3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
molecule keywords Disks large homolog 1
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
1JNYA 4LJ9A 2CHVA 4IXMA 3IIMA 3KXIA 2A3RA 4P31A 5AWFC 3ZVNA 5FBVB 2IS4A 2X8AA 1A5TA 2GBLA 2VP9A 2ZYTX 1G7SA 4NE2A 4PQRA 421PA 4M1SA 5AJVB 1KSGA 1TQ2A 3QEOA 2ZRIA 1EWRA 2OCPA 3CNOA 4PAOA 3L0IB 2ZE5A 3K09C 3OAAD 4IEEA 4WIAA 1ZD8A 1V5WA 2JCSA 3I8XA 4MGYR 2XX3A 4U5XA 1QCFA 2QL6A 1G3QA 2IYTA 1C4OA 4A8JB 1SKYB 2QTFA 2LQNA 4ZDIA 1KFZA 1WQ1R 4DLRA 2VP6A 1NYFA 1GBRA 1RPZA 4LHVA 2WJYA 5FOUA 3V4RA 2BMFA 5AR1A 4OMPA 2NQ2C 1SGWA 4CEJB 4AG5A 1CLUA 1CTQA 1FQJA 2ZVPX 2RQRA 5TMPA 2KRSA 2C77A 2QZ4A 4DVGA 2V1RA 2EQBA 1GP2A 3QF4B 4F92B 4Q1AA 3LX5A 4G1UC 3THYB 3FGNA 2NUZA 3SFVA 1PUIA 1W70A 3NPFA 2G0NA 2CT3A 1CSKA 4Z51A 2A08A 1KDOA 2JLXA 2JDIA 2WOOA 3B13B 3SYNA 4FINA 3LO5A 1UTIA 3TSWA 1E4YA 2M0YA 1VPLA 3PQCA 5KNDA 1XEXB 2BDTA 3REAB 1SHGA 4PR0A 2G0TA 2GBQA 3VFDA 1WX6A 4RD0A 4DCUA 1EFTA 4R71A 4QBHA 4B2IA 4KVAA 3WNBA 1W44A 3OEEA 2F1RA 4E5UA 2O8CB 2ROLA 4R7ZA 4Q03A 2ED1A 3VS2A 4MH0R 1P4SA 3T1OA 4CVNA 4NKRA 1UBGA 2BBWA 1AK2A 4XWAA 1G41A 3ZZTA 3UXMA 1OPXA 2ZRDA 3CRW1 2Q9CA 1E2GA 5CYPA 3C7KA 5D3QA 2AHOA 5ECAA 2C9OA 3SEAA 4JL5A 2QBYA 2VP5A 2GAOA 2C96A 4J9EA 5JRZA 1JJVA 1R0WA 4AG6A 3AKCA 2XXAA 1N0UA 4C0HA 2BJWA 4KITB 1UKZA 1X8LA 5JWHA 3SQWA 3E5HA 4DWJA 1S1NA 5FI1B 3VR5A 4IIMA 2ECKA 2VO1A 3BXZA 2QROA 4KAXA 3HU2A 4Q4LA 4P32A 1FQKA 4TMVA 2DY1A 2JLQA 4EPTA 1R0XA 2QI9C 4PC2A 1FTNA 3BFKA 2VYFA 3QPVA 4NP6A 4HCKA 2GXQA 4OI4A 4TQAA 5FUWA 4A2QA 4B48A 1KSJA 4AFUC 2C99A 2WWXA 3CF2A 4LE9A 2IYYA 2QMUA 2JA1A 2IL1A 5GJVB 2PT7A 1G8YA 3I5SA 1G3IA 3WXMA 2KBTA 4Z8YA 1T8TA 1LF5A 4OMMA 2J5XA 2W0MA 2YOHA 3S1AB 1BBZA 3W34A 1S9DA 2MSCB 2ZAOA 1TUDA 