3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
molecule keywords Disks large homolog 1
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
2EW3A 5JCPA 2BM0A 2EWWA 1IN4A 1PNJA 1HYQA 1HY3A 4XVUA 1U3OA 3KXLA 1SKYE 3RC3A 2XJ4A 4PC2A 3H4MA 1U98A 1ZSGA 4V0MA 1ZW6A 1G41A 1KY3A 4BUJA 1ZM7A 1Z0JA 2QE7A 1FTSA 2V4ZA 3WMGA 3KDSE 3GEEA 2O88A 2C9CA 3HR7A 1W36D 1F3OA 2BZYA 4FN5A 4E6RA 3U6BA 3SNHA 2KYMA 1DTSA 3TAUA 4GMDA 3H0FA 1NLPC 2H7VA 2GTJA 2XOKA 2C98A 2I4IA 4N3NA 4NYIQ 1OF1A 2V7QD 3F8TA 4S35A 3QEOA 3NVAA 2FGKA 4JZ3A 1DAGA 1ZBDA 5CK5A 5KPDA 2VYFA 3MWYW 2P2LA 1E2IA 1SVKA 4OMPA 3EZ7A 4YDSA 3QBTA 2V1QA 3X1DA 4DVGA 4RD6A 2Z83A 4HZIA 5L3SB 5FPSA 1UKEA 4HYYA 4JLVA 1E0JA 4ORZA 1SHKA 2RQRA 2J7PD 3O8CA 1KSFX 2FPKA 1NLFA 4XVQA 2TMKA 1I2MA 1MO6A 2OBLA 3R9IA 5DISB 1G6OA 2ZEJA 3PQCA 5JECA 1EK0A 1NKTA 1NN1A 1UECA 4RZ2A 5IXBA 1T6NA 3UG6A 4IDOA 1DE0A 1F2UB 2QBYA 2PEYA 1SVWA 3IIJA 4DIEA 3QKUA 1XMIA 3A4NA 1II8A 2RGNC 2YUPA 3GEHA 2ODWA 4E03A 2J9RA 4PPFA 2GESA 2OCPA 4QGHA 1ZBJA 3CF6R 2KXCA 3LRPA 2X1VA 1G5RA 1HH4A 4O2LA 4TMVA 2FO0A 1E9DA 4TL7A 5BN4A 4DLZA 2BJVA 1A1VA 3QXHA 1P3JA 2WKPA 2DY1A 1E69A 1ZYUA 2OAP1 2VPPA 3NWJA 1KIKA 1CKBA 4I1UA 1ZX6A 5K8TA 4OHYA 1D9ZA 1UKZA 1WYXA 2RNAA 4JPBW 2D3WA 2AHOA 2QMOA 1BOFA 5B57C 1FPMA 1XJ0A 3OIVA 1RJ9A 4LSGA 3B1VA 3TVTA 2F1JA 2NOAA 4LC0A 1HUQA 3QE0A 4UXJA 2CVFA 2B7BA 2FPLA 1T91A 2FSIA 1ZMXA 2ZRCA 1XD2B 2NG1A 3K09A 4ABYA 4DDUA 2ZRAA 2C0OA 2HCKA 1GNRA 5KSPA 4JT4A 1GILA 3DM5A 3JVUA 2YWGA 4CT4B 3QSYA 2JW4A 4M2LA 3U4QB 5F98A 3TGPA 1QHXA 2ZI7A 4M53A 3MUFA 2A36A 2GTOA 2YOFA 2MMGA 3H84A 5DI9A 2IUSA 1AD5A 1GUAA 4HZUA 4OK3A 3H41A 2F1RA 2MSEB 4RTTA 4DCNA 3T5GA 2EGAA 1ZU5A 1FUKA 4ZPXA 4ARZB 4WVFA 3CR7A 3M4YA 3M0EA 2W6JA 4KVAA 3LLMA 2JJ8A 3H1TA 1NI3A 4GZMA 4PSAA 2RF0A 2PMKA 3BFXA 2DX1A 4RVCA 2Y8EA 2GETA 4D8KA 4A8JA 5DI3A 4CC2A 1CP2A 5UKDA 2ZRLA 3HYRA 2EKHA 1JPJA 1KO8A 3ONWA 4G0NA 1E1RA 2CDNA 1CR1A 2K79A 2PNIA 4CC4B 1GDDA 2PH1A 2E9SA 4AFSC 3AVTA 4BECA 2DWQA 1RRFA 1E2EA 4DEXA 1KSHA 1XD8A 1P4SA 4ACAA 1A4RA 1NP6A 1FMKA 2BCJQ 1OXSC 1L2TA 2Q3FA 1YJ5A 3KTAA 5JZVA 2QSYA 3W6OA 1D2MA 1U90A 3V4RA 4ZCMA 1F48A 3CNOA 3I5RA 4K46A 1P72A 3AF3A 3KQHA 3VTKA 2FFQA 2ERXA 5FTJA 5M04A 1SVMA 1XXHB 2WTUA 4ZDJA 3W6PA 1HTWA 4BZQA 1S0UA 3B2EA 3T1QA 4QNMA 2GRJA 4UXIA 3O47A 4BE7B 4TYNA 5EXXA 1VYVA 2C03A 1E6CA 1A0NB 1SVSA 1UDXA 3P27A 2NWMA 1FTNA 1F2TA 2CNWD 4MH0R 2KRMA 3IQWA 1Q3HA 2C96A 4OK5A 5GVSA 3SZRA 3T35A 1BBZA 2GJ9A 4OQNA 1HV8A 1U8AA 3K0CA 4URYR 1IY0A 3TVDA 4EPXA 4EPVA 2F6RA 2JLWA 2KT8A 3I62A 2A5FA 5FPHA 4Q03A 4B75A 1NG2A 4B3DA 4H1VA 2BIFA 2CT4A 4ZIRB 3CZPA 1H8ED 1Z6YA 2H1LA 3GJ4A 2ZR0A 1HE8B 1IOZA 4B33A 1OV3A 2HYIC 2NPIA 2OCBA 1W4BA 1E32A 2YC4C 1S9DA 3GJ0A 3PUWA 4CF7A 4HDOB 2IHYA 1S9HA 3ZL7C 4Q1CA 4Q7KA 4X8LA 4B3BA 1TF2A 2WJIA 3QJYA 4RTWA 2VSXA 2RQTA 1OXTA 4MUBA 3OEHD 2ZE8A 4P4SB 2RMKA 1NSFA 2H8HA 1IN7A 4AI6A 4V0OA 4A8JB 3BOSA 4BLPA 2HXSA 1XP8A 3WMFA 4ZI2A 1I4TD 1WX6A 4PPQA 1RI9A 4Y0AA 5HZHA 1PZNA 4KRTA 1XD2A 4Q9HA 4FMBB 1G83A 1ETUA 4JKIA 1ZC3A 3RRYA 3VS6A 1NJFA 1Q1QA 1U9IC 4TMTA 1ZUYA 2AKLA 3CNLA 4WBSA 3FFAA 2OILA 3AP3A 1G20E 4MYCA 2ENMA 4JZ4A 2N1BA 2PLRA 2XSZA 3FKSA 4GDFA 4YONB 4EAQA 2RMOA 1H65A 2JLVA 2DBYA 2ZRNA 1W0KD 3W3AA 2V6IA 3B1WA 2JM8A 3NIBA 4GT1A 4B71A 4HUQB 3I5XA 2VSOA 4IVRA 4NCKA 1GG2A 4TN1A 1G8HA 2HCJB 3EAQA 5B58C 1SVIA 2A78A 1JO8A 1JJ7A 4TSFA 5JJKA 5E7MA 4L8GA 4KSCA 2D06A 2NO6A 1YHNA 3ICEA 2C5LA 2C04A 3B9QA 4JS0A 4KFSA 2ORIA 3RS3A 1J3TA 1N6IA 3LBIA 3NEYA 4IFBA 4P4UA 1OPLA 5AR1A 4QGGA 2QMHA 1J8MF 4F16A 2MIOA 4XH9B 3UPUA 1IJFA 3K9GA 5TY0A 1ZU4A 1D6JA 1YR9A 2CT3A 3ZGXA 4RTXA 4NP6A 2QDLA 3A1WA 2JJ1A 4C0LA 4DLTA 1QDEA 5JEDA 4QGAA 2ZAOA 1T0JA 1EFCA 1KAOA 3QNUA 1IM2A 4AFQC 4HLQB 4US2R 3FTQA 1GSIA 3AEZA 4MKFA 1MUZA 4PO8A 4XJXA 1Y3AA 5KPJA 4Y0VA 2J46A 2IK8A 1Y57A 1AWJA 2CSQA 4ESRA 2C99A 2OCAA 5LB4A 3SBEA 3GLFE 1M7GA 4ZO4A 4K8OA 1E2QA 2DL8A 3V9PA 4AG2C 4AKEA 2JEOA 3L2OB 3VRYA 1KI6A 3GLGA 2KE9A 3TR0A 1DG1G 3K9NA 2CNWA 1G5PA 2R6GA 3AF0A 3WBJA 2QG6A 4EJSA 3DKPA 2X8AA 1N6HA 3VKWA 3EIEA 4ZV4A 1XD9A 2Q0HA 4FI3C 3KXKA 4BLOA 1YKSA 1NBMA 1WF3A 2ASEA 2BBSA 3LW7A 1KFZA 3K0AA 4FCVA 4HSEA 1Z6GA 4ACBA 1JAHA 3SJZA 1W48A 2QGNA 5DNYB 4D81A 1NBMD 3ZIAA 2IEZA 4LBZA 1KI8A 2L3QA 3MLEA 4J9CA 1TEVA 4I4LA 4ZKDA 4PSVA 3C41J 2LCSA 1WBBA 3JZMA 3R8FA 2ZSEA 3I5YA 1Q57A 4Q7LA 3D6TB 3V00A 3ZZ0A 3QWXX 2YYZA 2KR3A 2IYSA 5TV2A 2IUTA 4D6PA 4B74A 1UJYA 4JVSB 4OMNA 821PA 2OBNA 2R8RA 1VHLA 4EPYA 2FF7A 3QENA 1UF9A 5IXFA 2Q21A 2R6AA 2IXGA 1C9KA 1IN5A 2RPNA 1GVNB 4Q4LA 1NL3A 2V54A 3KKQA 2AKKA 3R9WA 2A30A 5L23A 1N0VC 4EPWA 3AVXA 1Z83A 4D25A 3T61A 2QM7A 3RS0A 4QNRA 1I4DD 1KO4A 2M51A 4M22A 4IOLA 4C7OB 4JVNA 4NYMQ 5IRCD 4HZUB 2NO9A 2CE2X 3AVUA 1UFQA 2XNDD 4QBHA 2FSGA 2D62A 1PUIA 2UKDA 1PLLA 1VPLA 4MKGA 4PC7A 2ZE5A 2A5DA 2J5XA 1U9IA 3LXXA 2QAGC 2D8JA 2OG2A 4EJSC 3NH6A 2A37A 3EC2A 1LS1A 4C0SA 2DR3A 1S4QA 1R0YA 2X3XD 1MABA 1XMVA 2CL0X 3NH9A 3K70C 2RAPA 3KB2A 3MGCA 3MFYA 1NLOC 5P21A 4UNPA 1DAEA 3KKNA 4C3ZA 3IO5A 5H70A 2XSZD 1X8LA 5HKKD 4YQFA 1YR7A 3WRXC 