3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
b'SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
molecule tags Peptide binding protein
source organism Rattus norvegicus
publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
3BERA 1FTNA 1IXZA 3VS4A 4TL6A 3BH7A 1ABOA 1GFDA 1LY1A 3GLHA 4Q1EA 5JHGB 5FWCA 2GNCA 2ZRCA 4G1UC 4POAA 5B30A 1OXTA 4KSCA 1LV7A 4RUGA 1EFRA 4M22A 3R8FA 3SC3A 3RWOA 2A36A 1SXJB 3H0HA 1Q1QA 1XZPA 2WIAA 3MLEA 5L23A 4P32A 3X1DA 5KOYA 2JLVA 4BWYA 3EW9A 4NYIR 1XMIA 4OL0A 4XTCS 1N0WA 1N5IA 2PJZA 2BIFA 3DZ8A 1IXRC 5DI3A 5B57C 1JO8A 3LW8A 5L3RA 5AUNB 1CJTC 3UPUA 2EFEB 1XU4A 2EYZA 3W34A 1I1JA 4I1SA 1P2TA 3DL0A 2WJGA 3E1SA 2WWGA 1RLPC 2F2VA 3SYKA 3FE2A 4B35A 2BBOA 4LY6A 1G5TA 2PBRA 3QKSB 4MGIR 1ZU4A 4MGZR 2R6DA 5D3MA 4RTWA 3DMDA 4RFVA 4TYYA 4KFSA 4LPSA 5DGXA 1GFIA 1KI8A 1OB5A 1E1QA 1G3IA 4AWXA 3SE0A 1IY1A 1TQDA 1PVOA 2CT4A 2FSHA 3T06B 2J1LA 1PHTA 2G6BA 2ZJZA 1QG2A 1UECA 4K46A 1CBUA 2X1VA 3TQCA 4F7WA 2WJYA 1S9DA 3C15C 1K6MA 1R4AA 1XRJA 1E98A 2P5TB 4MGKR 4P3YA 5TY0A 1RJ9A 2D8HA 2C0OA 3I92A 3GLFB 2QT1A 1P7CA 4J9BA 2RH5A 1YU9A 1J8YF 1OXSC 2FX3A 1TADA 3H86A 2Z83A 2XZPA 3IIMA 4DSOA 2DL7A 4WCIA 1G9XA 2RGEA 3SYNA 4ZDKA 3GJ3A 4Z8XA 1K4US 2CL6X 4JL5A 4PPFA 2YT6A 1Z0FA 3SYLA 4IFBA 3I73A 1Q21A 2FWRA 4LRWA 1U3OA 2VF8A 3EXAA 3WNCA 5JEEA 1TX4B 2P5SA 2ZJBA 3RABA 1VDZA 4ON9A 2O8DB 1D9ZA 4A6PA 2Z4RA 1E3MA 2LX7A 2ZQ5A 4J9GA 2XJ4A 2W6ID 1TUIA 4HZIA 3ZLJA 2O52A 2ANCA 2AHOA 2IYWA 4S2EA 3SI7A 3EG3A 2GK7A 3EG1A 3TSWA 3A1UA 1ETUA 1G291 5UKDA 2BTTA 1Q3HA 1V1CA 2IXEA 3MSXA 2EYUA 1P5ZB 3M1IA 5AJXA 5E95A 2EGAA 1UJ2A 1UM8A 4ZKDA 5DNYB 2VHJA 3FTQA 3PEWA 3ADBA 5DYGA 2QE7A 1TG0A 1N6OA 1A5TA 2MMGA 2WJHA 3OE7A 4HLQB 2H17A 4IJMA 4MH0R 3E5HA 1JEEA 1SULA 1XX6A 2JJ1A 1G7RA 2WZQA 2DHRA 3BE4A 3B78A 2PZFA 1FNNA 3F3YA 2VHUA 4FW9A 1YZNA 2JJ8A 4UQOA 3NGPA 1KZ7B 3SJBA 1ZX6A 1I07A 3LXXA 5AK0A 4FXPA 2NPFA 4XWKA 1SZPA 2J59A 2WTUA 1AWWA 4OMOA 1OXVA 2WWHA 2CXXA 4PTLA 4ERNA 5JS7A 4Q4HB 2DBKA 1HT2E 1A0NB 5A0FA 4GOKA 2GTOA 3U7EB 3CO5A 2FFBA 3V4FA 2F3RA 3DPUA 5HCKA 3TAHA 2KT8A 5FOTA 2JS0A 2YUOA 5FOVA 2W0SA 1E79A 3H1TA 2PCJA 1YZLA 5FTNA 3C0CA 2R6GA 3OIWA 4UXHA 4XIGS 4ASUD 5HKKD 2XXAB 1CTQA 2JDIA 4I1OA 1CJUC 1LVGA 5SZJA 1EK0A 4DLVA 3TUIC 4R0KA 2FG5A 3UIEA 4FMBB 1LTQA 2XITA 1AGRA 3L0SA 3OEHA 5KSOA 1SVWA 1E9BA 2DWPA 1J3TA 2K79A 4TZ0A 2FZ4A 2JIZA 1AJEA 1SHGA 3OFND 1R5BA 2R9VA 1D8TA 3BB3A 2JLXA 2P6NA 1TPZA 4MA4A 1OXXK 2KBEA 2IBMA 2XTZA 4GMDA 3ADDA 1MUZA 2PEYA 2LKCA 3CX8A 3L82B 1C9KA 2FNAA 1MABA 2OFOA 1SVSA 3DEFA 2A37A 1RZ3A 1X1RA 2C2HA 2YOFA 4HB4A 4JLMA 4TYQA 2EFDB 3KKNA 1OIWA 4JLAA 4PHFA 1X8LA 2Y8EA 3ZS9A 1NIJA 3IO3A 4HAZA 1G83A 3SOPA 2DJQA 4EPXA 2GGRA 3U3KA 2RQVA 2RGXA 3PVSA 2OG2A 5D3QA 4DDUA 1E69A 4MDEA 1CR2A 3IPXA 2Z43A 4JLKA 3LXRA 4PSAA 2X8AA 1DADA 4PZLA 1ZM9A 3FMIA 2VL7A 4PX9A 2ODEA 4H9GA 2CHGA 4PHTA 1TUCA 3K0SA 3CH4B 2YC4C 3BH0A 3QWXX 2WPDD 4NDZA 5JS8A 2FV8A 4HVUA 4BPBA 1J2JA 1SXJC 2ZANA 4NL4H 4MKHA 1U5SA 1W5TA 4B3BA 1WLPB 2G0NA 3I4LA 1LFDB 2F43A 2YWHA 1W0JD 2GK6A 4Q1FA 2HCJB 1JXOA 3RWMB 3UG7A 1SQ5A 3AB3A 4YC7A 4BEJA 2HXYA 4HDOB 1SKQA 2IW3A 2RAPA 3KB1A 4OJQA 4C30A 1G41A 4C0JA 4DBLC 1CR1A 2ENMA 5H1YA 3EAQA 1N6RA 4HXJA 2A3RA 3H2YA 2HSPA 5HR5A 5D3MB 3RSOA 3LDAA 3TK1A 1W0JA 3ECCA 1IO6A 5M04A 2F2XA 1NL3A 4W5HA 1X8JA 3TJZA 2CL0X 3SHFA 5TVKA 1S9HA 1DPFA 1MKYA 5FR1A 2RMOA 1SPKA 2IYLD 3GLIA 3GFOA 4ILEA 2W2TA 1W46A 1XPUA 4XVUA 1GAJA 1NLPC 1IONA 1NEGA 2WWYA 4CEIB 1UBCA 4TSFA 2XZLA 4DLXA 1WMSA 4ACBA 3K0AA 2X2FA 2RCNA 3NBYC 4NONA 5C4MA 4QBGB 4BFXA 4DLRA 1EFNA 1SSHA 1F2UB 4IIOA 4PC2A 2IYXA 1SVIA 4D80A 1RKBA 4YQFA 3THWA 2ABLA 3A1VA 1A2BA 1E32A 4IDHA 3FPAA 1YZGA 2QGZA 5KSPA 1E6HA 1HH4A 5LB2A 4DCTA 1QHYA 4XD7D 4XSGA 5F3WB 3RS3A 2ZRAA 1H8ED 4P4UA 2QDLA 1U98A 2WWIA 4B6EA 2CK3A 2O8EB 4A2PA 1KI1A 5GJBA 2SRCA 5F98A 1JJ7A 3Q9LA 3CRQA 3IBYA 2JM8A 5J4VA 2KWIA 4QFMA 1NKSA 2BM1A 2DL3A 1ZAKA 2KRNA 2ZRNA 2O8EA 3AVTA 3A8TA 2QAGB 2WOJA 3A37A 4MDFA 1FTSA 2DL4A 1JXMA 4EFLA 4C3ZA 5HCIA 3U23A 1Q3TA 1QRAA 2EW3A 2EU8A 2ZRLA 3RS2A 3VHXA 1OYYA 3KFXA 4XOIA 4EFNA 1LF0A 2CK3D 3KKMA 5JWRA 1QCFA 2WMOB 1ZCBA 3RRMA 4HAVA 1GRQA 2FU5C 3KB2A 2ZRKA 4RJLA 1PLKA 2DPXA 4QRHA 3FOZA 1IN7A 3AQ4A 3RBBB 5IT5A 2ZRPA 3PEYA 4M53A 1II8A 1PUJA 2KSQA 2W6IA 4PR0A 4EPWA 2CLDX 4M4ZA 1U9IA 3EARA 2O8BA 4ZKEA 2NPIA 4XVRA 1P4SA 1AZGB 4IOLA 1NLYA 3T61A 3ZZUA 1X8KA 2DLPA 1OPKA 1OJLA 1KIKA 1G7SA 2J46A 4TN1A 2KRMA 2WJVA 2YWFA 2J6KA 4OBEA 1R0WA 3WMGA 1E1RA 5H68A 1WE2A 1KDTA 1XD9A 2IHYA 4O2RA 1W1WA 1OV3A 1W0KD 4KHZA 4GBQA 2HXSA 3Q7PA 4YXWA 5K8UA 4BLRA 3FWYA 4HEJA 2R6CA 1GSIA 1GTVA 2EFHB 1BBZA 1PZNA 2NGRA 3MFYA 1S1MA 4YONB 4MRVA 2VTKA 1GBRA 1XDBA 5FTMA 1P9RA 4Q47A 1HA3A 2IYUA 5JEDA 5AUOB 1VPLA 2NZJA 2J0SA 4LJAA 3I72A 4OK3A 3U2QA 2XOKA 4Z8YA 5FUXA 2A9KA 3LNCA 4A82A 2ODBA 2ZYVX 4IOJA 4MKFA 2EVWX 3KQHA 3B85A 2PT7A 1KK3A 1LF5A 4M1KA 1H65A 4A0FA 4HVVA 1QG4A 2IYVA 1WX6A 3NHAA 1W70A 3C7KA 3DVLA 3QF4A 2CT3A 3VAAA 1BMFD 2ZSEA 4DC9A 1FOEB 5KNCA 1DBSA 2P2LA 3TUZC 1NYGA 2IS2A 4KVGA 4OYHA 2WOOA 2EQBA 1XTRA 2DWQA 