4HSEA 4TMKA 4POAA 1XCGB 2OXCA 4A4DA 3VQTA 1W4BA 3SQXA 4OYHA 3BOSA 1WBBA 2IYRA 2GXSA 2OZEA 2WTUA 1TUIA 4PC1A 1CF4A 4JLJA 1DAMA 1IN6A 1V43A 3O8DA 2H57A 2BCGY 3ADDA 2G6BA 3L0SA 2GWHA 1YCSB 1X3SA 2X3XD 4PO1A 4B6FA 3HU1A 2JLWA 2IXFA 2VRWA 5IF9A 2FA9A 2CE2X 1G8GA 2HEIA 3QY0A 5BYKA 1E2PA 3QKRB 1ZIOA 4PX9A 3SHFA 3LLUA 4A1FA 1G9XA 5IXFA 5FI0B 1JJ7A 3BB4A 2WKPA 3VHLB 3SEMA 4IDNA 3TK1A 1OH6A 2XJ4A 4LC1A 4PPGA 1JEGA 2V1QA 1KK2A 5TARA 4BLQA 1M6NA 5E4FA 4G5QA 2F2VA 2FRYA 1GNRA 3GLHA 5UKDA 1I1JA 1Q22A 2K5UA 4HDOB 4JYCA 3ZVMA 4MKGA 4RD1A 1C9KA 1Z6TA 2NO6A 4PANA 4FI3C 3CUEF 5GADl 1I2DA 4Z88A 2CNWD 1EGAA 3BFXA 3CRMA 4MUBA 5CJ2A 1BU1A 2HDAA 5KO2A 3C8UA 1E0AA 3QBVA 3ND8A 4JLNA 4W9MC 1CP2A 3NH6A 3B5JA 2CLSA 2RN8A 2K9GA 3I92A 1VG8A 4A8JC 1ABOA 2QMHA 1XTJA 3K0SA 1RC8A 2ZEJA 1E79A 2JLRA 5BN3A 4BFTA 1E4VA 2R6GA 3IEVA 4TYQA 3A6PC 2QORA 1U8YA 3Q5EA 3ZLJA 1S96A 5FR1A 5E7IA 4Q4HA 2G1KA 1PRLC 4F4IA 1A7JA 1S2MA 2YV5A 3OIYA 4ZKEA 3V00A 4OL0A 2N1BA 5G41A 1L7VC 4URUR 1AZGB 4K81B 1XZQA 4M1WA 4R2HA 1W2HA 4MKIA 5KPJA 1E2LA 1GCQC 3CZQA 4NPHA 1UJ0A 2QDLA 3A1WA 1HJDA 3IIKA 4GFDA 1YWPA 4PHGA 4B73A 1OFIA 1OHHA 2AXPA 2J41A 3K70C 4EDHA 1ZNZA 1G64A 3RBBB 1KYIA 2W6IA 1ZC4A 2WWIA 2DBYA 2WV9A 4C2UA 1PNJA 1E79D 2ASEA 1Z0KA 4PSVA 2H8KA 2N46A 2FOLA 4XTRA 1MRNA 4L16A 4MRNA 1VECA 4BFVA 4JS0A 5JCZA 721PA 2UZ3A 2A30A 3SFZA 3T5DA 2HT1A 3AVXA 2IS1A 2D7DA 1ZD9A 1E2EA 4Y0AA 4PC3A 2YKGA 2PMDA 2EYWA 2DWQA 2VA8A 4TYNA 1UFQA 4TTPA 3OFND 4B6EA 3NXSA 2ZQ5A 2WWFA 4L9SA 3SJZA 5H1YA 1CXZA 4PPNA 4WAUA 2DFLA 2X2EA 5D3MA 5FBLB 4P4TA 4XSHA 3NMZC 2XZPA 2OSBA 4NYIR 1II8B 3JV3A 4Q4AA 4DLYA 1UJ2A 1F2UB 1XZPA 4JIMA 5EXTA 1LCKA 2OAP1 4OI1A 1YU9A 3ZYCA 4HI0E 2HUPA 3T15A 3W90A 2VHTA 3SBEA 3WBJA 4EUNA 3WY9A 2CT4A 