1OOTA 2CUDA 2J06A 5BYKA 1JB1A 1SULA 5JEEA 4R7ZA 2R62A 4F91B 1VCOA 2DCUA 1XTQA 4J9BA 1DEKA 1P6XA 1JR3E 1CXZA 1K8RA 2J1LA 3HR8A 2IS6A 3EW9A 1Z9QA 4TTQA 3L0OA 1DAHA 4KYUA 3AVPA 2X3WD 1AZEA 3ZD7A 1G291 3D31A 1ABQA 4URZR 4Q1BA 4XTRA 1T8TA 1XDBA 4PC6A 4OHXA 2CDTA 2ED1A 2CLSA 4JLBA 3FYHA 4TLAA 5C4GB 1IONA 2CHQA 3IHLA 2WHXA 2BEJA 5SZKB 5EE1A 1EX6A 1OFUX 3EA5A 5E3HA 1SPKA 4R71A 1X6GA 3THYB 2ZANA 2WWWA 1MO5A 1UDWA 4TZ6A 1W2HA 1TPZA 1E6GA 3Q5EA 3ZH9B 4DUGA 1QWFA 1YCSB 2HF8A 3K53A 3PUYA 3VMFA 2W83A 4U02A 4A0FA 2QZ4A 1JJVA 4OQMA 5EXPA 4D4MA 3GLFB 4HXJA 3CRW1 2XTNA 4RCYA 4Q4HB 4UQOA 3SR0A 4RKEA 1SHGA 1RJ9B 4HAWA 4DSNA 2PT7A 3ZQ6A 2XZOA 1AZTA 3A1TA 2V9PA 2D7DA 1F2TB 1R6BX 1KAGA 1FFHA 3OESA 4Q9LA 4Q18A 4OL0A 5FUWA 4BFXA 4TYWA 1ZUKA 3PIRA 2DF6A 3K0FA 1OHHD 2DLPA 4Q4AB 1AVZC 2FPMA 4URUR 1NMZA 5HPYB 3SQXA 2WKQA 4X8MA 1VECA 4JJKA 3R6NA 2QROA 3RANA 2XX3A 3IBGA 1U0LA 3R20A 5FFMA 5JRJA 1WIEA 4BLTA 4AKGA 3WXMA 4QFMA 4Q47A 3AP1A 4F4JA 2VBCA 2YUOA 2D2EA 1TU3A 4M1OA 4A0RA 1Z5ZA 2QMEA 1W36C 1K0SA 2WWHA 3QEJA 4DT1A 1MO3A 4D4KA 3J81k 2JASA 3M0QA 4XD7D 2ZI9A 3U7HB 3GLGE 4HB3A 1XBTA 1OYWA 3CZQA 3A4MA 1FUUA 2PX0A 2ECKA 1U99A 4O0MA 3L43A 4BASA 1TTTA 3Q85A 4EIKA 4ZNXA 2QPTA 2ZYVX 3CWZA 4I1OA 4R98A 5EZ5A 4EQ6B 3EZFA 2DB3A 2WJHA 1QKXA 1Z0DA 4JSYA 2HJVA 3AVWA 5KTYA 1G19A 8OHMA 1YZNA 1SHFA 4KU4A 3U3RA 2FFBA 2IHBA 1N25A 4CC3A 3H0KA 3CQTA 1VG9B 2DPXA 5JS7A 2ZI6A 5AUQA 2QQEA 1HA3A 3CRMA 3S1AA 2WAYA 3CB4A 5LDDC 2OAQ1 2ZM5A 2AN9A 2RGXA 3BERA 4PHHA 3NHNA 1RPZA 2F9MA 4GNKA 1MO4A 1CJMA 2QAGA 2JMAA 4DRZA 4TLCA 1NG9A 1AWOA 3MD0A 4V0ME 2E5KA 5JLJA 2GXQA 3BFVA 1AA9A 2DBKA 1C1YA 2JATA 4Q1EA 2OV2A 4PTLA 3OE7A 3LO5A 3NG1A 2W6JD 3VR3A 5CB8A 2LJ3A 4G01B 1Y0MA 4J0QA 2BMJA 2ZIAA 4JLKA 2O8BB 1DOAA 1KI2A 1XTRA 3CF0A 1GKUB 1NVVR 4HI0E 3LWNA 3EWAA 3QUSA 3GLHE 4GSYA 1F2UA 1NEBA 1KHTA 1P9WA 1T9HA 2KJQA 3Q5DA 4KODA 4LI0A 3RSLA 4BEJA 4AYTA 4BQSA 1UBGA 3QKSA 2W00A 1JR6A 1PVOA 3M1IA 4QBFA 1AGRA 1GNPA 1T0HB 2LP5A 1T0JB 2IX3A 5TARA 1G3RA 3AGQA 4ZDWA 1UJ0A 4AWXA 5JMTA 3GJ6A 1G8GA 1HJDA 1LNZA 5HZKA 2CCGA 3IHWA 4HUQA 3F5FA 5ELXA 4KLNA 3W90A 3ZZUA 1Q12A 721PA 5IT5A 3CRQA 2VTKA 5TB5A 5J4YA 4Z1MA 3I4LA 5LB2A 4QBGB 4FIDA 3DPUA 4XD7A 4B32A 1G7CA 1XCMA 3K70B 4V0LA 3HPRA 1E2PA 2ZSBA 2QPAA 4Z89A 2YOGA 5CJ2A 5DIFA 3WRYC 1M27C 3I9QA 3HU1A 1SXJA 2SEMA 4KV9A 4LHXA 3LH5A 1RZ3A 2LJ1A 2QRNA 4GOXA 4NH0A 2YHSA 3PUXA 3G0HA 2ZYWX 1M6NA 3VR5A 3QOFA 4H1UA 1KO7A 4XWAA 1XTIA 1X3SA 2O0JA 2IT1A 3GJ5A 1K4US 2RGGA 1AQUA 3CIOA 1B3QA 4LJ8A 1M8PA 1Z0FA 3B85A 3CW2A 1TMKA 2GNCA 4P4SA 2ZU0C 4PSKA 1GAJA 2G3YA 1JAIA 1Z6TA 3HPQA 1CR0A 1AS3A 1CRQA 3T06B 3VS3A 2C2HA 4M9SA 1JQQA 4CRWB 3THWA 1JBKA 3X1WA 2AXNA 4D26A 3B7GA 1OIXA 2F2VA 4HB4A 3KKPA 3VS7A 4OKSA 1NBME 2WPDD 4L9WA 4JLAA 1RRPA 4Q1AA 5D3MB 2QN6A 1R7RA 2KI5A 2BKUA 4MGIR 4MDFA 1P5ZB 2JMCA 2G0TA 3BORA 3K1JA 1QRAA 4EJSB 4DDWA 3U7FB 3LX8A 1SVOA 2FFHA 2IYRA 5EUMA 2GXAA 1MV0B 1A2KC 4C7OA 3PXGA 1CRPA 1UKVY 1FZQA 4Q4JB 4CC7A 2BKEA 2GVZC 1AZSC 1LW7A 2WJGA 1Q21A 4IHQA 4RKFA 2IYLD 2O2OA 3RABA 4A9AA 2MOXA 3VQTA 3QBVA 5KNCA 2Z4RA 4A2WA 3FMPB 3HWSA 3THOA 4PO1A 1RRCA 2P65A 4BGDA 2DFKB 4B3CA 2C95A 3IO3A 5CIQA 3EC1A 1P73A 3FJ5A 2J0SA 1U8YA 5FTNA 1JXMA 2LJ0A 1E9FA 2GA8A 4P0TA 3UMFA 1OT3A 4MA4A 1PRMC 1OH7A 4DLYA 4CEIB 2FFAA 2O8FB 2YZ2A 2Q9AA 2AK5A 1A7JA 5JHGB 5KYKA 1S8FA 3UIEA 2AKAB 1PJRA 2A3RA 4HDQB 5FPYA 3HYTA 2IS4A 1YP5A 4P3YA 1R2QA 5G41A 5TDHA 1LS6A 3W34A 2WIBA 5JI3E 2IS1A 2EFCB 3CX6A 3JVVA 5JWHA 5JJLA 2IXFA 3EASA 2CCKA 3CRRA 3TMKA 4Q1FA 4WA7A 1GCPA 3DMNA 1W6XA 4QRHA 1QBKC 1AWXA 4K11A 3PCRB 3TR5A 3B1ZA 5FI1B 4F4IA 2ZITA 4TYYA 1E9EA 1YR8A 1OE0A 4KSBA 4RD2A 4B47A 4DEYA 1W44A 1TQ2A 1KMHA 3FFBA 3THXA 4X8HA 1SVLA 1GL9B 3QKTA 4BPBA 3VRZA 2JLZA 2FH5B 1AS2A 3SYKA 5CB6A 2WBLC 1VG8A 3MG9A 1Z6XA 4LBWA 4QHTA 4TTPA 2FN4A 2H17A 4FCWA 3GLIB 3CPEA 4OHVA 3RS2A 5FTLA 2JS0A 1KSGA 4JLJA 2WICA 2CJWA 3TLXA 1M8MA 3K9HA 4M8NE 3ZDQA 2AFHE 1WXUA 1E0KA 2DRMA 3BRWD 1BK2A 1J90A 1ZIOA 4HDCA 2EFGA 2ZS8A 3IILA 3LFUA 4UXHA 1RLQC 3LY5A 3BWDD 3IPXA 1E2MA 1XTJA 3SJAA 3I61A 2XXAA 2CSIA 1E9CA 4TMZA 2IWRA 4B34A 4I1VA 2AK2A 1D8TA 5G40A 1XOVA 3AUYA 3OF5A 3EZ6A 2KBFA 3NDPA 5A5GA 4LJ6A 3ZIAD 4IW3B 3QKRB 4CYMA 2EW1A 3ZS9A 5FUXA 3EWSA 4D4JA 2KBEA 2BWJA 3MCAA 1ZIPA 4JL8A 1GWNA 5AUOB 1E1RD 1GZSA 4GOJA 1G9XA 1PHTA 3W3ZB 3P4YA 4RY2A 1V43A 2ZYUX 3K9LA 3D8BA 5H8WA 1G7RA 1VG0B 2ROTA 1Q1EA 3KL4A 5TMPA 2V55B 2EQIA 1JEEA 2A5JA 2C9OA 2BHRA 3CONA 1AKYA 2XZPA 2JIZD 2V7QA 2CLCX 2VP9A 3KKMA 4EFMA 4NKRA 4GRAA 1UHFA 2EGEA 1E9RA 4PQFA 3RYTC 2R6FA 4TYPA 2HJGA 3RNJA 3C16C 4L5BA 1S3GA 3CH4B 3KQUA 2DMOA 5IHNA 3T1OA 4FD2A 3C8UA 2JM9A 2B7CA 4GPTA 3AVYA 4PANA 2IYZA 2Z0MA 2AD1A 1KK1A 1OSNA 3NGPA 1Z8FA 3L0SA 3C4JA 5CYPA 3DZDA 1V1CA 4YMVA 4PZLA 1RYHA 3HP1A 3JZAA 1P9NA 2GTPA 2F43B 1GFIA 2GBQA 1SSHA 4IKEA 1TU4A 2JLRA 5HCKA 3EIHA 5H68A 1NLZA 3VHXA 4A4DA 1XTKA 4A82A 2ZJZA 3Q72A 1TF5A 3RLFA 3UA7A 3O8DA 1AGPA 4YXWD 1FNNA 4D8DA 3QVUA 1AK2A 1XMSA 2EYYA 4HLCA 1OYYA 1SGWA 1FQKA 4IVQA 4KBGA 1UADA 5JSZA 4E22A 2OEPA 2WJYA 4OMLA 1TQDA 