3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
b'SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
3DL0A 2ZVQX 2GJ9A 821PA 3K9NA 3GFOA 5C1BA 1HE1C 2EYYA 1ZJ6A 1VMAA 4A8JB 2RGNA 3SQXA 2ZS7A 5E7MA 4CIDA 4ZKEA 4LV6A 1DAIA 4CVNA 1X2KA 1G41A 4XTCS 1UTIA 5JLJA 1S4QA 5AJVB 5KOYA 2O88A 4WVFA 1R0YA 4Q1EA 4Q47A 1SVLA 1XCPA 3GJ6A 4LHZA 2IA5A 5K8IA 3FOZA 2V3CC 3K9HA 1J90A 3OHMA 1Z0FA 3PVSA 4A6PA 1II9A 1L4UA 1NKTA 2IUUA 1RYFA 2PNIA 2GDJA 4L4UA 4OK5A 1XPOA 4QJ4A 4Q48A 1Z9QA 3RWOA 2WJYA 3KJHA 1WX6A 1G64A 5EP2A 1Z9ZA 3TW4A 3BFKA 4F38A 4PZZA 2LJ1A 5GVRA 1P7CA 1W48A 3D6TB 5EXSA 1NJFA 3OEHA 3MGCA 3O8BA 2DBYA 2VWFA 4JBYA 2J6KA 4LHWA 3RWMB 3WBJA 5LDDC 1G2BA 2V9PA 3BD9A 4TQ9A 1HTWA 1A82A 1CR2A 3DM5A 4FINA 2LX7A 2R44A 2C95A 3PUZA 4ACBA 3IIKA 3T61A 2ONJA 4PC3A 5DNYB 2WWWA 4CEIA 2ECKA 1DS6A 2J59A 1Z5ZA 3FB4A 4FMCB 1GCQC 2FZLA 3VS7A 1S96A 4LHXA 1B07A 4ACAA 5FBRB 5G3ZA 2ZR9A 1KHTA 1J8YF 1JJ7A 5FWBA 3ZH9B 4R0KA 1ABOA 1JR3A 4POAA 4IOJA 1AWOA 1E2GA 2WMOB 1CR4A 3BB1A 3SI7A 5JHGB 2AFIE 1Z0KA 3PENA 2GBLC 2VP9A 5JZVA 3E5HA 1DG3A 3AF3A 1H8KA 1XNJA 3P27A 2W83A 4NYMR 4OJQA 4U02A 4BLQA 1PKTA 4LX0A 2BTTA 3GQBA 1RLPC 2RGAA 4XH9B 3H2YA 4QHSA 1X2QA 4TZ0A 2VSXA 1R5OA 3EA0A 3DVLA 5DYIA 1TQ4A 1WFWA 2CHGA 2H1LA 1S8FA 2IHYA 1SEMA 2J0UA 1H65A 2GNOA 2A5YB 3AP1A 2ROLA 3Q72A 3Q3JB 1PRLC 1E79A 5GJCA 1OOTA 4XVUA 1UAAA 1E96A 1VCMA 1GRRA 5I11A 4TQUS 3TR0A 2BM1A 2HV8A 4A0GA 2QQ0A 4OKSA 1X8KA 3MRSA 5L3QA 4BLRA 2ZRPA 3GLIA 2NZJA 2G3YA 1DAGA 3RS2A 5JHHB 2LJ3A 1JQLB 1RRGA 3MUFA 4NCNA 4F4CA 1A2BA 3TK1A 3WMFA 5IXFA 5LD2B 4OMNA 4LWZA 3A1UA 2EYWA 1PLKA 3VAAA 2GBQA 1CJUC 1UKYA 1W2HA 4RY2A 4RKEA 4OQFA 5AUNB 4MRVA 3TE6A 2IYSA 1BOFA 1ZYUA 3IIJA 4Y0AA 1NVVR 5F9FA 2AX4A 2ZANA 3QBTA 2XOKD 1YKSA 1CU1A 1ELOA 1NMYA 4TLEA 5FBLB 3TRFA 3EG5A 3X2SA 1XJQA 3JVVA 2O31A 2V7QD 1CR1A 3C16C 1QHSA 3UIEA 3CO5A 1AWXA 2BMDA 2J0UB 3NVAA 4MRRA 2X1VA 1TUEA 1Z22A 3TMKA 4MRSA 4BEBA 1H8EA 2JCSA 1TU4A 3GLIB 3FKQA 1OPLA 2JLZA 3QPUA 4UNSA 3KB1A 4LOAA 2YNMA 3H0KA 2DBKA 5HZKA 2QGNA 3B5JA 3L0OA 1PUIA 4B73A 4GOKA 1OB5A 3PEUA 4A4DA 1NVWQ 1Z6GA 5EZ6B 1RYHA 3C0CA 1UDXA 4JYCA 4UQOA 2QTVB 4R2HA 3SHWA 3VMFA 2WSSD 4B74A 1G18A 2G0NA 5M04A 2XTMA 1ZD9A 2OAWA 1I2MA 1VG1A 5C2JB 4MDFA 5K8LA 1K1ZA 4IIOA 2FMXA 3MWLA 2I3BA 2J3EA 5A0FA 4LYJA 1N5LA 4L8GA 1NJGA 2RGGA 4DLVA 4RTWA 5I22A 5TVKA 4UNRA 1BMFD 3R8CA 1GM5A 1XXHE 2GWHA 4P4TA 2P3SA 4BUJA 4ZDWA 1NSFA 4DIDA 4OI4A 4DSTA 4PSKA 2YWEA 4OK6A 1V1CA 2KT1A 2LJ0A 3V9PA 3CX8A 2C9YA 1QLYA 1EGAA 3KXKA 4CDGA 2DVJA 4D4KA 3A58B 2LZ6B 3R20A 3TQFA 3GLHE 1KTVA 4AURA 2CSIA 1LVGA 2ZSAA 1KGDA 4OMLA 3AF1A 3B78A 1E0KA 1ANKA 4OHWA 1YR7A 1VA7A 3AVVA 1OYWA 4X8OA 3L0PA 4QFMA 3U2QA 3W6NA 3NBXX 1D2EA 1E2DA 1N6RA 1NY6A 1Q1EA 3QKSA 2C0OA 4G3XA 2JLQA 2OCAA 2VL7A 2GETA 3ZZ0A 3NH9A 2CK3D 4ZPXA 2VF8A 1ODFA 4MRPA 1TEVA 2GRJA 2DE0X 4C0HA 5FOUA 2B7BA 1HQCA 2WKQA 3TVDA 3G5UA 1DVRA 3EC1A 3LAWA 1U90A 4Q4LA 2BBSA 3ZQ6A 1E1RD 1IY0A 4JPBW 1AK2A 1XJ0A 3WXMA 3JV3A 2FPDA 1PLJA 2XNDA 3B1VA 2F7SA 3C5HA 4M0LA 5D3MA 3NHBA 5J4LA 5L8VA 3UMFA 3UMRA 3V00A 1G8GA 2LWIA 3QJYA 3X1YA 2H8KA 5BN3A 4CW7A 2JGNA 1GSIA 3RVBA 2ZE8A 2GZAA 2ZRGA 3REAB 3U3RA 4W5JA 5TDHA 1FQKA 2CDTA 2QMUA 1SZPA 4PO1A 2OSBA 4M1YA 1YNZA 4X1VA 2LKDA 2O5VA 3QKSB 4IVRA 5B57C 2VBCA 3LBNA 4M53A 2H16A 3SOPA 3UK6A 3VU9A 4G5OA 4CEHA 1NIPA 2BEJA 2AXPA 2CBZA 2D7CA 1ZBJA 5EE0A 1ZIOA 1YU9A 4YMWA 2CDNA 3CWZA 2D8JA 1R2QA 3O5ZA 4KXFB 4ZCIA 3H4MA 3NC1C 3L8YA 4WBSA 1E1QD 1U9IA 3A1TA 3TAHA 4Q1CA 2ZE6A 2DX1A 2KRNA 2O8DB 2L2PA 3I35A 5D3MB 2OUKA 1E9BA 2E1RA 1HY3A 5CYOA 4LGMA 3F0TA 4IJMA 4DLYA 2EFCB 1UJ0A 1QHGA 2X3XD 1AEYA 4AD8A 1P4SA 4DZZA 1NN1A 3ASYA 3P20A 2ODWA 2Q3HA 1CJMA 1Q57A 3THWA 2BC9A 3RLFA 2OFOA 2ZRAA 2ED0A 2JIZA 4WZAE 2QBYA 4PHGA 5C18A 1F2TA 4EJSA 1SSHA 1XTQA 1G20E 5KSZA 2QTFA 4B47A 4LI0A 2EBPA 2ZRFA 3B85A 3BS4A 3FDIA 2XAUA 4P31A 4WXRA 1F3OA 3EZFA 2V1UA 1R5NA 3RRMA 4GSYA 4IHQA 2DMOA 1WQ1R 2VHUA 2JMAA 2GEUA 4JBXA 3VU9B 1OV4A 3KFVA 2AD1A 2ONKA 4S35A 4KHZA 4ZDKA 1FX0A 1WXTA 5FTJA 1MO6A 2W0SA 3UWOA 5IF9A 1TNDA 3DPUA 1WBDA 5ELXA 3ETLA 5EXTA 2WIBA 5JCPA 4TSFD 2GXAA 4LUCA 2G1KA 1B0UA 2QSYA 4P0TA 5DO9A 5IK2D 3R8FA 2WWGA 2C03A 5D3QA 3U3OA 1ZP6A 4RFVA 3H84A 4R71A 1R8SA 1K9AA 3THWB 2V7QA 5DIFA 1FTSA 2QBYB 1ZVQA 4Q1BA 2VKNA 4EJSB 2O8CA 1Z6AA 2L3QA 1T6NA 2ASEA 2YOFA 2K9GA 2ENMA 3BXZA 5KDOA 2J7PD 1FUUA 3K0FB 5DE3A 3CRRA 4QM7A 5FW9A 2ATVA 1XD9A 3GEHA 1E2LA 1ZD8A 1YRBA 1G16A 3EHRA 3VKWA 1FX0B 4K46A 4BLPA 6Q21A 3WRXC 3K70D 2FH5B 3SFVA 2EFDB 1VG0B 2BCGY 2J7IA 2P2LA 2SEMA 3EHQA 2GQIA 4Z89A 2GK7A 1AN0A 1OYYA 4HAUA 4PQRA 5TMPA 2CCJA 1CKEA 5BW8A 4WOPA 1U2RA 1E99A 2W6JD 1SVIA 1ZX6A 2GF0A 4HAWA 4LV5B 3WP0A 2HCBA 2IF2A 3W5JA 1CJKC 3A4LA 3OEEA 2E5KA 3CRMA 3JZAA 4FMDB 2GESA 2JDID 4HLQB 2DHRA 4BZXA 2ZU0C 3PFIA 1X6VA 4OQMA 3ZQJA 3CRW1 1XZQA 4US1R 4DCVA 2O8CB 5TB5A 2CE2X 1Z28A 5C4GB 2QAGC 3SC3A 1BMFA 1EFRA 2KBFA 2OLJA 1ZC3A 2BBOA 2RQRA 2PX0A 4A92A 4M4ZA 2ORWA 4YDSA 3U7FB 2AK3A 2R6GA 3T1TA 3FMIA 1SVKA 1NLZA 3FMFA 4KI0A 1MV0B 4Z8YA 3FE2A 3UKDA 2OBMA 2QP3A 4LC1A 