5EUMA 1X43A 2G1JA 3NH9A 5JBQA 1P62B 5JJLA 1CJTC 3BWDD 2PT5A 4Q9HA 2PBRA 2VSOA 4Q4AB 3QSYA 4S2EA 1X27A 2ZE8A 2FMXA 3LBIA 4AYTA 2R9VA 1GKYA 4O0MA 4OQLA 5TXGA 1AZSC 2W0ZA 2FSHA 1CJKC 4RFSA 3W6NA 3ZS9A 5C4MA 3I4LA 2C9YA 3GLGA 2PZGA 1TUEA 5AUNB 2J0VA 2JS0A 3NEJA 4IW3B 2O2OA 2PZEA 2C0IA 4JYBA 5CK4A 1M2OB 3U2QA 5H70A 1R5OA 2R65A 3VS6A 3OIUA 3TVTA 1H8EA 3LW8A 2CH4A 2ZSDA 1D8TA 2FV8A 2QA5A 3SZRA 2EVRA 2C98A 4MRPA 4BFYA 2EGEA 5EC7A 4DHEA 3AP2A 3SU8A 1M7GA 5KDDA 3AKYA 3GLGB 2FFBA 4D8DA 2WJHA 5KSZA 4KFSA 4LJ7A 1Z8FA 1DAEA 2QE7D 2VTKA 4CGZA 1CU1A 2FF7A 1DAKA 4DCSA 5HKKD 3LV8A 4C2TA 2Z43A 1GL7A 2B21A 3CX7A 4H1VA 4RCYA 2C03A 1G6HA 2EFGA 2OILA 3U60B 2XGJA 4G5SA 1F2UA 3CNNA 1KKMA 4AD8A 3VTKA 3I3SR 4D0LB 4BFXA 3SR0A 1U9IA 2ZRAA 3AVQA 3AH8A 2H5EA 1AZTA 3TVDA 3AGQA 3B8HA 4MGZR 3RWOA 1G8HA 1T3LA 4HAVA 4KYUA 2QRZA 4L5BA 1W7AA 4E09A 1MOZA 1NVWQ 1YZNA 2ZE7A 4TL8A 1GL6A 1ESMA 4HAUA 1MT0A 1J3TA 3K0FA 3RRNA 1UDWA 4LYJA 3U4QA 3THYA 3DDCA 5I11A 1S1CA 3B1YA 1FUUA 4NU0A 2YC4C 4ACAA 4PSAA 3U3JA 2IK8A 3NC1C 1KO7A 2E9SA 2P67A 1OFUX 4J9CA 2OAQ1 3ASZA 4UNRA 3EHRA 1L4UA 2H18A 3KUDA 5LD2B 1N6IA 1IY2A 4NCKA 5GVRA 1NY5A 1AM4D 2ONJA 1IM2A 1R8SA 1NMZA 1UHFA 2OE2A 1ZX6A 1IXRC 1KI2A 2HT6A 4LC0A 3K70B 2HYIC 1HD3A 4CC2A 4URXR 3KXKA 3FVQA 4PAQA 4AKIA 2WAXA 4IJMA 2ZREA 2WHXA 1RLQC 1RLPC 1E1RD 1E9CA 2KXDA 4J9BA 1X6VA 4GLMA 1X86B 3UG7A 2VEDA 2BC9A 1CKBA 4A63B 1ZM4A 2ZUDA 3WNDA 4ZPXA 4CYMA 2XZOA 3I62A 4JSTA 1UJYA 1R0ZA 3CONA 4OK6A 3F0TA 3VMFA 1TEXA 2EYYA 3FMOB 5HZHA 3VS1A 2WKRA 2Q9AA 1DS6A 2ZVQX 3RYTC 1MUZA 1W6XA 2C0OA 1E94E 1TAGA 4JLMA 1G17A 4QJ5A 4AFZC 1SPKA 2RGGA 5L8VA 1IN4A 1ZIPA 2CEAA 2JIZD 2ZRMA 5F3WB 4C7OA 2O8EA 4F7WA 1Q1ZA 1H8KA 2PJZA 3HP1A 2LMJA 2YC2C 4DLVA 2DF6A 4BUJA 4US2R 