1CBUA 2QT0A 1R8SA 3NBYC 1EX7A 1WDXA 2R65A 3RVBA 3K0AB 3KFXA 4US1R 5CJPA 5SZJA 4OI2A 1DVRA 2Q3MA 3I72A 3LBHA 3DOEA 1VIYA 4JBXA 2J3EA 1P2UA 2IXEA 4OI1A 3UMRA 4C0BA 2VHJA 3GPLA 1UGVA 3NDBB 1QF9A 2GCNA 3IEUA 2Z5FA 3AGPA 2C77A 4JVLA 621PA 4JLNA 4G1UC 2XTZA 3I35A 1NYGA 3CPJB 1KI9A 2O0HA 1ZM4A 2EYZA 5CM8B 1E96A 3U4QA 1R4AA 1EFUA 1CIPA 5GJCA 3W9YA 4TYQA 3KQNA 1W47A 2JLSA 3CUEF 2C0IA 2VP6A 4NCNA 1A2BA 4BFWA 4OQXA 3PR1A 2J6KA 2K2MA 4IXMA 4BFUA 2ERYA 1E0SA 4YC7A 4LK2A 5AJVB 4PXAA 1SHZA 1EFRD 4Q66C 1XFAA 4YMWA 1GITA 2R9VA 4DWJA 1QVAA 3KZ1E 5FTMA 4Q1DA 2KBTA 2IYQA 1G4AE 1IAQA 2QGZA 3R7WB 1COWD 2P5TB 3FE2A 1Z6AA 3QI2A 4FMCB 1OHHA 4JZKA 1G8PA 1XB2A 1WA5A 1TUCA 2KRNA 4HLUA 2YNMA 4D0NA 5CLQA 5DGXA 1MT0A 1N6PA 1XX6A 3U61B 3BJIC 4DZZA 1DAIA 2ZRBA 4Q00A 4IDHA 5B30A 5EXSA 4HVVA 3KKOA 2GHIA 3ND8A 1RUWA 1T3SA 1D2EA 3REAB 4ZIRA 1ZM9A 2PJRA 1VCIA 2D7CA 4LJAA 4TL8A 2HF9A 3C5CA 1EESA 2HDNB 4PAMA 2F1IA 2A9KA 3LVQE 2E87A 2CL7X 3SYNA 4NBSA 2GEDA 2PEZA 1WQ1R 3QPWA 4DKXA 2YWEA 4GFDA 1E4YA 2BTTA 1XTSA 2F2XA 2I1VB 1XU4A 1OFIA 2VA8A 2MSCB 3GFTA 4D80A 4J9FA 1RYFA 3PENA 2FDCA 4AC9A 3VKGA 2NTYC 3GFOA 3B1XA 2DFNA 3GFPA 3AVVA 1SXJD 3K0CC 5IDVA 1ZM3A 2VLIA 3U6KA 4PFSA 1WA7A 1ZNXA 4DHEA 5BN3A 3NPFA 1G5TA 3VX4A 4AIIA 3RWMB 4Q02A 2BMDA 4C0HA 1WXTA 4Z1MD 4URVR 4MGYR 5BN5A 3KX2A 2FPFA 2G1JA 2Q6TA 5E4FA 4NYIR 2G6FX 2HCBA 5E95A 3A1UA 3GLHB 2B8WA 1KJZA 2IBMA 2V1XA 4A15A 1JXOA 3LLUA 4QOSA 1KZGB 2IA5A 1HQYE 4I99A 1YVDA 3NXSA 2J0VA 1XRJA 2XAUA 4M1KA 2GCOA 2UVQA 2V1UA 5KOYA 2BV3A 4BLQA 2WSSA 5FR1A 4XSGA 2YWFA 1US8A 4LN2A 2MSDB 1TADA 3VU9B 4LY6A 3TSZA 4LYJA 4P33A 4RCZA 4JJCA 3T5DA 1QCFA 3KTAB 4Q7MB 3OE7D 2EYWA 1XEWY 2QU8A 2YINC 3RSOA 1K5DA 4W9MC 4BFZA 3K0EA 3OFNA 3THYA 4NTZA 1J7KA 1FL9A 3X1YA 1FQJA 1S1CA 3U44A 4WXRA 3ZD6A 2F3TA 4LV5B 4J9HA 4JJBA 2YUQA 2DE0X 4TL9A 4V03A 2QTHA 4E5UA 421PA 4DSTA 1WB9A 3KUCA 4IJMA 3W5JA 5TVKA 1B07A 2ZR9A 4RD0A 3WBKA 1H8HA 2L3PA 1TF7A 2D8HA 2IYWA 3WYFA 1KDTA 5JCZA 4PZZA 2ZSFA 4LJ4A 1Q44A 5G3YA 2KNBB 3MWLA 1YZGA 1FP6A 2P6UA 1E9SA 4NU0A 3NC0C 4XTCS 3WY9A 2ZETA 1QHHB 4E09A 4RJLA 5HE8A 1U06A 1E9BA 4FINA 4MRRA 1I2DA 3K09C 3SC3A 4EUNA 2LQWA 1OFTA 2A7QA 3P4XA 4ESVA 3DVLA 3Q8XB 3L8YA 3SHFA 1Z07A 3QXCA 4GZLA 2O5VA 3EPKA 3GJXC 4JYBA 2DL5A 2ORVA 5J5CA 2EYXA 5KDDA 1NN0A 3ZYCA 1ZNZA 2CH4W 1WXQA 3FPAA 2NGRA 3KJGA 3RRNA 3AVOA 1JQJC 3B60A 5FBQB 2EVRA 4TL6A 3TBKA 3BB4A 2E1RA 3DMDA 1TQ4A 4JBWA 4TZ0A 2FJUA 1K6MA 2VHQA 1N6LA 4I81A 4X8OA 2J7IA 1LB1B 4TMXA 5FOSA 4DLSA 1E79D 2BM1A 2JLQA 2QNRA 1YZLA 1KMHB 4V0KA 4QXAA 1GCQA 4AG1C 2ZPTX 1X6VA 1X43A 1ARKA 3FB4A 3K0FB 4Q4AA 4XVRA 3PJRA 2ZSDA 4Q7JB 3U3OA 3SJBA 3TK1A 3ADCA 4DBLC 2RQVA 2P0EA 4QT7A 1WCV1 1IXZA 1LF5A 3BE4A 5DLQC 5L3SA 2C0TA 4LUEA 2LMJA 4M9ZA 2QI9C 4IXNA 5DH9A 1KOFA 2KYBA 2QP3A 5SZIA 3HU3A 4DLXA 1R5NA 4LHYA 4OMQA 5J4LA 3MJHA 4PC3A 2IW3A 2DRKA 1S96A 1E2LA 1RIFA 4PQRA 1Q22A 3ECCA 3EPHA 1R5BA 1X8KA 4KJZA 1CF4A 1I4LD 4UJ5A 4KFRA 3X2SA 1OXXK 1IO6A 2R6CA 5J4KA 3O5ZA 3CF2A 2FZLA 1Z29A 4NL4H 2F7SA 4U7DA 3TRFA 4YLGA 1YZKA 1II0A 4BEBA 1HT2E 3M0RA 1PUJA 4DB2A 4O25A 4GMXA 1QG4A 2N42A 4WZAE 4A92A 5C18A 2GF9A 1R5OA 4CVNA 4ZCIA 4GP6A 3FHOA 1ZP6A 4JLMA 3BC1A 1XPOA 1NVUQ 2I0NA 1MV3A 4EPTA 2KXDA 1N3BA 5JSZB 3EHQA 4Q9JA 1NNEA 5JJIA 1VCNA 2O52A 2XXAB 2ZRIA 2JS2A 2K5UA 3CBQA 3CX8A 4LV6A 4WZBE 4V0NA 1OJLA 1NF3A 4FMDB 5DN6D 1NIJA 1G7SA 2IEYA 1E2FA 1GNQA 3C7KA 4HATA 1KI3A 2EPDA 5KO2A 4HAZA 2EBPA 2GEUA 1JI0A 2XJ9A 1ZLMA 2JCSA 1CJTC 3N70A 1N5IA 1SXJB 1XCPA 3BFKA 4NYJQ 3U23A 2CK3D 4BWYA 4POAA 2IS2A 4G5RA 3BBPA 2HT6A 1ABOA 2VO1A 2DJQA 2AWNA 3BGWA 3QF4B 4QL3A 4Z8XA 4X1VA 3WP0A 1JQLB 3CPHA 4NE2A 4C0KA 2AD5A 2CREA 1NKSA 1RFLA 1Q20A 3NHAA 5KDOA 2KGTA 2XMFA 2X19A 2ZI5A 4KAXA 4C2TA 1VYUA 3EG1A 4LJ5A 5DHFA 3EG3A 4M0LA 4MYUA 2W0MA 2K3BA 2CH4A 2GNOA 3UXMA 3WYGA 5DI3B 4QM6A 5F9FA 2KE5A 1Y63A 2PL3A 3FWYA 1KI7A 1TUDA 1UPTA 2C9YA 3FHTA 1VIAA 4C30A 4LYFA 3WNDA 4AYXA 1YZUA 3F0TA 5C1BA 1LVGA 3THKA 1GFCA 2DVJA 3W8NA 5JHHB 2O9VA 1E2JA 1DG3A 2QY9A 4XWOA 4TTRA 1ZD8A 3DHWC 2FEIA 4RUGA 2KRSA 2GK6A 2R44A 1X27A 1Z3IX 5J40A 1CJVC 3AUXA 1T5IA 2WSSD 1NN3A 1ZVQA 2OE2A 2IC5A 1L7VC 2CEAA 4OYHA 1BIFA 1W4RA 2A5GA 4QG7A 4DSOA 4Z51A 3UA6A 1BYUA 2RQUA 1WP9A 3F3YA 1OLOA 3U3MA 4JIMA 2VH5R 3E1SA 2QAJA 1QKWA 1N0UA 1WMSA 221PA 1CLUA 1GRRA 4LX0A 1AZGB 5F3WB 1LFDB 3W6NA 2P3SA 1NEGA 3T34A 2RGEA 3TW4A 1RC8A 3IQLA 2HSPA 2OLKA 3B82A 4KLZA 3OFND 4JT2A 4Q4HA 4QJ4A 1K9AA 4TSFD 3L8ZA 2LWIA 1ZD1A 1NN5A 1XZQA 4BFYA 4Q19A 1KKLA 3MSXA 3EG2A 3SN6A 4HVWA 4PPGA 2GZHA 2IYYA 2UZIR 4WCIA 2BVNA 4BZPA 2O8EB 3VR4A 5KHOC 4Z8AA 3HU2A 1FMJA 3GLGB 5GADl 4CEIA 4HAYA 2JDIA 1GL6A 1VG1A 2KSQA 1Q0UA 5AJXA 1X2QA 5IHIA 3RS5A 2O31A 3N2IA 4B43A 4N0DA 1KDOA 3KUDA 1E0AA 3S1AB 3TNFA 2EYUA 3I73A 1W4AA 5GJWC 2WV9A 3EPLA 1P7CA 2WJJA 5HR5A 4PX9A 5BWMA 3NHBA 3DKVA 1IXSB 4JMPA 2DHRA 4M1MA 1FW6A 4LBYA 1ANKA 1GTVA 2GQIA 1KI6B 4N0EA 2GVDC 3R7WA 4LC1A 1KGDA 2JJ2D 1Z47A 2MMCA 2GZAA 2PTKA 2VRWA 4QC2A 2PZFA 3ZQJA 2L2PA 4NZYA 2FRWA 1IHUA 3GJ3A 4L16A 4OK6A 3FMIA 2OM2A 2EQBA 3OHMA 4MKIA 5FBLB 4JLPA 