3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
2FRWA 3NH6A 4LV8B 4RKEA 5AJZA 3SJBA 5J4HA 5FL7A 1NLPC 1BMFA 2EVWX 3QXCA 1T4GA 5JHHB 3CH4B 1E2FA 2ZRGA 2RHMA 2IK8A 1H8KA 2VVKA 2YHSA 3VR3A 1LTQA 1CU1A 1NVWQ 3DZDA 2RNAA 1IBRA 2FNAA 1PLJA 2CBZA 4UQOA 5C4GB 2OBNA 3W8NA 4E5UA 1N5JA 4B2PA 4NZYA 4Y0AA 4GL2A 5E7JA 5A4JA 3OE7A 2KWIA 2OXRA 4JVSB 5DI3B 5JWHA 1AZEA 1KTVA 2Z4SA 3SDZA 5GVSA 3EX7C 2GTOA 4YC7A 5C18A 3QIAA 2W6ID 3AVPA 4M4SA 1NMYA 1VCOA 2XNSA 3GEHA 2OAWA 2IYUA 4P3YA 3PUXA 2HYDA 3OZXA 3GQBA 3TJZA 2ANCA 4JVNA 4AFZC 1GFDA 3B1VA 2EQIA 4TMKA 4LUEA 4CDGA 4MGYR 3B1YA 4F93B 3TUIC 4HCKA 1UHFA 3VHLB 2Q9AA 2IS4A 2JGNA 1BYIA 2VBCA 2DM1A 4B71A 1K5DA 3IQXA 1GTVA 2ZVPX 1W4BA 3B8HA 3IQWA 4QHYA 2RGNA 5DH9A 2V7QD 4IDPA 2J41A 4J9EA 2IXFA 2KGTA 2GZDA 3K0FA 5DE3A 1UJYA 3UXMA 2HEQA 1I2DA 2XITA 3B13B 3SOPA 3VKHA 1ZD8A 4Q18A 1S96A 4J9IA 1E2EA 5FFMA 2YWHA 4KODA 2KEAA 1GRQA 2ZS8A 4NP6A 1JEGA 1KSHA 2EFDB 2O5VA 1B0UA 2FPDA 3ZZ0A 1Z08A 4ASUA 3BC1A 621PA 4PTLA 2QORA 4LBYA 2R6AA 2AN9A 2ZYVX 4RTYA 1CTQA 3W6OA 5CLLA 2J9RA 4O0MA 1XEWY 1OH7A 1ZIOA 1G3UA 4C2UA 3EGUA 4IVPA 2DILA 1TUIA 5SZKB 2FSGA 1CR1A 2JMAA 4M8NE 2LQNA 2GXQA 4QNRA 3THOA 3TW8B 3T06B 4TMWA 3NBXX 3VS6A 2D4HA 1XTKA 4BEBA 2QAJA 1ZC4A 1DADA 1S1CA 1ZUIA 2DR3A 3OESA 4XSHA 5JRJA 1MH1A 2UVQA 2QN6A 1NY6A 2WMOB 1MT0A 2ZRMA 3MD0A 4MKGA 4RZUA 3RS7A 1QKXA 1G7TA 2YSQA 3IPXA 3Q5EA 4TN1A 4UNNA 5SZJA 2QDLA 2CCJA 2ZRKA 5C2JB 3R8FA 1PUIA 1NF3A 1GM5A 1GBQA 2CK3D 3WYAA 4OMNA 1W36C 3VR2A 3KZ1E 1KK2A 2BMDA 2D7CA 2F3RA 2A30A 2NPIA 2RGCA 2J05A 4MYTA 1DVRA 1K0XA 2IYVA 4JSTA 2BBTA 4AKGA 2R62A 4ZI2A 5F3WB 3U7EB 1ODFA 1ESNA 1GDDA 4NPHA 5CYOA 5FOTA 4NH0A 1NN0A 2QU8A 1X6GA 1XD8A 3QEOA 3X1YA 1ZM7A 2KRMA 2QL6A 3LQQA 4JT2A 5DISB 4ZV4A 3U6BA 4V0MA 2JJ1A 3TE6A 4C4PA 1XP8A 2LMJA 2LJ3A 4F14A 1KDTA 1WDTA 2DX1A 2M51A 3LDAA 1IJEA 3AF3A 3L2OB 2ENMA 1Z3IX 1ZU5A 5GJWC 4AURA 4D26A 3H0IA 4JYCA 1L7VC 4V0LA 4BFVA 4ERNA 4JL5A 2F55A 1U0JA 5HPYB 4JKYA 4L4UA 721PA 1NVVQ 1I0CA 3GLGB 5FOXA 3VHXA 1RI9A 1UFFA 1X69A 4AG5A 4LBVA 1W1WA 2KYMA 1F3OA 2ED1A 1COWD 3AP1A 4TYQA 1G3IA 4TSFA 2L2PA 1NG2A 2CDTA 1NN5A 1UG1A 2DFLA 5CB6A 2GBLA 5LPNA 2KR3A 2V1XA 2QRZA 4MRRA 2QM7A 4HAZA 5KSYA 1M74A 2D2FA 2YC2C 3E70C 5CJPA 4A92A 2GJKA 2JM9A 2BBOA 2ZR7A 4Z88A 3MG9A 4L16A 3TUJC 1UHCA 1XXHA 5LB2A 4U7DA 4EPXA 1JAIA 2VEDA 2WSMA 4NKRA 5HKKD 4I1SA 5H70A 5F9HA 2ESWA 5C46F 3X2SA 1E2GA 3CZQA 1P75A 2ZYWX 2F43B 1IY0A 2DCUA 3W5JA 2ZJ2A 1WDXA 1AGRA 2A5DA 2JEOA 3TVTA 3NKVA 2KE9A 1SPKA 2GCOA 3ZS8A 2NOAA 4IDQA 4M0LA 3KKMA 1FUKA 3BAFA 3EC1A 2CXXA 3MFYA 2NWMA 5JS8A 2ZRNA 3BB4A 1IONA 1YZUA 4BFTA 1SXJA 4OKSA 4D2IA 2FJUA 1OIXA 4M22A 4DRZA 4PZZA 2J5XA 4CF7A 2ZI4A 4LBZA 2RHDA 2UZIR 4IHQA 2EFEB 1ZYUA 5AJWA 3GLFE 1RKBA 5FBRB 1XF9A 3FKQA 1SHGA 4YDHB 3KKPA 5FUYA 1GCQA 1II8B 2LJ1A 1X86B 2VLIA 3WMFA 2ZU6A 3GPLA 2ODEA 2MMCA 1X6VA 4NYMR 4QFMA 2A5FA 3LXRA 5H68A 2OZEA 1E2NA 2P0EA 4BFSA 5L23A 1OPLA 2B7CA 3AGPA 3K0EA 4HSEA 4KFTA 4MKFA 3UKDA 3VX3A 3GFPA 4P4TA 1XPOA 4KCGA 4HEJA 4D25A 1RRGA 3AF2A 4J0QA 4RD1A 2QQEA 1X1RA 3EW9A 3G0HA 5KUTA 4ZCIA 3RRNA 4KO8A 3T34A 4C0JA 2A9KA 4HXJA 2FPMA 2XSZD 3ADDA 2P6UA 4QC2A 3NHBA 1VMAA 2WTUA 4R98A 1QHSA 4CYMA 1Q1EA 3BH6A 1G5TA 2BZYA 4M1OA 2NTYC 4PXAA 3LQRA 2NO9A 1DG1G 3WNCA 1OPKA 1M2OB 1Z0FA 2W6JD 2P6NA 3BD9A 3KB1A 3H0HA 1SHFA 3L43A 5J40A 2FPEA 1S4QA 2BZXA 1CULC 1XJQA 4I1VA 3VRZA 2O8CB 1FMJA 4EKDA 3THXB 3GLIA 4IOJA 3RS0A 1QKWA 2CL0X 1R0XA 1XCMA 3A1SA 3HDTA 2YWEA 1YE8A 2ZE5A 1XEFA 2XZOA 1EX7A 1IO6A 2PZFA 4EFLA 1DELA 4B75A 3ADKA 1FTSA 1J8MF 2QMOA 1OXTA 2LCFA 5FL3A 2ZM5A 4TZ6A 4LHVA 1A82A 1QHGA 3CNNA 4Q66C 2IYXA 3AKDA 4RD4A 4EQ6A 1VIAA 1W5SA 2DRKA 1TU3A 4DSOA 2L3QA 2I0NA 4A8JB 1QHXA 2ORVA 1E69A 4W5HA 3CONA 1G3RA 4A9AA 2N46A 4LYFA 1E98A 1D2NA 2WZQA 1UJ2A 3RBBB 2BMEA 2PT7A 3EG0A 5FR2A 2B86A 1AQUA 3PR1A 2A5YB 1RUWA 3X1ZA 2I3BA 3LBIA 2J7IA 3UA6A 3AEZA 2PCLA 1TF7A 2Q3FA 2CNWD 5DHAA 5FOSA 1GL5A 4XOIA 3G82C 4TYNA 3Q72A 5FTNA 3DL0A 4TWZA 2IHYA 1LNZA 1G5PA 1FX0B 3A4LA 4UXJA 2O8EA 3CB4A 1UM8A 2IUSA 2YINC 3IILA 3LAWA 4NCNA 3QXSA 4CEHB 3A98A 1N5LA 3WBJA 3TGPA 5HTKA 2ZRFA 3QNUA 4NL4H 1I4TD 1OXXK 1QG2A 2J0QA 3QKSA 4QG7A 3ECCA 2HSPA 5L3RA 3ZQJA 2BEKA 2ZEJA 1UPTA 4CT4B 2O8BA 1N25A 2M0YA 4JZKA 2XJ4A 3A1TA 4XTCS 4AWXA 1E0JA 3EC2A 3KUCA 3RYTC 2KXCA 3DDCA 2XOKD 1XJCA 4XSGA 4XWOA 4F17A 4TYPA 1Z6AA 2OCYC 1SRLA 5EQTA 1SZPA 1ZM2A 2NO7A 3U7GA 1JEDA 2QBYA 4KITB 4OHZA 3IBYA 5DN6D 1W4CA 4F16A 4Q9HA 4DUGA 3TVDA 2C96A 4M1YA 4QL3A 2ODWA 3K0FB 3OEED 4GBMA 4K8OA 3VAAA 3R9WA 4MH0R 1P7CA 4KSCA 2BBSA 4A0RA 1KI8A 3AVTA 2Q9BA 1Z63A 2VHTA 2VP2A 1PZNA 3KXKA 4BE7B 3PCRB 1M3CA 3K9HA 4IFEA 2DF6A 2JJ2D 1E2QA 4HLCA 1QHYA 1CS4C 5IK2A 3GJXC 1E9BA 4NYIQ 2ZITA 2FZ4A 3CX6A 3AF1A 2OBLA 1FUUA 3D31A 3GJ6A 1F5NA 2X2EA 1J70A 1SVLA 1JALA 2EW1A 2QTHA 2O8DA 2WAYA 2OCAA 5H8WA 1HQYE 2ZTSA 4LCBA 3VS1A 4JLJA 2BV3A 3QPUA 2GRJA 2RQUA 1DTSA 2WPDD 4Q48A 1KZ7B 5IT5A 3SBEA 1DEKA 1MRSA 2FWRA 3FMFA 2IXEA 3RANA 1MO5A 3LBHA 1KFZA 2A7QA 3WP0A 3LFUA 4XWKA 1I1JA 4J9GA 3NPFA 1JR3D 5KNDA 3UPUA 