3LBHA 2WWGA 3GJ0A 4PAMA 1SXJA 3K0CC 3FWYA 3N2IA 3HWSA 1E0SA 1G5PA 5EZ5A 4V0OA 3QE0A 1OH5A 1ZM7A 2QT0A 1Z0JA 1H8HD 4OJKA 5JSZA 3PG5A 1MKYA 5IXBA 2PX0A 1MRSA 1W4RA 4B75A 4EQ6B 2EW1A 5FWBA 2CHQA 2QMEA 1WI7A 1KAGA 3Q72A 3T35A 3I32A 1JPJA 2ZUBA 2CDTA 4D4MA 4QJ3A 1VYVA 1AWWA 2R2AA 3PEVA 5AUPB 2J59A 1IN5A 3B78A 1YQTA 1OIXA 1VIAA 5K8IA 1PLJA 1X1RA 5C18A 3R8FA 2BMEA 3M0SA 1QF9A 4XIGS 2ZETA 4QBFA 3T1QA 2HF8A 1GNPA 4KVGA 2QENA 1WCV1 4QC2A 1HT1E 4MKHA 2GCOB 1GRIA 1SVIA 3K0EA 3LD9A 2KBFA 4D80A 3OFNA 1XD2B 2QG6A 1JECA 2O5VA 3REFA 2A5GA 3T1VA 3ZIAD 3RC8A 2DA9A 2LWIA 2L2PA 3Q3JB 1CKAA 2GCOA 2CK3A 4YONB 4DEXA 1RRGA 1WMSA 2Q6TA 1KJYA 4TLCA 4UJ3A 3ZQ6A 2ZR9A 4EIWA 4RTTA 3W3AA 4M1KA 4Q7MB 3EZ6A 2V55B 2WBLC 3RWMB 2ZJOA 4ZO4A 3U5ZB 1XXHB 2NTYC 2XAUA 1AWJA 1H8ED 2D06A 4NYMR 3OAAA 3KJGA 3PV0A 2ZR0A 2F3RA 1S3SA 1DE0A 1F3OA 4DIDA 2P3SA 2QTHA 2BEKA 2OCYC 3LRPA 4JL6A 1SZPA 3NDPA 4ZCMA 2BCJQ 5EE1A 2OI3A 2KROA 1FP7A 4RTZA 2BTTA 4BE7B 4IFEA 1Q0UA 1YR7A 1R8QA 2YSQA 4NL4H 5AJZA 1VCNA 3M4YA 4A92A 4EJSB 3PE0A 2OFWA 4PHFA 1MABA 2L3SA 2CLDX 4V0ME 4LUDA 5JI3E 1T0JA 5BQ5A 5FUXA 1G2BA 2DR3A 1A4RA 1J8MF 4I81A 2KRNA 3TW8B 3I5YA 1WBDA 4FWTA 3LXRA 5FOWA 5IHPA 1G5RA 1G6OA 1AVZC 4N1AA 1KI9A 2DL3A 1AZEA 3TJZA 3TNFA 5DHAA 5B58C 4M4SA 3EA5A 1HSQA 2KNBB 2ESWA 2W10A 2QTVB 4QNRA 4DLWA 4JLKA 3FB4A 4EPXA 1CR1A 1XX6A 1UEJA 1Z63A 4OQNA 2QGZA 2MMGA 3AVPA 4I1SA 2F9LA 2XEXA 1WFWA 1XMVA 2P6RA 2I0NA 5AJWA 1UDXA 2JLZA 3CR8A 3KXLA 1SKYE 3QXJA 2WPDA 3U23A 2ZYVX 4M8NE 2FJUA 2NO1A 2RQUA 1NSFA 5CITA 5DYIA 4CDGA 3WHKA 4DRZA 2BMDA 2ZJ2A 1KO8A 1R5BA 2ATXA 2OXRA 2XB4A 5SZKB 1EX7A 4ZDKA 2ZU0C 5FFMA 2C2HA 1EFCA 4JVMA 5A5GA 4TWZA 3GBQA 1IY1A 1UKEA 2A78A 4ZV4A 2ZI4A 1FPMA 2FFQA 3NWJA 3BFVA 4PHHA 5B30A 4JLDA 1LV7A 