4MQBA 5EE0A 5LD2B 2ZYTX 1US8B 1G3MA 2F43A 2VHCA 4G5OA 1EG7A 5G53C 4JVMA 2KT1A 3IPYA 1UDLA 2GJ8A 3KJHA 4EDHA 3IEVA 1E3MA 1QHSA 1E2GA 4B73A 4QM7A 3ZVLA 1VTKA 1S1MA 4JLOA 2DM1A 4HB0A 2VKNA 5IF9A 3QF7A 2D1XA 1BMFD 1OKKA 3EGUA 2XTMA 3ZS8A 3TUIC 3U44B 1N6OA 3NC1C 1XNJA 5BW8A 1N0WA 5EE3A 3M0SA 1K0XA 1E2DA 4ASUA 1ZUUA 2NUZA 1R10A 1G8FA 4RD4A 4BRWA 3AKEA 2ZUDA 1SXJE 3T12A 2RCNA 3FKSD 2NO1A 1XXHA 2KROA 3QXXA 4F14A 1TQ6A 3VU9A 4C0JA 5DYGA 4OQLA 1R0XA 2WAXA 1WFWA 3HJNA 4L4UA 2EWVA 3X1XA 4A6XA 5FH9A 4CT5A 1DELA 2LKCA 1UJ2A 3MWKA 3QF4A 1XPRA 1UUEA 1RVDA 1E9AA 2AFIE 2LNHB 1MRNA 2WIAA 2ZRHA 4GL2A 5EP4A 3VR2A 2O8BA 1COWA 4DB4A 1VYTA 4QHSA 1XCGB 3ZVMA 3QWYA 1VKJA 2F9LA 3G82C 2JDID 5AJYA 1UBEA 3UWKA 3GLHA 3OAAD 3FGNA 4B3FX 3OEHA 3TKLA 1G8YA 4IFEA 2ROLA 4LGMA 2D2FA 4G5QA 1DPFA 3CRVA 5H1YA 1Z2AA 5GJVC 3KQKA 4A2QA 1ONBA 1QVRA 4YMUA 1UTIA 2XNSA 4WZ6A 3SHWA 3U60B 4Q21A 1WBDA 3MMPA 1CEEA 1N5KA 1G6HA 4KFUA 2GZDA 4NCJA 2HXYA 4C9BA 4HAVA 4CIDA 1KJYA 4Q5IA 1KSWA 4LOAA 3I3SR 2O8DB 3PV0A 3QKRA 1JEGA 1IQPA 5FL7A 3KQLA 2NMVA 2XNDA 1M34E 2FV8A 2RB4A 4NDZA 1W36B 4HVUA 2GDJA 5L3RA 2FA9A 3IIKA 3TAHA 4Q48A 2WPDA 1R8QA 2GK7A 1Z2CA 2ZRKA 4UNNA 2CMKA 2W2TA 2ZS9A 1RE0A 1G3QA 2IYVA 4LUCA 3DO6A 1W5SA 1OB2A 2HEIA 2RGCA 1D9XA 2ZU6A 4TLBA 4F17A 4IDQA 4ASUD 2ESWA 4I1SA 2O8CB 1YWOA 3TJZA 4B2IA 4Q01A 3U7EB 5ECAA 2OAWA 4KBFA 4JKYA 5FBWB 3LD9A 3FMFA 4J9GA 2IYUA 1E4VA 3THWB 4YXWA 2BBTA 1RKBA 4CEJB 4KHZA 2RGNA 5A4JA 2PCLA 2VHTA 3B8HA 1KO1A 1I0CA 2QRZA 3ETLA 5EJEA 1JU5C 4NHOA 2R2AA 1NVWQ 5BXQC 2F55A 1KO5A 2LQNA 1ZAKA 2MCNA 3GP8A 2X2FA 2ED0A 2VEDA 3IDQA 2DNUA 3BS4A 3PEVA 4D0LB 3VS4A 3M0UA 5LD2C 2JIZA 4ERNA 1NLYA 4CW7A 2GCPA 3IGFA 4DLWA 1BS1A 1N5LA 3LNCA 5AJWA 2AX4A 2AL7A 1OH5A 5CYOA 3CX7A 2EFEB 4TQUS 2CCJA 1NM7A 1PRLC 2LKDA 4HUTA 1W46A 2M0YA 3PVQA 1YN8A 1XXHE 1Z22A 2OFOA 3GMTA 1DAKA 4AKHA 3RRMA 2NQ2C 2YSQA 5HCNA 4C4PA 1EXMA 5J4HA 1PLKA 2EYQA 1HE1C 1H3HA 2VL7A 3R8CA 2OSBA 2DWPA 1SRMA 5EC7A 2HEQA 3VNUA 2QT1A 1FX0A 4LHWA 2HT1A 4G5GA 3EG5A 4MRSA 1X86B 1BH2A 2PZGA 2BBOA 1ZC4A 5FI0B 2REBA 4RZXA 1K5GA 1AOJA 2AK3A 1CSKA 4HB2A 2XGJA 3DL0A 4W5HA 2XB4A 1II9A 1VHTA 4ESHA 2L0XA 2WSMA 3I8XA 5AUPB 2F3RA 2O9SA 2VVKA 1QLYA 1NSTA 2ZI4A 3FKQA 2RHMA 4FMDF 2FG0A 2J0QA 5B2ZA 1DADA 1LV7A 4TWZA 2GJAA 3U5ZB 4JJDA 2D4HA 2QM8A 4OI0A 2IIMA 2Z43A 1XMJA 5F2EA 2I1QA 1M2OB 4LPKA 2RQWA 1XEFA 1OW3B 2ZRGA 3BH0A 3N5CA 5IK2A 2FPDA 4DDVA 5K8IA 2QAGB 1P61B 1CJUC 2BJWA 2IF0A 2YDLA 1JPNA 2W2VA 4GI7A 3FHCB 2QEQA 4GP7A 3ZZTA 2BZ8A 1GRNA 1G21E 2AXPA 2LCFA 1HD3A 1OV4A 1JALA 5C4MA 4LZZA 3LVRE 4CEHA 2GBLA 4BLSA 4AURA 3W5IA 3EXAA 1CULC 2CK3A 4XOIA 2JJ1D 5CIWA 3BB3A 4Z8YA 1KNXA 1D2NA 4C0AC 1T4GA 3K0SA 4MYHA 3ASZA 2CE7A 1PWTA 2AZVA 2I3BA 2NO0A 5IHPA 3ICQB 4PAOA 2VP0A 2K6DA 4Q9IA 2HBWA 1X1RA 3SE0A 2V8OA 2SRCA 1W0JA 2ZJ2A 5CDFE 2WWYA 2REXB 1W2GA 3LQQA 2DL3A 3A1VA 4PAQA 3SDZA 5L3QB 4M4ZA 3ULRB 4BFTA 2JT4A 1KSJA 2CHVA 2ZQ5A 2NZ8A 3B1YA 1GL7A 2OHFA 4QJ3A 4US0R 4LNPA 3VR1A 2X77A 1TG0A 1D5CA 2SHKA 3I1FA 2J05A 2QTVB 2ZVQX 4URWR 4B3XA 2CLDX 2Z4SA 3C5HA 4OI4A 4II7A 1Z0IA 4Q9KA 1MOZA 1KI1A 3VS1A 2WJVA 1MABB 2AR7A 1XJCA 2H5EA 1OPKA 1RLPC 4AYWA 2C78A 1SXJC 2H18A 3K70D 3A8TA 3IQXA 3NEJA 4IEEA 2O8CA 3Q9LA 1GIAA 2DFTA 1X1SA 5DN6A 3WHKA 2BOVA 3RC8A 2GXUA 1KK3A 4MITA 5EQTA 2G0NA 3QVVA 2ZJ5A 1UKYA 2FSFA 1ZRHA 4KITB 4JL5A 2WOJA 1Z0AA 1OB5A 5EP2A 1IY1A 3CH5A 1J99A 2WMOB 2QSZA 4IVPA 4MRPA 4XWKA 1Q1BA 3B9PA 3EPJA 1S1NA 3ZVNA 1G16A 3BB1A 3MAAC 2BMFA 5HE9A 2GAAA 2O0KA 1H92A 4IOJA 3VS2A 1CU1A 2RHDA 4JLDA 4ON9A 1KTVA 4QHYA 3OIYA 4CEHB 1G3UA 4P32A 1BMFA 5D3QA 3IUYA 4DXAA 1M30A 3REBB 1XF9A 5FWCA 2IL1A 2XOKD 2H92A 2B6HA 2ZR7A 3Q7QA 1AS0A 4RFVA 4LUDA 3AM1A 1EWRA 1NY6A 1O3YA 4ZI3A 2YKGA 3M0TA 4N1AA 5IHKA 1XJQA 4J9EA 4OBEA 2H8KA 1PKTA 1M74A 2WVJA 1P2SA 4DSUA 5C46F 4CGZA 1EFNA 3TUZC 4IDPA 3PE0A 3GCGA 1MRSA 1EFRA 1UEIA 2W58A 4IRUB 4M9XA 4D82A 4WW0A 1M3AA 3OEEA 1PKSA 1BKDR 3EA0A 5FL3A 2CHGA 1B0UA 4LCBA 5AWFC 1AM4D 2B92A 3DOFA 2GEVA 4F93B 2QMUA 1OIVA 3GLFA 2PZ1A 4F38A 4B6EA 3PUZA 5JI2E 1T3LA 4EKDA 2FZ4A 2HYDA 4KYIB 4DCUA 3ZLJA 4F7WA 2DBMA 1KMQA 4G5SA 2CVHA 3ZJYA 4DLVA 3EG0A 2OESA 3A37A 1G64A 3VHLB 3EX7C 3M6AA 2L0AA 3VNVA 1YQTA 2DILA 3FMOB 1GFDA 1E79A 1W4CA 1JEDA 2H57A 4URXR 1DO0A 4MRVA 5AK0A 2REOA 3M0PA 4A2PA 2A5YB 1JECA 4RD1A 4Y92A 1UE9A 1OXVA 3NBXX 2ATXA 4TLDA 5TXGA 1DO2A 1UEJA 1TAGA 2FEMA 2RGAA 2ZJBA 3T1VA 2W6IA 2ZJOA 1G18A 2Q9CA 3RNLA 2WOOA 1W7AA 4AKIA 2A28A 3PUVA 3BXZA 2BMEA 1U5SA 4FSSA 1W0JD 3SJCA 1BB9A 1T3HA 3L0PA 2PMDA 2GJKA 1G2BA 3ASYA 1FX0B 1CJKC 1YNZA 2OFWA 3OIWA 2ZS7A 3AB3A 2O8EA 4DJTA 2GWHA 3QIAA 3G5UA 4PQYA 5D3MA 5LPNA 3AF1A 3RDPA 4DT1B 2JAQA 2ZREA 2N46A 2WMNB 2F2WA 3NKVA 3A1SA 1W1FA 4FW9A 1B23P 3CNNA 4Z88A 5KUTA 2RGBA 1U0HC 2ONKA 4HAUA 1ZUHA 5I11A 1X69A 2FRYA 3VS0A 4A0HA 1BU1A 1GKYA 3IIMA 1YWPA 5AJZA 1NMYA 1Q1ZA 4YDHB 4W5JA 1OEBA 4BZXA 2JLYA 3PITA 1M7BA 1DS6A 4KI0A 2ECZA 2YUNA 3PVLA 4B2PA 3OEED 4E07A 5ANRB 2K7AA 2J6FA 3B13B 4RTZA 2GILA 2YOHA 2G77B 1LF0A 2PT5A 3QPVA 5FOVA 5A0FA 4EPRA 4ZDKA 6Q21A 5CM9C 4B2LA 4LE9A 