1CXZA 3OAAD 4Q1CA 1YRBA 1D9ZA 3CZPA 2EBPA 1E94E 1SVOA 1E4VA 3LO5A 4EPRA 2GEVA 1U2RA 1CP2A 1KO4A 2YC4C 3UIEA 3IHLA 3AUXA 4TLDA 3R20A 3C0CA 5BYKA 2ZUBA 2EPDA 4M53A 5BQ5A 3W34A 3HPRA 3K09A 2DNUA 1T5IA 2D1XA 1VYVA 4ON9A 2IYLD 2JLXA 1AS2A 4AI6A 1W0KD 3W9YA 2GF9A 1TG0A 5IF9A 4BFZA 4TTPA 4MYUA 4RTWA 4OI2A 2KXDA 4G1UC 5KDLA 3GLHE 1XPUA 1Z9ZA 2CCGA 3GEIA 3K0CC 1WCV1 3NC1C 2C0IA 1XU4A 4US0R 5DSZA 3ZD6A 5E95A 2OO7A 2ZJ8A 1AWXA 3I3SR 3M4YA 4PZLA 1Z07A 4M1KA 1MRNA 2V4ZA 4UNRA 4JLKA 3PE0A 2MSEB 4D8KA 4RUGA 3N5CA 3A58B 3LV8A 3SZRA 1WP9A 1CR0A 5KU1A 1TQ6A 4KYIB 2WJYA 2ZPTX 3BK7A 3QI2A 4LPSA 5UKDA 4A8JC 4AC9A 4HB3A 2DLPA 4II7A 2ECZA 3DMNA 3I8XA 2BMJA 3UMFA 3BJIC 3U60B 5E3HA 4BQSA 1G7SA 3LBNA 4NDZA 5AR1A 3GD7A 4HAWA 1T3LA 2V8OA 5G3ZA 5JMTA 1DS6A 1U0LA 1IN8A 1YVDA 2F1RA 2R6GA 4D0NA 1LB1B 2CREA 4G01B 1PRMC 2XTMA 3BB3A 4GOJA 4R2HA 1ZM9A 5JBQA 4KRTA 3MWYW 2OLKA 3KFXA 4M4ZA 4LPKA 4BLOA 1H8EA 1GRIA 4OHYA 2RB4A 4BASA 1H92A 1R0WA 3QXHA 2P5SA 4QNMA 4Q21A 2WICA 1FP6A 2SHKA 5CM9C 1W4RA 5KTYA 1IN4A 2C03A 3DKPA 3H86A 3ICEA 2F9LA 5FI0B 1RIFA 2P6RA 3Q3JB 4JZ4A 1JPJA 3H0KA 1OHHD 2ZSDA 2HV8A 4R9UC 3TRFA 2EGCA 4IVQA 1U0HC 5CLQA 1T3SA 4I99A 1AGPA 1U9IC 2YUOA 1FZQA 2D8JA 2JMCA 3NGPA 5FW9A 2R44A 3CPJB 3P27A 1VDZA 3CNLA 4ACBA 4B3FX 4B43A 4EPTA 1IAQA 4BZPA 4TT3D 1CKBA 1S3SA 4IOMA 4U02A 1PKSA 221PA 4WXRA 4BLSA 4CRWB 3ZVMA 2IS1A 3FGNA 4M2LA 4ARZA 2FEOA 1N0UA 4ZIRA 2YV5A 1QRAA 3V4RA 2QT0A 2ZAOA 1DO2A 2WJJA 1JNYA 2MOXA 2XTNA 2Z0MA 2IT1A 2ZJBA 3DM9B 2OLJA 2ZSEA 2GXUA 3TUZC 2VH5R 2LWIA 4X1VA 2KJQA 2QMUA 4GFDA 1T8UA 4MDFA 4I81A 4LJYA 1K9AA 4EPWA 2R6DA 2D74A 5FTKA 2AKYA 3EAQA 4EPVA 2DYKA 3IUYA 4Q7JB 1HE8B 1G1MA 3DEFA 2WJIA 1I2MA 1P61B 3FPAA 2MCNA 4JLNA 4RTXA 4FMDB 2J6FA 4DCNA 1KSGA 3T5DA 2LCSA 4CC4B 4WCIA 1XTSA 1Q3HA 1DOAA 4JLBA 3NH9A 4B33A 1XRJA 2GK7A 4DLUA 1S9DA 1NEGA 3GLFA 4LC0A 5EP3A 1HUQA 2CJWB 3CRRA 1US8A 5ELXA 3TMKA 4TMXA 1XDBA 3CF0A 4OMPA 1E0AA 1ESMA 2CH4W 1KJZA 4CIDA 1N6RA 2ZYTX 4PC1A 1Z83A 3TH5A 4AKEA 3I9QA 1XFAA 4PHFA 4DSTA 1II9A 4DSNA 5GJVB 3NXSA 1UBFA 4IXMA 2VPPA 5F98A 2RGAA 4LE9A 2VF7A 4QBGB 4DT1A 2WSSA 4JLAA 3WYFA 2DE0X 1G7RA 4LHXA 4QHSA 3KQHA 5EP2A 1A7JA 4L9WA 3WXMA 3EA5A 1W0JD 1KSFX 1LW7A 2Q9CA 4OJQA 1ZUHA 4GDFA 1ETUA 2RQWA 3C16C 1GCPA 3OHMA 2FPLA 3WYGA 1YP5A 4B34A 3OEHA 5JLJA 4Q4HB 4DDTA 1E1QD 2GNCA 2FA9A 3U3OA 3CKLA 4BPBA 2J7PD 1PNJA 1OXSC 3MJHA 5SZIA 1XNJA 2QRNA 5C1BA 1AZSC 3OFND 1FMKA 4FMBB 2H16A 1RFLA 3BGWA 3F8TA 1E1RA 2VQSA 3DKVA 4WA7A 3QWYA 3O8BA 4AKIA 4MUBA 2FF7A 2DPXA 2IXGA 2JLWA 1U90A 1UDWA 3QG1A 1E9FA 2QAGC 5EXSA 4EJSA 2QENA 4Q01A 5FPYA 3PEUA 2CEAA 3ZZTA 1NVUQ 1UADA 2BJWA 4NYIR 1KDPA 1KI9A 2GVDC 4RD3A 1TAGA 1VHTA 3I8SA 5FUXA 2GXAA 4KYUA 4IFBA 5J4YA 2O8EB 5FOVA 2D7DA 2J6OA 2CHGA 1ARKA 2PZGA 4KJZA 5BN4A 3R9IA 4M21A 3ZYCA 3SN6A 1UECA 3TSZA 1Z2CA 4QJ4A 4E22A 1XTIA 1U8AA 1FYNA 4RFSA 1U98A 1ZIPA 1E2IA 2PLRA 4URVR 1OIWA 3QXJA 3THWA 5CIWA 4FSSA 1XD2B 3AV0B 2AX4A 3SYNA 4IKEA 1NIPA 3MUFA 3B2EA 1XWIA 4C2TA 2FPFA 2HT1A 1W49A 4A1FA 1BS1A 1UBCA 3I35A 2IHBA 4TQUS 3T35A 2IF2A 2JIZD 3U44B 1GOTA 4YONB 5IHIA 1XZQA 1D8TA 4UXIA 1OH5A 2W0SA 3THYB 1VKJA 2JLRA 3PITA 1XOVA 3H0FA 2KB0A 1GL9B 2FFQA 1UDLA 1IXRC 1NJFA 3ETLA 1GSIA 2YUQA 2QROA 5B64A 2NZ8A 3AKEA 1RLPC 1XEXA 1UUEA 3LLMA 3AVUA 1NSFA 3NEYA 2G88A 2PX3A 4Q4AB 1CSKA 5JRZA 1BOFA 4YMTA 1KMQA 5H1YA 3RS3A 4F7WA 1TUEA 2A5GA 1EFRD 1NSTA 2VSOA 2J87A 2A36A 1KJWA 3EZ2A 2P65A 4CVNA 4OI0A 4CZ2A 1KSJA 2LKDA 2CE7A 3AP3A 4PPNA 2DWPA 3N70A 2BEJA 4W5WA 1UKVY 1XJ0A 4EIWA 3I5RA 4MKHA 1X27A 1RYFA 2IL1A 3PXGA 1WFWA 1QVRA 1ZJ6A 4OMOA 1UKEA 2RKOA 5AJXA 3P20A 3WY9A 1YN8A 5IXFA 3F3YA 4PSKA 1WB9A 1LV7A 3FFBA 4OHVA 4P4SA 3A4MA 1R6BX 1DO0A 2WBLC 1S1MA 3BWDD 3PFIA 5L3VA 1IY2A 2ABLA 5E4FA 2E5KA 2DWQA 1T0JA 4GBQA 1WXQA 2DFKB 1R5NA 1QHIA 3WHLA 5K8IA 2GAOA 4PAOA 2WKPA 1TUDA 2JLZA 3FB4A 1J7KA 4Q03A 4LYJA 4HLDA 2GCPA 4J9FA 4I1OA 2QSYA 4V0OA 2OFWA 1KI2A 4A82A 3VRYA 2CMKA 4KBFA 2BBWA 2HLDA 4B76A 1QHHB 2JLQA 4QXAA 4UNQA 3HR7A 4TMVA 3IKJA 1E0KA 5GJVC 3RS5A 2V1UA 3MCAA 4JLPA 1NMXA 1AD5A 4XH9B 1NN1A 1QHNA 5GJBA 2IEZA 3W90A 1IXZA 2RAPA 1KIMA 3NG1A 2XEXA 4DEXA 2C95A 1X2QA 4BFUA 4TYWA 4GOXA 1CR2A 3KXLA 2HF9A 2ZU0C 4EDHA 1QCFA 4C0AC 2BVNA 3ICQB 1Q20A 2PX0A 1HSQA 2ATVA 4D0GA 3ND8A 3NTUA 3ZLJA 2QTVB 5B2ZA 3E5HA 4AFQC 1GFIA 4CEIA 4AFUC 4JYBA 1W6XA 3TSWA 2P5TB 4AYWA 1KZGB 4WIAA 4DLWA 2GA8A 4S2EA 4NCJA 3X1XA 4Q4LA 2EKHA 1XD9A 3FYHA 3QF4B 2ZRPA 4ZCLA 2GWHA 1K1ZA 3QSYA 4NCKA 2LP5A 4TQAA 1N0WA 1ZW6A 1LCKA 3CF6R 1E9DA 3GLHA 1DAKA 4EFMA 4Z1MA 1Z6GA 1F2UA 4OL0A 3B85A 2CUDA 5FL7D 1BMFD 3VR5A 1R0ZA 2XNDA 4BLTA 2VP5A 2KBFA 5CYPA 1WIEA 4RTZA 4OMLA 4TL8A 1EWQA 3EG5A 4N0EA 2BM0A 2OUKA 4XJXA 1KNQA 3QQ5A 4U00A 1RVDA 1JEEA 3TK1A 3QEJA 5KDOA 2B8TA 2Y8EA 3ZL7C 2DL8A 1AN0A 1E2DA 4QJ3A 1WBDA 2KBTA 1OKKA 4A0HA 1BO6A 3FE2A 2DL3A 2W10A 1Q12A 1OFTA 3L0SA 4JSYA 5L3QB 2XXAB 4YLGA 5CK5A 3KTAA 2RGXA 4M1WA 2OEPA 4CGZA 4PO9A 2O31A 2O0HA 5BN3A 2G77B 1HH4A 5JI2E 3MLEA 2AXPA 3T1VA 3RWOA 4ARZB 4BLQA 1OH6A 1J2JA 2H57A 1XZPA 5DHFA 2OAQ1 1AIPA 1O3YA 