1G3MA 4GBQA 2GJKA 1MH1A 4Q47A 2ZIAA 2O88A 2FH5B 1GCQA 4Q4JB 4U7DA 3LX8A 2MSDB 3H86A 4W5HA 4E03A 3U6KA 4B3XA 3LH5A 2E87A 4EAQA 2WICA 2O8FB 3LFUA 4XOIA 1ZM9A 4HB2A 3BD9A 1E2JA 1SXJC 3K0CA 1WXTA 2NO0A 1G1MA 4IVQA 4B44A 3VHXA 1JQJC 2JIZA 2GEDA 3A1UA 1EG7A 1GG2A 4RFSB 3PJRA 2N42A 3LY5A 4AKHA 4CC3A 2EFCB 4EKDA 3AGPA 1AKEA 3NHNA 1VTKA 1KHTA 2C78A 2EU8A 1EFRD 2UZIR 5EQTA 4X1VA 2ANBA 2B8TA 2DX1A 2EFHB 2ZRFA 3BB1A 3GLIE 3EARA 1TTTA 3NDBB 2C8VA 4TQUS 1VG9B 2ZI7A 2XSZD 2DL7A 2PL3A 1G4AE 1E1QD 1TU3A 4QGHA 2XB2A 1A2BA 5L3SB 4S35A 1ZMXA 3U3OA 2OCAA 4MUAA 2HDNB 4C30A 2FEOA 4ACBA 1A1VA 1YRAA 4GNKA 1OF1A 2WJVA 4HDCA 3KKOA 2J1LA 1NBME 1NIJA 2CMKA 1KI6B 3WYGA 2H8HA 3NKVA 1CEEA 4R0KA 3K9LA 1OXVA 2CCGA 4V03A 3KZ1E 1CRPA 2NPIA 1AKYA 2D74A 3VS0A 1K0XA 4WW0A 4XTCS 3KFVA 1AGPA 1PWTA 1P2SA 4UNNA 1SRMA 3UA6A 2JJ2D 1ZNWA 1R6BX 1GCPA 5IK2D 1UKYA 1NM7A 4QG7A 4YMUA 3TIFA 2GZHA 4FXPA 2BWJA 2JW4A 3MWKA 1TQ6A 4IVRA 2ZROA 4LBWA 4W5WA 4NYIQ 2RPNA 2DB3A 4DUGA 1VA7A 4PC7A 1OV3A 2ONKA 3J81k 2VHQA 3T5GA 1W5TA 3U7EB 1OH8A 1OPKA 2LCSA 4DBLC 3NC0C 2JS2A 1VHTA 4XD7A 2O8BA 1M1YE 3UWKA 3VS5A 3QKSA 1E2MA 1M74A 3IBYA 4Q9KA 3AKEA 3I9QA 5DIFA 3VAAA 3PEYA 1KJWA 1L2TA 4P4UA 4A36A 3KKPA 1J2JA 2F3TA 4QGGA 1ZUKA 1AWOA 1OYWA 5H68A 3M1IA 1Z08A 3ZD7A 2IYQA 5TVKA 2K7AA 3LBNA 1E7OA 2O52A 4OK3A 4CEHA 4NBSA 2AK2A 4BFUA 4BWYA 2W83A 4BFZA 1UBFA 5HR5A 1HE8B 4TZ0A 2J7PA 4ZIRB 2A5YB 5JSZB 4GZMA 4HAZA 4JVSB 2R6FA 4EFMA 4EIKA 4XH9B 4M4ZA 1YHNA 4C3ZA 3AF4A 3WYAA 1TF2A 3KQHA 1P9RA 4PPQA 1S3GA 1P9WA 4GP6A 4KFUA 3QKRA 1WYXA 3H0FA 3LDAA 2ED0A 5TDHA 2JTEA 1VYTA 3THWA 2DRKA 1X8JA 3WBKA 2AWOA 5G40A 3DZ8A 5FL7A 4AURA 3RC3A 1YP5A 2O0HA 1OYYA 5BN4A 4K8OA 4C4PA 1M30A 3VU9A 3B7GA 3M0UA 3P20A 1G83A 4J9GA 1G8PA 2IUTA 