2HF8A 2R65A 4ESVA 3MSXA 2JLVA 3RBBB 1HURA 1C4OA 1UF9A 4GRAA 2RGBA 2Z4SA 3GFPA 3ICQB 1XRJA 1Z2AA 3DEFA 3CONA 1RI9A 4NONA 1A7JA 1N5ZA 2KBTA 5CDFA 1Q3HA 3CQTA 1GILA 3W5IA 1AOJA 3AVYA 1R6BX 2R6FA 3QG5A 2CL7X 2IS6A 3KB2A 1D6JA 1L7VC 4XJXA 3LLMA 1L8QA 4TQAA 4URUR 2EGEA 3W3AA 4OHXA 2QA5A 1Z0JA 2F55A 2K7AA 3T34A 2CK3A 1GWNA 4QRHA 1VPLA 1X86B 4DCUA 4HZUA 1I1JA 3R9WA 721PA 1IY1A 4QJ3A 1D2MA 3F5FA 3BFXA 2DRKA 4Q9HA 4GLMA 1E1RA 2OXRA 1OEBA 3FKSD 3SE0A 5F98A 2ZRHA 4II7A 4EUNA 3L8ZA 4WA7A 1HEIA 4O25A 3V4FA 2VO1A 5AJZA 2BVNA 3I62A 3IEUA 4O3MA 2W0ZA 1SVWA 2YVUA 2YUPA 5L3VA 1K0SA 1IJFA 1AZEA 1KNXA 4JKIA 1SXJE 2FNAA 4FWTA 2DFKB 4IDNA 4OJKA 3S1AB 5G41A 4JLVA 2QAJA 1W2GA 2WOJA 4F92B 4B3GA 1ONBA 4V0ME 1I4DD 1G17A 4NTZA 1E0AA 3CF0A 1KOFA 2C98A 3SNHA 1GBQA 2FPEA 3ZIAD 4AG5A 2IX3A 2DL5A 1IY2A 3IILA 5DN6A 5GJVC 2PLFA 2FRWA 5BWMA 1Q12A 2RGNC 4HZUB 3NC0C 3AF2A 5FPYA 2G1JA 3KL4A 2VSFA 4BFZA 2VSOA 3GEIA 4A0HA 2YC2C 2DL7A 4PX9A 3RNLA 4MKHA 4C0AC 1NSTA 3M0RA 5FBVB 4TL8A 2MMCA 4UNNA 1P2UA 2R6DA 1KSHA 2J05A 2NO1A 1E9DA 4EQ6A 3NH6A 2EVRA 3PUXA 4DLTA 1G83A 2IWHA 1Q0UA 3AQ4A 2IYVA 4Q9LA 2V1XA 3R9IA 1ZW6A 2C78A 3KKOA 4Q5IA 2QRZA 3K0EA 4GNKA 4KCGA 2QE7D 1CRPA 3QEJA 4BFWA 2J41A 2EYZA 2PJRA 1NLYA 2JLYA 4P32A 1JEDA 3NEJA 1S3SA 3NIBA 4TTPA 1G3IA 3DDCA 4Q1FA 1KI3A 1HV8A 3LDAA 4J9FA 5KNCA 2F2VA 4HAYA 2Z6VA 4XSGA 1CRQA 2X2FA 5JS8A 4B3BA 4NBSA 1JECA 5B64A 2HJGA 4JSTA 3FHCB 4MGKR 4C3ZA 4TSFA 2V55B 2OZEA 2ORIA 1OIVA 4A2WA 3U3JA 4JT4A 2RHMA 4LBYA 3RYTC 4BFTA 1T3HA 3SJZA 5KNBA 1M7GA 3VKGA 5AJWA 2CE7A 3BORA 4F4IA 1W47A 1PVOA 3UA7A 3RANA 5CB6A 3PUWA 3LA6A 2A78A 2BMFA 1CLUA 1TMKA 1K6MA 4PPFA 2Z5FA 3IO3A 3SJBA 4DDWA 2ZJOA 3B13B 4Z1MD 3PJRA 1WCV1 4XSHA 1QVAA 1TADA 3LY5A 5EE9A 2FWRA 3M0TA 2HT6A 2ZSFA 4RCZA 2ZM5A 4G01B 4JVMA 5DGXA 3U7EB 4H1VA 3GJ5A 2O0HA 1EFTA 1KAGA 4Q9KA 1S9DA 2YZ2A 4BZPA 3WNDA 1KDRA 4B76A 4LC0A 3I5SA 1W4CA 2DA9A 4LJ8A 2GJKA 4Z8AA 2OI3A 1OHHD 2F1RA 1Z83A 4IOKA 5DH9A 1KK2A 2CL0X 1XZPA 3TR5A 4TMKA 1JEGA 1FUKA 2W6JA 3NKVA 1LB1B 2FO0A 4I1UA 1N2CE 2EVWX 3CPJB 4IXMA 1YRAA 4Q7JB 2ZPTX 4TMTA 5AUQA 5J4HA 2RGDA 2ZI5A 2P0EA 2AXNA 2GJ8A 3CWQA 3LWNA 4V03A 1KAOA 4DLXA 1UE9A 3L2OB 1VCNA 2VYFA 2DNUA 2RN8A 1QHXA 2GHIA 3QQ5A 5JRZA 2FN4A 2IXFA 3NDBB 4ZV4A 1J3TA 1JAIA 5FOTA 2JLWA 3C14C 3ADCA 2A5FA 3CBQA 1Z3IX 1GRNA 4X8MA 1II0A 2K2MA 3K70B 1OIWA 2KYBA 3I9QA 2BBTA 3QVVA 3FPAA 2QNRA 5EC7A 1TQ2A 3D31A 5CM8B 2QM8A 1GBRA 1P5ZB 2PMDA 3ZGXA 3AH8A 4TL9A 2D7DA 3HU3A 3H0IA 4YXWD 2YKGA 1CR0A 4CC3A 3P1JA 1QKXA 1Y63A 3CKLA 4ZCLA 2GXQA 2D3WA 4PFSA 1FMKA 3QI2A 2KB0A 4A2QA 4W9MC 4WW0A 2JJ1D 3K8YA 1M3BA 3KFXA 3VNVA 5EQTA 1TUDA 4RTYA 3PUVA 5JCZA 3MWYW 1YZKA 1BKDR 1GL6A 1KZGB 2RB4A 2ZAOA 3OAAD 4IVQA 4NHOA 3RSOA 3VFDA 4B3CA 1G3MA 4DUGA 3RS7A 2D2EA 1BYUA 2XZLA 3MWKA 2OFWA 1TF2A 4B3FX 4Q4AB 521PA 1OSNA 3FKSA 3ZVNA 2VP4A 3KTAA 2ZEJA 1BBZA 1LS1A 1XWIA 3HYRA 1DG1G 1NVXQ 1N6HA 4W5WA 4JL5A 1AQUA 1RRPA 4A8JA 2NPIA 4DWJA 4F91B 2GCNA 2VP2A 5JWRA 1PLLA 2P6UA 3IBGA 4PC7A 3TIFA 1ZAKA 2FSHA 1DAEA 4B33A 2XJ4A 2HBWA 4QKQA 3CIOA 4B2IA 4B6EA 2BWJA 3EXAA 4MYCA 4X8HA 1NLPC 5IHIA 2QGZA 2B92A 3KXLA 4K8OA 4AI6A 4BASA 2P67A 2FG5A 2VEDA 2G0TA 2RAPA 2ZUBA 1Z0DA 3C5CA 2J06A 4Y0VA 2AZSA 1NMXA 5JJIA 4LPSA 2IUTA 2OILA 1IONA 2QUZA 3SYLA 2KXCA 4OMOA 4B75A 2ODNA 1E2EA 2HXSA 1XCGB 5EP4A 1H8HA 1UADA 4WAUA 5DLQC 2YUOA 1LTQA 4E5UA 3T12A 1N0WA 2X19A 4IEEA 1Q3TA 4QBIA 1G7TA 2YJTD 5SZJA 2YSQA 4HDOB 3FVQA 1FMLA 3KTAB 5C4MA 1IXZA 1FPMA 2EWWA 2OAP1 3Q9LA 4QGHA 2WJHA 4PQFA 3Q85A 3I4LA 3W6PA 2EPDA 4JLAA 2CCGA 1MV3A 4A1FA 5DISB 4MKIA 5CJPA 2JS2A 1WF3A 1CF4A 1HD3A 1KDOA 1W36C 3A98A 4LUDA 1E69A 3REGA 1BIFA 1KNQA 1N6LA 2IYTA 3SJCA 5JJLA 2JTEA 4OQXA 2KE5A 4Q4AA 1C9KA 3AUYA 1AS0A 2BJVA 4BFYA 5KSOA 4WIAA 4YQFA 4HI0E 1SXJD 4OYHA 5DYGA 1WP9A 2F1IA 1BB9A 1E2KA 1G5TA 1JPJA 2B6HA 1KK1A 2WHXA 1NVUQ 1E7OA 4RD6A 5AJXA 4ON9A 2AKYA 5JS7A 4TL7A 1PV4A 2LNHB 4CEJA 2HDNB 1I4LD 2ZRNA 4UXJA 3I92A 2J0VA 4JZ4A 4U7DA 3EG3A 2WPDD 1RKBA 4R9UC 1GKUB 1Z2CA 4CYMA 2PH1A 2ZI4A 1YZUA 4UNPA 2L0XA 5BXQC 8OHMA 1ZC4A 4RTTA 4KAXA 2OXCA 3K1JA 4DC9A 4HLUA 4KSBA 2D74A 3EG1A 4FIDA 1SPKA 2XITA 4I1SA 4IDHA 5HE8A 4B2PA 3M6AA 5AUOB 2NO7A 4HEJA 2IC5A 4TYQA 2D2FA 2BIFA 3M1IA 2WAXA 5BYKA 2FZ4A 1SQ5A 3SFZA 1XBTA 2XSZD 1U9IC 2P6RA 4K11A 1UFQA 2C96A 1HH4A 1SVOA 3CR8A 3FHOA 3OIYA 2RGEA 4NDZA 4Z1MA 1GCPA 4JJKA 1E32A 2DFLA 2ZI6A 2LQWA 2QU8A 1XU4A 2FSGA 2OBNA 4RKFA 1F6BA 1GFCA 1V5WA 3CF6R 3MG9A 3CZQA 3AV0B 3T1QA 1X8LA 2YWHA 4FCTA 4CEJB 4RZXA 5HPYB 1S1MA 3IQWA 4B71A 4EJSC 1KY3A 3GLFE 1FNMA 2LMJA 1XEXA 4QGFA 5JFGA 1O87A 4KV9A 5FTLA 1K0XA 2HT1A 1OHHA 1QG2A 1S0UA 1M74A 1Z29A 3PV0A 4PANA 3QEOA 4C2TA 3HU1A 1DAHA 1NMZA 4JVLA 2ZRJA 5KO2A 3QY0A 2ZR0A 1NP6A 1E2PA 3QE0A 3I1FA 1HT1E 2V1QA 1NG9A 1W44A 3TGPA 3P4YA 1RJ9A 2L3SA 1HQYE 1E6GA 3KKQA 1G8PA 2RNAA 3PG5A 3C4JA 3OF5A 1TUCA 3JZMA 4QHYA 1ZNYA 1M6NA 4FW9A 4QJ5A 3KJIA 2EW3A 1ZM9A 2YHSA 3LX5A 1YQTA 2VQSA 1W0JD 3GLGE 4AIIA 1UJYA 4E22A 3EC2A 3LQRA 4AKGA 4GT1A 1KI4A 2XB2A 4KSCA 2EGAA 3K9LA 1W49A 4CZ2A 4Q4HA 2QZ4A 3TSZA 3OIVA 