3VS5A 4DLVA 2FGKA 3P4XA 4C0LA 2W2TA 2PNIA 2PH1A 1KI7A 3D8BA 3PV0A 2CLDX 3B7GA 1X8LA 4RSGA 4IOKA 3TR0A 2I4IA 4KFSA 4OI4A 1CF4A 1W5TA 4KAXA 5F9FA 1N6KA 2NQ2C 4JVLA 1GL7A 2QEQA 3EWAA 1GZSA 3FKSA 4PO1A 1YJ5A 1Z0IA 2OCPA 2W00A 3NMZC 3EZFA 1YNZA 2ZR0A 3K8YA 3UK6A 3CW2A 3GJ5A 2IEYA 421PA 4Z51A 3DZ8A 2GNOA 3A37A 3P26A 2LZ6B 4KV9A 1E99A 1FOEB 1AZGB 4ASUD 1LF5A 2WAXA 1HA3A 4OK6A 1YR8A 5CB8A 1FNNA 2GK6A 4UNPA 3GLFB 2LKCA 2HJVA 5SZHB 1BU1A 1R10A 2J0UA 2EYZA 1AS0A 3CUEF 1OXUA 5L3SA 2YJTD 1OXVA 4US2R 4LJ5A 2BHRA 2QQ0A 1E32A 2G3YA 2ZJAA 2ZJYA 2SRCA 3QE0A 1Q21A 4QM7A 1IJFA 2KRSA 3VTKA 2QT1A 3CRW1 1K6MA 5KOYA 4QGFA 3W3AA 2JAQA 3K09C 3D7MA 4GT1A 1E6GA 4IIMA 3IIMA 4IJMA 3H2YA 1DAIA 5DNYB 1Z47A 2FO0A 4DLSA 3NBZC 3PUWA 3QJYA 4K81B 3QENA 3KJEA 5KHOC 3AUYA 1ZINA 5M04A 1GRRA 2CUBA 4JBXA 1RW4A 4A4DA 3FWYA 5FOWA 4BLPA 1UBEA 3REAB 2YKGA 1ZC3A 4LUCA 4EIKA 2FU5C 3GMTA 2C04A 1UKYA 4CC2A 4Y0VA 1E2PA 4C0QC 1KI6A 3GLGE 1E9CA 1ONBA 1F2TA 4TLBA 3AVYA 5J4KA 1XTQA 4EJSB 1U5SA 2ORWA 3RS2A 4DHEA 2CSIA 1MABA 2F2XA 2FSHA 1HT1E 3MWLA 4JS0A 4LOAA 4O2RA 4F4CA 1CIPA 2YOHA 3L0IB 1H65A 2CT3A 2AXNA 4PAQA 3O5ZA 5TMPA 3ZVRA 4IRUB 5K8TA 4IEEA 1C1YA 3QPVA 4IOLA 4PAMA 2EYQA 5AK0A 5AUQA 4GP6A 2VSFA 2YDLA 2CVHA 4MITA 5DYIA 2A78A 5TY0A 3ASZA 1OFHA 2PZ1A 4DCUA 4PQFA 4OI1A 1NBMD 3Q7PA 3G5UA 4FCWA 4HDQB 4TSFD 1FQJA 4XVQA 3THWB 1KSWA 1PV4A 4D4LA 4TL9A 3KFVA 3VKGA 3CR7A 4TLCA 5GVRA 4MRSA 3H41A 5B30A 5FWCA 3WRYC 2BCGY 4HZIA 1I4DD 2L0AA 3KKQA 2UZ3A 1SEMA 3KJGA 4JLDA 5JSZB 3R7WA 4ZI3A 2NO1A 3FHOA 4G0NA 4Q9IA 1NNEA 2VO1A 2RQTA 3ZDQA 4ZDJA 1JU5C 1BYUA 1HJDA 1MR3F 1Z6YA 2QMHA 2IS2A 5CK4A 2DB3A 2FMXA 3REFA 4LBWA 1XTJA 1RYHA 4A0FA 2HJGA 1NG1A 1NG9A 1YKSA 1T9HA 3C14C 1IOZA 4DB2A 3U6KA 1Y0MA 3A8TA 1G8FA 2D8HA 3K1JA 3K9LA 3IBGA 3IO3A 4ITRC 4PC2A 4C0SA 5DI9A 4CEJA 1G4UR 3T1QA 4PC3A 1XEXB 3WHKA 1G64A 4C3ZA 1T6NA 1Z5ZA 5GJCA 4Y92A 2DFNA 2X77A 2EYWA 1NLFA 3M0EA 2O2OA 4YXWA 3VFDA 2IUUA 5BN5A 1W1FA 2VP9A 1TPZA 4YMVA 2F1IA 2I1QA 3ZD7A 3U4QA 4POAA 4IEIA 1MUZA 1UDXA 2OJ2A 1M6NA 2G6BA 4DCTA 5G53C 1J3TA 2K79A 3SJCA 1UKZA 2KT1A 1WA7A 5JEEA 1G291 4KVGA 2D0NA 2C8VA 2WKQA 2V55B 4UJ5A 5HZHA 4MGZR 4HYYA 2LJ0A 2GESA 5CM8B 2DWOA 5AWFC 3LWNA 2VIIA 5FPTA 1NKTA 2VHUA 2O88A 1XMJA 2AFHE 2RF0A 2N42A 3CWQA 3I4LA 3OIYA 5DGXA 4HB0A 1JXMA 1HT2E 1T0HA 1S2MA 2VHCA 3EG3A 5L8VA 4JLOA 2SEMA 3GBQA 4HDCA 1LVGA 3SFVA 4QGAA 2W2VA 3GP8A 1JO8A 2ZRDA 4X8HA 2VHJA 1KI3A 4KFUA 3VU9A 2PBRA 2C2HA 1GVNB 1WXUA 2NO6A 5KDDA 1OB5A 3ASYA 3BB1A 3REGA 5DIFA 1EFUA 3WNBA 4WVFA 3T1OA 1W2HA 5J4LA 3RABA 2E1RA 4LX0A 4GPTA 1UTIA 1Z22A 3OAAA 2Q0HA 3QPWA 4L8GA 3ND9A 1FL9A 2F7SA 4LJ8A 4P0TA 5FUWA 4B2LA 1OFIA 1IM2A 2F2WA 1NMZA 4RVCA 1GP2A 1Z0KA 2ZE8A 4LV5B 4ESHA 1F6BA 3QXXA 4IVRA 3T12A 4A15A 4IDHA 2ROTA 4CT5A 3DPUA 4QGHA 4R2IA 3MWJA 1CJKC 5EJEA 2OI3A 3I5SA 3RSOA 2MMGA 4RCYA 4A0GA 1UE9A 1KJYA 2AZSA 1KO5A 1ZNXA 1G41A 1VCIA 2JS2A 1FPMA 5JCPA 5JEDA 1OIVA 4YMWA 4C9BA 3B9QA 1A2BA 4P33A 4RTVA 1KHTA 1TMKA 5DO9A 3U3JA 3U3MA 3C7KA 2MSCB 3C15C 4WW0A 4HUTA 1WXTA 5IH2A 1G83A 2XZPA 2W83A 5K8UA 2FGJA 1BB9A 4HZUA 1SVIA 2IX3A 2DBKA 2WIBA 1YCSB 1PHTA 1AKYA 1ZAKA 1NVVR 4DLZA 2J6KA 3ULRB 3EIQA 3KQUA 2G6FX 4FW9A 3RWMB 2DJQA 3GLHB 4XVUA 4WBSA 1UAAA 2G1KA 1TL7C 2WWIA 3CX7A 5FBWB 2JM8A 3B5JA 1NYFA 4GZMA 4KXFB 1FQKA 3AGQA 2L0XA 2GJ9A 3V00A 3VR4A 5HE8A 3BRWD 3A1WA 4C0HA 2HT6A 3BFXA 3CLVA 1SGWA 2WIAA 2K9GA 3C41J 2CSQA 2CE2X 3ZIAA 1AS3A 3FHTA 1E2MA 1NKSA 1A0NB 3H1TA 1H8HD 3IO5A 4PZYA 1T8TA 2NIPA 4ACAA 1N6LA 1PJRA 1CJMA 1Q57A 3LD9A 3SNHA 3KXIA 3AP2A 3GFTA 4A2PA 2FPKA 5CJ2A 3KTAB 3IDQA 1Z0DA 3CPHA 2O0KA 2KE5A 3NIBA 3W6NA 2RMOA 4LY6A 2ZJZA 4BWYA 1QLYA 2JASA 2V9PA 2ZS7A 4V0KA 4Q47A 5DI3A 3TQCA 3ZH9B 2R8RA 3MAAC 5EUQB 1GNRA 1JB1A 3Q7QA 1IY1A 5JJIA 1VA7A 1X43A 1YHNA 2IF0A 4HLUC 1KO8A 3WP1B 4D4KA 1D2EA 2R6CA 3PIRA 4CW7A 1W7AA 4URYR 1P2TA 3OF5A 1GKUB 1YZTA 3TKLA 4BGDA 2GF0A 1OF1A 3AKCA 3IGFA 4B35A 4Q19A 4OJKA 4DUGD 1OH8A 4O3MA 2D62A 1U81A 4B3CA 2F1HA 4NU0A 5D3MA 4QGGA 1VECA 3M0PA 4XD7A 2DRMA 4Z8YA 4CC7A 2ONKA 3IQLA 3TNFA 2H17A 3QOFA 1G8YA 1R4AA 2Q3HA 4KFRA 1ZNYA 2GKSA 4TMTA 3KJIA 3UATA 4DC9A 2WWHA 3RDPA 1X1SA 5IK2D 3EG1A 3REBB 1M7HA 2QGNA 3MGCA 2KROA 2X1VA 4PFSA 4V0NA 2RQVA 3NHNA 1XB2A 1XXHB 1P9WA 5P21A 4KSBA 3NEJA 1AVZC 3M0UA 4IIOA 2H5EA 2J0UB 5L3SB 1OV3A 1UEIA 4TTRA 1ELOA 1VIYA 2JDIA 1CRPA 1G17A 4ZNXA 1XEWX 1GBRA 3KKOA 3RNLA 3SI7A 2VP6A 1WF3A 1TADA 2PTKA 1G6OA 5HCNA 4ILEA 1I4LD 5JJKA 2CL7X 2GCOB 3U23A 2OBMA 3EASA 1AWOA 1XBTA 3FFAA 4HAYA 4Q1BA 4B47A 3KX2A 2JLVA 2K7AA 1BKDR 5IHPA 1V5WA 1WBBA 1G21E 2F2VA 1VG8A 2ODBA 4QT7A 1GAJA 1IN6A 1SXJB 2LX7A 4NCHA 1OT3A 3UWOA 1HD3A 5BW8A 2J45A 2BMFA 1Z6TA 5E7IA 3BORA 3I92A 4BFYA 3M0QA 3VNUA 2EGEA 1Q1BA 1S9HA 2RGNC 3DO6A 2J06A 1FFHA 1SKYE 4G5QA 1AM4D 2BTTA 4FMDF 2W0MA 1E79A 1F2TB 3SYKA 3I73A 4KVAA 1NBME 2OCBA 1VYUA 2WVJA 2FFAA 3C5HA 1A4RA 3QF7A 2IYZA 4JJBA 4JJZA 1OSNA 2YNMA 4E07A 1P72A 1K0SA 2ZIAA 4NBSA 5HE9A 1ABQA 3BS4A 2OT3B 3KKNA 5DLQC 4H1UA 821PA 2BZ8A 1NRJB 3LVQE 4M9QA 1SRMA 1XX6A 1AQYA 1KKMA 1G16A 2QE7A 