3EWAA 1NEBA 1E0JA 5HTKA 2CL6X 4R9UC 3CBQA 5DI3B 3O47A 2REOA 3V4FA 3B82A 3DHWC 2ZS7A 4PQYA 1BB9A 1WB9A 1RJ9A 3M0QA 2J6KA 3DKPA 2JLYA 2KYMA 2ZJAA 3DMDA 5FUYA 4RKFA 1BK2A 3H4MA 3VKWA 3VR2A 1JXOA 1R0YA 1EESA 2F43A 1OIVA 2A2ZA 4F16A 1OXXK 4RY2A 3MJHA 2CBZA 1N6OA 1XJCA 2WKQA 1I4LD 1Q3HA 2REBA 2AD1A 2VH5R 3FTQA 3RS3A 4D81A 4IVPA 2G3YA 5C4GB 1NBMA 1BMFD 1NNEA 2KT8A 1JR6A 2GDJA 2BKEA 2FE4A 3U44A 5J4KA 1GFDA 3MLEA 3TLXA 2KGTA 1QHIA 4DSTA 3VKGA 1Q44A 5L3QA 1T8UA 3PCRB 4IKEA 2ZRBA 3QKTA 4AWXA 4CRWB 1W48A 4FMCB 5GJVC 1ZUUA 4TQ9A 2GKSA 2IBMA 1TQ4A 4PHTA 4LYHA 1ZW6A 2R44A 2FO0A 2B8WA 4XVQA 3QF7A 3ZGXA 2QEQA 1WXBA 4JBYA 4UNSA 1GRQA 2HLDA 4ZKDA 1KI4A 4UKDA 1UADA 4WXPA 4OI2A 1UHCA 2KSQA 2V3CC 2HCBA 3F5FA 4P33A 2EPDA 2W2XA 2SRCA 2F9MA 3TRFA 4A8JA 2O8BB 4KHZA 4KV9A 4TLAA 2DL5A 1P60A 3PUXA 2F55A 1TADA 3C0CA 4F4JA 1E96A 1OV4A 2C5LA 1TUCA 3B85A 3QWXX 3S1AA 1OPLA 4X8HA 3CM0A 1O3YA 3A37A 1IQPA 1FMJA 1QDEA 3GEIA 4Q19A 2A5FA 1RFLA 3ZIAA 1KTVA 3VS4A 3A1TA 4A0GA 4Y92A 1HT2E 3RAPR 2BBOA 2VSXA 5TB5A 4YQFA 4KO8A 1NVVR 2PMKA 2IYWA 4ON9A 2D0NA 1DAIA 1JI0A 2YJTD 4Q18A 5KOYA 2NO7A 3F8TA 3UATA 2SEMA 1EX6A 2IYLD 2ZI5A 3HPRA 3RNLA 3QVUA 2PX3A 1WA7A 4HLUC 5DNYB 1C1YA 1NN5A 1R10A 3DO6A 4PXAA 1FP6A 4PZLA 2D7CA 3QQ5A 2AK5A 3TR0A 3FJ5A 5CB6A 2EGAA 1RRCA 1ZUNB 1NG2A 2DL8A 1Z06A 1Z22A 3AV0B 4OJQA 1OB5A 4HDQB 2W6JD 3ECCA 3EG5A 2P6NA 3SYLA 4O2RA 1DELA 1Z2AA 3OZXA 1NIPA 2QQEA 1WRBA 4LGMA 5JEDA 1TQDA 4B3CA 4RD4A 2PEYA 3JVUA 4BEBA 1P3JA 2FPEA 3JVVA 2B86A 2I3BA 4M9SA 4Q00A 1QVRA 4LV6A 4JZ3A 5FTJA 1ZNYA 4NTZA 5D3MB 5FPSA 1L8QA 3T1TA 3KFXA 4LUEA 1NG9A 4BFWA 1ZVQA 3UWOA 3EW9A 2JMCA 1SHFA 3QG1A 1MO3A 3QXHA 2EFDB 4ZNXA 4JBWA 1DO0A 1KDPA 1PUJA 3M6AA 2DWOA 4TLEA 3EPKA 1E9RA 3KJHA 1E99A 2XNDA 