1G64A 4QL3A 3Q5EA 4M9XA 1WBBA 3EPLA 1GNQA 1YE8A 5FBLB 3QF4B 3A4MA 1KSWA 4B47A 1YR7A 1ZD1A 4NU0A 1KO1A 2GDJA 5FPYA 4TMVA 4IOMA 1Q57A 2QENA 4JT4A 4HLUC 3VKHA 2CREA 4G0NA 1RLQC 3O5ZA 2VYFA 1NKTA 3IHWA 4IVRA 1KI3A 2C0IA 2XGJA 4GFDA 4C9BA 4TL7A 2AXNA 2O0JA 4ABYA 5EXXA 1XBTA 3ND9A 4BFZA 2MSCB 4TMZA 2BMJA 2ZS8A 1TNDA 3KQUA 5J4YA 2NWMA 2DRMA 5HZKA 3CW2A 5CDFA 3LQQA 2PNIA 1CJVC 1JAIA 1W36B 1X6GA 2A08A 2K3BA 2OFWA 5CJ2A 2QT0A 2BJWA 1TEXA 4L16A 3QXSA 1A1VA 3LRPA 1BIFA 4JJDA 1TQ6A 2ZYWX 4GOJA 4D2IA 4KXFB 4AFZC 2P0EA 3IEVA 1NNEA 4TQUS 1COWD 2FDCA 1KI6B 1OHHD 3CNLA 5AUQA 5GJVB 2VP5A 4N0EA 2YUQA 4AURA 3EG2A 1W36D 1GFCA 1NG1A 1UFQA 3CX7A 3QEOA 5KHOC 1SHKA 1X1SA 2CLCX 1BYUA 1DE0A 1ODFA 2D7CA 2J6FA 4E6RA 2IS4A 3L0OA 4Z1MD 5EJEA 1EESA 3K0CC 5SZHB 3E2IA 1R8SA 2VPPA 4XH9B 1DAHA 4BEBA 5FUWA 4AC9A 2OXCA 4B3DA 1IN6A 1GWNA 2NUZA 1KMHA 1OIVA 3W3ZB 1ZUNB 1AQUA 1NY6A 4UNQA 4C2TA 1CRQA 3FHTA 1UJ0A 2NTYC 5C4GB 2P6RA 3I5RA 2EYYA 4L9WA 4I4LA 4LYHA 3B82A 1I0CA 3IKJA 3LBIA 3QQ5A 4JLBA 4B6FA 1LS6A 4KFTA 4KYIB 1YZUA 1Q12A 2JAQA 4PQFA 4RZ2A 4TLDA 1Z47A 4B2PA 4B3CA 2AK3A 1J99A 1KSHA 4BUJA 3BAFA 2M51A 2QTHA 1SVOA 2YNMA 4PANA 3LBNA 4Q4AA 1GUAA 2HT1A 2PH1A 2GTPA 1OFUX 1II9A 1E9SA 1Z3IX 2FJUA 2GXSA 3MWYW 3T1OA 2RGGA 2EFGA 4JS0A 4NCKA 1KNXA 1T5LA 4TTQA 1XF9A 1FPMA 3VR5A 4ZDIA 4E09A 3AGPA 5JI3E 2G0TA 2CVHA 4JL8A 4CVNA 4NE2A 1YN8A 1UDWA 2GZDA 3B8HA 1E0KA 2GA8A 3WRYC 4KODA 2GJ8A 2H8KA 3VRZA 4M1TA 2BCGY 2JJ1D 2A5GA 4AFSC 4F16A 3GQBA 4X8OA 1L2TA 1YRAA 5CLLA 5B64A 4M1WA 2ZXUA 3ASZA 2BZXA 1Z0JA 4KVAA 4AG1C 1U0LA 3KX2A 2ASEA 2BEKA 2WSSA 4A0RA 1WDTA 4WBSA 3WP0A 4AFQC 1KO8A 2QMEA 2HLDA 4DLSA 5TXGA 2TMKA 5LD2C 4A15A 3I62A 4R7ZA 2B86A 2RQTA 4AG2C 2JATA 3TUJC 2QG6A 3BFKA 4FIDA 2F43B 4MQBA 1UHFA 3OHMA 5BWMA 2V6IA 3LAWA 5C1BA 2FPKA 3D7MA 3W6OA 4B3XA 1A4RA 4AKHA 1JQQA 1IHUA 3K0FA 1VIAA 2EWVA 1X3SA 1YR9A 3KXKA 1KZGB 2FFHA 1AWJA 2Q3HA 3U5ZB 2ZRDA 1ZC3A 1ZM4A 2WMNB 2KBTA 1UG1A 5BN4A 4RD1A 2VBCA 2AKLA 1G18A 4G5RA 1KK1A 2J05A 4DVGA 4C0BA 3BRWD 1WCV1 1YP5A 3QIAA 3LO5A 3GJXC 5FUVA 1SRLA 3C8UA 1E2NA 2PMDA 4B33A 5TV2A 1LB1B 5CYOA 3ZIAA 3UG6A 1ONBA 1I4LD 3CLVA 3BOSA 4U00A 2SHKA 3G82C 2XSZA 4RZXA 5DE3A 3U3JA 1I2MA 1B07A 2J3EA 4A9AA 1VYUA 1R10A 2ZI7A 4C0SA 1XXHE 2W10A 3WXMA 2ZI3A 2JJ2A 2UKDA 5DHFA 4UNSA 1W4CA 2G1JA 1E2IA 4AKEA 5K8TA 2HF8A 4M1YA 1YWOA 1AZSC 1VCIA 2XMFA 4IEIA 5IF9A 1GRRA 4KCGA 4UXIA 4TYWA 1NVVQ 2OSBA 5J5CA 621PA 4JBXA 3H41A 3R9XA 1N5KA 1SHFA 5JWHA 1UKYA 2FEIA 2JM9A 1AZTA 1E9CA 1PLJA 3LX8A 2LWIA 2DWOA 3U6BA 1JR3A 2X77A 2JJ2D 1ZNXA 1BYIA 1N6PA 1PKSA 2F1JA 1TQ2A 2ZRBA 3IUYA 1ELOA 2A5FA 2IT1A 2GWHA 2EGEA 3KUCA 2IYZA 4Q4LA 2JLZA 5C46F 5CM9C 1ESNA 3I9QA 4QBHA 1ZUUA 3AVWA 2DYKA 1S1CA 4EAQA 1P62B 4EKDA 1QHIA 4GMXA 1VCNA 4Q1DA 5B58C 4GRAA 4W9MC 3GJ4A 2ONJA 4C4PA 3M0PA 1A2KC 1CJKC 1CS4C 3QUSA 3QEJA 1MRSA 1MV5A 5L3SB 2ZR0A 3O8RA 1HURA 4HAWA 2CLSA 3HU1A 4ZNXA 4LWZA 2DBMA 2RHMA 2I3BA 2J0UB 3CRVA 2BOVA 2R6AA 2OBNA 4GLMA 1GNPA 3ADCA 4TQ9A 4TMXA 4EPYA 5C18A 4PHGA 5IXFA 1HEIA 4BFVA 3LBHA 3K09A 1UPTA 4P33A 3VMFA 4EPRA 1TU3A 3GFTA 4QGAA 3RVBA 3QG1A 1GP2A 4B76A 3FMPB 1M6NA 1OXUA 2VRWA 4D0GA 4U02A 3QG5A 1UUEA 4J9FA 4O3MA 4CZ2A 3REBB 1VCMA 1M1YE 4DIEA 1UBGA 3S1AA 1QHGA 2H57A 4QJ5A 4KBFA 1AQYA 3T1TA 1TF7A 1XTJA 5AJVB 4DCUA 2LZ6B 3AF0A 2HCBA 4A63B 4LUCA 1Z08A 1E6GA 2AL7A 3MRSA 4R2HA 3IPYA 2V1XA 3EHQA 1MR3F 2JLSA 3CWQA 2A30A 1JBKA 1GG2A 1SGWA 2KB0A 4FCVA 4XD7A 4TLBA 1FQKA 4CEHB 4Z1MA 2RGNC 3TLXA 3IQWA 4HB0A 1T3HA 2G83A 3KUDA 4LI0A 4JBWA 3TVDA 3PEUA 3KJEA 3MWJA 3IQLA 2O8FB 3LVRE 4O2LA 2FPDA 3BJIC 2CCKA 2JMAA 3KQKA 4MRPA 1XD2B 4URXR 4BLOA 1EFUA 1R2QA 2P3SA 2XNDA 1CF4A 2AKAB 4RTVA 1YCSB 4X8MA 2QE7D 3M0SA 3CQTA 1QVAA 2L2PA 2CH4A 2ZE8A 3CBQA 3JZMA 2B21A 1HT1E 4IEEA 2HEIA 3KJGA 1AKYA 1FMLA 1NI3A 1UKVY 4QHTA 2GVZC 3SU8A 2BVNA 1RVDA 5EE1A 4TT3A 3UMRA 1N3BA 3OAAA 2XTMA 4FINA 3VU9B 1JQLB 4KFRA 1J8MF 2QNRA 4UJ3A 2LJ3A 1GKIA 5HE8A 4LYJA 3FKSA 4Y0VA 4D4MA 2XZOA 2ZVPX 5HTKA 1U99A 2AKKA 3AVUA 1Y0MA 4JT2A 3WY9A 4JJBA 4M2LA 4NCNA 2OV2A 5EUQB 5LD2B 3THOA 2N42A 1H8HD 4JLPA 1TF5A 5BXQC 1PJRA 4Q03A 1SXJD 2PJRA 1ZMXA 4EUNA 4A2QA 4ITRC 2J87A 1GRIA 5K8LA 4PC1A 4Q18A 2CCJA 4GP6A 1G5PA 5JWOA 1X6VA 2N1BA 4JYCA 4YXWD 4RFSA 3PEVA 4OMMA 2GEUA 4LN2A 2GILA 1KDRA 3Q8XB 2D0NA 2V3CC 3CR8A 1FX0B 3EG5A 3VR3A 4JYBA 5KPDA 2BBWA 2KGTA 3SR0A 2JIZD 2I4IA 1F2TA 4TTPA 2F1IA 4HI0E 4A8JC 2OBMA 4Q1AA 3R7WB 3OEHD 4TYPA 2FFAA 3AF2A 2K2MA 5E4FA 2IS1A 2YV5A 1WF3A 2YZ2A 1M3BA 2JLYA 3FHOA 4FD2A 4EFMA 1N6LA 2QUZA 3EZ2A 2BZYA 3G5UA 3RS5A 3TR0A 2FSGA 4I1UA 3QNUA 1G8FA 4RD3A 5EUMA 4HCKA 1ZBJA 3C14C 3VQTA 2KBFA 2DL8A 2HDAA 3HYRA 5GVSA 2VLIA 2V7QA 4P0TA 2A5DA 4F14A 2D74A 2ZI5A 5BW8A 1BMFA 4E07A 3CH5A 3ETLA 1PV4A 1FUKA 1T0HB 2YOHA 2Q3FA 2QL6A 1NN5A 4DT1B 1E2FA 1KO4A 2AX4A 3Q85A 3QPUA 1QKXA 2WPDA 4WZAE 2ZAOA 4OI0A 4A0HA 1WDXA 1MO6A 2GETA 1T8TA 1WXBA 5KNDA 4D25A 1C4OA 1G5RA 1P2VA 2GBLC 3H4MA 1CU1A 1UGVA 2SEMA 2C04A 4MUBA 4V0LA 1WI7A 4CF7A 1ZNZA 2H1LA 2YUPA 3A58B 4A2WA 2KROA 2BHRA 1E7OA 3J81k 2O88A 1IJFA 5FBWB 2CCGA 2Q9CA 1GM5A 1RFLA 2FGJA 