3GFOA 4TL6A 4RY2A 3RHFA 2XAUA 3EHRA 4BFWA 3CX8A 2G83A 5G3YA 1M3BA 3I62A 3QVVA 4RCZA 5EXTA 4G5SA 1GL6A 1CJUC 2ZRIA 4BLRA 5KNCA 2FH5B 1L2TA 3BXZA 4L5BA 4HUQA 1FTNA 2IIMA 4KHZA 3CR8A 1A2KC 3K9GA 4X8LA 1AK2A 1E2KA 3CNOA 1QBKC 5JS7A 2R65A 3QY0A 1C9KA 5DYGA 4GMXA 1OLOA 3AVVA 3OIUA 2QPOA 3WMEA 2GTPA 3NVAA 4V02A 1H8ED 2NGRA 4U5XA 4MA4A 4ZDKA 3GLIB 1Z9QA 5LD2B 4O25A 1KDOA 3V9PA 2DHRA 3GJ8A 3ZVLA 3P4YA 3R9XA 3EPHA 2V1RA 4IDOA 4O2LA 3WRXC 4CEJB 1II0A 4B48A 5JJLA 2OG2A 1P2SA 2NMVA 2GDJA 4FWTA 4J9HA 3H4MA 2XB2A 2QP4A 4HVVA 2ZR9A 4HATA 4N3NA 3TW4A 2VHQA 4BRWA 1OE0A 1D5CA 3GEEA 3SBDA 4N1AA 1YWPA 2F43A 3DM5A 1WYXA 2QP9X 1QWEA 3QG5A 4EQ6B 3U4QB 2EW3A 1VG0B 4QKQA 4ZO4A 1NN3A 1IN7A 2QG6A 2OE2A 1HV8A 1TTTA 1G8HA 3VR1A 1Z06A 1YR6A 1J99A 1HEIA 2PEYA 3MMPA 1YZQA 4URXR 5LDDC 5AUNB 4FCTA 4JMPA 4PO8A 1RRPA 4US1R 2IYTA 3RLFA 2VTKA 4A36A 4GSYA 2C78A 4MKIA 1PVOA 2IYSA 2AD5A 1JI0A 2QY9A 2GEDA 1S0UA 2GBLC 2JW4A 2IYRA 3HJNA 3I72A 3U7FB 4EFNA 4YQFA 2ZRJA 4M9ZA 2WWYA 1QF9A 3IIKA 3LX5A 4JVMA 1NJGA 1II8A 1I07A 1Z8FA 3B1ZA 3VU9B 2AD1A 3W5IA 3W3ZB 2R2AA 2LNHB 1UFQA 2H8KA 2FG0A 1G8GA 3EHQA 3QKSB 5AUOB 4W7SA 2ERYA 4NTZA 2O8BB 1X8JA 2V3CC 2W0ZA 2FV8A 1R5OA 1JBKA 2W6IA 4JPBW 1NL3A 1JQJC 2ZI9A 3UMSA 5FBQB 1NP6A 1WX6A 4JL6A 1RZ3A 3ZVNA 1SQ5A 4Q5IA 2KT8A 1TQDA 5IRCD 2QBYB 1WE2A 3PVSA 3ZS9A 4DKXA 3U2QA 4Q4JA 4Q7KA 1L8QA 1Y63A 3T5GA 1YZGA 1CLUA 3UA7A 1V1CA 1Z6XA 1ZVQA 2WJHA 1SXJC 3RRYA 3B6EA 5HZKA 2J3EA 2OESA 2IWRA 2WSSD 1LF0A 3CH5A 2WWXA 1EFTA 5HR5A 1ZSGA 4LK2A 2WMNB 3CIOA 4D8DA 1KDRA 4UJ3A 5EUMA 4A6PA 3AVXA 2V7QA 2IWHA 4ESVA 4OQNA 3U5ZB 2ZRCA 1UGVA 2O8CA 1GCQC 3THXA 3M6AA 2P4RA 3KDSE 4HZUB 4LV6A 1JR3E 2NG1A 4LSGA 1AA9A 3LVRE 3T61A 3LLUA 4G5OA 1E2LA 1G3QA 1MO3A 3EG2A 2ZAMA 3K0CA 2O8DB 2NO0A 2JATA 1W48A 1E1RD 4UKDA 3RS4A 1KGDA 1G5RA 1NM7A 2PL3A 4A63B 1V43A 2HF8A 3NBYC 4UXHA 4HB4A 1WMSA 5EZ6B 4DJTA 4LN2A 1X8KA 5K8LA 1UBGA 3KUDA 4MYCA 5JI3E 4M1TA 1GKYA 1AKEA 4BECA 3VMFA 3SQXA 3HP1A 3IIJA 2FEMA 1DAHA 2O0JA 1OEBA 4TQ9A 1ZBDA 5C4MA 5TXGA 3KQKA 1AWWA 5EE9A 1JJ7A 1GNQA 2Q3MA 3A36A 4Z54A 3PJRA 2PMKA 2AK5A 1W70A 2MSDB 2YOGA 1JXOA 2ZROA 2CLCX 3EA0A 1KAGA 3SQWA 1P62B 2RGBA 4C7OA 2GEUA 1KO7A 2AK2A 1TEVA 1AOJA 1UF9A 2CK3A 2PMDA 2DL4A 2FRYA 3L0OA 3EPJA 1ZMXA 1CKEA 3R6NA 1FX0A 1P60A 3JZAA 5LD2C 3HU2A 4CEHA 2HCBA 4LNPA 2ZVQX 4QBFA 4OQXA 4K46A 1ABOA 4L15A 2JJ8A 4XWAA 2YYZA 4PC7A 4B73A 2B21A 4KLNA 4AK9A 1RC8A 2ECKA 1ZCAA 3BH0A 1F60A 3GJ4A 4B3XA 4WOPA 1KMHA 1G4AE 1C4OA 2HXSA 1JJVA 2HBWA 1U9IA 3AKYA 1U8ZA 2IA5A 2ZSAA 1W44A 2H7VA 4Q00A 5D3MB 3FOZA 3K70D 1ZU4A 2HYIC 1N5KA 1VYTA 2EVRA 1KI1A 4LJ6A 2OILA 1P2VA 2GTJA 3I61A 4R71A 4EPYA 2N1BA 4BRUA 2ZS9A 4P31A 4HI0E 4QHTA 3SU8A 1ZLMA 3QKTA 3RRZA 3F5FA 1ANKA 3PUYA 1EFNA 3EZ9A 2VWFA 1M27C 1COWA 2XB4A 4TLAA 4AYXA 2BKEA 5FBLB 3F0TA 2YVUA 1NEBA 2REOA 3HWSA 4RTUA 1Q0UA 4OYHA 4GLMA 1DAMA 2A08A 4MRVA 1T91A 1E9AA 2BDTA 4AYTA 4PR0A 1SVKA 1M1YE 2ZI5A 2Z6VA 1QDEA 3RAPR 1NLOC 5EP4A 3B82A 1Q1QA 2ZE6A 1OB2A 1M3AA 5IHNA 1ZM3A 3OE7D 4F38A 2YT6A 3K0AA 1R8SA 2AL7A 5HKKA 3MSXA 2V1QA 1P73A 5JCZA 1SVMA 2D2EA 2IBMA 4IXNA 8OHMA 4DWJA 2EWWA 3E1SA 5JWOA 3M0RA 1Z0AA 2FX3A 1JQQA 1N5IA 4AKHA 2GXSA 5A5GA 4AG2C 2C9OA 2Z43A 2Z5FA 2BCJQ 4MDEA 2K6DA 3VS0A 1FMLA 3BH7A 3TAUA 2FE4A 4RZXA 3K0SA 2JLUA 1P9NA 2HLDD 5BYJA 1E9SA 2C0OA 1OOTA 1Q22A 1B07A 1S3GA 4ZIRB 3KQNA 4QBIA 1XCGB 2DL5A 4FI3C 4DIEA 3UANA 4OQMA 1G7CA 2HCKA 2ZXUA 1RLQC 1KY3A 1N6HA 1N6PA 2J1LA 2JCSA 2OM2A 4Q1FA 1KNXA 5TVKA 1PLKA 1KKLA 1PUJA 1KI4A 1P2UA 1N6NA 1KK0A 2DL7A 4MRNA 2GVZC 2G0TA 1ZD1A 1XMIA 2E87A 1DG3A 3X1DA 4P32A 4B3DA 1BIFA 3WNDA 1QVAA 4XTRA 2GETA 2FOLA 1P6XA 3RC8A 2OFOA 5JFGA 1KO1A 2YZ2A 1PKTA 5BWMA 2VRWA 2K2MA 1N6IA 2DY1A 3R8CA 4PANA 2C98A 5JZVA 2H18A 4GOKA 3Q5DA 3CRQA 4OHXA 2ZRHA 1W47A 2AFIE 1DE0A 3CPEA 1ZP6A 3JV3A 3HYRA 4RD0A 3O8DA 2EWVA 3SYLA 2BJVA 4B74A 2QAGA 1WA5A 2VF8A 3VR6A 3DHWC 4MYHA 4ZDIA 1TU4A 2V6JA 4HUQB 1US8B 2ANBA 3C5CA 5EP1A 2I1VB 1NBMA 1OPXA 1U94A 1W2GA 2PEZA 1TUCA 1VHLA 3AF4A 3GJ3A 5CIQA 2GJSA 2ZANA 2KBEA 2XSZA 5EE0A 3VS3A 2XTZA 2AZVA 2ROLA 2ZSBA 4Z1MD 3NHAA 1AEYA 3QKRA 1A1VA 1E6CA 5I11A 1U06A 2FG5A 4ABYA 4OMQA 2XNDD 1OW3B 1TNDA 2ZREA 2WOJA 4PHGA 4DT1B 4WAUA 4C0BA 4S35A 3HR8A 3O47A 3FMPB 2W6JA 3FMOB 5E7MA 4J9DA 4LJ9A 1YZLA 1Y3AA 2JTEA 4NCIA 4Q9KA 4MGIR 5JWRA 1FP7A 2OFXA 2X3XD 4B6EA 4DDUA 1F48A 5FUVA 4MUAA 4DEYA 1OV4A 3QBTA 4DDVA 1OKKD 2WHXA 2WJVA 1CEEA 1EXMA 1ZUNB 3NDPA 1W4AA 2QP3A 2ZE7A 5F2EA 4DIDA 3EIHA 1N2CE 3RRMA 2K3BA 2A28A 1Q1ZA 1L4UA 1J8YF 2QPAA 4JJDA 1E3MA 2J7KA 2B92A 3NC0C 4E6RA 4YDSA 4Q9JA 1JECA 4LHYA 4LHZA 5J5CA 2HDAA 2RGEA 3DMDA 2JJ1D 3TIFA 4OBEA 4ZPXA 3CWZA 4Q9LA 2EFGA 4MQBA 4B2IA 4ZKEA 2ED0A 2D06A 4QBHA 3AVWA 3RC3A 1U8YA 1VPLA 1G6HA 3TLXA 5TV2A 2BOVA 3T1TA 1HTWA 2X3WD 1HYQA 5TB5A 3OIVA 1WLPB 1CKAA 1PLLA 3H84A 2WJGA 3KJHA 3QBVA 1WRBA 5KPJA 3LY5A 3OIWA 4HDOB 3ZQ6A 3FKSD 1BH2A 2FDCA 2EYYA 3PEYA 1MO6A 4XIGS 2CNWA 2QTFA 4NYJQ 4RFSB 2CL6X 1IQPA 4RKFA 2QPTA 4BFXA 2C9YA 3U7HB 1JPNA 1E9RA 2YWFA 2ERXA 4J9CA 3W6PA 4C0KA 3BIFA 3HPQA 4LYHA 