4D4LA 1CJVC 1DO2A 3BFVA 4RJLA 5J40A 5LB2A 4M1SA 5F9HA 4QOSA 1XEXB 4L15A 4PC1A 4RZ3A 2F3TA 3K09A 3HPQA 3VRZA 1YZTA 3CF2A 3JVUA 5CK4A 3RS3A 4EFNA 121PA 2D4HA 5SZKB 1UM8A 3K53A 2YUNA 2OBLA 3QXSA 1PRMC 4LPKA 4D25A 1WB9A 1I07A 1RJ9B 1E98A 3BC1A 1RUWA 1ZINA 1QKWA 2RQTA 2QN6A 3VR1A 4JT2A 1JNYA 3WP1B 2GCOA 2O0KA 1FFHA 2AKAB 4PPQA 1U3OA 2IS2A 1ZUYA 4Q66C 3IQXA 2EYXA 1E9SA 4F16A 2Y8EA 3KJEA 1GZSA 3AGQA 1M27C 2OCPA 3QF4B 2FA9A 3W3ZB 1E2JA 2VLIA 1M3AA 4Q4HB 3ZD7A 4M1TA 1FMJA 2IYRA 3ND8A 1ZNXA 4IEIA 2DYKA 3QSYA 1KI6A 1NYGA 2WJIA 2ZREA 3SBDA 3W34A 2P6NA 2ZRDA 1UPTA 4AYTA 1UBCA 1IXRC 1IM2A 3FFBA 3L0SA 3CX7A 1MH1A 1UJ2A 2R62A 4AG1C 1G9XA 3U6KA 2ANBA 3DMDA 4OHYA 1P72A 1ARKA 4KJZA 1OH5A 3CH5A 3RC3A 2AFHE 1TQ6A 2ZUDA 2HDAA 2X3WD 1S9HA 2GCOB 4I99A 4LSGA 1ZUNB 4KVGA 2IYWA 1AGPA 2XXAA 1YR6A 2D0NA 3ZVLA 1AQYA 3NHAA 4MGZR 1E2HA 2IBMA 4A82A 5EXPA 4GZLA 1MR3F 3KXIA 3CLVA 3GJ3A 2HXYA 1AZTA 1MABA 1U94A 1OV3A 1TEXA 4GP6A 3I5XA 4Q7LA 3ZS9A 4G5SA 2NO9A 3R7WB 2QM7A 4HUTA 5CLQA 1N0VC 1FW6A 4J0QA 4HYYA 1KI6B 3WNCA 1W46A 3GCGA 2CJWA 1DEKA 1XJCA 4D26A 3SDZA 5L3RA 2O0JA 2I4IA 1K8RA 1UEIA 4GPTA 4HB0A 1U81A 3FFAA 4UJ5A 2FV8A 4F14A 1GRQA 3KKPA 5KU1A 3M0SA 3OIWA 4IDOA 4JZKA 5CYPA 1KMQA 4ZDJA 1HSQA 2A08A 2AHOA 3OE7D 4V0OA 1YZNA 3M4YA 3VS5A 5P21A 4H9GA 1HT2E 2JLSA 4A2PA 1DADA 4Q7KA 2XXAB 1N25A 1ZUUA 2PZGA 2G6FX 1JAHA 2N42A 3FMPB 2O8DA 2W2XA 1RRFA 1MABB 5GJBA 2RMKA 2ZTSA 1T8TA 2ZQ5A 4OI0A 4FCVA 2F9MA 2W6ID 1KI9A 1R5BA 1W5SA 3C8UA 3VNUA 1OKKD 1WXUA 4HUQA 3U44B 1P73A 2QL6A 2D8HA 2C0IA 2JATA 3P26A 1OJLA 4C0KA 1G6HA 1E6HA 3BBPA 4WZBE 5KPJA 2PT7A 4JLMA 2CJWB 1S1CA 2W2VA 2ZR7A 2XSZA 2WJJA 4TZ6A 1F48A 4L9WA 2JJ8A 2J7KA 1X6GA 1EK0A 2RQUA 1Q21A 4XWOA 4C0SA 5FL3A 1TL7C 1N6OA 3QXXA 2RCNA 4GI7A 4BRWA 4CF7A 3LW7A 3O8CA 3BJIC 3THOA 1PNJA 1RZ3A 4RZUA 1JO8A 3B7GA 1LY1A 1G3QA 1P75A 2P65A 4MRNA 1E9CA 2IUSA 4TL6A 4O0MA 5JMTA 4Q9JA 1Q1ZA 2C04A 2DPXA 2ORVA 1TPZA 4TTQA 3ICEA 1XFAA 3NGPA 3THKA 1OXUA 4TYWA 5H1YA 4JIMA 2EFEB 1WBBA 1QCFA 2KGTA 1N5JA 2A2ZA 2JM8A 2OJ2A 3ZD6A 2GGRA 4KFUA 4GMXA 4HUQB 5CITA 3ADDA 2CEAA 4V0LA 2EFHB 2MSCB 4OK3A 4BRUA 1NKSA 4MA4A 4N1AA 1AZSC 1A5TA 1UBEA 1TG0A 1I0CA 1HUQA 4G5QA 3X1DA 3HU2A 4W5HA 1I4TD 3GJ4A 3ZYCA 1XMIA 1I2DA 2XEXA 4ASUD 2CH4W 1FP7A 4OMPA 2PBRA 3K0FA 2VH5R 1KMHA 2XB4A 1CKAA 4PO9A 2BOVA 2CHQA 3QXCA 1PJRA 1MRSA 4ESHA 5IHPA 2A3RA 1R0WA 1NN3A 4PQYA 2K3BA 3VS0A 1JR3E 3QF7A 5JBQA 3T1OA 1UFFA 2ZJYA 2JLXA 1TTTA 4V0NA 1ZM7A 3BOSA 1M8MA 1JBKA 2VHTA 4NPHA 4RD4A 3X1ZA 3AM1A 4P33A 5FTKA 1OH8A 4MKFA 3KDSE 1YVDA 2VF7A 2PTKA 3EPJA 2JJ2D 2XOKA 4MDEA 3THXB 4GOXA 4JVNA 2RHDA 2ZRKA 4Q03A 2J0SA 1ZNZA 1Y3AA 1NM7A 3U23A 4DLSA 2V54A 4D81A 3QXHA 2XX3A 2OESA 2YV5A 3CH4B 1S2MA 4FCWA 1M7HA 1E2IA 4RD3A 1WXBA 3VHLB 2ED1A 4BLTA 2FFQA 1XCMA 1ESMA 5AK0A 3E2IA 1VTKA 5BN5A 4PSAA 3UXMA 2IF0A 3FWYA 1KMHB 4LBZA 4PZYA 2VRWA 3QVUA 5KUTA 2VPPA 3PVQA 1G8HA 1OXSC 1D9ZA 5DI3B 4MYHA 5KNDA 2M0YA 4IOLA 2RGCA 5EE5B 2DL8A 1ZCAA 4IDPA 2F3RA 2VP5A 1JI0A 2QORA 1NLOC 2QP4A 2WKRA 1W70A 2ZI7A 4TTRA 1U0LA 1P2VA 4HVVA 3KJGA 3EZ9A 2WSSA 1JB1A 2OAQ1 4LDJA 1D5CA 2ATXA 1QWEA 1ZUKA 2DR3A 3AVTA 4GFDA 1YHNA 5FR2A 2GXUA 4ZI2A 1Q20A 1KDTA 3LD9A 2NWMA 2L3PA 4J9EA 2QG6A 4C0LA 4Q1AA 4DSUA 4HZIA 3SU8A 4KVAA 3BERA 4LHVA 5FL7D 1E2MA 3R6NA 4PC6A 1NEBA 3VKHA 4I81A 3QPVA 3A1VA 4D4MA 4MH0R 1OH7A 1MO5A 4TMVA 2NOAA 3GMTA 1GNRA 3QNUA 2FEIA 5TXGA 1T0HA 3QKUA 4J9DA 4FI3C 1S1NA 4J9HA 2A5GA 4MITA 2FEMA 1RE0A 1W4AA 2UVQA 5FFMA 2IWRA 2A28A 2Q0HA 2QTHA 3DKPA 4UJ3A 1Z0IA 2CH4A 4HVUA 1U8ZA 1H92A 1NF3A 1QG4A 4NU0A 3SN6A 5GJWB 2O52A 4GMDA 4N0DA 1EWQA 4LY6A 2A5JA 3S1AA 2VP0A 2CT3A 2PZEA 2X77A 1G21E 4MGIR 1G7SA 2IL1A 1GVNB 1Y57A 3NEYA 2PZ1A 4KO8A 2JA1A 2EWVA 2V4ZA 3U3KA 4NCJA 2Q3MA 3B1YA 3EWAA 2WSMA 5HKKD 1X8JA 2RF0A 3N70A 1KO1A 1G3RA 4PSVA 5ANRB 2Q6TA 4XIGS 1XD8A 1ZCBA 3OE7A 2EGCA 2AL7A 1DO0A 1R4AA 3HR7A 4OL0A 3WYAA 4A8JC 1KFZA 1XF9A 4NYIQ 4DIEA 4ESRA 1QWFA 1GP2A 1XDBA 3LO5A 2ROTA 4D0LB 5J4KA 1RPZA 1XOVA 1U8YA 2VIIA 1CKBA 1N5KA 3SHFA 4WCIA 1T0HB 2MMGA 4AKIA 3VS2A 2H7VA 3ZDQA 2ZYTX 3A1WA 5B30A 4MUAA 2FPKA 3IQLA 1E2NA 1R10A 1AWWA 2MCNA 1OKKA 5H68A 3BH0A 3HP1A 3LV8A 3P32A 5KDDA 1G3UA 2J45A 2CNWD 2ZAMA 3C41J 3I3SR 3LVQE 4G5GA 2HLDD 4DT1A 2E9SA 1R7RA 3RABA 4JJCA 5BN4A 1SVMA 3CRQA 4JZ3A 1MKYA 2FX3A 1XPRA 3TSOA 1DAKA 1J7KA 3WYFA 5FI1B 1CBUA 4X8LA 4KLNA 1OFIA 1OFUX 2A36A 1W1FA 1CIPA 2ZJAA 1VCOA 1M1YE 4HDQB 4RSGA 4EPTA 5JJKA 4HLCA 1QBKC 3B1WA 3BIFA 1NEGA 3CPHA 3TW8B 2KE9A 1G4AE 2J9RA 3QG1A 5JSZA 5L3SB 3Q5DA 4IFEA 1VDZA 1E2QA 4RCYA 3LVRE 1M34E 1AA9A 3KKMA 3U7GA 2QPTA 1E1QA 1TAGA 2C5LA 3IEVA 1WA7A 2PCJA 2XZPA 3VR3A 1TF5A 2FFAA 4YONB 3C7KA 1KSWA 3IUYA 1E94E 3TQCA 3A4MA 4DDTA 3DOFA 1SHGA 3B60A 5HCNA 3TBKA 3AKEA 2GTPA 3RC8A 2GXSA 3L82B 4KITB 1X1SA 1R0XA 5A5GA 4DT1B 2DF6A 5C46F 1N6NA 3QOFA 2JAQA 4PO8A 3GJ0A 3IO5A 1AKYA 1M8PA 1GOTA 1KIKA 1UKEA 3QUSA 1EX7A 4QT7A 1NI3A 4C2UA 3DOEA 2JW4A 2ZSBA 3E1SA 3MMPA 4G5RA 3SYKA 2EYUA 5SZHB 2MIOA 4UXHA 2NQ2C 2NTYC 5FBWB 5JSZB 3BK7A 4BFSA 1XMJA 1PWTA 4FSSA 4D82A 1PKSA 2GAAA 2FSFA 