2GF0A 2MSDB 4LK2A 5H70A 2PZ1A 1JPJA 2A28A 2GJSA 3EPHA 3ZVMA 3KQLA 2IUTA 3DO6A 2ED0A 3B1WA 1ZUKA 2Q21A 5HCNA 1EFCA 4FN5A 1L7VC 1FW6A 2QBYA 2ZSDA 3LH5A 3AKCA 4LGMA 3MWKA 4IVQA 5EP4A 2VKNA 1KJZA 5EP3A 1DTSA 4RY2A 2OE2A 3QBTA 3LWNA 3BORA 1AD5A 1E99A 1FNMA 3KKOA 4OQLA 5FTKA 4IW3B 4XWAA 2FRWA 3KDSE 1BH2A 2VSXA 3P20A 2QM7A 2O0HA 1ABQA 2CE7A 1OLOA 4LC1A 3TH5A 5DN6D 1YQTA 1P6XA 4FMDB 5G3YA 4GNKA 4Z8AA 3O47A 5JCPA 1NMXA 3M0EA 3GJ7A 2PZEA 1CKAA 1Z6YA 1NLFA 2H92A 1NG2A 1KJWA 2YKGA 5EXSA 4OQMA 4OJKA 4U5XA 3PV0A 2G6FX 2VQSA 1S0UA 3SJZA 1VCOA 1DO0A 1AOJA 5GVRA 2F55A 4GL2A 2NO0A 4KU4A 2WV9A 4JBYA 2DA9A 3HR8A 4TMWA 1FMKA 3WMEA 4DLYA 4DXAA 3AM1A 1FMJA 3GJ0A 2A5JA 4FCTA 4DLWA 1HYQA 2CUDA 4CC2A 5IH2A 2EVRA 4F92B 2QGNA 2V8OA 4EQ6A 4F91B 3C16C 1B0UA 3PUYA 2A7QA 5L8VA 4K11A 1PWTA 4M21A 3EX7C 2FPFA 2J5XA 4KAXA 1WA5A 2QP3A 4C0QC 5P21A 2ZM5A 1Q20A 2ZSBA 4B43A 2Q6TA 5CITA 4CEHA 1QHHB 3UK6A 3AH8A 1E94E 2ORIA 4RTZA 1KO5A 2QP4A 3U6KA 1E4YA 2GEDA 3L0PA 3QENA 5FTLA 3FDIA 4LHYA 1ZCAA 2GHIA 1QKWA 5C2JB 4Q7MB 4V0KA 4QJ4A 2H5EA 2FEMA 1GL9B 3BIFA 4CT5A 1US8B 5FR2A 5FPSA 4OHZA 4LBVA 4Y0AA 3B1ZA 5L3VA 1UEIA 1Z0KA 1GKYA 4LDJA 5FFMA 1R0XA 4DCNA 4Q5IA 4UXJA 5DYIA 1NRJB 2XX3A 1OIXA 5JBQA 2CNWD 2RPNA 1QWFA 1XP8A 1T9HA 1YJ5A 1NN3A 2IHBA 2VP2A 4LJ9A 3VKGA 3PXGA 5E3HA 4LHVA 5EE0A 1WXTA 1O87A 3W90A 2AK2A 2ZS9A 4QJ3A 1E9AA 4LHWA 3NHBA 2R44A 1GILA 1R8QA 2GCOB 4YMSA 4A0GA 4BLTA 4DHEA 1AGPA 3VS6A 2L3SA 1F3OA 3QXHA 2IIMA 4UNPA 3X1WA 5FPKA 4PAQA 5FH9A 2MOXA 3MGCA 4IIMA 1PLLA 4PO8A 3OEEA 2BMDA 2HJVA 2B6HA 3ZDQA 1G4AE 3RDPA 1OPLA 2O2OA 1OW3B 2Q3MA 3A6PC 2ERXA 3VS3A 1AKEA 2MSEB 3FKSD 3HP1A 1YZKA 5J47A 2ZSFA 4M9SA 3SNHA 1OOTA 1RE0A 3B13B 1G3QA 3F5FA 4O0MA 4PC6A 3UMFA 2KXDA 3U4QA 3AVQA 2QTVB 3CWZA 3T35A 2E87A 3KJIA 2CSQA 1RPZA 3GBQA 5LPNA 2GVDC 1OFHA 4FI3C 5FPTA 3O8BA 3EZFA 3R9IA 1FX0A 3ZGXA 1QBKC 1H8KA 2REXB 2NQ2C 5CK4A 1ZBDA 1VHTA 2QSZA 2ESWA 4Q4JB 1G7CA 1F48A 3TSOA 3NMZC 1OT3A 3VS1A 5EXPA 2DR3A 2OM2A 3QXCA 2QAJA 4RCZA 2YSQA 4LBWA 1E2PA 1ZRHA 3CPEA 3VR4A 4LE9A 2F2WA 3F8TA 4V0MA 3U7FB 2CH4W 4F4JA 1BU1A 4BZPA 1E2QA 3IHLA 3QKSA 4BFYA 2IL1A 2ZU6A 3CRMA 3IQXA 3QKTA 3QJYA 3RS7A 2UVQA 3C5CA 2ZJAA 4GZMA 2EBPA 4TL9A 3JV3A 2DBYA 1WB9A 1VYVA 1KYIA 3B2EA 3QPWA 1T0HA 4KV9A 2C95A 4HAUA 1M27C 1WQ1R 4HB2A 3THYA 4NPHA 4V02A 3BBPA 3UANA 3GFPA 1UE9A 2OCAA 4GT1A 4NCJA 4M9QA 1OH7A 3WYFA 1ZIPA 2GXQA 3RS0A 1W49A 4KFUA 4QT7A 3CR7A 3GLFA 1US8A 3H0KA 1WYXA 2FRYA 2C03A 5E7JA 3PITA 1TEVA 2J06A 2AFHE 4Y92A 1EWQA 1E0SA 2P6UA 3AF1A 1E2JA 1I2DA 3R20A 3VFDA 2ZS7A 4LYFA 4EDHA 5K8IA 4MKIA 2E9SA 2ZYTX 2MIOA 4TL8A 2VIIA 2NG1A 3AUYA 1OF1A 2GCOA 2ZE7A 3K70D 3SDZA 5FBQB 1VA7A 5FL7D 4TSFD 2ZUBA 1CKBA 2FA9A 3M0UA 1RRPA 1Z5ZA 3K09C 2QEQA 4IXMA 3SEAA 1H3HA 2DFLA 3QKRB 4UNRA 1G3MA 3B6EA 2BCJQ 4EJSB 2JXBA 1XCGB 1J7KA 2X3WD 5G3ZA 4NYMQ 2DY1A 3REFA 1E9RA 1BS1A 2ONKA 1BKDR 1NEBA 1ZC4A 3DOFA 1XWIA 4Q7JB 3T34A 4BECA 2KNBB 4TMTA 2R62A 3H0FA 1MV3A 1ZINA 2VSOA 5DN6A 3IDQA 3ZYCA 3OESA 1F2TB 2WSMA 3K0EA 4NBSA 2H18A 4W5JA 1E96A 2OLKA 2CJWB 2ATVA 4LJ5A 5AJYA 1V43A 1DAEA 2CHVA 1Z0DA 4RD6A 1OEBA 4MUAA 2D4HA 1G8YA 4IRUB 3VR2A 2LMJA 2KJQA 2QMUA 1DAGA 4Q4JA 4G5SA 3W6NA 4OHXA 2JTEA 5J4HA 2AZSA 3O8DA 4Q9JA 4B48A 1G3RA 2GF9A 4OI2A 3MWLA 4AYXA 4B74A 4B32A 1L4YA 3HR7A 1GRNA 4Q02A 4RZ3A 3AVXA 4B3GA 4ASUA 5SZKB 1ZU5A 2QORA 2PLRA 4LZZA 1OH8A 1AEYA 4PPNA 1NMZA 1UDXA 1M30A 3QSYA 1S8FA 2AKYA 3SHWA 1FL9A 3DKPA 4ZIRB 2W6JD 2FO0A 2OAQ1 2C78A 3GEHA 4BZXA 2J7IA 2ROLA 2XXAA 4S35A 1H92A 3I5SA 2KT1A 2ZPTX 2IEZA 1YNZA 2GRJA 4GBMA 1E2GA 1VG9B 2GCPA 1OH6A 1T3LA 1GL5A 3BS4A 1VMAA 4LSGA 3LFUA 2NZ8A 1YHNA 3EIEA 4G3XA 2JLQA 2OUKA 3ZZTA 2W0ZA 3RNLA 1F2UA 1OKKA 4DSNA 3PIRA 3OIUA 3A4NA 1CKEA 4IFEA 3TW4A 2FEOA 3UWOA 3ZVRA 2AN9A 121PA 5KDLA 1N0UA 1CR0A 5FOXA 4OMNA 5KNBA 3AUXA 5J4LA 2W6JA 2XTNA 2ZEJA 4TTRA 1Z6AA 1G8PA 3FFBA 2LQNA 3NDBB 2VH5R 1G3UA 2AZVA 2KXCA 2Z0MA 2O8DA 5LBIA 3Q3JB 2F9LA 1JEGA 1RRCA 1EFHA 1NSTA 2QPTA 4LJ6A 4AKGA 4D6PA 1RC8A 1W7AA 4XJXA 2ZRMA 5BYJA 5JJLA 1Z8FA 1DELA 1QZXA 2BM0A 2BV3A 4JJKA 4B2IA 3JZAA 2X3XD 2QAGA 3VNVA 1N6KA 1NJGA 2OT3B 5LDDC 4Q9HA 3CNNA 4DEXA 2FG0A 1DAKA 4J0QA 3C5HA 2LCFA 2DILA 4HUQB 4OI1A 4EJSA 1XMVA 1G2BA 1D5CA 1Z29A 1HD3A 4C0HA 4XVQA 5H8WA 2FFQA 2GXAA 5I11A 4PC3A 3HU2A 4QG7A 4BE7B 2EQIA 3BXZA 2CDTA 1AS3A 4HDQB 3WBKA 2V9PA 1NLOC 3MG9A 1II8B 1K8RA 3QI2A 4KLZA 2CDNA 2W00A 4YMWA 1JR3D 4DWJA 1SKYE 1ZD8A 2QPAA 2K9GA 2F6RA 3WRXC 1OHHA 2F3TA 2IYRA 5IHNA 2OAWA 1IOZA 2VO1A 3Q7QA 1DEKA 4IOKA 4I99A 2PX0A 4M0LA 2PCLA 2OI3A 2DF6A 2OILA 4Q4HA 1UAAA 3THKA 2W0MA 2R65A 2WJJA 3DHWC 2FPMA 3DMNA 4IVPA 3SS8A 4JVMA 1KIMA 3TNFA 5JI2E 1P2UA 3TAUA 4DDWA 1CLUA 1XD8A 1IBRA 1KAGA 4LPKA 5FOUA 4G01B 2ZJYA 4FWIB 4NTZA 3L0IB 4X8LA 2EYWA 3CF0A 2IWHA 3EGUA 2WVJA 1UDLA 2OO7A 1ZSGA 2ZI4A 1Z2AA 4F38A 4Z51A 3L8YA 2YOGA 1YR8A 3SJAA 3THYB 2DM1A 1WBDA 3K1JA 4C0LA 3UA6A 5CDFE 4RVCA 1IY2A 3RSLA 4MRNA 1Y3AA 3B1XA 3AVPA 3U3OA 4HVWA 4A92A 2AK5A 1S3SA 4ZCMA 2OJ2A 3CM0A 4U7DA 3NWJA 2JLRA 2FOLA 5FOSA 2HYIC 4TQAA 2VP0A 2JW4A 1RI9A 3X1XA 3DM5A 1P9NA 1X6BA 