2DBYA 5CDFE 1ZNZA 2GZAA 2F3TA 4IDNA 2EYUA 5EC7A 1MV5A 2W2XA 3S1AA 1G18A 4G5GA 4GZLA 2JT4A 4ESRA 3Q8XB 3J81k 3Q85A 2NUZA 2PJRA 3CO5A 2OHFA 2JS0A 2Z4RA 1ZBJA 2YOFA 4OQFA 4DLTA 4FMCF 2XGJA 2VL7A 4Q4JB 3SHWA 3E2IA 4K11A 2XOKA 5B57C 2PJZA 4H9GA 4OK5A 2V54A 2ZUDA 2CH4A 1KIKA 3QVUA 1M34E 2VKNA 4FCVA 3K70B 4HVUA 2OAP1 2GAAA 1A5TA 2CJWA 2WM9B 3C8UA 4URZR 4QJ5A 5ECAA 121PA 1NIJA 1XMSA 3IEVA 2DFTA 2MIOA 5DN6A 2ZI6A 4WZBE 3SJAA 3X1WA 4CC3A 2C77A 3SEAA 3AH8A 3OEEA 4LC1A 5AJYA 2RH5A 2EYXA 2DBMA 1UJ0A 1SXJD 1YR9A 4M1MA 2DMOA 5HCKA 2QZ4A 1D9XA 4FMCB 3L82B 3I1FA 2ATXA 2ZQ5A 1GIAA 3BFVA 4NHOA 1U3OA 1QG4A 2BKUA 3SE0A 4ZDWA 1X6BA 2JJ2A 2UKDA 4NONA 5FH9A 3ZGXA 2CVFA 5FI1B 1NLZA 3BFKA 1M8PA 2OXCA 1HQCA 1TQ4A 2KSQA 4Q4HA 2R6FA 4RZ2A 4P4SB 1Z2AA 2IYWA 1G3MA 1R7RA 4DCVA 1YR7A 2VA8A 3NBFA 2O9SA 3A1UA 2C99A 3KL4A 2ZJ5A 4HB2A 3SS8A 2GZHA 1T0JB 3IEUA 2O8FA 4KU4A 4I1UA 2AKKA 2GJ8A 3PG5A 3LW7A 5CITA 4HAVA 4DDWA 2WPDA 1S1NA 4GI7A 1EESA 1GUAA 2KYBA 4V03A 4Z8AA 1TF5A 2GCNA 1YU9A 4URUR 1E9EA 3EZ7A 1JR3A 1Z28A 1ZD9A 1U99A 4KBGA 4EUNA 4C7OB 4B3BA 4FXPA 1ZCBA 3D6TB 2J0VA 1M8MA 4Q7MB 4B6FA 2B8WA 2R9VA 3M0TA 1H8HA 4YMUA 1E6HA 1E2JA 3MWKA 2QUZA 3B60A 3CM0A 4GP7A 1GRNA 1O87A 3NWJA 1RPZA 2EQBA 3RVBA 3RSLA 4FD2A 4FN5A 2WOOA 2XX3A 4FWIB 3FHCB 1LY1A 4WXPA 1LS6A 1N5ZA 4G3XA 1W0KA 1XD2A 3TR5A 2GHIA 4AG6A 4D82A 1KOFA 1K4US 5FTMA 2QI9C 3GJ0A 4D4JA 1KMHB 1K8RA 1ZRHA 1NVXQ 4LJ7A 3AQ4A 2CDNA 4J9BA 1KYIA 1EGAA 2IYYA 1VTKA 2HUPA 3GJ7A 2FZLA 4CEIB 3KB2A 1R8QA 1X3SA 4A2WA 3U44A 3VX4A 2ORIA 2NZJA 4D0LB 1EG7A 4RD6A 1DAGA 1KK3A 4D4MA 6Q21A 2YUPA 4EJSC 3THYA 2JLSA 4YXWD 3B9PA 1R2QA 4B32A 4AY2A 1RE0A 4XVRA 1VCMA 3LNCA 1OYWA 3B1WA 1MO4A 4GRAA 4OQLA 4LWZA 1G8PA 2IS6A 2H8HA 2RN8A 4HAUA 1CR4A 4Q1EA 2G9NA 4Q1DA 4LJ4A 1F2UB 5FBVB 4Q4AA 2VP0A 2VP4A 1RJ9A 521PA 3SFZA 4Q7LA 3T15A 3DOFA 3K9NA 3FDIA 1T5LA 5KO2A 1LFDB 4LHWA 5HCIA 1WXBA 2E9SA 4JIMA 3N2EA 4LI0A 3SR0A 3BE4A 1YZKA 4PC6A 3EXAA 4IW3B 3BOSA 1NYGA 4PQYA 1L4YA 3K0AB 1DARA 1P4SA 2WWGA 1S8FA 4PSAA 4TLEA 1HY3A 2QM8A 2CHQA 3FVQA 3IPYA 3VKWA 4B3GA 2QMEA 5EXXA 2QSZA 1PRLC 4DLRA 1MOZA 2DA9A 4WZ6A 2JXBA 1SHKA 5KNBA 4R7ZA 1OHHA 1DAFA 3VS7A 1EFHA 3HU1A 4PX9A 4X8OA 3CF2A 5LBIA 1K76A 5KYKA 3SJZA 2CLSA 3TAHA 1EWRA 4H1VA 2OV2A 3K70C 2GQIA 1SVWA 2HEIA 2TMKA 4TT3A 2K5UA 1BK2A 1DPFA 3ADBA 1YWOA 2CHVA 2P3SA 4I4LA 1KAOA 4AFSC 3CBQA 1SHZA 4JZ3A 1NI3A 1QHHA 2BM1A 5I22A 5FPKA 2ASEA 2ZSFA 3LXXA 4PHHA 2J46A 1QZXA 2X19A 1W36D 1OFUX 2A5JA 4LZZA 2ZUCA 3LH5A 4HAXA 1TEXA 4Q02A 4JJCA 5FWBA 2B7BA 2RGGA 1XCPA 2BIFA 4G5RA 1MKYA 2ONJA 4TZ0A 2G0NA 2JA1A 4Z89A 2IW3A 4EAQA 3LRPA 2FFHA 2FFBA 1SSHA 1YZNA 2H92A 4X8MA 4FINA 1H3HA 3W8RA 2A37A 2FEIA 1ZUYA 1YRAA 2QAGB 4NMMA 5AJVB 3M0SA 3AVOA 4A2QA 1P5ZB 2AK3A 1SKYB 4KI0A 3SHFA 5KSZA 5GADl 2P2LA 3JZMA 3L8YA 1M7GA 2L3PA 2ZETA 1R0YA 2RCNA 2J59A 1FW6A 3ONWA 3TBKA 5EE1A 1HURA 2FN4A 5A0FA 1DAEA 1G9XA 1XMVA 2ZI3A 2KI5A 4NYJR 5J4VA 3I5XA 3TSOA 3UG6A 3DVLA 3QF4A 3QKRB 4JBYA 2ZRAA 2HDNB 4DVGA 3EPLA 4PHTA 1OJLA 2W58A 4W5JA 2C0TA 1N3BA 1KY2A 2FSIA 4BUJA 2WWWA 1Z29A 1E7OA 2OSBA 4QM6A 1CBUA 1SKQA 3ZIAD 2C9CA 3SC3A 4DBLC 4F92B 2AKAB 1Q44A 3A6PC 4Q1AA 4V0ME 3AF0A 1SVSA 1GG2A 1ZNWA 5KSPA 1RRCA 3MJRA 3CQTA 2RGDA 1B3QA 3L0PA 4D6PA 2F1JA 1WI7A 1ZM4A 1G19A 1R5BA 3I32A 4DZZA 3FMIA 1W46A 3JVUA 2GJAA 4TMZA 1XTRA 3QUSA 2PZEA 4OK3A 1W0JA 1AZTA 4AIIA 2AWNA 1JQLB 1KI6B 1TF2A 1CJTC 2F6RA 4PPQA 1E1QA 1GITA 2J7PA 5FTLA 1MABB 5FPHA 1J90A 1RRFA 2EU8A 5L3QA 3L8ZA 2XXAA 3OFNA 2HCJB 4F4IA 1XPRA 2FSFA 4RFVA 2WWFA 1BBZA 1DBSA 4LJAA 2Q21A 3D3QA 5TARA 2REBA 3LW8A 2KNBB 2ZRBA 1P3JA 1XXHE 3PENA 2Z83A 2NPFA 3Q9LA 1E0SA 2GGRA 4HLQB 4DB4A 3EPKA 3RNJA 4XD7D 3UF4A 2X8AA 1D6JA 4DLXA 4URWR 1E2HA 1FNMA 2PLFA 3AM1A 4PQRA 5D3QA 2V6IA 1IHUA 4JJKA 1N0VC 4BEJA 3GLGA 2O52A 4GMDA 1TX4B 3PUVA 4TTQA 5TDHA 3R7WB 5EE3A 4DXAA 4RZ3A 1JR6A 3SEMA 3S1AB 1GILA 4L9SA 2Q6TA 4D80A 2D3WA 4AD8A 2RQRA 1E4YA 3AVQA 3U61B 1LS1A 2ZJOA 3C4JA 1SXJE 3B1XA 4R0KA 2JDID 4JLVA 3PVQA 3ADCA 2XZLA 3HYTA 1NLYA 1N6OA 4JKIA 5FR1A 2BWJA 4PPFA 2JIZA 2PCJA 3EIEA 5FPSA 5IXBA 1JAHA 4HVWA 5EZ5A 4JBWA 2DYBA 1TQ2A 2X2FA 2WV9A 3BBPA 3V4FA 5KSOA 3PQCA 2KRNA 4JT4A 2EGAA 3U3KA 3JVVA 3PUZA 1YQTA 4LRWA 3O8CA 5IHKA 3O8RA 3HU3A 1MV0B 3CRMA 5CDFA 4N0DA 5JECA 4ORZA 1GWNA 2XJ9A 1ZX6A 1ZUUA 3THKA 4F4JA 1QWFA 2CT4A 2ODNA 2WKRA 1GNPA 2IUTA 3PVLA 1GFCA 4D81A 1EFCA 1UEJA 1ZUKA 5JHGB 2G1JA 3P32A 2RPNA 1EFRA 1EK0A 3LA6A 4PPGA 1E79D 3UMRA 5G41A 4LUDA 4DLYA 1VG9B 2EFHB 4NE2A 4UNSA 4DSUA 4E09A 2IC5A 1E96A 3VS2A 2AWOA 4JLMA 2DVJA 2LQWA 1T0HB 2B6HA 3EWSA 4WZAE 2P67A 4QOSA 3PEVA 2HXYA 2AKLA 1Z0JA 2A3RA 4MGKR 4C30A 4BZXA 2YWGA 1IXSB 5ANRB 3I5YA 5KPDA 2O8FB 1X2KA 3QKUA 1MV3A 4TL7A 3VQTA 2J0SA 1AWJA 1AJEA 3TQFA 4QRHA 2YUNA 2REXB 4AG1C 1CJVC 1B23P 5IDVA 4ZCMA 2QE7D 4PSVA 4M1SA 1HE1C 1PWTA 1Y57A 2ZI7A 2CCKA 4FIDA 4MRPA 5AUPB 2A2ZA 3GLIE 2L3SA 3NDBB 3WBKA 4YMSA 1GKIA 1G2BA 3DOEA 4GNKA 1NY5A 2ZRLA 3K53A 2AHOA 4M9XA 5G40A 3KQLA 1KK1A 2GILA 3N2IA 1EX6A 2RMKA 2VYFA 4RD2A 2QA5A 1D2MA 3A1VA 1CRQA 4BZQA 3IHWA 3WMGA 4Z8XA 4F91B 3ZZUA 2BC9A 4OHWA 1W36B 4A6XA 4W9MC 5LB4A 5B58C 2AR7A 2IYQA 3A4NA 4E03A 3UWKA 2GBQA 5JSZA 2QGZA 3EARA 3U3RA 4DCSA 2O9VA 4KLZA 2JLYA 3GCGA 5EE5B 3OEHD 1SULA 3EZ6A 3FJ5A 4LYAA 2C5LA 3M1IA 3QWXX 4RJLA 3FTQA 4LGMA 4TYYA 1OYYA 1P9RA 3P1JA 1WQ1R 4HLUA 4B44A 4M9SA 4RTTA 5J47A 3ZJYA 2QNRA 4JL8A 3PEWA 5GJWB 3MRSA 1K5GA 3AB3A 2XMFA 3VS4A 5BXQC 5EXPA 5FOUA 2H1LA 1M30A 2VSXA 5FTJA 4ZKDA 4LDJA 4P4UA 1RJ9B 4OMMA 2PT5A 3CRVA 4NYMQ 2EFCB 1M7BA 2ZYUX 3B78A 1IN5A 2F9MA 1T3HA 1VG1A 1VCNA 3VNVA 3UG7A 3BERA 3LX8A 1Q3TA 4A8JA 1G20E