4Q02A 2A30A 3LBIA 1L2TA 1YN8A 2HUPA 2LQNA 4NYJQ 1JU5C 5CIWA 5IK2A 2KT8A 5JEDA 3A8TA 2BZYA 1CS4C 1DAMA 2IS4A 2YT6A 3LNCA 4N3NA 4DLRA 4PPGA 5LD2C 1ZIPA 3GLFA 4JL8A 2C0TA 2FPMA 4NZYA 3KKNA 4DSNA 1Q1QA 2DWOA 1ZNWA 2ECZA 3PE0A 4K81B 2OE2A 2EQIA 1HE8B 2J7PA 3MD0A 1WI7A 2CREA 3O8DA 1YR9A 2ZITA 1IHUA 2QMOA 3AVUA 1HA3A 3RS5A 4R98A 3K0AA 5DI9A 2QPAA 5TV2A 5FOVA 1KSFX 3WMEA 1NY5A 3F3YA 2FU5C 3U60B 2YOHA 2DL3A 1J70A 2EW1A 2OCYC 4KBFA 4LN2A 1N6IA 1IN7A 1T3SA 1T0JA 1VG9B 5GADl 1OB2A 4M9XA 1JR3D 1US8B 2Z83A 1PZNA 1T3LA 2VHJA 3MLEA 2PMKA 3K0SA 1N6PA 5FOSA 3U7HB 2ABLA 1NBME 2JDIA 3GLFB 3UF4A 1U99A 3AGPA 1XP8A 4HDCA 4DJTA 3IGFA 2CT4A 2W0MA 2ODEA 3A37A 1KSGA 4KYUA 2IYYA 4FMCF 3CUEF 2BDTA 3CM0A 3K09C 2ZXUA 1K5GA 4LJ6A 2QPOA 2NUZA 1NG1A 4NKRA 4J9BA 4GP7A 4IOMA 1BO6A 1MRNA 2GILA 2IT1A 2FJUA 3K0AB 4ZDIA 1YJ5A 2F43A 4QL3A 1LS6A 3MJHA 2DCUA 4HB4A 4N0EA 2H8HA 1Z08A 1T0JB 2OT3B 5GVSA 4KU4A 3VQTA 3GFTA 2W00A 2SHKA 4OHZA 5CM9C 2AD5A 4D4JA 4EIKA 2W10A 2CUBA 1OW3B 3TUZC 4Q19A 1E9RA 2HCKA 2G6BA 2QT1A 3NBYC 3AP2A 4M1OA 2NO0A 5HKKA 1M3CA 2NGRA 2BV3A 3PQCA 1AZGB 2IXGA 2IW3A 2ZYVX 2RPNA 1KDPA 2IEYA 2GZHA 1GUAA 3CPEA 5FOXA 1JQJC 3WBKA 1Z6YA 2ANCA 2GCPA 1XPUA 2WWFA 1CP2A 3B9PA 3NPFA 4LHYA 4XVRA 2WWYA 1BU1A 2KSQA 4LJAA 4A9AA 4Q18A 3VX3A 2Q9CA 1XXHA 3NWJA 3SR0A 4DBLC 5K8UA 2ZI9A 1AGRA 1IXSB 4AWXA 2F43B 2KRSA 4BPBA 2B8WA 1H8ED 2GF9A 4KBGA 4M2LA 2Q21A 3I73A 2KNBB 5FBQB 2E87A 4JMPA 4LJ9A 3M0UA 2N46A 1W1WA 2VTKA 2X8AA 2XTZA 4JLBA 5E95A 2HLDA 4RTXA 1W5TA 5KSYA 5CDFE 2AK2A 1MUZA 1YCSB 1KI2A 2B8TA 5J5CA 1E0JA 3KUDA 2H5EA 3GLHA 5EUQB 4LUEA 3RS4A 3ZIAA 1WDXA 2ZROA 4B35A 1AIPA 2DM1A 1J2JA 4HSEA 1QRAA 1TX4B 1UKZA 5EXXA 3SEAA 3AVPA 4M9SA 2O2OA 4AKHA 1SHFA 5FR1A 3VR5A 1AM4D 1XTJA 1E4YA 4D0GA 1QHHA 3KX2A 3PEYA 2IYLD 4LZZA 1RFLA 3H86A 2QDLA 3LRPA 1MO3A 1XMVA 3CZPA 1OLOA 1XXHB 4DHEA 2ZJZA 5HR5A 3HYTA 1CXZA 1KO5A 1SKYE 1G7CA 2W58A 4D6PA 1WDTA 2WZQA 1U98A 1ESNA 3UWKA 2GAOA 3ADKA 2YUQA 3U6BA 4MUBA 3NTUA 1RC8A 2RKOA 4LBWA 4QNMA 5CLLA 2QE7A 3X1WA 2QT0A 1B3QA 4CGZA 1FYNA 3GLHB 3VHXA 3NMZC 4HAVA 3LBHA 2A37A 2KYMA 2WKPA 1G19A 2P5TB 3UANA 2YYZA 4PAOA 1E6CA 1LF5A 4OMQA 1ZUHA 4B32A 3NBFA 1SVSA 4IKEA 4RZ2A 4QGGA 2KEAA 3PR1A 3A6PC 2CMKA 1QHHB 3OESA 2IS1A 2C77A 2GVDC 1ZSGA 2REXB 1FL9A 1VIYA 3A36A 2V6IA 3ONWA 4OI1A 3PEWA 3BB3A 5FWCA 3IHWA 4YC7A 3V4RA 5CJ2A 4KFRA 3FJ5A 3T35A 2Q3FA 3A4NA 1NLFA 1A2KC 1VKJA 1M2OB 4P4UA 3SYNA 2JASA 1IJEA 3LX8A 4EKDA 1KY2A 4E03A 2ZE7A 3ZL7C 1W36D 3TH5A 4NYMQ 1XD2A 4I1VA 4DDUA 2IYZA 2ZETA 4URYR 1HJDA 5E4FA 2XNDD 3H41A 2JS0A 3EZ7A 2PT5A 5EP3A 3ZJYA 3OIUA 4OI2A 4F7WA 2GK6A 4OMMA 3E70C 3REBB 5B2ZA 2PCLA 4H1UA 3ZZTA 4DCSA 5EJEA 4L9SA 3WYGA 4B6FA 2JM9A 3KQNA 1BH2A 5GJVB 1QHYA 3N2IA 3O8RA 4QC2A 2ZRMA 4DVGA 3EIEA 5BYJA 4JLPA 4LNPA 4Q7MB 4RTUA 2YC4C 2KI5A 1GNQA 3TAUA 2UZIR 1JR6A 2GEDA 3RRZA 5A4JA 2HEIA 2QENA 3AEZA 3BH7A 2ODBA 3EW9A 5KPDA 1IBRA 2YWFA 1KI8A 2WJGA 2Z43A 4LBVA 5FTNA 2HYIC 3MAAC 1EWRA 1II8A 2H18A 2NMVA 3T5DA 3K0CA 2FGJA 2IHBA 1WYXA 3DZ8A 1SRLA 3EPKA 4RFSA 1P2TA 1GIAA 2DL4A 1XD2B 2QSZA 3D8BA 2HF9A 1JEEA 1XB2A 1NVVQ 1XTRA 2FF7A 5JRJA 2J0QA 2JXBA 1YZGA 1T4GA 1VYUA 2YINC 1MO4A 3GEEA 4C0BA 2BBWA 2HSPA 2WWXA 4C9BA 1H3HA 1IOZA 3LFUA 5H8WA 3EIHA 4DRZA 4D8DA 4QBHA 2DB3A 2CXXA 3T06B 1XEFA 4PR0A 1CULC 5LPNA 3QF4A 3THYA 2B86A 2OFXA 2JIZD 4TYPA 2IK8A 4BEJA 2D06A 1BYIA 2GZDA 4CEIB 4Z54A 2QROA 1M7BA 3HJNA 1XEWY 4BFVA 4RD0A 3N5CA 2WBLC 2XJ9A 3TJZA 3QBVA 1UEJA 3J81k 3ZVRA 4YXWA 3I61A 1R8QA 3L43A 4IRUB 1N5IA 3BAFA 5G3YA 1II8B 4Q21A 3EGUA 3B9QA 2G9NA 1KKMA 4FD2A 2ZRCA 1RW4A 2JJ1A 5EZ5A 3TNFA 1EFUA 4RFSB 4ZKDA 2Q9AA 3FGNA 5FTMA 2V1RA 4TYNA 5E7JA 5IH2A 4Z88A 5J47A 5GJWC 4ZIRA 3T15A 3OAAA 1Z0AA 4GBQA 3VR2A 4TLCA 3SEMA 1UDLA 1LCKA 4NCHA 4QBGB 2FPFA 3BH6A 1N6KA 4EFLA 3NG1A 1NBMD 1FQJA 4OQLA 1D2NA 1CSKA 4PXAA 5IT5A 2FEOA 3LH5A 2GKSA 1DAFA 3B6EA 2BJWA 4DLUA 3PIRA 4CT4B 3THYB 1JXOA 4DLZA 3QKRA 4BGDA 1NN0A 3R7WA 3M0EA 4AC9A 2C8VA 5EE1A 2A9KA 1AS3A 1E4VA 3PITA 4TN1A 1NYFA 4RTZA 5IRCD 1OIXA 2O8EA 4LJ4A 4XD7D 3WNBA 1WE2A 5E3HA 3AF0A 5IHKA 3ND9A 1F5NA 3F8TA 1L4YA 4B43A 5L3QB 2WIAA 3WHKA 2JMCA 1X27A 1GL5A 4L16A 1GTVA 2EQBA 1AWJA 3ADBA 1YWPA 4JLJA 3GD7A 2J46A 3ZZUA 4GDFA 2GJAA 2X2EA 4QHTA 3CX6A 4ZIRB 1YE8A 3QKTA 4QNRA 1JXMA 2F2XA 1XTSA 2CHVA 2J6FA 2D62A 3QPWA 4QG7A 1E9FA 2ZJ8A 3AKDA 4JL6A 2RQWA 3OEED 4YMVA 3HPRA 3CB4A 1W4BA 4C30A 5J4YA 4URXR 3QKRB 2DRMA 4V02A 5EP1A 3U44A 2CLDX 2V8OA 1Z07A 2V6JA 1KO7A 2L0AA 2WWIA 3X1XA 2SRCA 3NHNA 1EFRD 1G1MA 2A7QA 2O8EB 1XTIA 1OFTA 2ZJBA 4JS0A 3REFA 1TU3A 4JBWA 3UG7A 5JI2E 5FUYA 1IN6A 5FPHA 4Z8XA 2BKEA 2W2TA 1OT3A 1F2UA 2MSEB 4B34A 3AVWA 3UATA 2EYQA 4FMDF 1SXJA 4M1KA 4ARZA 1UGVA 4F17A 2AK5A 1JPNA 5SZIA 3L0IB 1NL3A 4QBFA 4URVR 1XX6A 2DJQA 4XTRA 1FP6A 2OV2A 4V0MA 1LFDB 2RQVA 5B58C 1KK3A 1QDEA 2ZJ2A 3W8RA 3FMOB 4HB3A 3CW2A 4NH0A 2WPDA 4UKDA 1E2FA 3BE4A 1Q44A 1X1RA 4Y92A 4URWR 4BLSA 1Y0MA 4EAQA 2WMNB 4TLAA 1AS2A 4RUGA 2F6RA 4BZQA 4L5BA 1JALA 1ETUA 2Z4RA 4P3YA 4YLGA 4YMUA 1KKLA 4IVPA 4MGYR 5FUVA 3FHTA 3LLUA 5G40A 2RMOA 