1OLOA 2WMOB 4JJDA 3THXA 2EWVA 2RH5A 1XBTA 2LJ1A 5FBWB 3FHOA 3H0KA 1QHYA 4B74A 3VU9B 4CC4B 3KJIA 4F17A 4JSYA 121PA 5B64A 3GLHE 5GJWC 3VR6A 4EPVA 1A2KC 1KI3A 1LW7A 4Z8XA 5KU1A 4TT3A 3GPLA 4ZCLA 2DBMA 1G19A 1SQ5A 2Q3MA 3T34A 2B92A 1QWFA 221PA 2ZU6A 2RKOA 1GWNA 2QP9X 2OFXA 3K0AA 4JJBA 2P65A 2J46A 2JXBA 1XTKA 3O8BA 1Z0IA 1Q1QA 1JB1A 2Q0HA 2J0UB 2J6FA 1DADA 3BAFA 5JWOA 1RE0A 3L8YA 2FDCA 2F43B 3GCGA 3MWJA 5DGXA 2FGKA 5CLLA 1TX4B 4DJTA 1UE9A 4NCNA 1M27C 1W36B 2XITA 1EXMA 1U94A 1J8YF 4CT4B 3ADCA 2RB4A 2FGJA 3CR7A 3FE2A 1SULA 2CUBA 5FBRB 3H41A 4TYPA 4QL3A 1E98A 4BECA 1DAGA 5DI3A 5TV2A 4Q7KA 4ZI2A 2X3WD 2CH4W 1W5SA 2Z0MA 1WE2A 3BC1A 3HU3A 3DPUA 4GBMA 4KLZA 4OHVA 2XNDD 3TR5A 2KBEA 1F48A 3REGA 2RGDA 3R9XA 4LHYA 3QEJA 2OBNA 4HLUA 3C41J 2AZVA 4JPBW 3WP0A 1X1SA 3BERA 1Z5ZA 1FMLA 2C04A 3VRZA 3X1DA 2HEQA 4HAWA 1NN0A 2DMOA 2K79A 3M0RA 2AKAB 2JT4A 4KCGA 1YZQA 1W0KD 1ODFA 1JR3A 3KKMA 4JT4A 5FOTA 2JM8A 1Z6YA 2XTNA 3CB4A 4ITRC 1ZUHA 4US0R 3AKDA 1GOTA 1K5DA 4NMMA 4WA7A 2G6FX 2DFTA 2LP5A 2LX7A 4KSBA 1NLZA 4TMWA 4IOKA 2PCJA 3TUIC 5C2JB 1PRMC 1XCPA 4BLOA 4ZIRA 4DCVA 3VRYA 1E2FA 1ZNXA 821PA 1W4CA 1ZSGA 1QWEA 4LNPA 2ZRNA 4JLVA 4YMWA 5KDOA 1OKKD 1XJ0A 2RMOA 2QU8A 2WIBA 3CPJB 4C0BA 4CW7A 3GLHB 2GHIA 2LQWA 1I2MA 5DISB 1RW4A 4JVLA 4AC9A 2CVHA 4TSFA 3EZ9A 4YXWD 3ADBA 2LKCA 2WPDD 1PJRA 2J3EA 2V6JA 1KNXA 4FN5A 4AY2A 3ZVLA 4V0NA 3EHQA 4CZ2A 1JR3D 2NOAA 2VP2A 2WOJA 4ILEA 4AFSC 5L3RA 1US8A 1E9BA 1QHGA 3EC1A 2QBYB 2MIOA 3AF2A 1AOJA 2ZS9A 1Z6XA 1II0A 2DYKA 2B7BA 1Z6GA 1KY2A 4ABYA 2XMFA 4CC7A 1A82A 2CHGA 3M0EA 4LSGA 3X2SA 5HPYB 4QGAA 5J4HA 4URYR 1SKQA 2D4HA 1OE0A 1G5TA 4KBGA 4DIEA 1AS0A 1OT3A 4ORZA 8OHMA 4M9QA 4LHZA 1NI3A 3BE4A 1KZGB 3K09A 1XPRA 4N0EA 2BZYA 3C16C 2YT6A 3OF5A 1IONA 