chains in the Genus database with same CATH superfamily
4LQLA 3GR6A 2FZGB 5JSYA 3A7EA 1V7CA 2IK8A 4DTCA 1D1BA 4N5IX 1N5JA 5A4JA 1MXHA 4YC7A 1LPSA 3E82A 3N76A 3QIAA 2NTVA 3FSGA 2XUDA 1FFAA 3HLYA 3EMVA 4HCKA 3MWDB 3OFJA 2D7JA 2IG0A 4V39A 3EXFA 1MFZA 2J41A 3K0FA 4U5QA 4JI8B 4OXYA 2XITA 3E81A 5J2UA 1E7SA 3V5NA 3R09A 1TKRA 2XKAA 3UGKA 2JZNA 1F0PA 4PTLA 2QORA 3D5EA 4A6EA 4FYXA 3KPWA 1FCJA 1OH7A 4O0MA 5CA1A 1I2BA 2YJGA 4D9BA 1HKHA 1IRXA 2FEPA 4QG3A 4GM0A 3ZEHA 4NCBA 1ZWKA 3GUZA 3IRVA 1TXQA 3EDOA 3WYAA 4OGEA 1DIHA 4I14A 1PM3A 3ICPA 1W6UA 3AHFA 2BBTA 2ZGWA 3ZXXA 1NN0A 1UDCA 2Z8ZA 2NSLA 2KRMA 4M7RA 1TTQB 4LSZA 2I87A 2CZQA 3R41A 4EB6A 3HKCA 3QBDA 4AURA 2X1MA 1U0JA 3Q3CA 2WIKA 4UDXX 3F78A 1ZJJA 4K6KA 3OZGA 4TYQA 2CDTA 3H9BA 5CB6A 1UG1A 4M7AF 5A04A 3NBAA 1OZ3A 2D2FA 2Y3IA 3E70C 2DMRA 3F1LA 2VYTA 3H5OA 3NJ4A 3CQ9A 3NBMA 2DPYA 3V33A 4ND3A 3RAFC 1ORTA 2NOAA 4F7DA 5CH5A 4GI2A 4WLUA 4BO8A 3GYGA 4WK0B 1NR1A 4F21A 4IHQA 1Q91A 2IPOB 2YZGA 3DDWA 5LP1A 1I94B 4N9WA 2W4IA 3SK0A 1EFVA 4PZAA 1XTZA 4EA7A 5H68A 4F7UG 4AO6A 3GFPA 1C2YA 5CCEA 1CUUA 3P4UA 3KTOA 4XRGA 1OWNA 4P8RA 2OXFA 2C9BA 2EZ8A 5HRUA 3CJQA 1G5TA 2ACWA 3JYPA 3MRVA 3LQRA 2NO9A 2AMLA 2R1TB 4JK3A 1M2KA 3NWEA 2FPEA 3CCRT 5F5XA 3N9IA 4FZJA 3EGXB 2O8CB 1XEAA 3GLIA 3RS0A 4X7PA 1N9GA 4BVBA 3G2JA 3WMXA 4UCXA 4MWCA 2F1LA 2IUYA 3ZEAA 3BXFA 5A3VA 3WWZA 1L4MA 3V3TA 4A8JB 1SUCA 2GWRA 1B0ZA 1A5AB 4RY8A 4RWZA 5J2TB 3QLJA 5KC8A 4QBTA 1FX0B 1E3SA 2FVUA 3LAWA 3P9QA 4JJFA 3WZMA 3QNUA 3DBLA 3ECCA 4MVJA 3C39A 4E46A 3RYTC 5A02A 4F17A 2OCYC 4KXYA 1ETHA 1JEDA 3EVAA 1XA4A 5C8YA 2PYIA 1AQJA 4MH0R 1XKLA 1HL3A 2E10A 1KI8A 3L7LA 5ALOA 5CFPA 4MPJA 2X0JA 2ZITA 3AF1A 4Y2UA 2X2EA 4MR7A 2Q8QA 4R2XA 2ODTX 1MRSA 4IF6A 4GR4A 2HPHA 5U1PA 3OAAD 1RC0A 4DIOA 1AS2A 4MQ6A 4JIGA 9LDTA 3SPXA 2W2NA 2IOFA 2WMDA 4G65A 1Y37A 1Y3FE 2Y1OA 4D8KA 1A9PA 3CCUT 1IMOA 1K66A 3GPBA 5JXHA 1O94D 1RZRD 2HQHA 1GGFA 4BQSA 1G7SA 2NQ8A 3ZU5A 2C5FA 3I56Q 2DX7A 3K0BA 4FHFA 3HK2A 3EJWA 3HCDA 2O3RA 1CY8A 3ICEA 1Y4AE 3DV0B 1UFOA 2C1ZA 4YRMA 1A3CA 2FUG1 2V8IA 3GV0A 2Q6LA 3WB9A 5FA5A 2J33A 2JAPA 4RGVA 4BOYA 2QWXA 3TI7A 1DJLA 4RELA 4MMZB 2MU1A 3M6VA 3Q10A 4UPDA 1Z82A 3IDAA 2ZJBA 1FVHA 1QX4A 2FMTA 1DINA 4KQEA 1K9AA 1VCHA 1GZHB 2UYOA 2VUBA 4B17A 4DE5A 4KDRA 1WJSA 4RTXA 2R8BA 1CJSA 3NLLA 3RUIA 3S5JA 2VJMB 4UUPA 1OLUB 5T64A 4F4UA 1NJ2A 4DF3A 4YJHB 2WRZA 2VF7A 3VH3A 3ZCQA 3KQHA 3WXMA 3JB9F 1J5PA 1YP5A 1ZMRA 2GNCA 1PNJA 4DCOA 1GGVA 3O4GA 4QUJA 1UDWA 5F1KA 3EJ6A 4K7JA 3HGTA 2XLCA 1ZLXA 4JI6B 4LHSA 1S2GA 4JLGA 3V1NA 5AW6A 2F5TX 3Q8KA 1E2IA 1RAFA 3ZV3A 2O2YA 1C3OB 3T35A 2V03A 1KJNA 1YQ9A 2JEYA 1D8TA 1J8FA 3ZDRA 3PITA 3H0FA 4L4RA 3ZWOA 2DBQA 4YTLA 2FK7A 4Z2AA 4ITUA 2YXPX 4BO3A 3LKBA 1XJ0A 2IYOA 4ZYLA 1X27A 1RYFA 5LP6A 1L8OA 5AJXA 4RH3A 5IXFA 1TM3E 2J6BA 3C6QA 2DWQA 4PAOA 1SIBE 4CTMA 2Z95A 4IHJB 4EGAA 5IWCA 3M4XA 2RGWA 4NNPA 2BBWA 2FUEA 5FYQA 1OU4A 2WC1A 2G9ZA 4J2OA 4JB3A 5GJBA 1AQ6A 2ZOSA 2YXEA 4I50A 1H2AS 4S0XA 4DEXA 4M76B 1EGVB 2ZU0C 2GVNA 2RA2A 5TMDA 5KOJB 4A27A 4D0GA 5E9JA 2QTVB 3IODA 3DLIA 3TSWA 4WIAA 3DB3A 3IPCA 1LEHA 5BRJA 5JW6A 2CD7A 4BX8A 4EFMA 1Z6GA 1JFFA 4H6XA 1K68A 2XNDA 3ILSA 2PO7A 1AG9A 1RVDA 3TEMA 1NOIA 1S5PA 5JMPA 3A6GA 1XAGA 2ZCUA 2PUCA 3BGOS 4B1FA 1PJ2A 2I4IA 4E6PA 1K9VF 3OQBA 4KGXB 4BD3A 3PHLA 1E89A 2HSJA 421PA 3DZ8A 3KJFA 1V8FA 1OTYA 3P52A 1A95A 3EFOB 3GELA 4CETA 1FNNA 2EP7A 5LKAA 5JZBA 5AT1A 3TLZA 4F6RA 2BPOA 3JAME 3MEQA 4Y2RA 1I5RA 2Y4XA 2SKDA 1S8NA 3IIMA 3T3PB 5DNYB 4G25A 4DUZB 5M04A 1FPQA 4N4GA 1UBEA 4OP0A 4FDVA 4F2GA 2FU5C 3GMTA 1OLSB 1VQMA 1DC6A 1XTQA 5KYNA 1HT1E 3EFEA 3W79A 2OCIA 2ZIXB 3GDOA 5CDSA 4MITA 4FSXA 3B5EA 3SQNA 3GGOA 4PQFA 4XU1A 4TXLA 4FCWA 2D1QA 3ELUA 2ZBFA 3CSDA 1GRVA 3IB6A 4PRYA 5JIBA 2ZVDA 5AW3A 4G0NA 2Z8YM 3G88A 3STYA 1IOZA 1Y0MA 2QRJA 3NPAA 1QORA 3VFDA 1SBZA 2I2CA 4DMHA 3HJTA 1Q15A 3IVXA 5JARA 1J3TA 1WA7A 2C8VA 3T5AA 2GYYA 1JYEA 2JBAA 1PR1A 1BCSB 3RMQA 2H65A 3RUAA 4LSWA 1S2MA 1HK9A 1LVGA 2ZRDA 5K6AA 5CAEA 2PUWA 4X8HA 5BVHA 2PBRA 2C1XA 9LDBA 2E1RA 2NTNA 2WZBA 2JFUA 3PNYA 2QYHA 4C8QD 2ZE8A 4MVXA 3GF4A 4QFDA 4QGHA 3ZV5A 1R9NA 5C7IO 3NIGB 1GDHA 1RYNA 1D4AA 5DO9A 4X3OA 3GDHA 2XZPA 1P74A 4D46A 1VZ3A 1SD1A 1JHUA 2DJQA 4GZMA 1FQKA 4DJJA 2WSFE 3B6KA 4Y2JA 3SMVA 3CUUA 1CUVA 1K3FA 4WL0A 1HYEA 1Q57A 4BTEA 1MF7A 4WACA 3CPHA 2FW6A 5CLHA 2J48A 3ND7A 2JASA 4V0KA 5EJAA 4E2FB 5JFTA 4V24A 1D2EA 1WIWA 4GZ6A 4YYZA 3PIRA 2UV8A 3JV7A 1LUAA 1YZTA 2VRBA 4NU0A 3M0PA 4KGZB 4MVJH 2Q8NA 