3KQLA 1J8MF 1T91A 5G53C 4EIWA 4LJ5A 5AUPB 2DBMA 1CJTC 4I4LA 2FG0A 1G291 4LRWA 4DCNA 3WY9A 2FRYA 1F2UB 4B3DA 4AFUC 2DYBA 2H92A 3DHWC 2FDCA 4QXAA 3RAPR 4IIMA 1LF0A 5UKDA 2JLUA 4A36A 1SXJB 3HR8A 4RD2A 5JWHA 4ARZB 4GL2A 3OFND 3A1SA 2CUDA 5FPTA 4KLZA 1AVZC 4PZLA 2FPLA 2J87A 5IXBA 1G8FA 2A5DA 4DB4A 3D3QA 4S2EA 5DHFA 3VX4A 1PHTA 5FH9A 3UA6A 4LE9A 2C9OA 2C99A 2CVHA 4PAQA 3TUJC 1IO6A 5CK5A 1T8UA 2OG2A 3EX7C 1K4US 4TYYA 4IW3B 4EPYA 3EPLA 2DWPA 3THXA 4LYFA 3QWYA 4CRWB 4TT3D 4IDQA 5DN6D 2ZE5A 1WXQA 3DO6A 1KI1A 1UG1A 3I8SA 1G5RA 1ZM4A 2KRMA 4TLDA 2XMFA 1ZRHA 3GJ8A 1NG2A 1W36B 4KYIB 1GKIA 1G7RA 5JWOA 3IPXA 4Q01A 5CB8A 3U5ZB 1GCQA 1GDDA 4XWAA 3AVOA 3RNJA 4JLNA 5AJYA 2J5XA 3Q7PA 4HAZA 1W0JA 1T5IA 2ZYWX 3KQHA 5HZHA 1OFHA 4JLKA 4PHHA 421PA 4ABYA 1JQQA 5DI3A 4RVCA 1U5SA 5FOWA 4QM6A 4NP6A 4DXAA 3U4QA 3VR6A 1FOEB 1ZU4A 2BM0A 3HDTA 2VVKA 4ZCMA 3R9XA 3KUCA 2GBLA 2PEZA 3NDPA 3SJAA 5J4VA 3H0FA 5KHOC 4XVQA 2KROA 1YP5A 2LKCA 4YMTA 1PUJA 2P5SA 1KSJA 5K8TA 5FUXA 4ILEA 3D7MA 1TF7A 4URZR 4CEHB 4A6XA 4MYTA 4LYHA 4NL4H 5JEEA 1UBGA 3K70C 2Q9BA 1P9WA 4A0FA 5AR1A 4JLDA 1G5PA 3O47A 2TMKA 1QZXA 1NNEA 4D2IA 3GJXC 2GEVA 2IYUA 2QMEA 5FUWA 2BHRA 1Z6XA 3EAQA 4CT5A 4FWIB 1SULA 3BGWA 3PVLA 1UUEA 4MKGA 1UDWA 5AWFC 2BCJQ 3GLIE 1NBMA 1EXMA 1P3JA 1UBFA 2BMEA 2UZ3A 3CNLA 3U4QB 1VHTA 2BZXA 1QF9A 3CNNA 4Z51A 2O8BA 1LW7A 1WLPB 1IN8A 3U61B 2LCFA 2ZUCA 1F2TB 4WXPA 4ERNA 2M51A 1T5LA 1ZBDA 3VS6A 4M4SA 4B48A 1LNZA 2IEZA 1U0JA 2FOLA 3WRYC 3N2EA 4TLBA 2WICA 4AYWA 3PUYA 1E0SA 4HAXA 4UNQA 4XD7A 2O9SA 5IHNA 1QVRA 5DHAA 4AG6A 3LXRA 3MJRA 2WAYA 2VP6A 2ZSDA 4US0R 2WTUA 2DILA 2OEPA 3B8HA 4KODA 2R9VA 3G82C 5F2EA 4MQBA 2P4RA 1GKYA 2CCKA 3SBEA 4I1OA 4EPXA 2H17A 4LJ7A 2CLCX 1R0ZA 3RSLA 3UG6A 1BK2A 2BMJA 4EPWA 3B82A 2F1JA 3K9GA 4BFXA 4NCIA 1KO4A 2K5UA 1IN5A 1P2SA 3AKYA 2PZFA 3QENA 4HB2A 1VECA 4UXIA 2GTOA 4AG2C 5JECA 2O8BB 1WIEA 2QMHA 3Q8XB 4O2LA 1KIMA 3UMSA 4KRTA 3EA5A 1P60A 3U3MA 3WHLA 2ZI3A 2YOGA 3I32A 2KXDA 4G1UC 3IHLA 3IIMA 3LXXA 3OZXA 1ZU5A 3VTKA 1HYQA 1KJZA 4D80A 4M8NE 4QGAA 1DTSA 2QQEA 3ZLJA 3AKCA 4KFSA 2DY1A 1YZLA 2FE4A 3RRYA 2YWGA 4PTLA 1E9EA 1VHLA 2R6AA 4W7SA 2AN9A 1KK0A 1ZUIA 5CIQA 3QIAA 1WA5A 2GTJA 1RIFA 3B2EA 4EPVA 3AVXA 2QEQA 5KSPA 2DLPA 1ZM3A 2XNSA 1J99A 4LJYA 4A15A 2EU8A 5L3SA 2I1QA 1B23P 5BQ5A 4D0NA 2RH5A 1FZQA 4ZO4A 5HE9A 2FFBA 2ERXA 1S3GA 4M9QA 1X69A 4E6RA 3Q5EA 1EFCA 2I1VB 3BRWD 3GJ7A 1SKQA 1XEWX 1P62B 2J6OA 3MCAA 4FMBB 1A1VA 3DMNA 1JJVA 3FYHA 4EPRA 2R6CA 4ITRC 2W6IA 3IDQA 4GOJA 4PHFA 3PXGA 4E09A 2ESWA 4LK2A 4TMZA 1Q22A 1W6XA 1DELA 2GJSA 4JKYA 1Z8FA 4OHVA 1QHNA 1SGWA 1GL7A 4PAMA 4DUGD 4YMSA 2ZSEA 1E3MA 4DDVA 2IYQA 221PA 2C9CA 3FTQA 5FPKA 2F1HA 2NIPA 4OQNA 1YZQA 1V43A 4WZ6A 2KJQA 1G8YA 1XTKA 1C1YA 5HTKA 1GG2A 2GNCA 1EFNA 1A4RA 2ZRIA 2G77B 5LB4A 3T1VA 3OFNA 2DFNA 4Q00A 3I72A 1AJEA 1UECA 1W0KD 4NYIR 3ASZA 1EFHA 3W90A 4F93B 3DKVA 1UHCA 4HVWA 4MYUA 1Z6TA 1SHZA 2BZ8A 2QI9C 3DM9B 4M1MA 2ZS9A 2OO7A 4RD1A 621PA 1G6OA 3W6OA 2EFGA 4D8KA 4AFQC 2HCJB 2PEYA 1COWD 4TT3A 4AKEA 2IXEA 4O2RA 3IBYA 3H0HA 1GAJA 2C2HA 5EUMA 5IDVA 1OXVA 2JLRA 3EWSA 1H8HD 5KDLA 3VS4A 1ZLMA 4IFBA 4A0RA 3WMGA 5TARA 3ECCA 2WM9B 4BE7B 4HCKA 4A63B 4C4PA 1Q1BA 2H57A 1P9RA 4ASUA 4ORZA 5LBIA 3MWJA 1SKYB 1X6BA 5HCKA 2ZIAA 4HLUC 3TKLA 1W4RA 2NPFA 1P9NA 3PEVA 4AYXA 4TMWA 3VS1A 1FNNA 3ZVMA 3B1ZA 1MT0A 1TUIA 1YWOA 4DKXA 4OBEA 2RGXA 1OPXA 3CRVA 4NCKA 4NE2A 2QRNA 2F9LA 3AB3A 5FI0B 5E7IA 1F60A 2JT4A 2G83A 3EPHA 3M0QA 2I0NA 1KI7A 1K5DA 4BFUA 2EKHA 1US8A 4HATA 2JJ2A 2REOA 1KZ7B 2HJVA 2PLRA 4B2LA 4KFTA 1U8AA 1WMSA 4R2IA 1VG8A 2BEKA 4CC7A 1GNPA 3EG0A 2FGKA 2B7CA 4LCBA 2CL6X 1N0UA 3KZ1E 4R7ZA 3OEHD 1T9HA 2KR3A 1KO8A 3BWDD 4JJZA 1VYVA 1VYTA 3UPUA 4JLOA 3CNOA 1MOZA 2GVZC 2WWHA 2DFTA 3IPYA 2QY9A 1NRJB 2ZRBA 4PPNA 3CR7A 1UHFA 1TQDA 2BKUA 3ULRB 1OPKA 1RVDA 4EQ6B 5F3WB 2R8RA 3K0CC 3W9YA 1O3YA 2HEQA 1ZD1A 1OF1A 1AKEA 1P6XA 4C0JA 4RTVA 2XGJA 3EASA 3GLGA 2K79A 3IKJA 4P4SA 4PHTA 3RDPA 2OCBA 1OXTA 1W7AA 3PCRB 2IIMA 2VA8A 3I5RA 4NYJR 4AK9A 4B3XA 1DPFA 4LV8B 4ZI3A 1DBSA 2WV9A 4Q4JA 4B44A 1ABQA 3SQWA 4XOIA 3NXSA 4XWKA 1DARA 3LW8A 2ERYA 2OLKA 4GZMA 4PC2A 4U00A 3GBQA 1XMSA 2D1XA 4EFMA 5KYKA 1GFIA 3W8NA 2XZOA 1IN4A 5FL7A 4CC4B 2OM2A 3AUXA 2LCSA 2O9VA 2XTNA 5TY0A 2K6DA 2ZU6A 3KQUA 2FSIA 1QHIA 4DSOA 4DB2A 1BS1A 3RS0A 2AWOA 3VS3A 2IYXA 2QP9X 2CSQA 4GBMA 4M9ZA 3I5YA 2GA8A 4AY2A 4Q9IA 2Z0MA 3KQKA 3TLXA 4IXNA 1KJWA 1OH6A 3EIQA 4DEXA 3RHFA 1AD5A 4BQSA 4TWZA 1E79D 4EDHA 3GLGB 2YDLA 1FTNA 4HLDA 1GRIA 4P4SB 4BLOA 4JJDA 2MSDB 2PX3A 2F2WA 1E9AA 2ZYUX 4JVSB 5EE3A 3TUIC 2OHFA 3NBZC 1RRCA 3EG2A 4BECA 2KBEA 5KTYA 1KJYA 1EX6A 2REBA 4AFSC 2AWNA 2AZVA 2ZJ5A 4Q4JB 4Q1DA 2G88A 1LV7A 2CLSA 2HYDA 1SHKA 3HWSA 3H1TA 3QXJA 1EG7A 1MV5A 1ZM2A 4C7OA 2O8FA 4J9CA 4G0NA 2FFHA 3GPLA 4DCTA 2QAGA 1IQPA 3MFYA 3DZDA 1D9XA 3I8XA 1K76A 1U06A 2PL3A 5JI3E 1CEEA 1NN5A 1M30A 1VCIA 2MOXA 1ZMXA 3TSWA 3TVTA 2R2AA 4M21A 4FXPA 1Z63A 2VHCA 1DOAA 1NIJA 3RRNA 2CVFA 3VRYA 1GFDA 2AKLA 3GP8A 1X3SA 2PJZA 2UKDA 3AVQA 4YDHB 1D8TA 4FN5A 2WVJA 2ZS8A 2CNWA 2ZRLA 1A0NB 1RLQC 2VHQA 3SZRA 3Q7QA 2WOOA 3BB4A 3VR4A 1GITA 4NMMA 4U5XA 3G0HA 1N3BA 1OE0A 4M1WA 4M22A 2NG1A 2NZ8A 1OXXK 3AF4A 4J9IA 4C7OB 4DEYA 2ZVPX 2O8FB 4HXJA 1DE0A 2WJVA 1GL9B 3EZ6A 4AFZC 1U0HC 1X43A 2DWQA 2QAGB 3EZ2A 4LYAA 4F4JA 1VIAA 2AR7A 1WRBA 4JSYA 2LP5A 1SRMA 1UKVY 3T5GA 1P61B 4JYBA 5ECAA 1W0KA 3C15C 4ZNXA 2J1LA 4BWYA 5HCIA 3ZS8A 3EARA 4DLWA 3P4XA 1IAQA 4C0QC 5L23A 5H70A 3SS8A 2JEOA 1SXJC 3M0PA 2N1BA 2AKKA 1CTQA 3B1XA 3LQQA 4TMXA 4V0KA 5DSZA 2NO6A 1Z47A 4JJBA 1COWA 1EESA 5FPSA 4CC2A 4US2R 1KYIA 1G4UR 4J9GA 2B21A 3QWXX 2KWIA 1Z06A 4E07A 3AP3A 1YR8A