4V02A 4HLDA 2EFDB 3T1TA 4UNSA 3SI7A 5FUYA 2EU8A 2ZUBA 3TUJC 1TX4B 3REFA 2F1HA 3U2QA 3L82B 2JGNA 1M7HA 2ODNA 2ZXUA 1K1ZA 3GLIE 2QBYB 1MV5A 1S3SA 3WYAA 4OMOA 3AKCA 2J7PA 4LJYA 4XSHA 1W0KA 3ADKA 2OCYC 5EZ6B 3SU8A 1VMAA 3E70C 3LBNA 1DAMA 2OXCA 1HSQA 2PCJA 3SYLA 4ZCLA 4LHVA 4P31A 5L3QA 4B6FA 3UATA 1G7TA 1YR6A 2QORA 1DAFA 3BH6A 3TIFA 3A6PC 1OH6A 2G83A 1BO6A 1XPUA 4DUGD 3PEWA 2ZI3A 3Q3JB 1CKAA 5K8LA 4MUAA 4TT3A 1CKEA 1HT1E 1SKQA 5FR2A 4MYTA 2FGJA 1CR4A 1GKIA 2V6JA 3ZVRA 2K9GA 1P9RA 4AD8A 3U7GA 3R9XA 1TL7C 4KXFB 2ZTSA 4J9IA 1X8JA 1N2CE 4NYJR 2ORWA 5K8UA 4LYAA 2B8TA 2WWFA 2J41A 4TMKA 2B21A 3WP1B 1M1YE 3KB1A 4LJ7A 5FPKA 5BQ5A 1SRLA 1VCMA 2IYTA 2VF7A 3I32A 3BAFA 4FCTA 2HDAA 2QE7D 3E5HA 1OPXA 4EFNA 4RTYA 1W1WA 1ZINA 3H0IA 2GJSA 4KFTA 2FU5C 5HTKA 3NBZC 4HLUC 1P62B 1OH8A 3W8RA 1FNMA 1U94A 1E99A 1RW4A 4OMMA 4ZKEA 1E6HA 3QXSA 2YVUA 1AQYA 4R9UC 5DE3A 2X2EA 3REGA 3WMEA 3OAAA 1NJGA 3CKLA 3LW8A 1EGAA 2FNAA 4PHGA 4RFSB 2FOLA 1YZTA 3PVSA 2P6RA 1I1JA 1L4YA 2J45A 2ZROA 2FWRA 3A4LA 2QP4A 1NYFA 4IIOA 1ZNYA 4YMTA 1J70A 2ZE6A 3KJEA 1I07A 1TUEA 1GBRA 5DSZA 2BCGY 3IKJA 1LY1A 4OHWA 1QHHA 2VF8A 1GL5A 4DDTA 3SOPA 1E2KA 4S2EA 1J8YF 1II8B 1QHIA 1X6BA 2Q9BA 4YMSA 2CJWB 1ZJ6A 5KU1A 5FPTA 4CDGA 1BYIA 1E2NA 1T0HA 2KEAA 1V5WA 3MWJA 3NTUA 3DM9B 2BEKA 2R6DA 3HDTA 2WWIA 3QKSB 5FBVB 4QKQA 3B5JA 3BD9A 3EARA 4M1YA 1F5NA 1FP7A 2NIPA 2YV5A 5DO9A 1KK2A 1KK0A 4JJZA 2V3CC 1WLPB 2ZRMA 2HV8A 4UNRA 3C14C 2FG5A 2VQSA 3MRSA 5HKKA 1YRAA 1X2KA 4D0GA 2L3SA 5E7IA 2W10A 2VWFA 3GJ8A 1Q3TA 2AWOA 2OZEA 3LXRA 1P2VA 4LRWA 4M1WA 2W0ZA 2RGDA 4D4LA 1UG1A 3I8SA 2IYXA 5KNBA 2LZ6B 1F6BA 1GCQC 2A2ZA 4AK9A 3SEMA 4AFUC 3H2YA 1CS4C 4A1FA 2JJ2A 1DARA 3AF2A 1J2JA 5JRZA 3RAPR 2QENA 1KNQA 3GJ7A 1QG2A 2VHUA 3PEUA 121PA 1IBRA 1MH1A 1NMXA 1FOEB 2ZRDA 2ZRFA 4B35A 2RKOA 2QTFA 2OFXA 3IBYA 4Q4JA 2EVWX 4WAUA 3AVQA 2WKRA 1NG1A 2AKYA 3AQ4A 3EZ9A 4LDJA 4PHTA 2EGCA 3A58B 5EE9A 5EP1A 4B44A 1XZPA 4EFLA 3AV0B 1H8HD 5JBQA 2A08A 1T8UA 2QP9X 2ZRJA 4NMMA 3SQWA 4AY2A 2QUZA 4R2IA 2FX3A 4A0GA 2J0UA 3WHLA 4RZUA 1YRBA 5KSOA 3TSOA 5JFGA 4IOKA 2RH5A 1RRGA 4NCHA 2C8VA 1IXRC 2CL6X 2J87A 3B6EA 3LX5A 1MKYA 4W5WA 4QGFA 3RHFA 4C0QC 2CXXA 3SFVA 2YT6A 1WDTA 2Q3HA 4B3GA 2ZAMA 4W7SA 3KXIA 4QBIA 3AF4A 5C2JB 2YJTD 4FXPA 4BRUA 2PX3A 2WM9B 2EFHB 3C15C 1U2RA 4JSTA 2IF2A 2W2XA 5FUVA 5J4VA 2ANCA 2DYKA 4A63B 1UFFA 2DL4A 1Z28A 1O87A 3QG1A 3TSWA 4FWTA 1U8ZA 1Z06A 2OJ2A 5GJVB 1TNDA 1IN8A 3D7MA 4FMCF 4LBVA 4M9QA 5GVRA 3WNBA 5G3ZA 2ANBA 2KB0A 1M3BA 1L4UA 5BYJA 4GLMA 1R0ZA 4QJ5A 2D74A 2PLFA 4M1TA 1P60A 4KVGA 2VP5A 4GBQA 2D0NA 1VA7A 3QY0A 4MRNA 1Z0KA 2P5SA 1GP2A 4NCIA 3NMZC 4WOPA 3ND9A 3P20A 3UF4A 4RZ3A 4Z54A 3EHRA 2J59A 5B64A 5FL7D 1E1QD 1NVVQ 1H8KA 1N6KA 1PLJA 3SS8A 3TE6A 3VS5A 2PZEA 5F9HA 2P4RA 2DL7A 4L9SA 1KYIA 1ESMA 5GJWB 1DBSA 1CTQA 3RS4A 3DZ8A 2NO7A 2JA1A 2WZQA 1U0JA 2ZJAA 1GBQA 4B48A 2XITA 4TLEA 1K76A 4LHZA 5FTKA 4EIWA 3ADDA 2J6OA 1GOTA 2G88A 2W0SA 1HQCA 3QXJA 2G9NA 2GGRA 3VAAA 1TEXA 2FE4A 4PZYA 3RWOA 4PR0A 5LBIA 5JWOA 1Z63A 2V1RA 4CEJA 4XIGS 3CLVA 1QHYA 5CLLA 1C4OA 5KSZA 2ATVA 1EFHA 2P67A 2QL6A 1UBCA 1N6RA 3AKDA 4M21A 3FOZA 3GEIA 1U81A 2IUUA 2GCOB 3GD7A 3CR8A 3UMSA 3VR6A 1T5LA 2VSFA 2DA9A 1AJEA 3CM0A 2CUBA 1R0WA 1WE2A 4EQ6A 1KZ7B 1QWEA 1FYNA 1AWWA 1WRBA 4C2UA 4PC1A 1SQ5A 2RN8A 3ADBA 2BBWA 3D3QA 5EUQB 1Z08A 4GBMA 3PEYA 3UWOA 5CITA 3NBFA 1HURA 2BZXA 3OZXA 3GLIA 4DCVA 2H16A 3SBDA 1M3CA 2AZSA 3QPUA 4AG5A 4MDEA 1GRIA 3WNCA 3B78A 3GQBA 1N5ZA 3Q7PA 3VX3A 3H0HA 1N5JA 1EFTA 1OKKD 5KSYA 4DCTA 4FWIB 5FBRB 4LPSA 3T15A 3O8RA 1E7OA 3JV3A 4AG6A 1SZPA 3I5SA 2YWHA 2LX7A 4JL6A 1G1MA 4NPHA 1ZCAA 3LA6A 1KDPA 3LDAA 4O2RA 4R2HA 4IIMA 5EE5B 4BFSA 5FOWA 4WIAA 2WWXA 4OJKA 3AH8A 1WI7A 2QA5A 4U00A 3MJRA 5FOUA 3A36A 3UG7A 1IN6A 4IDNA 3DDCA 1IJEA 3A98A 4PHFA 5DYIA 5J47A 1CR2A 1LTQA 4P4TA 4KO8A 4RSGA 3TQFA 1KJWA 1W5TA 1UBFA 5EXTA 1N6NA 3U3KA 5AUNB 4ILEA 5KNDA 1ELOA 4HCKA 2BDTA 2PJZA 2QPOA 4TT3D 1NIPA 1YZQA 2ZE7A 1HEIA 4ARZA 4LYHA 4R0KA 4ITRC 4IEIA 4CZ2A 3V4FA 3VKHA 2ZRPA 2IWHA 2XEXA 2P6NA 5JWRA 1TUIA 5FOTA 1G17A 4F4CA 3RBBB 3QQ5A 4HEJA 3RRZA 4M1SA 1E98A 4OHZA 4TQ9A 4B76A 1JNYA 1IY2A 1H8EA 4IOMA 3H86A 4TMWA 4UJ3A 5I22A 1GRQA 1UM8A 4MGKR 2Z6VA 3AP2A 3OIUA 2NZJA 4PO9A 1KKMA 2NPFA 3EZ2A 4ZDIA 3RS7A 1XEWX 3FDIA 4MGZR 2ZVPX 1ZM2A 2OO7A 4LJ9A 5E7JA 1YE8A 2OI3A 1ZCBA 3C0CA 5L3VA 1SKYB 1KDRA 2OBMA 1AKEA 3CO5A 5IH2A 4DLRA 3I92A 4GOKA 1OIWA 3LQRA 4HAXA 5L8VA 1LCKA 2BC9A 1P2TA 4PPNA 4G3XA 1FMLA 3E2IA 1QHGA 2OT3B 1E1QA 2ZUCA 1VDZA 4LWZA 3LAWA 2GAOA 1W70A 5FW9A 3N2EA 4F92B 1UHCA 5CK4A 521PA 1UAAA 2ODBA 4NYMR 1SEMA 3U3JA 1G3IA 3VFDA 2J7KA 4K81B 3UANA 4A6PA 3CWQA 3P1JA 1KY2A 1MR3F 2G6BA 1G4UR 4U5XA 1PV4A 1A5TA 1F60A 4TQAA 4RTVA 4WXPA 2ODEA 4RFSA 4JYCA 2G1KA 2DFLA 3KJIA 4UNQA 4M4SA 1GM5A 1NY5A 2O8DA 2HUPA 3BH7A 1OFHA 1XEXA 3L0IB 1ZNWA 2OLJA 2XB2A 2DWOA 1E94E 2ONJA 2HLDD 2JLUA 2WWGA 2KWIA 5EP3A 4OQFA 5IK2D 3EIQA 2VP2A 1XWIA 4RD3A 4A36A 4BFVA 3TQCA 4LV8B 5FOXA 4NONA 2FPEA 1Z9ZA 1NRJB 4D2IA 3AKYA 2YC2C 2PBRA 2W6ID 5DHAA 2UZ3A 1S2MA 3P32A 4JBYA 3UKDA 3TW8B 2XZLA 2GXSA 4UKDA 2VIIA 2HLDA 1ZUIA 1ZD9A 2FSHA 3DEFA 3QG5A 1JR3A 1KIMA 5KDLA 2ABLA 3P26A 3TH5A 3THXB 5JS8A 2J0UB 4OJQA 1WXBA 1AN0A 4MKHA 3PG5A 1KI4A 1JR3D 1ZUNB 1AIPA 1AEYA 2GF0A 1QZXA 3FVQA 5HCIA 2OUKA 3BK7A 3GBQA 2CBZA 4KCGA 2GKSA 3UK6A 4H9GA 3X1ZA 4DCSA 2VP4A 2B86A 4RTUA 4O3MA 3K8YA 2ZJ8A 2FMXA 4A8JC 4BLRA 2JLXA 4L15A 1A82A 1QHNA 1P75A 3O8BA 3SFZA 3KFVA 1YU9A 3PFIA 4DIDA 3SEAA 2O8FA 5SZHB 5GJBA 2JXBA 3BIFA 2QQ0A 2GBLC 5CDFA 2ZSAA 1L8QA 4DLUA 1EWQA 1NVXQ 2OXRA 1OXUA 1W49A 2FEOA 2JTEA 4DC9A 2DYBA 1ESNA 1E2HA 4AFZC 4J9DA 3LV8A 5FWBA 1XEXB 2ZJYA 1ODFA