4DV1B 2E3HA 4NEHB 4V0NA 1XB2A 4LJSA 1G5IA 1NR5A 2VJPA 4IIOA 2V0NA 2XT6A 5FULA 3RNLA 1BA3A 3G8BA 3L2UA 5LM3A 2E0IA 2CL7X 3B53X 3KX2A 1Q7YU 1LPNA 1S6YA 1TYZA 1KP9A 3HCAA 2AEJA 1M8FA 3IT3A 2FFAA 1U2GA 1A4RA 4PQGA 4AJKA 3IOEA 3R4VA 3BS4A 5JQWA 3S2YA 1P92A 4L9AA 3KZKA 3ZUGA 3DOOA 5BQPA 1OLOA 1GPUA 4EI7A 5HWSA 4YECA 1QIDA 5LD2B 4LGCA 3R9XA 1STOA 5KYUA 3PRJA 3V4LA 5JJLA 4HVVA 2ZR9A 3AEQA 2BLNA 3IBSA 3W9UA 4LOJA 3KJNA 1FTYA 3D7LA 1FSFA 1LVKA 2QL5A 5ECGC 3EAFA 2PX2A 3DL7A 2KSSA 3PC4A 2Q5EA 3KWLA 1VGQA 2UZ1B 2FZEA 1Y71A 5IZ4A 2WWYA 1X2EA 3LX5A 2AD1A 4DOVA 3NTIA 5ITZB 1XRRA 3T7DA 5D3ZA 3RM3A 1U1EA 1GCOA 2FG6C 2GBIA 3KSDO 3ZS9A 2JI8A 1JPUA 4Q7KA 1C3LA 1A71A 3RRYA 3EZLA 4N6GA 4K6GA 2ZBRA 4D8DA 1Q0PA 1FA9A 4OQPA 3QJ6A 1SBQA 1BMDA 1Y5MA 1DTEA 4V2SA 4ZMRA 1UBGA 3SS7X 2NW6A 3HP1A 5J1SB 3LUFA 1DAHA 2GX6A 4YH1A 3LO8A 1RACB 3KLPX 3R23A 3EA0A 2RGBA 4C7OA 2PMDA 3C45A 4EDUA 3JR3A 1O08A 1AKTA 2E4VA 1MNDA 4MLCA 3IIIA 3LHDA 1S3FA 1ZSYA 1V3TA 1N8TA 1ODLA 2E6ZA 1I3CA 4DMMA 1G4AE 3ZE0B 2G9QA 2H7VA 4MVJI 1YJXA 3F3MA 1CZRA 5FWDA 3I55T 4HI0E 3F5FA 5LN1A 2GB4A 1EFNA 3JWJA 4PCAA 2B3TA 1GZ5A 1XK6A 4AZ3B 1VPVA 5EC8A 1P73A 3OU7A 1T8YA 1M1ZA 4JA0A 2H07A 1ATZA 1FMLA 5D6XA 2B0JA 3DVSX 4C4XA 4B87A 1XCGB 1G7CA 4M75B 3GJTA 4HX2A 3ROZA 1IUOA 1P2UA 1J2TA 1XMIA 2ZSUA 3LDFA 3RC9A 2W6NA 3QUIA 4PANA 2C98A 4WI1A 3SHVA 4TTAA 2X42A 1V4BA 4CM8B 2XDAA 3E9MA 4XUCA 3TPFA 1VM6A 3VC2A 2I6SA 1US8B 2N0SA 1MAUA 5FRDA 3SP1A 2E82A 6NULA 1K7XB 1N0IA 1E6CA 1Q7YR 2FG5A 2WIFA 4K86A 4NCIA 1C7FA 1F48A 4LIPD 5FUVA 2Z57A 4OXQA 3ILXA 3NDPA 5JC8A 3NP9A 3G17A 5J39A 2FMUA 4I5FA 3KYDA 1R1DA 3CWZA 3SM3A 2OR3A 3GD5A 3WIDA 2ED0A 3N86A 3DQQA 1HYBA 3N8NA 2IHUA 4PIMA 5KHLB 3LH0A 2C9YA 1ZRSA 3PDHA 5DOZA 3U7HB 1XKTA 1E1DA 4NAHA 4DV7B 5A5FA 4Z4IA 3K96A 1SD5A 2MK5A 2Z2JA 1JFRA 4Q3KA 2NUZA 3NASA 3OM0A 2AQHA 4J0IA 2R79A 4FMCF 1RAEA 1SBCA 2PH7A 1DPGA 1A5TA 3IEVA 4WZBE 3I9OA 3EVDA 1JHRA 2Y4YA 5EYPA 3TLKA 2O3TA 4DCMA 4NONA 5B4UA 2J3DA 2QJWA 1JPVA 4NENA 1R0BA 3A1EA 1HNXB 1WZ2A 2GZHA 3ELBA 3PP8A 2AZXA 3UAOA 2M6RA 3PQEA 4ZAYA 3OEYA 4W1RA 4EUNA 4B3MB 1SBIA 1M8MA 4IIJB 3B60A 1V5GA 2GGSA 4DMCA 3TSYA 3SF0A 2PZAA 3MMZA 4AG6A 2HJRA 4WBNA 1PRYA 3OPYB 1A7AA 1Z8NA 3CXCS 4CLRA 3KB2A 4G0MA 2CNNA 4YAJA 4YXWD 3H2IA 3TKYA 1NFRA 2IYPA 2EJVA 1BDMA 3QTLA 3CKMA 3D54D 3BMNA 3RHZA 3L04A 3N07A 2W2MA 2YXNA 4QTUB 1V37A 2QOEA 4G37A 5KWSA 3J7TA 1E7WA 3QVGA 2YUTA 2JJMA 4PX9A 2R7MA 3GGSA 5KYKA 3VPSA 2AW5A 2FMIA 2TMKA 2K5UA 4L8LA 1DPFA 5TJHA 2VYVA 5T5QA 3G6EQ 2PU7A 2IW3A 1YZNA 4FFPA 1QZTA 4CMAA 2BEUB 1NVTA 1ZZEA 4EG0A 4PZUA 4JI4B 4TSRA 1X74A 2V74B 2OSBA 2VJNA 3L46A 1IL0A 4W9NC 2DXBA 1C9JA 4B5LA 4AKSA 1GNSA 4HFNA 4BQRA 1VI6A 2J7PA 2AXQA 1J24A 4PYJA 4RFVA 4GXNA 4LJAA 1MORA 4HWSA 4EKYA 2K3XA 4LOHA 4HS9A 2LRQA 1A0OA 4I4TF 4WCVA 1VKZA 3RNJA 4XD7D 2V7VA 1FMTA 4MVJG 1TW3A 3BMQA 1VJ1A 5CYFA 2QIOA 1WJQA 2BF4A 1MJFA 3M83A 1OZGA 4HT8A 2CZGA 3INRA 4FHEA 3ZDEA 4G8BA 4TV9F 1REQA 3AR2A 4PPFA 2CBGA 2VOJA 2X2FA 2XDQA 3OY9A 3FSEA 3MN1A 2Q62A 1P4AA 2C3MA 4F4JA 3PVLA 5A1TA 3EFRA 3GEDA 1JQBA 3P32A 5JCOA 4CLHA 1UANA 1YJWQ 1E96A 3BQNB 4CMBA 4C30A 1W2WB 1EFDN 4L02A 2VBIA 2YVQA 3CMAA 2H2AA 1ZICA 4E7ZA 2FR1A 2JI4A 3WBKA 1IPFA 4EJ6A 4P3XA 4M9XA 2GILA 3V2IA 1CRQA 2Z04A 3RYFB 5I9SA 1MT3A 2A8YA 3R6LA 1FU7A 4QOJA 1GARA 4CUKA 1P9OA 1PGJA 5EE5B 3MBKA 3FJ5A 1GG5A 3WGOA 5DCLA 5F35A 4KYVA 4PCVA 5B6PA 3CLUC 1P5RA 4P4UA 2IYEA 4DNXA 2JLCA 2HZ7A 3UG7A 3ICOA 3VZBA 1XG5A 3CH4B 4N4HA 2NT4A 1NVWQ 1IBRA 2FNAA 1JEQA 3LIIA 2EKPA 4H3HB 1V4NA 3ORSA 1M67A 3V7SA 1VRWA 3LQ4A 4RZIA 4J1TC 1ZJWA 1CPYA 1C80A 4P1ZA 1LLCA 3I2IA 5T67A 5HTOA 1UPFA 4ITVA 4LUEA 1UHFA 4RABA 4ZZ1A 2FCAA 3VKHA 4AZ0B 5K2OA 2IGTA 2IU4A 4UCQA 1SXPA 4ADSG 5GAN8 3M8KA 5F51A 5GOZA 4C76A 5JAHA 2D4HA 2QAJA 4RYDA 3LKVA 3F49S 1U1DA 3HJCA 1QAOA 5CB4A 4IX9A 5SZJA 4B7ZA 2HHHB 4MW0A 1JMYA 1NKVA 4PYNA 5FOTA 1XD8A 1V2HE 3UV3A 3RC7A 2JJ1A 3CU5A 2I8LA 2JBWA 1ZGCA 4JKYA 4RF5A 1I0CA 2ED1A 3OX2A 3K1ZA 4QSHA 1NN5A 4B3HA 4ICIA 3HVHA 3V8VA 2V1XA 2QRZA 5CVEA 2YBEA 3ZGZA 1FYXA 2ZR7A 1C8VB 1XJWA 3HSKA 4L3VA 4CTJA 4JI1B 4C0DB 2C5GA 5FJJA 4WKPA 2R5MA 2L42A 5H83A 3WO0A 3KIPA 5HIMA 1PCXA 4JQYA 3BAFA 2CXXA 3I9MA 3OPVA 5EWJB 3BB4A 3F2VA 3AHCA 1NW5A 2FJUA 4TZKA 4DG5A 4QQRA 3G6WA 5BR7A 1N57A 2DP4E 1SHGA 2CUKA 1GCQA 2EHDA 2LJ1A 3UT0A 2W2PA 1CFZA 4D96A 2OZEA 5L23A 1WB4A 3JWPA 2E89A 4P4TA 4D25A 3AF2A 4AP9A 3DBHB 1VZ2A 1X1RA 4BY6B 1HE5A 1O6CA 3L4JA 4CKBA 2VAXA 3VJKA 2WEKA 3C3WA 3HMKA 3L1KA 4TVOA 1IBCA 5J43A 4EI8A 4H7DA 3HDTA 1XEFA 2MR5A 4IS3A 2IIBA 3ZLVA 3WWDA 4DV6B 1ZD5A 2Q5IA 4RHYA 3VZRA 2I0NA 4W5HA 3CLUD 3IMGA 3DTVB 2PQMA 5DYNA 1UJ2A 2BMEA 3FPGA 4II2A 1V11A 1BFDA 5CA0A 1GL5A 4XIIA 2H9YA 2VNAA 3O2SB 1WSBA 4R0NA 2HRQA 3FLAA 3GRZA 3F6RA 1OXXK 1M1XB 1YULA 4YR7A 2BEKA 4ALKA 2I2BA 1UPTA 1E0JA 1OAOC 4XGQA 4OATA 3A9VA 3MT7A 4AT1A 5EQTA 2GLUA 2A88A 2W6MA 1YI2A 5KZMB 4OHZA 1NXWA 3M5AA 3OEED 1Y1LA 2H3EB 4RIHA 2BBSA 4A0RA 4F45A 4Q93A 1M3CA 3AW9A 1HLDA 4HLCA 1E9BA 4H7IA 5CNMA 2QTHA 1L5YA 5BWCA 3H6ZA 5IH3A 4IKFA 1XZIA 1FU4A 