chains in the Genus database with same CATH superfamily
2VYCA 3AL0C 5E1DA 4MA0A 2XOEA 821PA 1HE1C 2XRMA 2PSEA 1NP3A 1DAIA 4LG1A 1QB7A 1FA9A 3KIPA 2OFPA 1XTBA 3CZMA 4H31A 4C4TA 1JIQA 2ADMA 2WB2A 5K0CA 1MD9A 2PNIA 4QJ4A 1U3WA 3EHDA 1WX6A 3H2IA 2PMEA 2LTOA 4N3CA 2EQAA 4ZREA 1CR2A 4C43A 4B8ZA 1S2GA 3QYHB 3R5KA 3KCNA 3Q8KA 2JAUA 1JVBA 3VH1A 3ZDZB 3GBSA 4I6EA 4NFYA 4POAA 2I65A 3JPWA 1CQJA 3IEXA 4RIEA 1TD1A 3P27A 4WERA 3FM9A 1AU9A 1KQ3A 3FJYA 2H4JA 4TUYF 4JUCA 2IHYA 4P0PB 4UBMA 4C5CA 2BM1A 4ZOCA 5JHHB 2PY6A 1BA3A 3TK1A 4AMUA 5L7WA 4X1YA 4EHKA 4OMNA 4LWZA 5GOTA 4JZYA 2GBQA 4CE6A 3GUVA 1KZ1A 5AQ1A 5C37A 1QIHA 2AG6A 1ZIDA 3ANTA 2O31A 2VC8A 2XYGA 4R1MA 5DLPA 4F9GA 4HV4A 1AZLA 4AJ4A 5CYGA 3F6BX 2PGJA 1T6BY 3A6JA 4PCVA 3B5JA 1Z6GA 2X8JA 4JYCA 1EIZA 1OLUA 2KMLA 4BQOA 2FPUA 1CE8A 4IX1A 5K8LA 1RYEA 4U2BA 2W4QA 3OYBA 1V8BA 3ZZMA 3OZVA 3TTVA 3WGKA 2VXEA 1OWNA 1PO7A 4BNDB 1HDGO 2DVJA 4NOLA 4IHJA 3NBAA 3SQOA 1KWGA 4FE4A 1V45E 2NNWB 1Q2UA 5IPFA 2XE7A 3SDBA 1A98A 1N6RA 1X42A 4UEWA 3PD1A 4PLFA 2P9CA 4INOA 3N2YA 1XVTA 1JRIA 4BQIA 5J9FA 2HTFA 4JJFA 1AKUA 2E4XA 3I76A 4D45A 2QRGA 3C5HA 2Q50A 3RUDA 3WLFA 3LY9A 3X1YA 5KQPA 1EFLA 4I55B 4PZDA 3R0ZA 5EI5A 2I2XB 4M9CA 4B17A 5TDHA 5D6NA 4ZTFA 3DD5A 4FC7A 2GD2A 4MR7B 5JRDS 4NJOA 4ZVLA 4RMIA 2C4WA 2HQEA 3O5ZA 1U9IA 3MM4A 2OK8A 1E62A 5K9ZA 5AMXA 2DH6A 2X5NA 2Q3HA 1CJMA 2UVPA 3ZY2A 3H2KA 2QBYA 5HJEA 1PWHA 3U62A 2QTFA 2GAJA 4X65B 4I4TF 4OB2B 3L1AA 1MIOB 2VZ8A 5FTJA 3B52X 2W0SA 3TLKA 5KVSA 3HN7A 1N6AA 2FUCA 3FPKA 1PTJA 2UZ1A 5CB4A 2UYHA 1R8SA 1EIFA 1O03A 1H641 5E1BA 1A9YA 4IIUA 4D7AA 3IMGA 3BXZA 2HIGA 5DW3A 3FYTA 2XVMA 2MINB 1VCHA 3SFVA 2G63A 1DP4A 1I13A 5BW8A 4WVLA 1CP3A 1ZH6A 2FPRA 1RIIA 4MCIA 3WS7A 5JNLA 4EAAA 1ZHIA 1Y5IA 3RREA 2PUOB 2XOXA 4YDSA 3BDLA 3T1TA 3FMFA 3O1LA 2HF8A 1C4OA 4LXTA 4GRAA 1XRJA 2KBTA 1IOLA 3AVYA 1D6JA 3WOVA 2EL7A 4QG3A 3MK31 1L8XA 3UENA 1DBVO 1GWNA 5CLHA 4RVDA 1BX3A 3HUTA 1I2AA 3DBRB 4QJ3A 3MPOA 4HQOA 4WA7A 5DNCA 3INTA 1T0IA 3BA6A 1TYCA 4LOKA 2YUPA 1IJFA 3LWZA 4G4GA 1TJPB 1BH6A 1YJWT 1FU8A 4TMFA 3USCS 4HJXA 1Q82C 4CMBA 5GJVC 3Q0EA 4RXTA 1B0AA 4S05A 1V9SA 1ID1A 3N7UA 5F76A 5TX7A 3GEIA 3KQSA 3GAMA 2REQB 2QX6A 3M0RA 2B2NA 3GZTB 2Q0XA 3GNLA 4Q9LA 1VQ8T 3SX4A 5EZQA 1C9DB 3ZH2A 4JWTA 5JH7A 1L3BA 2O2JA 1B3RA 2O2CA 4C92B 3UV7A 1MZVA 4XSGA 5F2NA 1E77A 3OQ6A 2VJOA 1M7GA 2QR2A 1MJFA 3FCSB 3LA6A 2CLIB 1K6MA 3EFOB 4J0HA 3IJPA 4RKRA 3HL0A 4DUYB 3V3TA 2GFIA 4EA8A 2CJYA 3WWEA 4QOJA 2YZ2A 2XNCA 1JHDA 2EJWA 2E82A 2GJKA 5MDHA 1FTWA 2GBFA 3GRCA 2VKQA 3DOHA 1ZH0A 2NVUB 4FLMA 4IXMA 1SWWA 1A0OA 2WACA 1QIKA 3IAM6 4WLUA 1VOMA 1Z7YA 3RM3A 4R8KA 2C0PA 5DHPA 4AJEA 2HMSA 4IUDS 2RK1A 1UB4A 1BXRB 2WZBA 4U1RA 2AR9A 1QVPA 5ADUS 3CMAT 4O1MA 3TLCA 1VL2A 1D1AA 1M1KU 1YZKA 2RB4A 2ESRA 3ENZA 4HGPA 1TF2A 2BGIA 3MWEB 1RYYA 4W5WA 1AQUA 1N2IA 4CNBA 1XPJA 1ZI8A 2HBWA 4CU5A 3UFBA 1QSGA 1M83A 3IQZA 2AZSA 5JJIA 2IHUA 4ZU6X 4OMOA 2HXSA 1R6VA 2XHZA 4GX2A 4QBIA 4EKGA 3S3MA 4M75C 5C4MA 5AVWA 3PC7A 3SC4A 1NE7A 1P44A 1W36C 3M7IA 5FA5A 2EKBA 3SJCA 1CY4A 4IDFA 4ILKA 3ZV6A 1ZWKA 4D9IA 4KN6A 4HI0E 3MYYA 5B53A 4E4YA 2V8JA 1ZFNA 5B3LA 2AKYA 1QONA 1RTTA 3L4EA 4X0EA 3PVCA 4UNPA 1VQ9T 1ZD2P 4B2PA 2WLSA 2NTNA 2D0IA 1TM1E 1UBOS 4Q4AB 3PHCA 3PYXA 4TKLA 2R3SA 1UQRA 4XUCA 3ZKWB 4PWZA 4BZZA 4IH4A 2YWHA 4CEJB 2R8OA 1S1MA 5CFNA 1KY3A 3QVGB 4L0CA 3QEOA 1NMZA 2IV7A 3QY0A 3LGSA 1G8PA 2BKVA 2XBMA 4HG2A 4MVJP 1SQ6A 1ZM9A 2I9KA 1W0JD 4GT1A 1NQWA 1KXJA 3OT1A 2XY4A 1XEAA 3EUAA 1JHYA 4YCJA 3TDKA 2BE7A 1QKWA 1SCDA 3OY9A 3LGAA 3S3NA 1FFHA 4MQFB 1DTWB 4PPQA 4CG1A 2BZGA 3H8SA 3AGQA 4DTIA 5I45A 1Q95A 3AY0A 4M1TA 3S6WA 1FMJA 1U7UA 4LYEA 3QSYA 3DEKA 2ZRDA 1NFFA 1H3FA 2R62A 3B48A 1MX3A 2WF6A 1L5OA 1GY8A 2ANBA 3RC3A 1ZUNB 4QT0A 5B6IA 2H06A 1E2HA 4OHFA 1U7TA 1MABA 4D6WA 1TECE 2C0CA 1QB8A 3VXKA 4K7JA 1E6LA 1K9MR 2IOHA 4OVKA 5AVOA 4PYQA 4XGKA 1UEIA 3RMSA 4HB0A 3HUFA 4WX2B 5IJ9A 3L2VA 2DKFA 4I50F 1Y81A 4V0OA 3UJ8A 3FVVA 3V7SA 1Q92A 5H3HA 2N42A 1KDZA 1ZVKA 4RZIA 4CU2A 3F5DA 3DYBA 1G5IA 1R5BA 3VNUA 4FSHA 1WDKA 1VSTA 4CKEA 4W99A 2VRNA 4WOJA 4BRWA 1QO9A 4TL6A 2C04A 3FPGA 3WKDA 3D8SA 3JCMc 3J80E 1SNYA 2F1KA 4FCCA 4REQB 5JY6A 3RBXA 1XZKA 3C1UA 4WJLA 1MMDA 3F97A 3OCUA 1R0WA 2HWXA 5BSEA 2QJFA 4OA5A 4RD4A 7REQB 1YVDA 5TEWA 2PTKA 3EPJA 5IZCC 4KYTA 4HQLA 1NM7A 5BQPA 4Y1RB 2WUGA 3K0HA 2FFQA 3UQYS 1BGXT 1RHRA 4OFBA 3WG9A 4TRRA 2QN9A 2XVXA 1FF9A 5KNDA 4IGAA 4EG0A 2Y05A 4AT1A 1NLOC 1DX6A 3GO4A 4R31A 2D0PB 