3KL4A 5IXBA 4DDTA 2VWFA 1KJYA 4M8NE 4F4CA 5EQTA 4BLSA 3WYGA 2IF0A 4PPQA 1UJYA 4WW0A 1MOZA 2OZEA 3QXXA 1JALA 1XJQA 2VHQA 1G7TA 2ODNA 4WIAA 5CYPA 1NVUQ 2OEPA 4F4IA 2QSYA 4URZR 1B3QA 3O8CA 3TW8B 1K0SA 1BO6A 5JLJA 4OMLA 1ZM3A 1TMKA 1W47A 3PVLA 1G21E 4RZUA 2HT6A 2J41A 5DH9A 4D8DA 4LHXA 4LC0A 1OFIA 4QM7A 1EG7A 2DFTA 2KE5A 3U4QB 3AGQA 2Z5FA 2E5KA 1I4TD 2J0QA 1GIAA 4PZZA 4AFUC 4A6XA 1T0JB 721PA 2D3WA 3GEIA 4CW7A 1U0HC 4CDGA 2EKHA 3LQRA 4RD4A 2ZREA 1XNJA 2GAOA 2VHCA 2V6JA 3BFXA 4OMQA 1SVKA 2LJ1A 3EIHA 4JVLA 2B8WA 2IUUA 3BFVA 4R2IA 4KYUA 5F2EA 4D81A 1A7JA 4CEJB 3NBXX 4GSYA 2ED1A 3UWKA 3VTKA 4D4KA 5G41A 2BJVA 1AS0A 3ICEA 4MRRA 4Q48A 4IHQA 3PUZA 4CYMA 4HLCA 4HLDA 4US1R 1KI6A 2QN6A 4C7OB 3QXJA 4OI4A 5GJVC 1NBME 1FQJA 3KFVA 1O3YA 1MRNA 3NBZC 2B92A 2G1KA 2VVKA 3GCGA 4IXNA 2ODWA 4OQXA 3U60B 4TZ6A 4YDHB 3OIVA 1VKJA 3MUFA 3PG5A 1PRLC 1KO7A 3IO5A 2G88A 1N5JA 1KDOA 1Z6GA 2CMKA 4XSHA 5EZ6B 4LX0A 5KU1A 2AFIE 3B7GA 2IK8A 4QHSA 3OZXA 1G17A 3K70B 1JR6A 3ULRB 3CZPA 4L5BA 5CJPA 1VG8A 1JECA 1KNQA 2ZJOA 4NCIA 5CM8B 3EHRA 3DDCA 4MITA 4ZIRA 2ZI9A 2PZGA 3SFVA 1U8ZA 5KYKA 1CEEA 2D2EA 2ECKA 2UZ3A 3R6NA 3D6TB 3ONWA 4Q7LA 4ARZB 4YMTA 1CSKA 2KRSA 2CEAA 3NBFA 1DAMA 1E2HA 2ERYA 4ZCIA 2GNOA 2ZAMA 4BGDA 4JLNA 1PRMC 2ECZA 1K0XA 3H0IA 4A1FA 4V03A 3R8CA 2WKQA 1PUIA 3I5YA 3GLIE 1SRMA 4EPTA 4KSBA 3K70C 1Z2CA 4JVSB 1Z0IA 3RRZA 4B75A 2DYBA 3TKLA 4B2LA 5DISB 4Q19A 1OKKD 2OCYC 1M3CA 3B5JA 2XSZD 3VR1A 3HYTA 3U3MA 4F93B 4TLCA 5HZHA 1D6JA 2V7QD 4GDFA 3WHLA 2KYBA 2YYZA 3QPVA 3N2IA 3AEZA 4PAOA 1AS2A 1UF9A 3THXB 1TAGA 3SFZA 4CRWB 1JR3E 4DLTA 1Y63A 4QM6A 3CZQA 1GITA 1M8PA 1DVRA 2QZ4A 2RQWA 2IUSA 2VP6A 2ZE5A 4IDOA 5IRCD 5JSZA 1DAIA 3WYAA 1P60A 3UMSA 1VHLA 4D4LA 4AY2A 3TR5A 4BRWA 1NN0A 1UADA 1T91A 4D4JA 4DEYA 1M2OB 3P32A 5FPHA 4BLQA 4RTYA 2C5LA 4ESHA 2YWGA 1XEFA 3PUXA 3FMOB 4MGYR 4E03A 1KSGA 2A2ZA 3ZZ0A 2GBQA 1E9DA 5JSZB 2O9VA 2OBLA 2ROTA 3VS5A 1HY3A 5ECAA 1ZW6A 1N6NA 3V4RA 3A98A 4XTRA 4AD8A 4OMPA 1W6XA 3EC1A 2HBWA 3PR1A 4NYMR 2FPEA 3LW7A 5FUYA 3TMKA 4BFWA 1A82A 1JB1A 3TGPA 3U7GA 1VG1A 3N5CA 2C8VA 3BC1A 2FPLA 4R71A 4HAXA 2DRKA 4KRTA 1XZQA 3A1WA 4R98A 2H16A 3PE0A 1IN8A 1SXJE 3FMFA 2XB4A 4K8OA 2AR7A 1Z0AA 1YZQA 5JMTA 3NIBA 2IF2A 2W83A 3LVQE 1ZIOA 5TMPA 4DSTA 4CC7A 1L4UA 1OE0A 1R5OA 1E9FA 2L3QA 4CC3A 1GCQA 3L43A 3KKPA 4LV8B 1R0YA 1R7RA 5EE9A 2QM8A 4MYUA 1KY2A 3UA7A 1CJMA 3TSZA 2ZU0C 1UTIA 1Z22A 3RRNA 4KLNA 2WAXA 1KHTA 2YC2C 4GP7A 5EP1A 2XNDD 3ZVLA 5A4JA 2C9OA 2ZRGA 1S4QA 3T1VA 2C0TA 3QF7A 1EXMA 3FB4A 2Q9BA 4Q4AB 1AVZC 4D0NA 3GLIB 3DZDA 3SBDA 1W36C 2Z4SA 1EX7A 4JLDA 4PC7A 4JVNA 4V0NA 1E0AA 1D2MA 3A1SA 5DIFA 2W58A 4JZKA 4ZI2A 2EPDA 3DKVA 3OAAD 4BLPA 1IM2A 2GKSA 2IX3A 1G20E 2D1XA 3AVOA 2J7PA 4BQSA 5G53C 5JFGA 4LV5B 4JPBW 3JVVA 3THWB 2GTJA 4D8KA 4H1VA 3T5DA 4PPGA 4N3NA 1DAFA 1Q1BA 4BZQA 2KYMA 1P3JA 1Y57A 3VX4A 5KSYA 3RC8A 2DFKB 1MV0B 2XNSA 5ANRB 2HYDA 1G16A 1ZNYA 1Q22A 3L8ZA 1LNZA 1P75A 4N1AA 5JJIA 3DOEA 2ZETA 2ZVQX 3GMTA 3LD9A 2WBLC 2WJIA 2G9NA 1JU5C 2ORVA 3REAB 3TRFA 3WNDA 1Q1ZA 4YMVA 1BOFA 1XFAA 3SQXA 1JPNA 4UJ5A 4BASA 1T0JA 3PVQA 4JJCA 421PA 2IYQA 3EIQA 521PA 4W5WA 3RC3A 5L3SA 4ZO4A 1ZJ6A 2EYXA 2JEOA 3REGA 3LLMA 1KI9A 2DMOA 4LJ7A 4LBZA 3SN6A 4LV6A 2IA5A 4PQRA 3VS7A 1CP2A 1VECA 1Z06A 2OCBA 1WFWA 2QRZA 1LCKA 1KSFX 3H84A 3BWDD 1NYFA 2QA5A 1X2QA 4YDSA 1F6BA 4JL6A 3T12A 4IDNA 4OKSA 2C77A 2LP5A 1W4BA 5EXTA 1VG0B 6Q21A 4JLOA 5L3QB 1HV8A 3OE7D 4PFSA 3SJCA 1X69A 1W48A 2K6DA 3R9WA 2VHTA 1N2CE 4MYTA 1RW4A 3DM9B 4TLEA 1XCMA 3Q72A 3NH6A 1NBMA 1AN0A 2BMFA 5CIWA 4OHWA 4QGGA 4D82A 4BFSA 4EIKA 1X43A 4OQFA 2AD1A 4LUDA 1QHNA 2V1QA 4HATA 4AI6A 2IYYA 1V5WA 4V0ME 2WM9B 4NZYA 2JS2A 3K0CA 1WXQA 3CF2A 3TQFA 3OF5A 1G6HA 1FFHA 2G77B 4LOAA 1IN5A 4AIIA 1FP6A 4DT1A 3KXIA 4DB4A 1T5IA 1XB2A 1U2RA 3T1QA 2DCUA 3ZVNA 3ASYA 4CGZA 1AM4D 3BK7A 2KR3A 1E2DA 5HKKA 4AK9A 3ZD7A 4IDPA 2EFCB 1N6HA 1N25A 3FJ5A 4QNRA 3BB1A 1IXSB 2XEXA 2CSIA 4GOXA 5FBVB 1FZQA 1Z63A 1XMSA 2O9SA 1YRBA 4YMUA 2PMKA 3N70A 2REBA 2IXGA 1U06A 1U94A 2RMKA 5HE9A 1RYHA 2O5VA 2RGCA 1W5SA 2IYSA 3N2EA 1NY5A 4K81B 1Z6XA 2KI5A 2RQRA 1S96A 1YWPA 4L4UA 1GDDA 1ZVQA 1UEJA 2ZUDA 3CPHA 5FWBA 1YR6A 4TWZA 4CIDA 2HDNB 1WXUA 1HQYE 1JNYA 1XMJA 2V54A 3ZQ6A 1YZTA 1KKMA 2P65A 5E7IA 1E1QD 5CB8A 4LYAA 2ZRJA 4JJZA 5BN3A 1T6NA 3IIKA 3LY5A 4TYNA 1T8UA 1GBQA 1R6BX 4HB3A 3WP1B 5SZIA 4WXPA 4EJSC 1NM7A 4CC4B 2J7KA 4ZDWA 2AXPA 2X2EA 3CONA 4NYIQ 4P31A 5EP2A 2GCNA 3WBJA 2PT5A 4QXAA 1UHCA 4RD0A 2D2FA 5B2ZA 1T4GA 2AWOA 2MCNA 2AWNA 2C9YA 3P4XA 3T15A 2F7SA 2R8RA 3W6PA 3K8YA 4URVR 1C1YA 1T3SA 1TUDA 1XPOA 4C0KA 3LV8A 1SHZA 1S3GA 2JASA 1TU4A 4LHZA 1TUEA 4M1SA 2FGKA 4X1VA 4Z89A 1RRFA 2QI9C 3CX6A 3UF4A 1SVLA 4PZYA 1M7BA 3VX3A 3MCAA 2DX1A 3NG1A 1GZSA 4PHHA 3EZ9A 5JRJA 3ZH9B 1OPXA 4US2R 1M7GA 1P61B 5L3QA 3AP3A 2M0YA 2R2AA 1EGAA 3I1FA 3MD0A 4KI0A 4NKRA 5FI1B 2BZ8A 5GJWC 5AR1A 1HJDA 2J0VA 1RUWA 5JZVA 1COWA 2IC5A 1CXZA 1XEXA 3ZS8A 1WP9A 4EPVA 3VS2A 1G4UR 2JLWA 3U3RA 3C4JA 3AVYA 1K5GA 1MO3A 3W3AA 4ARZA 5KSZA 4WVFA 1AWXA 4AKIA 2F9MA 2J9RA 4E5UA 3GJ8A 1GNRA 2WICA 3K53A 2QTFA 