 1VQLT 1EQAA 2Y1FA 3SSAA 3RI3A 3WQBA 2WFAA 1M5Q1 3U3OA 4DNFA 3CCVT 2QT1A 3EUEA 6ADHA 1P2SA 3UUFA 1NI5A 1XN1A 4AC9A 1AEYA 3IAM6 3VHRA 4CM6A 4J07A 3FVQA 5TE9A 4C7XA 4EHAA 3KTFA 3K9FC 3QUAA 3PIRA 4HXGA 1ADGA 1NC3A 1X2QA 2FPEA 2GQVA 3LYAA 4MIKA 3DHVA 4ND4A 4FGSA 3ZGNA 2JLVA 2BL4A 4BDSA 4MQ4A 1E0AA 2H59A 3EGCA 4CWAA 2VRCA 2I2WA 1OFHA 4U8HA 3PJRA 2FW9A 1IY2A 3P45A 5EPEA 1IUKA 4KQXA 4RVDA 1T9GR 4XVHA 1I36A 4F38A 1TNDA 2PV7A 2DPXA 2IH5A 3B13B 1KO8A 3R41A 5A4DA 2LZ0A 2C8KA 4ZDJA 2IYVA 2PBRA 2IPXA 3ORYA 4ENTA 2DPPB 3FLMA 3DE1X 4ZYLA 5F2NA 2DFPA 3TF5A 2B94A 3D0OA 5FOWA 4JYZA 5I9IA 3UK0A 4RLFA 3AT1B 1L4LA 1NJ1A 3AOEC 1KJIA 4MVCA 4CM4A 4HDOB 2O8FA 4X8OA 3KWMA 4UC4A 4HT8A 1FP1D 1U0GA 3NC4A 2H2IA 3OT1B 2WHPA 2BGNA 4GGOA 5ALUA 3UAGA 4CE6A 3UJ8A 4EHDA 5KOJA 3M70A 2RGUA 4N7RA 1UEXC 2H0AA 1MC5A 2W93A 1PGQA 1XMVA 2XGGA 3DE2X 3NPAA 3GJ0A 1W49A 4NDZA 2UVDA 1A9SA 1J00A 3MQ4A 3OYKA 3EGWA 4P08A 4TMZA 4AY5A 2OZVA 4TWRA 5DBIA 1PT7A 3WG9A 4BMVA 4E0BA 3KNZA 4FKZA 4RCVA 1TZKA 2E4VA 4EMKC 1QG6A 5CDFE 2IV7A 4JYCA 3PTLA 4IIFA 3LT0A 5IT9E 2Q29A 3NFYA 3ESZA 2Y76A 1QH0A 3HFNA 2DBQA 3K1YA 2ZAYA 1S9DA 1N5MA 3K2EA 3HCWA 1WD7A 3GQBB 1JQQA 1IG3A 1C14A 3HZHA 5D7NA 2HV9A 5LJ5d 1FP7A 4EMGA 3MD0A 2MK5A 3PEUA 4YQZA 4PC1A 4AP6A 2VRWA 2RBEA 1ZEJA 3HJGA 4XWYA 2VBFA 2OCPA 4CQNA 2YWGA 1LPMA 3F8SA 2O0JA 4N3AA 3J80A 3BB1A 4UAJA 1OFUX 1BKBA 3AOGA 1G21E 3OM0A 4HLQB 3O3MB 2R1UA 5AOVA 5H3CA 3ZDQA 8AT1A 1L5QA 2BR3A 3NTUA 3OT5A 1BWQA 1OU4A 1S3SA 4GOJA 5TPZD 2JAUA 1YFLA 3Q5EA 1XRJA 3PL5A 5CTJA 2YRXA 1CR6A 1RYFA 3V8EA 1M83A 2NZXA 3V7WA 3GN2A 5LOVF 4Y6PA 2X4GA 1HXDA 4OGEA 4JRPA 4RTLA 2IYRA 2F62A 1QBKC 3OQJA 4IW3B 1KWKA 2OM6A 3FPEA 1BEUB 4N0EA 1CUYA 5CKDA 4LMBA 4IUUA 4RUKA 1YNOA 3EEFA 4FJ1A 4RDIA 4EA9A 2HC9A 2J6KA 2LW7A 4FDLA 4QKQA 1OROA 4NX2A 2IPOA 4FGWA 2HYIC 1C30A 3W90A 1Z4IA 1E3JA 1WB5A 4ZKDA 3STTA 1F4VA 2GCXA 3GVIA 4HWRA 1DAFA 4D0LB 1ODIA 2BN4A 3QV1A 4O2BA 4QD3A 1IHOA 2ZTMA 2C5AA 4DDTA 5L40A 5J1SB 5FNVF 2BR5A 4UUAA 4XDHA 2IUSA 4TKVB 3VU9A 4U4AA 3OOHA 4NBKA 1H9BA 4L07A 4OY3A 4KR3A 1WHKA 5CCEA 2JIDA 3AY3A 2D00A 1YBMA 4PG8A 4X90A 1LOJA 4CM1A 5JARA 3KBOA 4XUCA 2J45A 5JNTA 2I67A 3DDZX 3T1HB 2IUFA 1IZ7A 4HB2A 4LCEA 3GV0A 4EDFA 3BDUA 1KEKA 2QUAA 2ON6A 4EEXA 