3E0XA 2G7MC 2OWDA 1Z38A 1M1ZA 1VQOQ 3C3JA 4ZZIA 5LMZA 3P96A 3PT9A 2NOAA 2IELA 1LQTA 1T0HA 4J9HA 5PNTA 4UM8B 2UVQA 3EUEA 2CH4A 3UBTA 1NF3A 2HA4A 1FNDA 3BMOB 1QQ5A 3OOWA 1KQGA 2X77A 3O8OB 4MGIR 1O0CA 1IXDA 1E64A 1LBHA 2XMDA 3OVMA 2CS7A 1G3RA 4EY4A 1Y5RA 4A8JC 1R4AA 5F2KA 3M1YA 4DIEA 4GH5A 1XQ1A 3ZV3A 1ZN9A 3HA7A 3SHFA 5M2QA 1XYGA 5JPIA 3VS2A 3KSUA 5LA6F 3TIGA 3IQLA 1CVLA 5G4KA 2ZAMA 1TZ2A 4JEUA 3R7SA 3M4ZA 1SVMA 1YS4A 1TPYA 1IHVA 1UKAA 4UZEA 3K0BA 3RYFB 4EPTA 3BIFA 3QG1A 2FW0A 1YJCA 4OAQA 3MS7A 1T3ZA 1LPBB 4D9FA 5DCYA 1IULA 2JD2A 1SHGA 3CISA 4XU0A 4IXWA 4Y6QA 1KZHA 3J81E 3QOFA 4Q9NA 4ZARA 2HO5A 4ND2A 1EIWA 1NR1A 4XB1A 2HUPA 1E6UA 4KVFA 3OLCX 3L7DA 3LPDA 4OJMX 2XUIA 3GLFA 2C0TA 2CWDA 4M49A 2AN1A 2IEAA 4NECA 4N0MA 2OE2A 1HE8B 3MD0A 2CREA 4PFQA 1QIDA 1AMOA 4MDHA 1QUEA 3WK5A 2YOHA 1J70A 2ZUFA 4PYOA 3FD8A 3NDIA 2NX2A 1OB2A 3QFHA 1YRLA 3U7HB 3LUCA 1NBME 3FSGD 3UF4A 1P5FA 2Z04A 2PVGB 2ODEA 4F3KA 2GZ2A 3WRYA 4LJ6A 2QPOA 3QJGA 1L7BA 2DSTA 1WS6A 3D81A 5MN5A 4AO7A 4UBKA 4EHJA 3UAYA 2YXEA 1PHRA 4YRNA 3G0DA 1QRSA 2EZ8A 2MYPA 3VNSA 4QDUA 1K7EB 3GROA 3NR2A 5HILA 2H54A 2V59A 1PBTA 3DFFA 4BL5A 2WWFA 4YJ2B 2AIRA 3RWBA 3VX3A 1TQ8A 3QPHA 1SUIA 1RR6A 3R24A 5FBQB 2LVMA 1YL5A 5KSYA 5EUQB 5BYBA 5EXXA 4AKHA 4QICA 2BL4A 3BMCB 3FKJA 3K30A 1DXHA 1MO3A 1NR5A 3D6NB 2AG8A 1M2OA 5HKAA 3ZWAA 1ODIA 3DKMA 4HAVA 3TG8A 4C8QF 2YYZA 1LF5A 4HL6A 4KUEA 4DIOA 2C42A 1QHHB 3AFOA 3YASA 3LLRA 4OI1A 4RC9A 1CJSA 4EMSA 1MH9A 1WTCA 2CFRA 1KQNA 4OBBA 2ZETA 3HDQA 2JS0A 3EZ7A 3P2EA 4BXOA 2SKDA 1SBNE 3D9QX 3H2GA 3F6EX 4MZXA 1SUSA 4RIFA 2UZIR 4G4IA 2ZSIA 2FFRA 3FIFA 4ZN6A 2C92A 2FEKA 2IHBA 4RFSA 1XTRA 4BMCA 1YZGA 1VYUA 4C9BA 1R66A 3B6IA 5LPNA 4KQ9A 2ZTMA 3WAJA 1VGQA 3TRIA 3I61A 3CZ5A 2UUBB 1FMCA 4LXXA 1VL5A 2G36A 2P8JA 2ZAYA 4Z88A 2OHJA 1YB2A 1Z0AA 2A0UA 2Y0DA 4NCHA 2B7LA 3DEIA 4K05A 2NUTB 2Q29A 1EMDA 1UK9A 2CT8A 4HGNA 4RTZA 4AL4A 2DCMA 2XF2A 3EEQA 4C0DB 1S02A 4H3HB 5SYMA 1T35A 1A2QA 2D62A 4DA4A 1TVKA 4C30A 4KJXA 4D46A 5CEEA 1HYHA 4C0GA 3TU4K 2AI2A 1R12A 2WWIA 4J1SA 3MTIA 4P7JA 1WXDA 5GAOp 2ECPA 2YJZA 2MSEB 3L0IB 4ZK6A 4C5AA 2VC2B 4MWCA 2XDQB 4QNNA 2SKEA 1Q44A 4URWR 4HQ0A 2HN9A 1ETUA 5G53C 4ZVRA 3IQFA 1YOBA 4LCJA 4AZVA 1SXJB 2JVKA 2OOSA 1M1GA 5T6MA 2OG2A 1RMQA 5GAJA 3CVWA 5C6SA 1KI1A 1M34B 2A7YA 1L5SA 4XGIA 3KEOA 2XMFA 1GDDA 2XUDA 2PQ6A 1M2JA 3HVJA 3ZUPA 2ODQA 3HDYA 2NSHA 3ELWA 3QMMA 5CQYA 3HFGA 4L27A 2WVAA 2HL6A 4FVTA 1YOVA 2H2IA 4YMTA 3ZWNA 3VI3B 2BUAA 4A6XA 4P3XA 1UBGA 5J2TA 2Q9BA 5AR1A 4IGFA 1KQ1A 1MNAA 4TVBA 4CQJA 1SF9A 2GPSA 4A10A 1B7TA 3C1OA 3IDSA 1U7PA 1BRTA 4ERNA 1T5LA 4B48A 1XQVA 1FSFA 4TLBA 4YDQA 4XD7A 2ZKLA 3LXRA 4KODA 3K31A 1CSEE 5EUCA 3D4NA 4C5BA 4BE1A 3TNLA 3UG6A 3L4SO 4ONEA 3C94A 2PS9A 2HOQA 2FB7A 1UJCA 2J09A 2PFKA 1OX4B 3U3MA 4KOEC 4RPCA 2FOXA 1KJZA 3N76A 3ZEAA 3RFFA 3W78A 3RRYA 2O2GA 2PVDB 1CQZA 3WKEA 5JOQA 1K5HA 4JLWA 2OKGA 2HL5C 1OXKB 3ZK7A 3RYCA 4F1WA 1S3GA 4M9QA 1PJBA 4HD8A 4ZMBA 3AXTA 2R6CA 3UMGA 2B5WA 1DELA 5IHXA 2RK2A 5J3JA 1V71A 1T2EA 3O31A 3TX2A 1M6EX 1NOJA 1E7SA 2QYSA 3AESB 1GG2A 4JMLA 3OFNA 4CMCA 5LP6A 4WKOA 3PJGA 5HJ5A 1PYGA 1DJ7B 1EVEA 4EY7A 1G6OA 5CFOA 4NNPA 4AFQC 1H8HD 1J4AA 4C07A 1H6CA 1HRKA 3G6ET 2H57A 1K68A 1P0PA 3MWJA 2NU9A 1XO1A 3X0DA 1J97A 3N0XA 4QYTA 2PRYA 3CRVA 4DNFA 4MW9A 3C87A 3AB3A 4L5GA 2DTDA 1WMSA 4QUDA 1VG8A 1E3LA 1M1UA 4CC7A 1QO7A 4Q3CA 1T9HA 4E4RA 4QFBA 2YRVA 3HMKA 2J9XB 1OV6A 4N0AA 4BKMA 3FPFA 5GAN4 2K79A 4S24A 4GGMX 5KC8A 4LKRA 1T5DX 2AB0A 1EEXB 5KNBH 3E4DA 3JWIA 3CLUD 3W2HA 2BGUA 2LDMA 2P4HX 2OMKA 9LDTA 5CX1A 4N6GA 3G6WA 3UB3A 4BLOA 4HLDA 4JU9A 1RRCA 3NBZC 3A7EA 3EG2A 1LW6E 4BNWA 1EXDA 2V0CA 2NLOA 2MT9A 4WXHA 3DZDA 4M78G 4TOIA 1VCIA 1NRXA 2YVKA 2R2AA 3JCMd 3KXTA 2VHCA 3Q9SA 3PX3A 5GPBA 2M6RA 1A0NB 4HGOA 1CCWA 2JFZA 1U0NA 3O95A 3FTEA 3ABOB 3D8HA 1LLUA 4RIGA 5HCIA 4XQ9A 3SS8A 5KQLA 4DQLA 4YAKA 4JI3B 2YHIB 3NGLA 3OH8A 3P2YA 7MDHA 3LXUX 3UKJA 4J6FA 3BZWA 2MF2A 1U3GA 4WZBA 3C43A 4AS2A 2ZWVA 3HDJA 5M9OA 1I4OA 1PSWA 4CVNA 5G1NA 2ISCA 2M9MA 1E66A 2RI3A 2JUFA 3U7RA 1EUDA 1II9A 4L4UA 2GDJA 4FYVA 5IX8A 1G64A 4AP5A 4PZZA 2XMSA 2HA2A 3NAQA 1QP0A 1TZJA 3MGCA 3RWMB 4JELA 3I58A 5LDDC 3E53A 3V6MA 3JZDA 1Z33A 2Q3BA 1Z2EA 2QVYX 4LMAA 1QS0B 4X1KA 2HO4A 1ABOA 3RFXA 4F4HA 2ZIWB 3BB1A 3KE9A 1V26A 3O94A 3VH3A 3W1WA 2LE0A 4LX0A 1E92A 3NONA 3KJFA 2ZDQA 3W7VA 1AQ6A 4OHOA 4XVUA 2OYSA 1WW2A 2LXNA 5I11A 1DFHA 4RULA 3GNTA 1XTZA 2FQYA 3MRSA 3GLIA 3GUZA 1UK7A 1LLCA 2XMCA 5AESA 4MQEA 3JSAA 1UZLA 5U4QA 3QU7A 3EUFA 1ZJ5A 1NBEB 1AWXA 4RJTA 4MRRA 1F12A 3OA6A 3E9GA 3BWCA 3GAFA 4W5OA 2P9JA 2YJ4A 3IEKA 2JLZA 4UNSA 2YDXA 5CHYA 2DBKA 3L0ZA 3H11B 2J6CA 4B74A 4R2HA 4X45A 5M04A 5LLDA 1K1ZA 4MS1A 3UNXA 4OX9B 1NJGA 1BQ3A 5AM1A 1GQFA 1DC4A 1WZIA 4GKBA 3UUFA 1KC1A 1JKIA 3QY9A 4CMGA 3BQNB 3KXKA 6REQA 2AOUA 4KXWA 1BCRB 2AMLA 3K9CA 4YX9A 4JVOA 2X41A 4OHWA 3AVVA 2QB5A 1JT2A 3OCYA 4JYPA 2C3PA 1NY6A 1E2DA 3IFSA 2C0OA 2RONA 4WNIA 2VF8A 3ESXA 4H1HA 2NTJA 4GYJA 3IVGA 2J67A 3AFNA 5BR4A 2HUNA 4PJOF 5DEOA 2QX8A 4Y8VA 1GSIA 2VCHA 4LYGA 5LR6A 2YWWA 