5HPYB 1GOTA 3RANA 4ZDJA 2JMCA 1TTTA 3CRW1 4KITB 1WRBA 2K5UA 3K9LA 3EA5A 1Z9ZA 5KPJA 3GEEA 1IJEA 3QY0A 1N5ZA 2GAAA 4J9DA 2R6FA 2BEJA 2YINC 1NMYA 2OCPA 4HLUA 3GJ5A 5AJZA 3CRRA 3PFIA 3I5XA 3A36A 1U8AA 2C99A 2BDTA 2V55B 3EZ7A 2PEZA 2QQEA 1ZUIA 1NF3A 2GJ9A 3K9NA 1HTWA 3MJHA 5IHPA 3ZJYA 1J90A 3GJ6A 2IWRA 2J6OA 5JJKA 1XTQA 2JCSA 3HPQA 2F1RA 2QROA 3LA6A 1ZUHA 3EPKA 3A1TA 5FW9A 3IBGA 4JIMA 4BRUA 4Q21A 4PSVA 3MJRA 4KBGA 1UKZA 2IXFA 3NC0C 1QVRA 4DKXA 4P4TA 3M0TA 2KE9A 1S2MA 2QPOA 1XEWX 4IKEA 3D31A 1K9AA 4M1MA 4Q9LA 3PUWA 5KDDA 3RLFA 1KFZA 4RCYA 4PO9A 1W4AA 3GD7A 2JDID 2L3PA 4WOPA 1AK2A 2G3YA 2RGBA 5DO9A 5J4KA 3AF4A 1KMQA 1P73A 2O8BB 4Q1CA 5KTYA 3AP2A 1IQPA 4NMMA 1KK2A 2D8JA 4JLJA 3NPFA 1E79D 3OEED 1F60A 2VEDA 1HUQA 3D3QA 4LCBA 1DS6A 2YVUA 3TBKA 2ZI6A 1JAHA 4WXRA 2D7DA 2ZIAA 4IDQA 4OHYA 2RHDA 1QDEA 4FMDF 4DDVA 4R9UC 1G1MA 2RGDA 4AYWA 3AP1A 3RYTC 1Z07A 2BBTA 2ZRFA 1DO2A 1E6CA 2NOAA 4EQ6B 1OFTA 1G8HA 4C2UA 2RGNA 1JI0A 3IGFA 2LNHB 3P26A 3EA0A 2DVJA 2F1HA 4LNPA 2WIBA 2D62A 5F9HA 1ZUYA 2YDLA 2BMEA 2PLFA 2X19A 3D8BA 5AJWA 5IDVA 3C41J 4PXAA 1M34E 2ATXA 1KMHB 2PL3A 1D2NA 4J9EA 1EFRD 2V1RA 1NBMD 1OV4A 1HSQA 3KXLA 4WA7A 2B7CA 2ZRHA 2C98A 3NKVA 1IY0A 2N46A 3SBEA 4II7A 3V9PA 5F9FA 4I81A 2Q0HA 3EPJA 1UKEA 2Z6VA 1OSNA 2QAGC 3PENA 4ZPXA 2YWEA 3FHCB 2W2XA 2FSFA 3P4YA 4ORZA 2ZR9A 4QC2A 3ZIAD 1SKYB 2QQ0A 2WAYA 1TL7C 2EYQA 1G8GA 4X8HA 2O8FA 2H7VA 2NO6A 4NH0A 4QKQA 2FH5B 1W4RA 2QU8A 4AG5A 4PAMA 3L2OB 5FTJA 4RKEA 1VYTA 5CK5A 3JVUA 3KTAB 4BFUA 1F5NA 1N5LA 4RTXA 1EX6A 5JECA 3NH9A 4LJYA 2BKEA 2ZITA 4FMCB 3VR6A 1G19A 3I3SR 3P27A 1M3AA 1ARKA 4J9IA 3PJRA 2RQUA 821PA 2FMXA 4NYJR 3W8RA 2OXRA 2HV8A 2ZE6A 2WWFA 4QGHA 3VU9A 1UBFA 2HCKA 2YUNA 4JZ3A 3TVTA 1JQJC 1P9WA 2WKRA 2CUBA 1EFTA 3EZ6A 3V00A 4A8JB 1S1NA 2QRNA 1X27A 1GL7A 1KI4A 1Q44A 1XTSA 1IAQA 3I32A 4FMCF 3W5JA 3MMPA 1XEWY 4B3FX 1KKLA 4URUR 4D26A 1AWOA 2NIPA 4P4SA 5FBRB 4D0LB 2HJGA 3GLFE 2FZLA 2GEVA 2BC9A 3UXMA 4JMPA 2RNAA 4FSSA 4HDCA 3RAPR 3GLGA 5FL7A 1AIPA 3QWYA 1U90A 2FSIA 3IIJA 1OH5A 1HE8B 1WIEA 1RYFA 4RFSB 4P4SB 4DSUA 1NVWQ 3HPRA 3CF6R 1HE1C 4TLAA 4B71A 1AA9A 2ZJ2A 5GJWB 2JLUA 4M4SA 1H8EA 3AVVA 2IYTA 1K5DA 1G6OA 2ZUCA 4Z54A 4QHYA 1ESMA 5E7MA 3S1AB 4DUGD 2OHFA 1XXHB 2Q9AA 3W8NA 1ZNWA 3W9YA 3I8XA 4URWR 2ZJ8A 3EWAA 2RF0A 1KGDA 4GI7A 2J45A 2J7PD 1Q0UA 1GCQC 3UKDA 2GBLA 2HEQA 2CL7X 2ZYUX 1Z6TA 2PTKA 4LBYA 3NDPA 1U8YA 3W5IA 3WHKA 3X1ZA 3U44A 1NIPA 4OHVA 4OQNA 4FWTA 2BWJA 3U7HB 2O31A 3CUEF 3I61A 4QBFA 4GPTA 3X1YA 3P1JA 5BN5A 3EWSA 4DUGA 4Q1BA 3U44B 1HQCA 1JJVA 5IK2A 4C0AC 3F0TA 5EC7A 2H8HA 2VP4A 4HZUA 4Q7KA 2O8CB 1NVXQ 1YKSA 4I1VA 4EIWA 2QBYB 1KOFA 2NO7A 5CIQA 2CBZA 3M0RA 2HF9A 4DCSA 1W44A 3KJHA 2OESA 1OB2A 4QOSA 1E2KA 2JGNA 2P4RA 2OAP1 3TE6A 4KJZA 4HZUB 4DJTA 4Q9KA 3GLGE 3EASA 2VSFA 3KTAA 3B9QA 1YVDA 1XPRA 4FCWA 2RB4A 4ZI3A 1E2EA 1U0JA 2ZSAA 3SEMA 1U81A 1W0KA 4MKGA 2CVFA 3B1VA 4YLGA 1X86B 3RNJA 1FUUA 4MYHA 4DRZA 5IK2D 4KO8A 3QVVA 3VNUA 3B60A 1RIFA 1ZD9A 2L0AA 1RRGA 1E1RD 1ZYUA 2P67A 1XJCA 5FOWA 5JRZA 3HDTA 4RSGA 2YJTD 1KY3A 3QKUA 4QNMA 5JCZA 1E0JA 2PX3A 5FI0B 4JKIA 3ZL7C 1XTIA 3CPJB 1NJFA 4G5OA 3QOFA 5FL3A 4QBIA 2QY9A 4L8GA 5GADl 2XOKD 2ZTSA 3EG0A 1IN4A 1MT0A 3U61B 2NO1A 1N0VC 5DSZA 2RKOA 2WSSD 4AG6A 5CLQA 1TQ4A 2GQIA 2IS6A 2O0KA 3KKQA 1CRPA 2HLDD 2DFNA 1PKTA 1FYNA 1EWRA 1L8QA 1SXJA 1XJ0A 3FVQA 3K0FB 4GZLA 1QHXA 4Q66C 5BYKA 1QHSA 4DZZA 3GLGB 2V1UA 4HSEA 4B73A 3TIFA 2V4ZA 1KDPA 5DI3B 4W7SA 5IHKA 4RKFA 2FN4A 3CNOA 1K76A 1Z9QA 3R7WA 4DLUA 1P72A 1Z28A 2B7BA 4ESRA 5KUTA 5KO2A 2QMHA 4H1UA 1OYWA 2FF7A 2QP9X 2WWWA 1XEXB 1I4DD 2YHSA 3ADKA 1GL6A 5GJCA 5J40A 2WHXA 3X2SA 1GKUB 2LJ0A 4E22A 1XXHA 1CULC 2LKDA 3CB4A 2IEYA 4HYYA 5BQ5A 1NG9A 2BKUA 1DARA 2NMVA 1R5NA 5A5GA 2CHQA 4DB2A 2DB3A 3CIOA 2D06A 1D9XA 5CB6A 3NXSA 3VS0A 1CR4A 1WA7A 4Z88A 4B34A 3M4YA 1M8MA 1D2EA 2L0XA 5DI9A 2WKPA 1ZM2A 2XB2A 4C7OA 1X2KA 1M7HA 1R0ZA 1XOVA 1QHHA 3Q5DA 2LCSA 4WZ6A 3GP8A 4TMKA 2VF7A 2NO9A 2ORWA 1B23P 1VTKA 4PSKA 2ANBA 4L9SA 2E1RA 3AKDA 1BK2A 4DLZA 4LJ8A 2REOA 2XAUA 3IILA 2UZIR 1J70A 4L15A 1RJ9B 2XJ9A 2AD5A 3AKYA 1PNJA 1MH1A 1ZP6A 3AV0B 2MMCA 2GJKA 2B8TA 1XTKA 2GZHA 3NEYA 4N0DA 5ELXA 4NCHA 4QGFA 1ANKA 3NHNA 2I1VB 2RGAA 4UKDA 2RN8A 2CE2X 3RHFA 3FKQA 4LJ4A 4JKYA 3HU3A 3ZQJA 1K1ZA 1VIYA 5LB4A 1DG1G 2DE0X 3QKRA 4AYTA 1M74A 3QVUA 3SZRA 2VP9A 5TDHA 2ZJ5A 3NEJA 3LX5A 1KK0A 4A8JA 5JHHB 2A78A 3GLHB 4RTTA 3CKLA 4Q9IA 4URYR 1SVMA 3LLUA 4HUTA 3SQWA 4HUQA 1DG3A 2A5YB 3BD9A 2GXUA 1ZLMA 3WNBA 2J0UA 3RS4A 4Q01A 1Z83A 3FGNA 1GVNB 3PUVA 4A36A 2DL5A 3B1YA 1XCPA 2CJWA 2OLJA 1N6IA 3GPLA 2EGCA 5I22A 4LUEA 1W1FA 4J9CA 2BBSA 4OK5A 2QMOA 4HAYA 1U9IC 4WAUA 3RRYA 3B9PA 4JLVA 3E70C 3WMFA 2I0NA 2ZROA 4CEJA 3M0QA 1II0A 2HUPA 5TB5A 3AKEA 3VKWA 2LQWA 4CT4B 1E2LA 3K9HA 2C9CA 5DHAA 3EC2A 2DNUA 1DOAA 4NP6A 4ZV4A 4RTUA 4A4DA 1LS1A 1E2MA 8OHMA 1KTVA 3NTUA 1UFFA 3FYHA 2GESA 3M6AA 4NYJQ 1QWEA 4V0OA 5EE3A 2I1QA 4DIDA 1E4VA 1P2SA 2WWXA 3BH6A 4RD2A 1KI7A 2OFXA 1KI2A 1NVVR 4MRSA 1Q1EA 2GJAA 4BFTA 1LW7A 4G5QA 5EZ5A 3I8SA 4F17A 3NC1C 1QF9A 4TT3D 3BGWA 4JZ4A 1E9EA 4UNNA 4DCVA 4XWOA 1XD2A 1NN1A 5G40A 221PA 3VRYA 3T5GA 4J9HA 3FFAA 2JA1A 4M1OA 3HWSA 4WZBE 3UATA 1AZEA 2ZR7A 4ACAA 5TARA 2VA8A 3A4LA 3PQCA 2FE4A 4MYCA 1KAOA 4M9ZA 3HJNA 3ICQB 1QLYA 5EE5B 2O8CA 5DLQC 5AUPB 1CIPA 3QBVA 4CEIA 5IHIA 4PQYA 1NSFA 3MAAC 3K0AB 2K7AA 4ZCLA 1BB9A 3KZ1E 3OFNA 4O25A 1GCPA 2JT4A 2ZRIA 4PO1A 1JEDA 1MO5A 1FP7A 3OIYA 4US0R 4G5GA 4JSTA 2W2VA 1W2HA 2EW1A 4OK6A 1W2GA 3AF3A 3ZD6A 1ZM7A 3QE0A 2EWWA 3VHLB 3KQNA 2CNWA 4NHOA 4Q00A 1UBEA 1KSJA 1SEMA 1NLZA 2C96A 1MO4A 1MABB 3GLHE 5KDOA 3G0HA 1TF2A 1NP6A 3PCRB 3THXA 5AWFC 3K9GA 3BB4A 4JSYA 3I35A 3NVAA 2KEAA 2GZAA 3IEUA 4B44A 3ND8A 4ESVA 1H8HA