chains in the Genus database with same CATH superfamily
2EW3A 2OG1A 3EW7A 5K6TA 3BYZA 1PNJA 1D2GA 1HYQA 1RMTA 2VZEA 1U3OA 3I53A 3MJFA 3NTRA 4GPZA 3TCKA 1AKQA 5LN1A 4PC2A 1VA4A 5ALFA 3H11B 3VTZA 5LQKA 3H4MA 4IIBA 1D1PA 2HMVA 1ZSGA 1V6SA 4GXNA 1GAQA 8AT1A 3NPAA 2J4FA 1G41A 2YY7A 1KY3A 5CB0A 5JAHA 2OHJA 5I9BA 1ZM7A 1Z0JA 2QE7A 4BUJA 2H4FA 4U3JB 2EKOA 4DIOA 3KDSE 2PX2A 5IJ9B 2C9CA 3HR7A 3L7OA 4TTSA 4FN5A 4YAUA 3U6BA 3SNHA 2KSSA 2DBZA 1DTSA 3TAUA 1MGQA 1NJIC 3H0FA 1F5SA 4GMDA 3CPSA 4JJFA 5FPYA 2B36A 3H1GA 4BQQA 5LNK1 3R2JA 5JH7A 3GPDG 4M0FA 5EQFA 3R9XB 4N3NA 3OBWA 1OF1A 2WMYA 4S35A 1QP2A 2D59A 3D6MA 4DMRA 2ZYAA 3FCEA 2FGKA 4MQFB 1U65A 4V0KA 5IAJA 1ZA1A 2P2LA 4JNCA 2UYCA 4E14A 3ZNNA 4NX2A 4M7AG 4BBAA 1WHMA 1RHJA 4RO0A 4JLVA 4HYYA 2II6A 1FRZA 2IHUA 4YJKA 5FPSA 3HJTA 4AZTA 4D45A 2E89A 3UWMA 2RQRA 3EH1A 3FJPA 4IQ0A 4G1CA 1SURA 2HU2A 3QU2A 3A8HB 1NLFA 1U1FA 2OBBA 3MOGA 4L6CA 4NU5A 1Z7YA 3CA8A 5DISB 1NJ8A 3P9KA 2XYHA 1J25A 2FOXA 2XCTB 4RXMA 1UECA 1JYFA 2GOYA 3DNMA 2NU9B 2PPVA 5EJ8A 5LFAA 3ASUA 3SHTA 4INPA 4X71A 3HSBA 5AVXA 1A8PA 1H05A 2POQX 1UKCA 2O2EA 1FLAA 1PSEA 4PHCA 2QBYA 4BYMA 1NQXA 4IY1A 1XPJA 2Q0SA 1R9GA 1SVWA 2OKCA 2QD4A 1JMVA 3IIJA 3KTOA 4LYGA 5FNVF 3RLIA 5JVDB 4RVSA 3ZBUA 3A4NA 4G37A 2ZVDA 3C98A 1ZN8A 1VOTA 3CLTC 3GZTB 1II8A 2RGNC 4Y6RA 4B4UA 2ZBVA 4X6XA 5ELLA 2HJWA 2ODWA 1D2HA 2GERA 2X8LA 4Y0NA 3WR5A 1ZBJA 4XSVA 2KXCA 1PJBA 2X1VA 4MP8A 5AJTA 4MGHA 4O2LA 4YCDA 3RRJA 4PYMA 2R58A 5E9WA 2YW9A 1CCWA 4IIJF 4DLZA 3GO4A 4L8LA 1O4VA 3B1KA 3SHVA 1H2ZA 2ZAYA 1E69A 3EFBA 3OYDA 2OAP1 1C3XA 4MWOA 4R4JA 3NWJA 2OV6A 1CKBA 3OZVA 1ZX6A 3GL9A 5ALXA 4F97A 4LOLA 1D9ZA 1JJAA 2QMOA 2QVXX 4RZSA 3WIVA 2AHOA 1IXDA 1FPMA 1BCRA 1EA5A 1JFVA 2RAVA 3LY9A 3TVTA 2QWXA 2NOAA 4LSGA 4PRKA 5CBPB 3EGXA 1FFXB 4PSDA 5JVDF 1T91A 2FSIA 1Q74A 2G7MC 3D6NB 4ZT3A 3FD8A 5BSFA 3WJ1A 4KBMB 2H1IA 5F7JA 2C0OA 1YQUA 2HCKA 3AM5A 5KSPA 3BXOA 3H17A 4LXXA 3T52A 3QSYA 2JW4A 4ER7A 3HTRA 2MCFA 2NTEA 1UINA 2ET6A 4IL5A 4XYMA 2VSNA 3MUFA 4J2TA 3A2KA 2YOFA 2MMGA 3OG9A 5DI9A 3EN0A 5IVHA 4EHAA 2IOHA 3K16A 5GGXA 4BATA 4ND3A 4OK3A 3T5GA 4P2GA 1D1SA 1ZU5A 2GEFA 4R5MA 3QX3A 1P74A 2LR0A 3ZBQA 4EFDA 1JEQB 3G6EQ 1M6HA 1J1UA 4KVAA 1UOPA 5GGYA 3LLMA 1PM3A 4DTCA 3ENQA 4PG8A 4DUZB 1IGQA 5CGZA 2PMKA 3GPCA 4MCHA 2DX1A 3OT1B 2GETA 1GUDA 3ENKA 4A8JA 1WXDA 2O2CA 2R1TA 4P3OA 3K3PA 2ZRLA 3GUUA 2EKHA 1KO8A 3HYRA 2E5QA 1EHYA 3NAQA 3ONWA 3I37X 1ECCA 1GDDA 3HB1A 5TQJA 2JPDA 4N01A 2LNDA 4ETMA 1NX6A 2SBTA 4AFSC 1R27A 4YAWA 3JW8A 3IPAA 4CKBB 1CB7A 2VJAA 1WF6A 5BXYA 4DR4B 4P83A 3KZNA 4ACAA 1NP6A 4B84A 4ALJA 1FMKA 1A7AA 1OXSC 3L8MA 2LTOA 4JB8A 3KTAA 1HKUA 4YUVA 5JZVA 2AF4C 4MW6A 3ZHCA 1EK6A 1CLEA 4ARVA 2P4QA 1C0LA 4PJMA 1F48A 1OROA 3CNOA 3JQBA 3NIGB 3QFCA 4K46A 2M1ZA 2JS7A 1PDVA 1V2GA 2FFQA 2YJ4A 2Z2YA 2NO4A 3I2HA 3KS9A 3N0RA 1S72T 1SVMA 4LTDA 5ECWA 5M04A 3L01A 2JKVA 2CNLA 2YFQA 1LRLA 1NI4B 1S0UA 3QYAA 5SZKB 2XK0A 1GSHA 2UZ4A 2D0OB 1Z4IA 2CLMB 2GRJA 4UXIA 3O47A 1HETA 3GK3A 2FZCA 1WG8A 4UW9A 3WL3A 5I4BA 4GZ5A 5EL0A 1UDXA 1SVSA 3P27A 4CCWA 4EG0A 5IKMA 3CNEA 3ZKAA 2XCRB 1M8KA 4MNTA 3L3BA 2WPNA 2JN0A 3LCMA 1Q17A 3VPHA 2CDRA 1T2DA 2AZ4A 4OK5A 5TPZA 2B1RA 3L2VA 1BBZA 4I4NA 4A03A 5BOSA 1R77A 2WM3A 4OQNA 1XRQA 5I9TA 5BMOA 3I8OA 1TS9A 1WNTA 4L51A 4O02B 3UA4A 2PE5A 1ZA1B 2A5FA 3EGIA 4B75A 2FWNA 3JTEA 2BIFA 3PYMA 1HE5A 3ER8A 4LEIA 1NJ2A 3ABRB 3CZPA 4F1WA 4ZIRB 2DFPA 2K7FA 1IOZA 3EGOA 3HJHA 3V8JA 2H2HA 3TB4A 4BMZA 3WKAA 3UY4A 4CF7A 2JBWA 1DC5A 1QQ5A 1S9HA 4HDOB 4AF8A 3AU9A 3FI9A 2JFYA 5H59A 3RTGA 1TF2A 3QJYA 4RTWA 2QJRA 2PO5A 3EISA 1Y9DA 3UT6A 2ZR8A 4BMSA 4P4SB 1M2FA 3COSA 3S44A 2XB6A 1O96B 2ZYDA 2WVHA 3LF2A 2JFUA 5IT0A 4A8JB 2E7ZA 4BLPA 4KVFA 4GLBA 3I9OA 4PPQA 3LGAA 4L3OA 4C22A 4GGOA 3AOEA 1ZDMA 2WQZA 3EVCA 4GKVA 4CMBA 2QQ5A 4JKIA 1PJ4A 2RONA 1JRLA 3NHLA 3RRYA 4ARSA 3PA8A 5EQJB 2AKLA 3HFNA 4WBSA 4ZAVA 5BMVA 3H3JA 3GWGA 2YASA 2QK0A 3IOCA 2RKBA 1G20E 5F77A 4JZ4A 1NJSA 2E55A 2PLRA 2XSZA 4NSNA 2C2GA 4NULA 5F1KA 2LX9A 3C85A 4OQQA 2NSLA 1BX3A 3IEKA 1UJNA 3MGGA 1W75A 2Y77A 3PFGA 2V6IA 2Y2VA 2JM8A 4PS1A 4GT1A 4AMVA 1O95D 1NJ6A 5IM5A 2YMPA 4GI3A 5U4XA 2QN2A 2O5RA 1JLSA 2ZPIB 2QZ9A 2GJ4A 3ORFA 1G8HA 5U4QA 3TKYA 2HCJB 4PIMA 3WLMA 2MTBA 3KSDO 2DR0A 2PWYA 1CQZA 3NBMA 3IAHA 1PDWA 3OQHA 1KS2A 2TMDA 4M36A 3NAGA 3VZCA 4L8GA 3IQGX 4BX9A 4FGLA 5JDIA 3HUEA 2D06A 2P7HA 2PUGA 3DPSA 1YHNA 3NEPX 4LQLA 1R6AA 3D1VA 1PS9A 2C04A 3B9QA 4NG5A 4BMPB 1B41A 2ORIA 5IAOA 