4GRDA 4LFAB 1GPH1 1P7PA 1T43A 1PGJA 4L8YA 4U7DA 4QOIA 3BBPA 1K8AC 5KO2A 1R8JA 2WK1A 1K73U 2IHVA 3CX7A 3ONDA 1YQDA 5G0SA 4NR0A 4E5PA 4ITVA 4HDMA 1F8XA 1KYYA 1VI2A 2EBFX 3RSGA 4PFPA 1EFRD 4ZCPA 4GL2A 3DEJA 9MHTA 4NL2A 1GQOA 5CXXA 2AJDA 1I7PA 1BYIA 1GRIA 1USWA 1C41A 2OCAA 8GPBA 4PTYA 1UPFA 2I5PO 3NWJA 5DBOA 4C0KA 4CRWB 3CUYA 1OI4A 3RYCA 1PVOA 4ACAA 3K5IA 3WBJA 4CTNA 2NYSA 2J9FB 1Z35A 2NO4A 1YR1A 3Q0IA 1JIXA 1RAEA 3KSUA 3N2ZB 4MPRA 4TMWA 1XMQB 3Q9NA 1IZ6A 4R71A 2O7RA 1P0CA 4KVGA 1HSQA 5IXFA 3PFCA 4DIFA 1PDOA 4ZCQA 1R9JA 1GU1A 1E7MA 4KXYA 3RT1A 2AZVA 4G0UA 4HFNA 5SYAA 4JEUA 1YMVA 2TYSB 2VDVE 2PU9B 4QUJA 4RD3A 4AG1C 2IOHA 3N76A 4E1VA 2CFSA 3BE8A 3LCVB 2C5EA 3OZCA 5CCXA 1N2HA 2VHUA 3MRSA 1IWBB 3G0GA 2W6QA 3TWOA 4F1JA 1J5EB 1PFGA 4F5YA 1ZFNA 4UVDA 5FNZA 1MX1A 3SIWA 1T2CA 3EWSA 4UUQA 2BEUA 2G4CA 4JUIA 4F3CA 2AIRB 4LRTB 4N7MA 1FUKA 2A0FB 1PJLA 1ACJA 1XA3A 3GLKA 2Z2IA 4QVKA 5IJWA 4AY3A 4CHGA 4H3HB 2DXIA 4LYEA 4IMIB 5CFRA 3GMIA 1D2CA 1RAIB 1IXKA 1AWWA 3GEGA 1X19A 4OO3A 4P7GA 4N47A 2E18A 5IMBA 3DDUA 4L4ZA 3Q7EA 1J1IA 2ZRIA 5AM3A 5EKDA 1XTJA 1JR3D 1RZUA 1LTHR 2CNBA 5F73A 1O4WA 1P7YA 2I4RA 1QZZA 3BE4A 4Y9RA 2F4VB 2JTMA 4U7GA 1Q7BA 1F4LA 2GD1O 1J0BA 3I01A 3Q15C 2A0FA 4ENQA 4RJTA 1W29A 1LV7A 2ODAA 2XYQA 3CC7A 3GIWA 4K1XA 5NLLA 1L6IA 1F51E 4JI1B 3RBAA 1YVUA 3WVNA 4EG1A 4PAWA 1KMMA 2I6GA 3LT4A 1WUYA 2JCYA 2ZG6A 3R6WA 3AHDA 1DPGA 5A4IS 2EU8A 3HFGA 4JKYA 1NLPC 1BDMA 3CJTA 3NETA 1X15A 1HI9A 3A4MA 2KWIA 3SI7A 4U3JA 2V55B 1FQWA 5IPFA 2H5LA 4LZPA 5C5CA 2MSWA 3GPBA 3IMCA 3OC0A 4YASA 5ICSA 2O54A 3HO1A 1G4UR 1HQCA 3WXMA 2HU2A 1WSAA 1HNZB 1PYGA 3QE4A 1TZ2A 1NXXA 3IPYA 3QVVA 3B3QA 2ED1A 1S9HA 1SBTA 3KOMA 4P84A 1HQKA 1WCV1 2ZBPA 1LXCA 5DRYA 3F2VA 1AK2A 3U7GA 4LQDA 4NKRA 1IRIA 2VT2A 1SZDA 4OQMA 3FOZA 2XCIA 3DQZA 1NG2A 3TD9A 4M7PA 4IIGA 4CN8A 2GM3A 2J6IA 2O9SA 3GY0A 1CLEA 5HCKA 2VZ0A 3G5UA 2PJZA 4OGLA 3C4SA 3W2GA 2WY2D 3SEAA 3LWNA 4Z2AA 1D9ZA 1ND5A 1XZHA 2M1XA 1YOVA 3SPXA 4BNKA 4DCCA 2XIDA 3T7EA 4CLRB 3MELA 3CW9A 4RTKA 3DXZA 2JVIA 4JP1A 5GJWB 1FMLA 1U2DC 2MYPA 1QMPA 3DVAB 1ODKA 4LEIA 2Q5FA 4JBYA 3P9YA 5DHAA 4G4JA 4EG5A 1K4YA 4MMZB 3TJZA 5B1EA 5EJ4A 3TUJC 1JDSA 4EOGA 4N0AC 2VG8A 3QUIA 1IE3A 2FWBA 3EDOA 4U39A 1U63A 1U7XA 2EG9A