chains in the Genus database with same CATH superfamily
4UMDA 4LMBA 3VS4A 1OVGA 1ZGCA 3D8NA 4OQDA 4QICA 4RA9A 4X54A 4ZOLF 2OXIA 3VSDA 4CQLB 5BMVB 3EZYA 1COZA 4GL4A 3RJMA 5B6PA 3CCVA 4TRMA 1Q7TA 1I3MA 2MDTA 1F6WA 4G1UC 4WNCA 5B30A 2C7PA 2JLAA 1LV7A 1YQGA 3G1TA 3ZU2A 2Q27A 3MMXA 1C80A 1FJ2A 1G0NA 5DX1A 3SC3A 1D4AA 1GFWA 3H0HA 3X1DA 5C5EA 2CEKA 4LFBB 3RAEC 4BWYA 4NYIR 1E6EA 3CHYA 4NMWA 1XMIA 4OL0A 3UJHA 3QVGB 4XTCS 3O0TA 10MHA 1Q7EA 4JWKA 2FKAA 1JO8A 4GW3A 1FSFA 3B38A 3TCNA 4I66A 5CBPA 4I1SA 4G0MA 2JGDB 2ACKA 3LLRA 1B93A 4GVPA 2X6TA 4Q9AA 5KTMA 1FSZA 4KGXA 1NULA 3JRZA 1J00A 3SYKA 3FE2A 4PWZA 3HI4A 3OWOA 1HTTA 1U0EA 2B2CA 3IT2A 4AROA 1XPUA 4K9RA 1FS4A 1TC1A 2VNKA 2OTLT 4PJOC 3GZTB 4MGZR 2R6DA 2JI7A 5JVDB 2B98A 4RTWA 2JFOA 2MSWA 1FP4B 3DMDA 4R4JA 4WJZA 4EM6A 3GMSA 5DGXA 4WCFB 1T35A 3IB6A 2I4NA 4DXDA 4OHCA 3PHLA 1LX6A 4M7DB 2PGDA 1ZR2A 2VPYA 1Q7YC 1K68A 1CDEA 5FDFA 1KOLA 1V29B 2HK8A 4YAGA 5KNDH 2J1LA 3OQMA 4OGCA 2EJ9A 3RSGA 5H3HA 1UECA 1GADO 4K46A 6GPBA 1O6CA 1CBUA 5HZGA 2I55A 5IKXA 1UM9A 1VLMA 5CLJA 4UBNA 3B7PA 4WK0B 2INGX 5CX1A 1S9DA 2X8WA 4PGAA 3UBTA 3HZHA 3BF8A 2P5TB 3LQYA 3MB5A 5EY5B 3MJVA 3DAGA 2HW8A 4RVUA 2D8HA 5EHQA 3N6VA 3AIKA 4N5MA 3H5AA 2FMIA 1PL8A 1R0BG 2J9YB 2Y2UA 3JRXA 4ZOBA 4BB0A 3DE3X 5M29A 3C7TA 2JVVA 1GUBA 1YU9A 2Y0BA 4LRUA 3QO3A 4B7CA 2X1MA 2Z83A 3FF4A 4G37A 3K32A 3K5HA 1G9XA 4DSOA 3GJ3A 1C1XB 2EP5A 1I4OA 4ZRMA 1OU0A 4JL5A 4F5DA 4PPFA 4XGKA 1C5KA 3E5MA 3SYLA 2BHSA 4M38A 2XUOA 1D1AA 1C9JA 4AL4A 2IZ6A 3EXAA 2CP7A 4C6SA 2P5SA 4YMGA 2O3SA 3QU5A 3GEPA 2XU8A 2EQ5A 3ZCTA 5MDHA 1F9AA 3K96A 3UPTA 1D4ZA 3QHSA 3URKA 4MMLA 1XA0A 2I4MA 1T15A 2AS0A 2POQX 2LX7A 4HRYA 3NIDB 4WKCA 1E5TA 1Y5NA 4J9GA 4GICA 4ZXPA 4HZIA 5I8ZA 1XAJA 2ETXA 3M34A 2TMGA 2ANCA 5TMEA 3EG3A 2GN8A 1TCAA 2YJ5A 2QWXA 2P5YA 3JD0A 3EG1A 3JQPA 1T2VA 4JFRA 4NCXA 4M75E 5K1ZA 2BTTA 3W5CA 1G8MA 3FFTA 1T5BA 4AP9A 2IXEA 3MSXA 4EW2A 1WOYA 4CM8B 4ZKDA 3OHSX 4MUIA 3FTQA 5T64A 5IXJA 1TG0A 1N6OA 1A5TA 2WJHA 1GUYA 4UC0A 5J59A 4A8HA 3C98A 4X1KB 1JEEA 1SULA 2BFEB 2JJ1A 1G7RA 2WZQA 2DHRA 3HCEA 3OLVA 4RYDA 1KH2A 1SG0A 3VV3A 2VHUA 4CIXA 1TQHA 4RKWA 4UQOA 1KZ4A 4J9VA 4UZEA 4GKAA 4G09A 4MWSA 3G49A 4KMOA 4HDAA 4F11A 2AQHA 1J09A 2BFEA 4QJBA 1SCIA 5FU6C 2I67A 2JFQA 4D41A 1AWWA 2IU6A 2WWHA 1Z13A 5CEEA 2WTUA 2CXXA 5JS7A 4ERNA 3C24A 3DZHA 2DBKA 2QQAA 1HT2E 2A35A 2H52A 3GW8A 4M37A 5A0FA 5JVDA 4GOKA 3ZWMA 5JAPA 3T9EA 3X44A 3S8EA 1KMMA 5DEOA 5HK0A 1KFEB 3V4FA 2G07A 2XUFA 4TWRA 4U7PB 1DQYA 3P2KA 3G6EQ 1HLFA 4ZGDB 1YBMA 5CH5A 3GPIA 1TGVA 5FOVA 3H1TA 2PCJA 4JGGA 1YV9A 2R6GA 4FR5A 4UXHA 2AC4A 2YH2A 4XIGS 3ZGVA 2XXAB 2P84A 1CTQA 2JDIA 3P2YA 1A9SA 4X00A 5HFAA 1X7HA 2R68A 5JNWA 3ELYA 3ILVA 2XITA 2CXNA 2GMWA 4GR5A 3GYBA 1LC0A 3FLMA 4HNAA 5FRMA 4K0RA 2FYKA 3E9CA 1E9BA 3QUAA 4HNQA 1MJNA 1V47A 1J0AA 1J3TA 3VH4A 4BNHA 5CXQA 5EJ6A 1GPKA 3CIFA 4A6DA 5ABPA 4QBKA 4HGOA 1AN9A 1SHGA 1JQBA 1RAAA 3OFND 2R9VA 1D8TA 4E5NA 2YMLA 2JJMA 3QX9A 2P6NA 4JFAA 2JLXA 4NFSA 2VC2B 4OQZA 5ICFA 2WD9A 4YP6A 3ZVKA 1IBKB 4RPGA 4X1IA 4YACA 4F85A 4GMDA 3G6EA 4EHBA 2W6CX 3CX8A 1SA0B 3TN7A 2FNAA 1DOHA 2JZOA 2OFOA 1IZ6A 1SVSA 3DEFA 1RZ3A 1X1RA 2H07A 3PDWA 2EFDB 4X63A 2ENUA 1D0YA 3WICA 1EFVA 5D7UA 1XZDA 4RVSA 4CDRA 1ZN7A 3IO3A 3NPMA 2IVWA 1YO6A 3AC0A 3JALA 2HI0A 1RJWA 5AK5A 4B7XA 2Y4OA 4KH1A 1YJWT 3I6MA 4L27A 1IZ9A 4UATA 4WZAB 1YK0A 3U3KA 4CETA 1YDEA 3MWFA 4MDEA 3WB9A 2Q7OE 4JLKA 4FM9A 1MDFA 3FKJA 5JD5A 1DEAA 1AKNA 3FMIA 4PX9A 4YPVA 4PHTA 1WETA 2YC4C 1KS2A 1TW2A 2YJGA 4IY1A 4D9EA 5AVZA 2ZSUA 4HVUA 4A27A 4BPBA 4MPPA 2YXBA 4B83A 3H5VA 3RUCA 4DV3B 1U5SA 3CMEQ 1SXGA 1V8ZA 1MAAA 3I4CA 4B3BA 3NAZA 3I6IA 2Z6AA 1JB0E 1JG1A 2HREA 2XGMA 4NZOA 4BO8A 1JHZA 2GK6A 4EG7A 2QUKA 1LTHR 4J8PA 1QYXA 1VMEA 4JBNA 3ANXA 4QTUB 3RWMB 3UG7A 1SQ5A 3FR7A 3LNTA 1JHPA 2PY6A 2J3IA 3AB3A 1SBQA 2HXYA 3PYXA 3VPGA 4BEJA 5EHZA 1P2DA 1FU7A 2PU7A 2RAPA 2RBEA 3GU3A 1J23A 4FGUA 5IH3A 4C30A 4CKYA 4DBLC 4DKJA 4XA8A 5C80A 2ALJA 5H1YA 3EA4A 2VK8A 3QHPA 2PS3A 3U31A 3UJBA 4Y9SA 4BLWA 3IALA 2AE1A 2PQMA 2XLBA 4FOTA 1ZCZA 3VDXA 5KIAA 4NCBA 4REQA 1MAUA 3TK1A 2M98A 3ECCA 4DWOA 4RUKA 1IO6A 5DV9A 5BWLA 4D0SA 5CB4F 4PGHA 1F8GA 3WKDA 2CL0X 1VIFA 5LBUA 3ZDRA 1S9HA 3OF3A 5FR1A 1M5TA 1RJGA 1C9DB 2CP2A 2DPYA 2NYRA 3IP9A 5EZYB 3GLIA 3GFOA 4R5HA 2ZRQA 1VLZA 1YACA 2BRUC 4JOBA 1LC3A 1WX1A 3T7IA 3TZLA 2LQ8A 2FUKA 2A5LA 2CUNA 2C3YA 1JJ2S 4CEIB 1UBCA 4AF7A 3RQIA 3WXMB 5A4AA 4KQXA 