3F1KA 2VYVD 2VPZA 3I9NA 5CVTA 1M72A 4HMPA 3U48A 4YMWA 1Q91A 1K3TA 1WW3A 1QOPB 5SY9A 2IH2A 5HIMA 3UF0A 5B4UA 3G0CA 4GIBA 3VPSA 4WZAE 3Q1LA 5LDGA 2EBPA 3B85A 1JQEA 3MHPA 1T29A 1WKBA 4MMKA 2J9ZB 2B1GA 4UUBA 2VJMA 2JZ2A 5THKA 4XJVA 1LI7A 2GXAA 3CZCA 1JXAA 3B9RA 3WGGA 3N2KA 3UPTA 3FPJA 2M98A 4CFZA 1TIPA 2EATA 4GVXA 5AYFA 4LDQA 3HZZA 2EBFX 4TQGA 2HC9A 4KXUA 1H2EA 2AN5A 1SXGA 3JB9H 3EWNA 3K0FB 4K40A 4PBRA 1YRBA 4L4SA 2RGWA 5JH7F 2HCBA 3JZAA 1L4KA 4DCVA 2O8CB 4FFWA 3OI7A 4GSLA 3O3CA 4A92A 4M4ZA 2AK3A 2CZ6B 1H4VB 3M1AA 3DEFA 5CM2Z 1GILA 1SZDA 3JYLA 2R00A 3MGGA 3RGGA 1MHNA 1BI1A 2YW9A 1SURA 1T1SA 2WP0A 2Z95A 2BP7A 3KLOA 3OU2A 3R9WA 4C7KA 3FZEA 3GLQA 5FRNA 2ZSUA 2PNFA 3IBCA 2LD4A 1ZXLA 4E7SA 3OOEA 1SKMA 4KGXB 1E1LA 5H4HA 3HZOA 4RAQA 3I62A 4ZCSA 1TTHB 1D4AA 4TWIA 3W4JA 4JOSA 3CPFA 1QO0A 3SNHA 1RWKA 5DN6A 2QRVA 1RI0A 1XA3A 4HZUB 3NC0C 1I5OB 2P4UA 1VRCA 3T3GA 3HUEA 1S2LA 2NXJA 4Z02A 4PX9A 4B1FA 2MMCA 3GW8A 2P9EA 1GN8A 1SQFA 1Q0UA 4PLCA 5HRUA 4CIAA 1ORDA 2CBXA 1R74A 1N36B 2ZZMA 2AZMA 2ENWA 4RPHA 1HV8A 4ES6A 3F9CA 5B64A 1I9CA 2ORIA 4JC4A 4M7RA 4FHGA 3BORA 1V96A 2BHTA 2BMFA 1CLUA 3SS9X 3LXMA 2XQVA 5GP1A 4PG7A 3LY5A 2Q5QA 5D7NA 5C5EA 4WFJA 2CV2A 2AEEA 1PG5B 5DX8A 2EKQA 1NLUA 1W4CA 1J0AA 4KZKA 5I6DA 3DMHA 4DMGA 1R3DA 2XWBF 5IXYA 4U8GA 1MP0A 3KUXA 1KAOA 5FKJA 2O7VA 2GHIA 2IXFA 4RQAA 5K7SA 2ACVA 3PR2B 1LDNA 4M7DA 4C8QC 3QWHA 1JSZA 3UM9A 4BNVA 4MR8B 4GR4A 3NDJA 4BCDA 3K8YA 4QAQA 3KFXA 3LPNA 5I3ZA 1DKPA 4CKXA 2OCLA 2RAUA 2J3IA 1B7GO 1TGVA 1XWIA 1ISHA 5LM3A 3GRZA 5HCUA 6NULA 3KWMA 2D1SA 3GZJA 5YASA 2DTHA 2QXUA 5BSHA 4TKVA 4AI6A 3DE4X 1TEZA 5JSUA 1VIFA 4JYZA 5CT4A 1KRWA 2NZXA 2ZYGA 5FPQA 2AYXA 4E5UA 3T12A 4EATA 5SZJA 5A3JA 4CMEC 4YR9A 3RESA 4Q3DA 4KRFA 4BI3A 5ITWA 5ALIA 1WWKA 4R0MA 3GUHA 1BIFA 1E3WA 2KE5A 1SK9A 1AQJA 2ON6A 4YQFA 4FDMA 2IY9A 3HEBA 5A05A 2WHXA 3P9QA 3U56A 3RRJA 3RAGA 1GKUB 2FEWB 3A5ZB 2A0FB 3WB9A 2CSUA 3NNNA 3L02A 3H9GA 4TTIA 2O05A 4KSBA 1OBHA 1UBKS 3GA5A 1H0KA 3C70A 3EEIA 4BAUA 4Z3DA 1GCPA 2ZI6A 4CM4B 1YQDA 3MHTA 4P38A 4ZQEA 2QMZA 2QYOA 5HPYB 4M86A 4TTTS 4LHEA 3LQYA 2WD7B 1PAUA 2C06A 2G9UA 2H7YA 1N33B 1W44A 4ICIA 4C5IA 3QUTA 2RNAA 2Y1WA 4G0YA 5IJZA 4WADA 4D6XA 2PANA 4JR2A 1TYAE 3O4VA 3TLGA 1FFSA 1Y98A 5I7UA 1ZNQO 1YJBA 3EBOA 1NBOA 4WK4B 2FW9A 2D1RA 3PDCA 1E98A 4N01A 2VJYA 2QN6A 5FO0A 2RM4A 3LE8A 4BQPA 2FR1A 2PX8A 3A4YA 5EC8A 4TS3A 1ECBA 1YBVA 1JIIA 1Z8HA 5HXAA 2ILTA 5CT6A 1M27C 2EDAA 4ZALA 1VJTA 1E2JA 1VFPA 3CBPA 2QQ5A 2A94A 4RSHA 1MH1A 1NNI1 4IHKA 2HDAA 3VJPA 4JXKA 1VLQA 2DJ5A 1MR3F 3GJ3A 4RCCA 5M3BA 1KEZA 4GP6A 1T2UA 4UUPA 4IS3A 2B6NA 4G5SA 5AJTA 4J0QA 3CLHA 4CTMA 3SDZA 2OGSA 4IDOA 1ZBXA 1MA0A 4H9GA 2I7DA 1EWYA 4LZNA 4PICA 2ZTSA 3VSBA 1W5SA 2C4TA 1N8SA 1RM0A 3C8UA 2VDKB 1P7YA 1OBVA 1CETA 5KMGA 5BVGB 4NOYA 1G63A 3OKAA 1S1CA 1I33A 5A4MS 3B5EA 2WJJA 2JBAA 4M3NA 3QXXA 1ECJA 4Q3LA 1RZ3A 6AT1B 3WFZA 3KETA 1FFYA 3HCDA 5JDIC 1OPRA 4KN9S 2A2ZA 1EINA 2RH2A 5CKHA 3DCYA 1VHQA 1O8CA 5H02A 3WGVA 1P77A 1UBEA 1N5MA 1PZFA 4UM7A 3GJ4A 1NQ5A 4ASUD 4AXXA 3GIBA 4PQYA 5JBQA 3HYSA 1M8MA 3HFSA 4X7PA 1X74A 4QVKA 2ZRKA 4Q03A 5CFZA 2ZOSA 4C1BA 2Q1SA 1NJ6A 1GV0A 3EIUA 1ISPA 2W90A 3DHYA 2ED1A 4M77E 2JBWA 2QM3A 4GOMD 3NM6B 5DI3B 3LYHA 3F73A 1XYVA 2XLCA 1N4AA 4QVDA 1EVJA 4KXMA 3EVZA 2WTBA 1B43A 1U0LA 3EZ9A 5JXHA 1VQNQ 4R1NA 3N59A 5FYDA 1ZQ1A 1DRVA 2IPAB 2NYAA 2C2BA 3PXEA 1KQFA 3MLAA 1CY6A 2O52A 4N0DA 5DXAA 3S1AA 4DJEC 3T7CA 2C2ZA 4CM3A 1AMUA 5HIKA 2O50A 4YRSA 1O5OA 3ITEA 4XAQA 4MVJG 4MS3B 4F5ZA 3KCQA 1Z7BA 1CKBA 1KJ8A 3IMFA 1ZD3A 4AW9A 3ZDQA 3A1WA 4WGGA 3VYSB 4IGEA 4A36A 2ZB4A 5FLXA 1G3UA 2O1WA 4EW3A 1ENYA 1J7KA 2C84A 2VJKA 2PLWA 2I8AA 1GSOA 1NVKA 3GT4A 3STHA 2KE9A 1AA9A 3HKDA 2EJVA 3KU4A 2ZJFA 1WUYA 1GU0A 4A4HA 3ZE7A 4BV2A 2RG7A 2HSZA 2RD1A 1VQ5A 4YREA 1N3LA 3T41A 3RI3A 4IINA 4CPDA 3OBBA 4FSSA 4D82A 5KJ1A 3Q1JA 4QEDA 2Y67A 3DNPA 2H2AA 2Y1DA 4OHPA 1KRXA 4QVIA 2IS4A 1H9CA 1T4DA 4NCAA 3PF9A 2Y0BA 3A1EA 1WI7A 4Y2RA 4QVCA 1V3QE 2ZITA 1EGQA 4J7UA 4IG9A 3DKKA 1VG9B 4JHLA 4QUGA 1J20A 3N2LA 1V6SA 4B6QA 4JB3A 3TCXB 4QXRA 5F35A 2HB6A 3MWDA 4WFIA 4HDCA 1VQ1A 5E38A 4PSUA 5KTSA 2GEFA 1XL1A 2P2ZA 1DZ3A 4J9BA 1DQSA 4EW6A 3HP4A 1IREB 4IDDA 3MJHA 3I2GA 4TN5A 3JATA 1Z08A 5JAUA 1JQKA 3ST7A 4KU4A 4ZVSA 1JPUA 3AXSA 2G6BA 4GC9A 4UUOA 4Y2SA 1M3CA 3FYDA 2ANCA 3FUXA 4LHYA 4ND6A 2RJ3A 4MVJE 4XVRA 4Q7QA 2WWYA 2RGYA 3IP1A 4AJ9A 1RSZA 3MERA 2JGKA 2JH3A 4M88A 3QELB 5KX5F 5CDFE 4G24A 2RIPA 3CE6A 3GJRA 1QRAA 3ETNA 1KS9A 4CLRA 1F1BB 2HSEB 1FUYB 5ITZA 1V41E 4IEFB 3G2JA 3ML1A 1P0FA 4QQNA 4B5KA 3VR4H 1Q77A 1G7CA 3JQ8B 3OYKA 4UAVA 2GAOA 4C4OA 3KNZA 2QLFA 4MYSA 2VPXA 2W2OA 2DUNA 2POQX 3L93A 4GPEA 1AKTA 3PA6A 1K7SN 3LHDA 3CLKA 2J4DA 4Q0MA 3PR1A 2RHTA 4FYXB 1XHEA 3OESA 1CUEA 4M75D 1L5FA 3PEWA 1HX7A 1NUPA 4P4UA 4W9NA 5MF6A 1P8JA 1PJLA 1DO8A 3UOGA 1W36D 1XD2A 4I1VA 4AKTA 1C30B 3Q87B 2HA5A 4D8YA 3T3NA 2MPXC 3DDOA 3VHXB 3REBB 5EJEA 3LU1A 1BWRA 2GUWA 1Z0ZA 4DHWA 1T5OA 4EY8A 5CIUA 2ODBA 3EW9A 4TKZA 4KIJA 1TT5A 3OOJA 2H18A 3TKAA 2DXTA 1ZA1B 1XTPA 3GFSA 2VS1A 2JJMA