1WHGA 3RANA 5TPZD 3I1YA 3WP0A 3CZPA 1X80B 1U2RA 1G9SA 1CP2A 1VQMT 1RI5A 1ZITA 2I6FA 4IZHA 1LSSA 1SCQA 1G21B 4RAQA 5EWMB 3H5NA 2ZJ8A 4UNRA 1MRNA 3D6MA 3A4TA 3MJTA 2LVMA 4W8OA 3QI2A 2QW1A 4A8JC 2FDXA 1T8PA 4ZOLB 2WHYA 3V3KA 4G01B 4QEKA 2XTMA 4DBRA 2XTAA 3MWYW 3KFXA 3L7BA 4QECA 1H8EA 2DU8A 4FHCA 1DCFA 3R0IA 1QQBA 5ETJA 4BBJA 1T3SA 2E37A 2Q4TA 2WM8A 1IAQA 4KQ6A 4D02A 1PKSA 1W88B 2QS9A 5HILA 4FL6A 2OKCA 2MOXA 2Q4OA 3DLMA 2KJQA 2UZAA 4MO9A 4IO0A 5K0EA 3KXDA 1TM4E 5AOVA 1QS0B 1L5SA 1QE3A 1KSGA 4U7PB 1XRJA 2GK7A 2MTBA 3LT0A 2CJWB 1BKBA 4Q4DA 3TMKA 2E41A 3OCVA 1YRYE 2VT3A 5IVHA 1RMQA 4IXMA 5KVVA 2H00A 2OM6A 2P3LA 2RG7A 2SKEA 3OHMA 4FC6A 2N1MA 2OGWA 3V6MA 3S3NA 4MQLA 4CM7A 2XWQA 3QWYA 2AUTA 3GNFB 1U90A 1RLJA 5EXSA 3N8KA 2JD0A 3MOGA 1NVUQ 2B83A 4LJRA 4WV3A 1X38A 1YI8A 1X7YB 4O2BB 2PR7A 1HE2A 1YJAA 3ICVA 2AX4A 4AY4A 4GPEA 4F46A 4C2TA 1W49A 3GOQA 4CLDA 3K1TA 2WM2A 5BRAA 4U3JA 3U9SA 4RCCA 4FYHA 1IXRC 2WQ7A 3N0WA 4JJ4A 5HRCA 5JT1A 4Q4AB 2PX3A 4BE9A 1Q0LA 2W4QA 1EFRD 3V8RA 1QVZA 3EZ2A 2IOFK 4CZ2A 2RHRA 3EN0A 3SHTA 4MW2A 2HDWA 4Y2YA 1PFGA 4PBSA 1UKAA 4R1UA 4RAOA 3IVMA 3OQMA 2EBHX 3ZQUA 2GAOA 1WDWB 3KP1A 1H69A 1OROA 4OSEA 1TWBA 1F3LA 4A82A 2Q07A 2JIOA 4KBFA 1O96B 2CUZA 3A3NA 4Z1OA 2VHEA 1EVQA 5IHXA 4AM8A 2OD9A 4E08A 4XSVA 2HIGA 4HN2A 3LOUA 1N92A 5BT8A 1XZNA 3O21A 1C30B 3RI3A 1Z7YA 4S2EA 2VDJA 4FDMA 4DCGA 3GP5A 4E94A 2R6R1 4Z1MA 2XG8D 2GCEA 1ESDA 3B85A 4OL0A 5FL7D 5GMKl 1DEOA 4KUEA 2KBFA 1EWQA 5ED0A 4N0EA 4DVJA 3R6OA 5TVGA 4A0HA 3FE2A 4R8KA 4MUJA 3IAAA 4O2AA 5BN3A 3FNIA 2REQB 2IXDA 3RTAA 1SA0B 3HXOA 4J83A 3G4SA 1XZPA 3RKUA 5DNVA 1A9XA 2FPWA 1UMDB 1K08A 3FNRA 3F6BX 4C0LA 2PNIA 1N2CB 2FSVA 3QBJA 1ZVJA 1X8LA 5HQ3A 4JVLA 5FO1A 3RK1A 5IUNC 2W2LA 5J9FA 4Z51A 4UEOA 1QFXA 3P26A 4Q6WA 2WUGA 1E99A 4ISCA 1JTFA 2ZWVA 2A86A 3KLMX 3ZU4A 4UNPA 1ABBA 4RG2A 1Z75A 2IIQA 2YJTD 1YL7A 3D3WB 4QPNA 3UAVA 4ZGWA 1IBSA 1Q21A 2XA9A 4L0QA 2JVKA 4OMCA 2RI1A 4X6YA 1ORWA 4F5WA 4H3VA 3NBZC 1FK8A 3KETA 2C4NA 5IAGA 3R0XA 1CQXA 4BLPA 5PGMA 1VQKQ 3U0VA 4MR8A 4CC2A 3WLFA 1FUYB 1FSSA 4DHEA 2BT4A 4UDNA 1UXOA 3OI7A 3TGLA 5K8TA 3K0HA 3PT9A 2E5WA 1QR6A 3V1LA 5E1BA 5BUZA 3EIWA 3LPCA 4AG3A 3T1YB 4ENUA 3C0KA 3THRA 2IKSA 4G6ZA 2G71A 4JX8A 1WTCA 5CK4A 5DCWA 3LCVB 2RK3A 1L7MA 1EVJA 5ERXA 4HCCA 3DEJA 4W1QA 4C0SA 1Q0SA 5DTJA 5KYYA 1T6NA 4L9RA 2SKCA 2DFNA 1XA0A 2VP9A 4HMQA 2DM6A 2I1QA 2CP2A 4DYVA 1WDMA 3CCEA 2HK9A 1E5TA 5JEEA 1NURA 4WECA 3CZ5A 4OB2B 3U48A 3T7TA 1PS0A 3ORFA 5ITVA 4X1IB 4LDZA 3QM1A 1I3KA 3CT6A 2VHJA 1O77A 1GSHA 5KDDA 2QXUA 4FGUA 2YQ4A 1PX2A 4GPTA 3QPWA 1Z6ZA 3ZJVA 3UFXB 1IIBA 1Z0KA 3DKKA 3B3QA 4OXKA 1P0QA 1B34B 1DEXA 1WZEA 5EJEA 3IOCA 1UE9A 1KJYA 5LJ3e 4WGGA 1GYQA 4K8RB 5JEDA 3B7WA 2NPOA 4O5OA 1TMKA 3JCMf 3C7KA 1WBJB 5K0CA 1WXTA 5IH2A 2NU6B 2W83A 5KOHB 4HZUA 1ZK0A 1NQVA 1ZO8A 1PHTA 4L08A 2OY0A 3FNHA 2A0XA 2HXGA 4DBFA 3WGHA 1TS9A 2WIAA 3DUWA 3ZIAA 2BFNA 5AW2A 1PD1A 2X8BA 3FDZB 1T8TA 1C2TA 1LPLA 4KW7A 2ECQA 4NXMB 1I36A 1HOTA 4HLUC 2ZBGA 5DSTA 1GUBA 3OF5A 4P35A 1KYTA 1U7DA 4B35A 1TAUA 5D3MA 3H9NA 2DRMA 4R6WA 4H35A 3KEOA 2BP7B 5B55A 3H9UA 1JA1A 1D0SA 1PF7E 3TGWA 1JIXA 4P4NA 5F21A 3MTAA 1C3XA 4A2CA 1MVOA 3I12A 4LRUA 1AU9A 4D8XA 4BLWA 3CWCA 5KOIA 1HG0A 1I5OA 4IGAA 4RENA 4CRIA 3SQDA 2LX7A 3UWOA 5JDIC 3OMCA 3DVAB 1R0BG 2EIFA 3JCMJ 3OMWA 2E70A 1UZAA 3I73A 4C8QF 4E07A 2K4MA 2ZIAA 2O5CA 4EHDA 3INZA 4IWNA 3DLAA 2I3AA 2VXYA 3EHRA 4G5SA 4PXYA 4L5BA 5KIAA 1AK2A 3FZEA 3Q98A 3SAJA 3I55A 3MIZA 2G0AA 4CEJB 5EQJB 4B48A 4EW2A 3U5TA 1JHOA 1CUYA 2O50A 1H6AA 3A8HB 2QG6A 1HV8A 3COPA 4A23A 1ZHHA 4WASA 4AF6A 1ZIXA 3QKWA 1Z4LA 5JS6A 3U7FB 4EP1A 5CT5A 5DTIA 2BUAA 3ONEA 4CCSA 5C5DA 3TTVA 5EIFA 5CEFA 1W30A 4H7PA 1AKMA 2TS1A 5HK0A 3CMMA 3UMSA 2Q2NA 1RZ3A 3LECA 2QD2A 2AOUA 5HM8A 2BUCA 5FEUA 1UBOS 5LQKA 2FPXA 1R0CB 1LLDA 1ZVQA 3B6EA 2PNJA 3P2YA 2WMNB 4UJ3A 3H8JA 3NFRA 3I9V1 5ITSA 5EWLB 2P4RA 2JFVA 3H17A 4G5OA 4BUGA 2VDWA 1UC8A 4RM3A 1AZLA 5EZ6B 3BSWA 1FEZA 3E6AA 1PSDA 2P91A 3BSSA 3E3AA 4G0QA 5GAJA 3I39X 4Z54A 4OX9Y 2F48A 1VQ7Q 2MSDB 3ANTA 3LL7A 4ZVKA 2W4MA 2SECE 4MPPA 2CHEA 4BGUA 1VSTA 2NU7B 3ROTA 4ZT7A 1O4WA 1I2ZA 1K8XB 3R6NA 1P60A 1N2XA 1FBTA 5LD2C 4H15A 4XJTA 5E6RA 4IIHA 3FPEA 4B73A 3GJ4A 2XVZA 1W44A 3ITDA 4D8YA 4PYQA 5LYJB 1B00A 4FW1A 3OX1A 2IX9A 4BRUA 2FZVA 4P31A 2JZ2A 1G2OA 4DSZA 3E5RA 3E9QA 1T91A 2BDTA 1SVKA 1FRZA 5JAZA 2VUIB 5EP4A 1Q1QA 2ZE6A 4IDEA 1CY4A 3F4KA 1K6XA 5IABA 2YDYA 4J0KA 3ZHBA 2GXSA 2Z43A 4QDUA 3CGGA 3D8RA 1E9SA 4ZIRB 1B07A 3RK0A 4FI3C 2DAPA 4UHKA 4PJOE 2J1LA 2JCSA 3CMAT 4QTYA 4IH9A 5M3BA 3ELWA 2P2YA 3VBEA 5A06A 2FOLA 2OFOA 1KO1A 2VRWA 3MO8A 4X3CA 2B34A 2DY1A 1KPGA 1P44A 4RHXA 4RD0A 3SYLA 2W6PA 2X6TA 4X1YA 3VR6A 2R96A 5BWLA 3PLAE 1JVNA 4KWTA 1SQ6A 4BMZA 1E77A 2OCXA 4XDZA 2XGMA 4DDVA 3OQIB 2H1SA 2VAPA 3LZ6A 2NXJA 2HREA 3D6JA 5CB0A 5LOVF 3E4DA 4N5DA 2M1ZA 3WIUA 5BV1A 4ZKEA 1KVSA 4D9JA 4HDOB 3FKSD 3LM8A 4UE6A 2COYA 1HDEA 2ZIGA 2HOQA 2RBKA 5E6UB 3LX7A 2VG8A 4C0KA 2QAZA 5KQRA 3BJRA 1CVLA 5DIZA 3ERCA 3USZA 3KD2A 1BE0A 2PJZA 2CH4A 1P6UA 3K70B 3NVD