5IMSA 3NBYC 3VPFA 3ELDA 3W9SA 1BOOA 4PC2A 3DNMA 4YRZA 4UUMA 2XQKA 1SVIA 4D80A 4HH3C 2RK6A 3CV3A 1DKQA 1NBHA 3A1VA 4IIXA 1A2BA 3NETA 4XKJA 4B4OA 3X2EA 4DARA 1RJDA 4YNBA 1HH4A 1JFSA 1KYTA 2WG0A 2QGGA 3FCUB 3IDOA 1T5HX 4KLAA 2ZRAA 3FVTA 1I01A 4AF6A 4B6EA 1RI0A 5CKHA 1E61A 4A2PA 1KI1A 4QQGA 3EF1A 4K5QA 5IPFA 5GJBA 3Q9LA 4GZ5A 1LH0A 4R0NA 4C8QB 2A88A 4WKGA 2JM8A 1OTXA 2KWIA 1NW8A 2D1QA 4BLTA 1NKSA 2BM1A 1OWLA 4CHTA 1UAYA 1SZDA 2DL3A 4DDHA 3H1FA 1MB4A 2XVXA 3QVLA 4DIFA 3Q10A 4G8DA 3T5BA 2YASA 4PCLA 1ZPDA 4S12A 4IICA 4MW2A 4HT9A 3TE7A 4AQ7A 1KJ8A 5DK4A 3EGVA 1K8AC 5GM2A 2GLUA 3OA2A 5HMLA 2CZ6B 4OVAA 1Q3TA 2EU8A 1KL7A 2KQUA 1OYYA 4XOIA 4EFNA 1ODIA 1LF0A 3EC7A 2CK3D 5LD2C 3HHTB 1C9MA 4LVUA 5ADUS 2WMOB 1O2DA 1VQOQ 2GK3A 4BNUA 5JDCA 1J49A 5KC9A 4GBED 3KB2A 4RJLA 3FOZA 1ESCA 4OLFA 3WGOA 3DTYA 1IN7A 1I24A 3AQ4A 3H8VA 4KGVA 2ZRPA 4P3NA 4CMBA 5JMWA 3I09A 4NAVA 4C2AA 3PEYA 4HNUA 2W6IA 1Z5VA 4M4ZA 1FYEA 5FI3A 3WQQA 2O8BA 1RYYA 2NPIA 4XB6B 3UICA 4ENPA 1P4SA 4IOLA 2AF4C 4QELA 1B4DA 1X8KA 1X80B 4N5LA 2CC2A 4YP1A 3EXFB 2GPBA 1SD2A 5ITVA 1QIMA 1V76A 3NHMA 4RE6A 2VTBA 2PSFA 3WMGA 2VRCA 2RDMA 4FFBB 5JO0A 1N34B 1TS9A 1BFKA 5I7AA 2IHYA 1NXVA 1W1WA 2G8LA 2WSIA 4ZVKA 4WFKA 1KFBB 1W0KD 2XMCA 4KHZA 4D6WA 4DQXA 4CGYA 1U6KA 3G7NA 3GC6A 4YTEA 4BLRA 3O84A 5K8UA 4IQFA 4E1VA 5HKOA 2EFHB 3AEUA 3GOQA 1FJXA 3L7NA 2NGRA 3MFYA 1UEBA 1TEHA 1PK7A 3QELA 2VTKA 4MRVA 3V8VA 1EXDA 5JDIC 1Q82R 1D1CA 2RONA 1GBRA 5BSWA 2XPCA 4DV4B 3ROZA 4OI0A 1JU9A 1T6BY 2LRHA 4AJEA 2FVYA 2BN4A 3GOHA 4RMGA 4E94A 4G23A 4IOJA 3IS3A 5L6LB 2WT9A 3KQHA 4JASB 4LKRA 1RPAA 4IGFA 1ATIA 1IULA 2WHRA 4M1KA 3S0JA 4UUAA 1M6EX 4PAGA 4HVVA 2J0EA 3JYOA 2C8JA 3VDMA 4A0FA 2IYVA 4AG3A 1WX6A 2DD4A 3BXEA 3NHAA 3A4YA 2VV5A 1PT7A 1VIDA 2E5FA 3DVLA 2CDAA 3NBQA 3QF4A 4Y1RA 3V8LA 1RCTE 3EQ8A 1BMFD 1EG2A 4GECA 1D1SA 4MLDA 1FOEB 2LNDA 2O01E 2A1IA 2Q62A 3WGJA 4UQLA 3ZJVA 3BTOA 5LOVA 3LFTA 1MTZA 4TRJA 2HRDA 1CT9A 4HDSA 4ZO6A 3ZGNA 2PUGA 4OLJA 5FBLB 4DS3A 3QF4B 1QTRA 4NZPA 4B47A 2RHYA 1APBA 1KO1A 2GDJA 3IULA 4TMVA 3GA5A 4CCYA 4CR6A 1VLHA 2QENA 1I36A 4P4GA 2YRCA 3EGDB 1QO0D 4L95C 2F17A 5ALIA 1RLQC 3C1AA 5I9IA 1RTKA 2BFNA 2VYFA 2HDHA 4WNAA 2R6ZA 3IHWA 3UOGA 5KOJA 3MHTA 1Z56C 5LJ5g 5TPWB 5KI6A 1Z2PX 2I6TA 4GFDA 3TIVA 4ZO7A 4TL7A 1FMCA 2O0JA 2H1OA 2ZJ6A 5EXXA 4OM7A 2ZUSA 4L4XA 3VNQA 4BFZA 5DMHA 1TNDA 3CW2A 5CDFA 5ADWA 2PNIA 1K75A 2CZQA 2VUHB 2A08A 2K3BA 5GANf 5CJ2A 4IKFA 4QZVA 4YMLA 3ZJ4A 1N8NA 2ZT7A 4AJJA 1PKEA 1P4HA 4D2IA 3DE5X 3RTAA 5GQSA 1COWD 4E2YA 4I46A 1EK6A 4UHEA 4ARVA 1F8YA 1LV8A 2VP5A 2YUQA 1P29A 1M10A 1GCGA 2BEWA 4CKBA 1QQAA 4N8DA 1KJJA 2CLCX 1XTVA 1FFCA 1Z33A 3FVRA 2QIPA 4JR1A 1ZGHA 3Q15C 4IH4A 4JBHA 1SBZA 2XR1A 1RPJA 3H8JA 4C5GA 3L0OA 1UDRA 4MUGA 1VQNQ 1VYHA 3K0CC 5CCDA 5SZHB 3UENA 3WIVA 1GEGA 3DW1X 1NMQA 5ADVA 4MK4A 3B51X 4XH9B 5BPFA 1VRVA 2I34A 4LQLA 1DP4A 3TGLA 3MJCA 3W3ZB 1PJ2A 2IPOB 3JQQA 3D6VA 1RMQA 1T9ZA 4UNQA 1PQYA 4QPZA 4IP0A 4C2TA 1CRQA 3IDSA 4LOLA 1R8OB 3CTMA 4PRKA 3W5UA 3FHTA 1U0GA 3GR6A 2IBTA 1QE5A 1O97C 2ACEA 2CVOA 1LGYA 2ILVA 1I0CA 3ON5A 4TS4A 3GXBA 3F5DA 2X15A 4UM8B 4E2FA 1EUCB 4AN1A 2HRCA 2OTJT 2OO3A 4RZ2A 4TLDA 1Z47A 4AMYA 1MD9A 1SSFA 1J99A 2AK3A 4I50F 4NX2A 4XTWA 3DTNA 4G67A 4NNJA 4TS3A 2HCFA 1JQEA 1SVOA 3DGEC 1YI2A 2WLTA 4JDUA 4P86A 1NFRA 3PC3A 1OI3A 4FZRA 4LTDA 3ZWVA 1KVTA 1II9A 2FJUA 1Z3IX 3MWYW 4DSAA 4FLEA 4OMFB 2EFGA 1A7KA 4JS0A 3WA7A 4ZVVA 4RDCA 5KWIA 3E19A 1KH3A 2B2XA 2Y99A 3VR5A 3W78A 1VQ7Q 1N9GA 4RORA 4ZDIA 3HJCA 4MMXB 4MZPA 3AGPA 3I42A 2PK3A 2WVGA 1VQMT 2G0TA 2R58A 3O4GA 4Q3AA 4B6SA 2DUUA 1HF3A 1LZKA 5A9SA 4EY8A 5I48A 2G1PA 1YN8A 4TS1A 5ERGB 3F1LA 1E0KA 2C7BA 3JCMV 3QYFA 3ROMA 1EP9A 1HKHA 1EDOA 4KQ9A 2MYUA 1CZHA 1IE3A 1EA5A 1MIOA 1NM5C 1W25A 1XI2A 2GJ8A 3VRZA 3S3OA 2H8KA 4LDXA 1ULAA 3EPRA 3PQ5A 2A5GA 4PBRA 4F16A 1SN7A 3GQBA 3N5KA 1YRAA 5CLLA 2A0WA 2I4LA 3K6JA 5GAMd 3PS9A 1DDOA 3FDZA 2V0CA 1ZGZA 1YB4A 1Z0JA 2J9XB 2A9OA 2PMBA 3BWCA 2ZJ3A 1U0LA 4RPCA 4EW6A 1VSUA 2BF7A 2QS9A 1N77A 3DMRA 3TWOA 3K5IA 2QW8A 5A0LA 1AUOA 3OQVA 3QIVA 5CA1B 3MO8A 1WDTA 5J1SB 4WBSA 3DWEX 3IV9A 1H3NA 3GQBB 5E9JA 5TXGA 2TMKA 3UWMA 4RM3A 4POOA 1J20A 3Q1JA 1NV9A 5IWAB 2IHNA 5BN3B 4KV7A 2JATA 3STHA 2QG6A 2IW1A 5IAKA 5EJIA 3RFVA 1ODCA 1XC7A 2F43B 4C04A 4YRBA 4K6MA 1EIFA 4R69A 1T3ZA 5C1BA 2FPKA 3AUKA 3DDNA 3D6HA 4LDQA 5JDCC 1A4RA 3S2IA 2WJZB 1QRUA 4BACA 3FCAA 4ZU6X 2HU8A 3ETNA 2IGTA 3KXKA 2FFHA 5EGNA 4GX1A 3WK8A 3W4JA 4LIPD 4R3WA 1BE8A 2D2XA 1F14A 3KWFA 3LK7A 4COOA 3GRUA 1O9GA 4C5EA 1JJBA 2PUHA 2VBCA 3JQ7B 2P9GA 4KX5A 5MN6A 4D7AA 1KJQA 3BRWD 3KOYA 2GJ4A 2GOYA 4OMFG 2FY8A 2VG8A 3GJXC 1JEAA 1VKHA 2WINI 1Y8RA 3C8UA 3LPDA 2XWBF 4CM6A 4N5HX 3GFVA 4X71A 3QQPA 4KI7A 3BEOA 5EMHA 2IP1A 1P2FA 2A67A 2D3TA 3GPBA 4EYKA 4WJLA 1C8LA 1EE1A 2QA4A 1AXGA 3G82C 3FCSB 3S29A 1I2MA 2O0LA 1YHZA 1EMDA 3T7KA 1U1EA 2A1UB 1ZGAA 2ERCA 3VYVA 2O5EA 5EFOA 2KY9A 2Q07A 3H5NA 5ITZB 3UTDA 1ORDA 1SUDA 1W4CA 1R6VA 1BSVA 4M1YA 3RYIA 1YWOA 2OZLA 3D2AA 4NVRA 1AURA 4NJEA 3ZWPA 2JBHA 4DCMA 4AXXA 1PR3A 1WHGA 1EYZA 1H3ZA 2WMYA 3H41A 