1J24A 5JJ5A 3KCNA 4IFBA 3QE3A 3GAAA 4FR5A 4P4UA 1OPLA 2IY9A 4RMJA 5JPIA 4B6GA 4WASA 4TSRA 4W5NA 5AR1A 3GU3A 4INZA 4QGGA 1YJ8A 4YREA 3UXHA 3E9MA 5D7NA 5JT1A 1TCAA 1IJFA 3DS8A 5MGBA 1OGIA 2DIGA 1D6JA 2OHHA 2X23A 4RTXA 5BW6B 2QDLA 3A1WA 1L5WA 2ENWA 4R3WA 4S1NA 4QG3A 5JEDA 1TU0A 4QGAA 3LDFA 2ZAOA 5LYJF 1M2EA 3DGFC 3PNWC 1R1DA 4AFQC 2LW7A 3M3PA 4G1EB 4IJKA 4AMCA 4FHDA 2N47A 1MUZA 4MKFA 4US2R 2B5VA 1Y3AA 5JAPA 3QUIA 3WQRA 2J46A 3A6JA 4NJEA 4CETA 1AWJA 4QYSA 3VUFA 2RGYA 3HO8A 4LF4B 2BF7A 1VPVA 3QTTA 5EJGA 5BSUA 1ZIDA 5LC1A 1DKOA 5KINB 2PQWA 2NW6A 3V9PA 4AG2C 2IHTA 4WKGA 1UGQB 1KI6A 4X44A 4BUZA 1BMDA 2KE9A 1YI2A 3FJOA 3GLGA 3K9NA 2YBEA 3AF0A 3AWDA 2ORYA 1A5AB 3DKPA 2X8AA 1WHGA 3IP1A 1N6HA 3AXTA 3L6UA 3WL8A 3VKWA 2FSUA 3EXHB 1KFJB 2A0XA 3EEIA 3EIEA 2R8OA 2AUTA 3JS5A 1YBFA 2WIJA 3NT2A 1JZSA 4FI3C 1RXSA 1DWOA 1M34A 4GOOD 2WWVD 3V1YA 5I3ZA 1OFVA 1L5MA 3LW7A 3QSUA 1J49A 3PSAA 4IDGA 4BBPA 5B4UA 4ACBA 1VIFA 1JAHA 3SJZA 3MD9A 4D6XA 5IDWA 3QHAA 5DNYB 4MDEA 4D81A 2Z09A 1NBMD 3DLHA 1UDBA 1DKQA 1QIGA 3L4BC 4ZT2A 5KWIA 3RKSA 2V8KA 1AV7A 4I4LA 4ZKDA 3QY9A 1MMDA 2LCSA 2H1VA 3JZMA 4AF6A 3K4PA 2ZSEA 3TPZA 1PT6A 2HQBA 1IM5A 2LCCA 1Q57A 1P92A 1RJGA 1WPXA 3H5IA 4Q7LA 2GKGA 2WK1A 1IHPA 2QYSA 2JGJA 2UVPA 5JATA 5H3LA 1UJYA 2FETA 1YHQA 3N39C 4HQKA 4JVSB 1BD3A 2OC4A 3VUZA 4RWEA 3VZQA 3AILA 4OMNA 4OHOA 1JB0E 1EDOA 2YQ4A 5T57A 3HVIA 1T2NA 1QV9A 1VHLA 4QYIB 5AW1A 2JJYA 1HMPA 4IX9A 2I0FA 5IXFA 2Q1WA 1M2GA 2R6AA 4HBGA 5A71A 2IXGA 1C9KA 5IJZA 1E20A 1GVNB 4Q4LA 2AKKA 1K2VN 3OOEA 2A30A 1Y98A 4W8OA 1TI7A 3ESRA 4D25A 4MQUA 1UMCA 5AKIA 3SF8A 2QM7A 4WERA 3RS0A 3CC4A 3STTA 2I2CA 4QNRA 1I4DD 1K86A 4M22A 2HRDA 3ESDA 4JVNA 1KU6A 2K2QB 3G7SA 4XKJA 1VQLT 1SUPA 2NO9A 4M78D 1XCLA 3IBFA 1BE0A 2XNDD 1A9TA 1KU0A 1TW2A 1W96A 1KRHA 3K2BA 3OJCA 1PUIA 4EHKA 1O96A 1M66A 2Z1MA 4BI4A 3HDJA 1MORA 1XQ9A 3RC9A 1MX1A 2W8BA 1SH7A 4N4AA 1XK7A 1U9IA 2X13A 4XWWA 5AKGA 2X3UA 3SBOA 2Q0QA 1GFZA 2R87A 4UZSA 3PUKA 2FWMX 1RQXA 2X3XD 3P2YA 4M7DD 2W37A 3AB7A 2WLTA 3E9YA 3WLQA 1V11A 4MICA 1NLOC 5P21A 1DAEA 1FIUA 4LOJA 4C3ZA 4ZOCA 4YJ2B 5FYQA 3QYPA 2H7XA 4PV7A 1AKTA 3ZHBA 1X8LA 1YDMA 3FFTA 1CDDA 5AW3A 5HKKD 3WRXC 1M34B 4QEKA 2LIVA 3BA1A 1SULA 4S12A 3C95A 4YRQA 5AK5A 5K4AA 4B3SB 1VCOA 2X41A 3E4CA 3AX6A 4FEEA 4K9MA 3U62A 1JR3E 1NZJA 5DLEA 4HTFB 1R4NA 1CXZA 1K8RA 2LE0A 3D2AA 4BVKA 5JH7F 4KUEA 2P2SA 4UC4A 4C6TB 5C31A 2RA2A 3TTSA 2XQIA 3EXG1 1UK7A 2X5NA 4JDUA 1VQPT 3AFMA 4KYUA 2W2LD 3IA7A 4YACA 1TXQA 3PS9A 4L7VA 3RYCA 3D31A 2WDZA 1JTVA 3LQ2A 3VO1A 2BIVA 4XTRA 4HWKA 1PFQA 2ZIUB 4C21A 3KYJB 2IBSA 4DR2B 4FNOA 2ED1A 5ALSA 2WQ6A 2XYQA 2BFOA 4TLAA 2C31A 3S28A 2CHQA 1TK3A 1PYDA 2CDBA 1R64A 4DA9A 1QC5A 3CKKA 1UGRB 3OMGA 1T0PA 2QTAA 3EA5A 2Q4DA 3OP1A 2WAOA 4C0FA 1QGZA 3PQEA 1CZUA 4I4IA 5DM70 3THYB 2WWWA 1FTGA 2H0RA 1RYZA 2HGZA 4FMPA 2MHCA 4OH1A 5E8JA 1XLVA 1ONSA 2WYVA 4O33A 5HOQA 4LF6B 4W5TA 4PZEA 4X93A 5LJ3d 4POOA 3OOSA 2HF8A 3IOMA 3K9FC 3S3NA 4RJJA 4U02A 5ARCA 3KTDA 2ABWA 5AXBA 1WPRA 3TKAA 1JJVA 4A0FA 4BTVA 2G9QA 4D4MA 4EZEA 2Q3EA 2RGRA 3GLFB 5CR9A 5EJ6A 1JL3A 5IAEA 4BKOA 1BDIA 1ML3A 4Q4HB 2ZDGA 4I50B 2PSDA 4UQOA 4Y1FA 3JD4A 2CLFB 1RJ9B 1J0CA 3CF4G 3OMXA 4KBYA 4DSNA 1XQHA 3U40A 3BF8A 1RYBA 3NZEA 4FQ5A 4P0PB 5D00A 4D57A 4IIVA 2D7DA 3AMVA 5FUWA 3OESA 1FFHA 3IDSA 4MHOA 4WL0A 4TYWA 4BFXA 1GCOA 2JKZA 1NTRA 1BQEA 1ZZEA 4Q4AB 2DLPA 2R7LA 3E1KA 1HQDA 3MCVA 1AVZC 4K87A 5LQUA 1KRWA 3BMQA 3P96A 2CJPA 3FTEA 2WFZA 3L8CA 3RVSA 3I9LA 2QROA 3RANA 1Z0SA 3R20A 1VQ7T 1BU8A 4WFQA 3IP8A 2OO5A 4MJXA 3QTBA 4J1TA 4AKGA 2XUJA 1G8JA 1QH0A 2IU3A 4PZUA 4BMCA 1R0CB 4F4JA 2WU8A 4MWTA 3M5AA 1NPTO 4BS9A 5LLSA 5T4HA 1TU3A 1LDNA 3AK4A 4A0RA 1XLUA 3B2NA 3O8QA 5EMMA 3QEJA 1MO3A 1V8OA 1NYRA 3M0QA 5H9WA 4BX3A 3U7HB 1ACJA 4HB3A 5GAMg 4XFKA 4L75A 2VSQA 2OTCA 5AVUA 1LA2A 1U99A 1D2RA 5DWQA 5K4HA 1DCTA 3ZY6A 1JDSA 2QYOA 1C7FA 1A9XB 2EKPA 1LNXA 3N07A 4EQ6B 5JDCA 2J48A 1DAOA 4CLXA 3WX0A 2OTLQ 1PR5A 2WJHA 3KHTA 4JSYA 5K3AA 2XRZA 4X1IB 2DB3A 2VDVE 1YZNA 8OHMA 5JC8A 4AS1A 1QYWA 2IHBA 4OYRA 3C1UA 4CC3A 3GLSA 3D4OA 1VQ5A 5LP6C 1MAAA 2ZI6A 3PU6A 4TN5A 2FN8A 2CNBA 5E7QA 3TX6A 4AUKA 2PQ0A 4BMXA 3RQSA 1L9KA 3ZUGA 3I1JA 1O94D 4P7JA 3CXCP 1GA4A 3HJUA 1H641 4GBJA 2RGXA 4O3FA 1JBMA 3G79A 5CCDA 1PDOA 3AIIA 2CB9A 1Z9BA 3NHNA 3CXUA 3F97A 4GNKA 1KYZA 1RPZA 2M1HA 2NUTB 2PVPA 1NG9A 1WY5A 2HPVA 1V39A 1LX6A 4V0ME 1U3GA 4UVIA 2GXQA 1AA9A 1J9ZA 2VJKA 5HMLA 3O7WA 2YJGA 2OTLT 4RY9A 3FIFA 3L05A 2BRUA 3HP7A 4WLFA 5HJEA 3NG1A 4XD2A 2LJ3A 3BGIA 4KR7A 2A57A 2HSWA 1F0PA 2BMJA 2ZIAA 4JLKA 5J2UA 2DUMA 1DOAA 2UAGA 4IJ6A 4QGBA 2AOTB 4FYPA 3IELA 3QUSA 3DE0X 3GLHE 4GSYA 4KODA 1RXVA 1T9HA 1VJDA 3EXEB 4B46A 1IVYA 4AYTA 1V1RA 3KWJA 2O7RA 1XZAA 5IYZF 3M1IA 1NPYA 5CLJA 1RM3A 2IU4A 1T0HB 2ZKIA 1OI4A 3IE2A 5D51S 1OOEA 1NFFA 3AGQA 3Q6MA 4OXIA 5TARA 2PU9B 1U3CA 3GJ6A 3VC2A 5JMTA 4LHSA 1HJDA 3OZTA 2CZCA 1LNZA 3GFQA 3IHWA 4AO8A 5HK0A 4HUQA 3J7AC 5FD8A 2LCQA 4KLNA 3ZZUA 5B53A 1C6VX 2HD0A 4IYRA 4YY3B 3I4LA 5LB2A 3DPUA 1HDIA 4XD7A 1DWPA 3QEMB 4UMEA 5IAKA 1SU6A 3LPAA 