5T4FA 1FVXA 5K09A 2LT1A 1DINA 1N5KA 1U4OA 2JZ2A 4LGVA 3OIFA 3W6ZA 1F8XA 1AZTA 1PLJA 2QQBA 2C4TA 2VWQA 3MWDA 1VRCA 4GLFA 1T43A 2GEBA 5FYDA 2IXBA 5LMCA 1JLLA 4GOND 3U6BA 4GP9A 4DR4B 3H2BA 3DS8A 1A9OA 3ZZ0A 4ALLA 5FWNA 3VKIA 1N6PA 2AG1A 4OV6B 3IUYA 3AHEA 4U39A 5EOVA 5LC1A 1TIBA 1ELOA 3UF0A 4CLXA 4F6RB 2EXXA 3GZNA 1G42A 2EGEA 2PKQO 3NS7A 4Q4LA 4XARA 4F7DA 2JLZA 3D43A 5C46F 1XCJA 1ESNA 3I9QA 2NNLD 2VF5X 2Y71A 3DWIA 3FY4A 1ZUUA 3ITNA 1DDIA 5AI0A 2DYKA 2GQ0A 2Z58A 4Y2HA 3PJEA 3JQ9C 5AVXA 1QRTA 3R4CA 3USCS 1QHIA 1P6UA 2VXFA 1VCNA 1Z7BA 2CF5A 2PUJA 3KLOA 3GJ4A 3M33A 4ZJYA 1LDNA 5CVTA 2FW9A 3M0PA 3DOOA 1MV5A 2VNAA 3O8RA 2ZR0A 4J75A 1AGYA 4OOEA 4HAWA 3SP1A 1YTLA 4BV9A 1W73A 1XMPA 1P4GA 4LYGA 2RHMA 5FQNA 5JNSA 2YDYA 3AG6A 4AMVA 3TZKA 1ZSZC 2UYHA 2OBNA 4GLMA 2C5SA 3EWIA 4RTSA 2B0JA 3NBMA 4TMXA 4EPYA 2W2NA 4B7UA 5JAUA 4PHGA 1F7UA 3HJRA 4Y30A 1QQJA 1HEIA 3GEBA 2R8EA 1ZY2A 3C4QA 3HCRA 5DTQA 3RKXA 1P9OA 1PTKA 2R4QA 3RVPA 5K6AC 3AI3A 2EX1A 3IL2A 1NVAA 1V1RA 4B76A 4RJ2A 3RV4A 3FMPB 5DLOA 2VRWA 4ITVA 1TD1A 3FZNA 1U5AA 2HO4A 1UUEA 1MHPA 3DBRB 1R16A 3GWGA 4O3MA 5A0VA 3E3AA 5TMDA 5C35A 1KWGA 2WQ6A 3ZQ4A 1QHGA 1JDVA 4QJ5A 1HDOA 1AQYA 4KBFA 5F78A 5GONB 2D1TA 1XTJA 1YIJA 3HS3A 1KKUA 3EH1A 3BXOA 2QX7A 3HXQA 1Z08A 3M81A 4U63A 2OSVA 3JQAA 2AVDA 1UJCA 3ANNA 1A77A 4K9OA 1EWYA 2IKQA 3LT1A 3LZDA 5I9BA 1QGOA 4QLBA 5B7NA 4UVHA 3T5AA 4B3TB 4L6IA 1GG2A 3CW8X 2OHGA 2V0GA 1TLLA 1BJRE 4C3UA 1FQKA 1M1YA 4Z1MA 5LQNA 1ZLYA 3CCMT 3Q3CA 3KUDA 2G83A 2F3SA 3ETGA 3KYIB 4KTVE 4LI0A 1XHLA 2CW5A 3HKBB 4LVCA 4QYIA 3TVDA 4EHLA 1D1BA 3CCMQ 5CD1A 2FPDA 3LGFA 3BJIC 1PTJA 3GVIA 3HBJA 3KQKA 4PSUA 4FLMA 1R2QA 4R9SA 4EUEA 1BX3A 1GQRA 1M8FA 2P3SA 1RRVA 2XNDA 2XUJA 3CT6A 4Y2UA 4RV5A 5DT2A 5A5FA 2APJA 2W8BA 4X8MA 2QE7D 4QTTB 3M0SA 1FB5A 3EEQA 2CH4A 4FIZA 4IEEA 2UXDB 3MJ4A 4FLFA 1Y3IA 1P33A 1M5RA 1NI3A 1K3FA 2BVNA 3L4SO 5EE1A 3X2FA 2PGIA 3ZXXA 4TT3A 4E2WA 1YTUA 3UMRA 3CE6A 16PKA 2EQAA 4NL2A 2AHJB 2GPWA 2C5AA 2WOJA 3QW4B 4FINA 4PBTA 4RY0A 4BUZA 4ZHSA 3GGSA 2F2TA 4RDXA 4C92C 2J3MA 1WULS 3FTNA 4HA8A 4ZT2A 1NPPA 1UXJA 2WM3A 2W2PA 1FMVA 2LJ3A 1GKIA 2YIDA 3H9NA 2O7RA 2X8BA 4H16A 5JYCA 3FKSA 5AI5A 4D4MA 2XZOA 1F0PA 1O1YA 3NB0A 4AO8A 2HIMA 1RXYA 1YA8A 4JT2A 3S5JA 3WY9A 2R48A 4KNWA 5JXHA 2OV2A 5EUQB 2RI0A 2JBAB 4H7FA 1RQRA 3THOA 1ECBA 5L51A 1SKBA 2O7QA 1XRQA 2PJRA 1RADA 1O03A 3HZZA 4J0KA 2OD9A 4A2QA 3BHMA 1R3UA 1YD7A 4PC1A 1U8CB 3H2KA 4QOGA 4RZSA 4WESB 4GP6A 3S28A 1BIAA 1G5PA 3EDMA 3V4OA 4CKZA 1K0UA 5JWOA 4V3BA 3V33A 4OG2A 3DD1A 2FRXA 3V55A 2BFDB 3ZHVA 3IJPA 1XLTC 1T36A 5T5QA 5COQA 4OB6A 1EXNA 4W5RA 4J0FA 3CR8A 5K3OA 1C0IA 1SCJA 2L82A 3QVMA 3NXKA 5E2AA 3VU3A 3LJKA 4KPYA 4A4GA 4J03A 4JELA 2QYZA 1S8NA 3OZGA 4AJ1A 2V0NA 3H8SA 1U2DA 2F1IA 1PSZA 3OS5A 3V6MA 4B84A 4PYKA 1TVKA 3WDSA 2P9YA 1N2XA 3JARB 3SLKA 4KQFA 3ZHUA 1KJIA 2YV5A 4J7AA 1QYVA 1WF3A 2P2ZA 3I2FA 5JZBA 5EJ8A 3C2QA 4NI5A 2JFYA 4JWTA 1I33A 1LRLA 4N4HA 2BZYA 1QVFS 1K3TA 3TR0A 2FSGA 2QUZA 3EZ2A 1G8FA 4I1UA 5EUMA 3RS5A 2YJ4A 4BX9A 1ZBJA 1CC1S 3C14C 2DL8A 3HYRA 5GVSA 2VLIA 4P7KA 2FN9A 2CY0A 3CCQA 1T4MA 2WT8A 3BJRA 1QVFA 2I2BA 1G6Q1 4S1OA 3CH5A 1PV4A 1HMPA 3MJFA 4FFVA 3D4IA 4O63O 2J5BA 4KW7A 4MP6A 4RK4A 1XRLA 3HG7A 1NGSA 1NBWB 5ALOA 4IM7A 4ALMA 4DT1B 2FN7A 2AX4A 3FH0A 2P9BA 3GLUA 3I8OA 3G68A 2ZAOA 3K9CA 3U56A 3NTLA 4QUJA 1WDXA 1D0ZA 1M90R 3CLKA 1OX4A 3EG9A 3COPA 4LC9A 1T0IA 5GANd 2Z0WA 4EMGA 2C04A 3H4MA 4EMKB 1I1QB 3H11A 3HA3A 4QBTA 5HF8A 5I9SA 2H1LA 5BV1A 4D8VA 5I4CA 3GNLA 2WTXA 1NC3A 3A6JA 1E7OA 3PQ6A 3J81k 2PQWA 9LDTA 3D02A 4W5OA 3TM4A 2ZVDA 2W8BB 4PZEA 5GMKh 4O4LF 4NOKA 5AW7A 1LNQA 3ZWWA 1JPJA 2A28A 2KQWA 2G5CA 1KARA 2GJSA 2H65A 2IUTA 3JD3A 4LEIA 3ES9A 5JPCA 1YI2T 3CVUA 3SWNB 5IXYA 1FW6A 4WY2A 2XT6A 2AEFA 4FR2A 4KXXA 2ON6A 3KVYA 3LH5A 1P18A 3AKCA 3AUTA 4YIHA 4XQ3A 1BS9A 1OA1A 1ZX1A 3MWKA 1KJZA 3REQB 1DTSA 4RY2A 1EEXB 1NR7A 4OB0B 2JFGA 4TSKA 2AZMA 3GVXA 3EW7A 2FOIA 2GA9A 2QQSA 2RAUA 4OQLA 5BR8B 4IW3B 4N18A 4Q7QA 2FRWA 1YITQ 3VSBA 2VSXA 3VO8A 2QM7A 3G3EA 1LSJA 3I45A 1EVEA 5HCUA 2FCAA 5K0BA 4FDTA 2YZGA 3OFKA 3AY7A 1K6EA 1U8TA 1V4VA 2CE7A 3G79A 1VSBA 2X14A 3WG9A 3OW2P 1P6XA 1XTBA 3GCXA 5E1BA 5DB4A 3W2HA 3A4VA 2JGJA 2FUEA 3MPOA 1V8BA 5G3YA 3NUGA 2AW3A 4IINA 5JCPA 2I8LA 3BUSA 1NMXA 1GXSA 2IYOA 4QXQA 2PZEA 3HLTA 1IY9A 1NWHA 3TINA 1CNFA 4IV5A 1KJWA 1AZLA 2O2XA 4PSCA 4RVGA 4XX0B 4LCJA 2FEKA 4JBLA 3IA2A 4LRQA 2I78A 1QCZA 3PV0A 3FSRA 3RYHA 2VQSA 1CUEA 2JJYA 3LPAA 1KDYA 1GTSA 2OHJA 2F55A 1HOTA 2WV9A 4JBYA 4TMWA 4DXAA 1QUFA 1FMJA 3VPBA 2QTGA 3ERCA 2OXEA 2HC9A 3UJ8A 4G1CA 2EVRA 1YJNT 2PIAA 1AT1A 1LK0A 2NTEA 2QGNA 2V8OA 2G1UA 3MAJA 1T9BA 4EQ6A 4B4KA 1S3FA 2MMPA 1OT5A 3VH3A 1VQOT 1QRDA 4K11A 2A7QA 1WCYA 1ZVMA 2ZSHA 4H7HA 4CNQA 2FPFA 2J5XA 4EF5A 3KAQA 4PYNA 3N2KB 5EHXA 3OTOB 5JLAA 3Q9NA 1NNUA 1WJRA 5IVIA 5ALNA 1KPGA 1PW5A 2VJKA 3FCYA 2XF8A 1D1PA 2YV2A 4TOIA 3FAZA 4XQCA 3LY7A 4Y1EA 4CDNA 1CG6A 3CUSA 1HTBA 3GCZA 4M75G 4XYEA 5BMOA 5JAHA 1T6YA 2VJLA 4IXTA 5AK6A 4LHYA 2GHIA 4AKGA 4YR9A 2QYTA 2HQOA 3U7QB 1XYGA 4QOJA 3G0OA 2H5EA 4BB6A 1L7MA