3SQNA 3ZBPA 1WXIA 3NB0A 5BSHA 2LT1A 4IZHA 3LP8A 1TTHB 1F51E 1NVMB 3HU1A 4R8RA 5JCJA 4DW8A 5HKCA 1WMEA 5GONF 4UCXA 1M1YB 3LWDA 4O4LA 1KDZA 2LIPA 2LJ1A 1C1AA 5GANf 1XZKA 1YKFA 3TEFA 1NR7A 4QUEA 2ZAEA 1M6NA 2PWAA 2Q49A 3OUZA 4GRIA 2QT9A 3R6TA 4H1UA 3Q87B 3PPIA 4PZAA 1IJBA 4YXFA 1MRZA 5DGHA 2OHVA 2GHTA 2GCXA 3FDFA 3GJ5A 5I47A 5IMSA 1PQWA 2XUAA 4LJ8A 4RS4A 2RH8A 3NHSA 2HA3A 4LRXA 5ALRA 2X7JA 1ND6A 3CW2A 4H3SA 4ROTA 1YFJA 1TMKA 3MJSA 1X6OA 3F8WA 4M7AE 1X80A 1AT1A 1GAJA 1WAMA 2JD1A 1YI8A 2Q4RA 3HRKA 2ZUEA 1N2JA 3F7MA 4WBXC 1Z6TA 5ALLA 3WGMA 2BUDA 4G24A 4WESA 1CRQA 3UJDA 4J4BA 1ZITA 3L8EA 4XU2A 2C2HA 3GNSA 4DC0A 1P7PA 2J3JA 3DH0A 3T5BA 2YN2A 1JBKA 1YI2T 1V8PA 4BCBA 4B3HA 3G71A 1OIXA 3B7GA 2XIQA 3CO0S 5DXFA 5EKDA 2C2MA 4EGFA 2QLTA 3VS7A 1NQTA 2WPDD 1KORA 4EGQA 4KWTA 4L9WA 1OV6A 4QAQA 1OYVA 5KJ6A 5DXAA 1FFSA 1UBHS 2QN6A 3DXYA 2KI5A 3IPRA 1A88A 3L2ZA 4O2BA 1MFZA 1VFNA 4JP1A 2JMCA 2G0TA 3BORA 1QRAA 1H2BA 1KH3A 2FEPA 4LXQA 1WZUA 3LX8A 1GPJA 4G1VA 4QTUB 2FZVA 3DWFA 4R7GA 5K99A 2EZ4A 5BNIA 4H18A 1ZI6A 4C0QC 4QKUA 1C4XA 2WJGA 1HBJA 1AZSC 1WGSA 1NYQA 2A86A 2GVZC 2OV1A 3JZDA 4ZV7A 5REQA 3SR4A 3DEZA 3SQMA 4A9AA 1EUDB 4S1TA 1D0SA 2I29A 4PJOG 4KQ1A 4C2AA 2HREA 2FEWB 3CKYA 4GPD1 5KNCA 3FMPB 4B40A 3HWSA 4BL5A 2AW5A 1W9MA 1SQFA 4PO1A 2UXCB 3MMNA 2MSKA 4BN0A 3IO3A 4GEKA 2P3OA 3PE4A 3EC1A 4FFWA 5EWLA 1P73A 4QPPA 2Y67A 1AO0A 2J0SA 1Z5WA 2YIMA 1JXMA 3QX7A 3V9AA 4H1WA 3UMFA 1YRHA 3H19A 3KUUA 4HT3B 4NL3A 1XP5A 1PZFA 2FN3A 4X1YB 1KQSS 1LX7A 4IHAA 4IURA 1FBNA 3Q1LA 2PS9A 5FWXA 3RU9A 3PFSA 1Y1QA 4BMOB 4MQMA 2DY0A 2PUCA 1S8FA 3JB9F 1PJRA 2A3RA 4EHJA 1GQYA 2H5IA 1N2CB 4PLWA 1V8FA 4UZFA 4N6NA 1QIIA 3JWGA 3QQPA 1YB5A 2IHZA 3Q7TA 5G41A 5C0OE 1U3VA 5EMLA 2EFCB 3N5BB 2EBWA 1IZ6A 2X86A 4FU0A 4BB5A 5JCOC 2JVIA 3VVBA 3KZXA 1P2FA 1RQNA 5JWHA 4FYXA 1ZHFA 2IXFA 3CRRA 3EASA 3L04A 1CUWA 4EELA 5F5LA 4CNBA 3PRYA 3ANTA 1MOQA 13PKA 4CPDA 2PUJA 4R1UA 1QFYA 1YNSA 6ADHA 4EI2A 2CDCA 3JWEA 4LDRA 2WILA 2BGUA 4K11A 4EMKA 2HF2A 3PCRB 3PFHA 4X45A 2C7QA 3OP4A 1GPLA 2BW0A 4TYYA 4WNIA 3E3MA 5HHTA 4PR3A 2IE8A 4U2CA 4BKUA 3JALA 4F11A 1P1FA 3LYIA 1FXUA 5PNTA 3HTXA 3R7AA 4X8HA 3G85A 2P6OA 5G0WA 4XRGA 1RQGA 3UMGA 4IO0A 3ZXXA 4BB6A 3NHPA 5CB6A 1VG8A 5FI3A 1Z6XA 3HY3A 1NMQA 3IB6A 4JR2A 2W4MA 1OBVA 2XDAA 3IALA 2H17A 4QHTA 2GMWA 3IDFA 4OHVA 5ADHA 1CPYA 3VZSA 2V7UA 2YZKA 3N8GA 1N77A 2CJWA 3QV2A 2ZWPA 1KJNA 4Q15A 4M8NE 3LRTA 4CM9D 3CZ5A 3DAOA 3BRWD 5CHEA 1NR5A 3LLSA 4HDCA 1ZIOA 3OJWA 3ZK8A 3NP9A 5LUBA 2VR1A 3SFMA 2XCOA 4NI5A 3DZKA 3KLNA 1R0BA 3LY5A 3BWDD 4G8DA 4CMKA 4D0RA 4B3RB 3ZV7A 1ZX1A 2R1VB 4IRMA 1E18A 4TMZA 1TK9A 1R50A 4O2BF 4UM9D 2IWRA 1BMQA 2AK2A 4ZTUB 5H3HA 2D3TA 3ZBTA 5K0SA 4INOA 2DC1A 2D0DA 4GSLA 2W22A 4FYKA 4M0PA 4NZ9A 4OYLA 4ZQEA 5AO9A 1KBOA 5HUHA 5JQGA 1PTKA 1JS1X 2EW1A 1LZLA 5FKJA 1Y5IA 4BO4A 4D4JA 1SQ0A 4WK0B 3MCAA 4F84A 2XIDA 5KX5F 3TLGA 2CKDA 4DQ2A 2XUZA 4MV7A 4RVNA 3VKUA 4DY6A 4EX7A 3JZIA 1G9XA 1PHTA 5DKFA 1BMTA 3NJRA 4HX5A 4UBJA 3K9LA 4RA9B 1R0BG 5TRTA 2VDWB 1UBTS 3GFBA 4XM0A 2A5JA 2O7VA 2C9OA 2IQ5A 1ZJ4A 4AUEA 4RHCA 4PLCA 5YASA 2PLNA 3R1IA 2D5IA 5C8VA 3C6ZA 3G7UA 3E9EA 1RAHB 1R6TA 2O9JA 3MTEA 1UHFA 1IHXA 4J7XA 2ISQA 3MS7A 1JHXA 4E2FB 3JWPA 4E5PA 6REQB 1Y96A 2QYHA 4LZNA 2IP1A 2A9RA 1EXNA 3ONEA 5C8YB 4L3WA 3KQUA 3JQDA 5IHNA 2XBUA 2XVMA 3QWBA 4GVLA 4LRTB 4XYEA 2HF7A 2A5LA 1E59A 2COKA 4FGWA 2YRFA 4M9CA 2XQJA 4DLLA 1PL8A 3L0SA 1IG0A 1Z4NA 3DZDA 4NBLA 5JS6A 4R8VA 2FKNA 3ZU6A 4BC1A 4YMVA 3JZAA 1L7QA 1P9NA 4LRYA 4A36A 1XZMA 3IH5A 5DJ5A 1AY0A 1HYGA 5K6AC 1U1GA 2VQ6A 2QGFB 3EIHA 2O2DA 2O20A 5AQ1A 2Y6UA 1EX1A 3EDOA 2H4YA 4F04A 4BE2A 1OXMA 5ISMA 1TIBA 1S3FA 3UA7A 2P7IA 2YNMC 1YCGA 1FNNA 4D8DA 4OB0B 2YQ5A 3O8DA 4MK4A 1XMSA 3L5KA 3UJ9A 4B85A 4PLHA 2YVKA 3FWHA 1SUSA 5KMGB 1ZCZA 4RK6A 5L6LB 3ZGLA 4ANFA 3KEOA 1UADA 4CM9A 1WXFA 3OZSA 4E22A 3HXMA 4MVJD 5KVQA 4DA7A 4LMAA 1TQDA 4HAIA 2I4MA 1PJCA 1R8SA 1VI6A 3DKMA 1N9ZA 3GLVA 5LU9A 1AHNA 3JU3A 3LUCA 5CJPA 5SZJA 4HDSA 3ZY4A 3UGKA 4O6JA 1ZWLA 2Q3MA 1Q11A 3CGWA 3DOEA 4ZEWA 2J3EA 1P2UA 3TG2A 1C7EA 1LK0A 3GLGE 1ODLA 1OVGA 4M8SA 2XDWA 2Z5FA 3AGPA 621PA 4JLNA 3B89A 3CMAT 3FBWA 3I35A 4UM7A 4HCJA 3V1KA 1XU7A 2XWPA 3HKCB 5CM8B 1K5PA 1Q0TA 1E96A 3U4QA 1EFUA 1CIPA 3SM3A 4K88A 2LZ0A 2QM3A 9LDTA 3KQNA 2M2IA 4G0UA 3CUEF 4NCNA 5AYVA 1A2BA 4DC1A 2VJMA 2UU9B 3WHIA 2K2MA 3HKDB 1RI4A 4DDHA 4RG2A 2EBHX 3FCCA 1SCDA 4ZN1A 1NUHA 2PYIA 1VGRA 2BGRA 3BSSA 3KVNA 3BGSA 3L18A 2DLDA 3OC0A 4Q66C 2FMHA 4Q9DA 4WUTA 1G4HA 2OCLA 4J7UA 1GITA 4YMWA 6PFKA 2ECPA 5FTMA 3Q12A 4Q1DA 5D6NA 3TIGA 4JC5A 4Z7OB 5JUWA 4HFMA 2IYQA 3TRHA 5F33A 5CDHA 2O59A 1E5TA 1IB6A 3R7WB 3CCST 2VDMB 1GPAA 2VRCA 1Z6AA 3DG9A 4JZKA 1Q7YU 3RAEC 5GAN4 1G8PA 4M37A 1IHOA 2X22A 3GLXA 2I65A 1U3FA 1N7IA 3T7SA 4MEBA 4PJOD 2OCKA 1SG5A 2ZUWA 4B2YA 5CLQA 3X44A 5EFZA 4HDNA 1XX6A 1YJWQ 1W0CA 3F96A 1M6VB 3HB5X 3KHSA 4DZZA 3FTFA 1XVAA 1Z5OA 1E1NA 4UREA 3ZUPA 1PTJA 2OCIA 2GHIA 2YHBA 3KKOA 1XVLA 3QBYA 3ND8A 1C3JA 4K6HA 1O57A 4RZIA 3REAB 4NAVA 4P7FA 3EB9A 5IF3A 1VCIA 3O8LA 1DDIA 3LWIA 5BSMA 2QR3A