3IILA 2PEZA 3IHWA 4DSNA 1Z0FA 3AM1A 521PA 3EG0A 2QP3A 2ZANA 3ICEA 5B57C 1DOAA 4AYWA 4TSFD 4YXWA 4DDVA 4PZYA 1KK3A 2CNWA 5HCIA 4QM7A 1N25A 1LTQA 4IIOA 4Q9JA 3DZDA 3AUYA 1UECA 4B2PA 1R4AA 1ZD1A 3P26A 4IXNA 4FD2A 3SYKA 2WVJA 4D4JA 5CDFE 3WYFA 1P73A 4RTUA 4DZZA 3QF4A 3G5UA 3FMFA 1TPZA 4YDSA 4UNPA 4LJ6A 5GJBA 1D2MA 2FPKA 1XTQA 2O8EB 1KJZA 1UGVA 5GJWB 2IF0A 2LCFA 2KT1A 1VDZA 3SNHA 1G21E 3VNUA 1EFUA 1XDBA 5J47A 4Z1MA 4MQBA 2IWHA 4OQFA 3PIRA 3OEED 4LPSA 4LBZA 4TL9A 4B2LA 4O3MA 1D9ZA 2ZRJA 4OHZA 2KXCA 4Z89A 4KLNA 4QHTA 1FL9A 2GJ8A 4JLAA 3RNJA 2C95A 2CCKA 3NBZC 1YZGA 2ECZA 1XEFA 5FWCA 3N5CA 1KO1A 4BGDA 2XZLA 4A6XA 4EPYA 2A7QA 1E6HA 2QE7A 1XD9A 3IHLA 2ZJZA 3TSZA 4DLSA 2AFHE 3SOPA 1T0HB 3WRYC 4YMSA 4J0QA 2FSGA 4UNQA 2Q21A 3R9WA 2O9SA 1QHXA 1QHHB 3W8NA 4RZ2A 4UJ5A 4FIDA 4F4CA 4RVCA 1COWA 1MR3F 1CR0A 2ATVA 3VR1A 1K5GA 3CIOA 4BLSA 2PH1A 2GXAA 2HCKA 1JEEA 3RVBA 3U3MA 1W0JA 1OHHD 4B71A 1T9HA 3G0HA 2KE9A 2GK6A 2CSIA 2QAGA 4GZLA 1BO6A 2C0TA 2W6ID 4A9AA 3I5XA 1E2HA 3W5IA 1U5SA 3OIVA 5KSPA 1VG0B 2Z5FA 3Q8XB 3I72A 1GVNB 1CIPA 4H1UA 2IWRA 3RRYA 2IYSA 2K3BA 1YJ5A 2YVUA 3FFAA 2FWRA 3OIWA 4OBEA 1ETUA 1K76A 3PUZA 2ODWA 4A15A 4HZUA 2ERYA 2BEJA 3WMFA 2OG2A 1T6NA 3UG6A 1X2KA 3KKNA 2OV2A 2DFNA 3GFPA 5J4LA 3FKSD 3CRVA 4A0FA 2AK3A 2FPDA 2ZITA 2M51A 1GFIA 2EGCA 1T0HA 2YWEA 4R98A 1OEBA 4QRHA 4MYCA 5J4VA 1ZC3A 3IBGA 4OK5A 1IHUA 5CIQA 3H0HA 3KJEA 4Q1CA 1LS1A 3BK7A 2FEIA 2YOGA 3ICQB 4KU4A 2PNIA 4CEIA 2DLPA 2O0KA 4LHWA 5LBIA 5I22A 1M8PA 3EIQA 3B9PA 4NZYA 2FRWA 2BOVA 1TG0A 5DSZA 3ETLA 3KB1A 5KSOA 5FPYA 2GESA 2VLIA 2F1HA 5AJXA 3MRSA 1S0UA 5L3QB 4N0DA 1D2NA 1AN0A 2RQWA 2DHRA 3UMSA 4XVUA 2RHDA 1F6BA 1NG1A 4DB2A 1KI7A 1P2UA 2RGCA 2XOKD 3CPHA 5JMTA 1CR4A 4NCHA 3MGCA 2V4ZA 1YWOA 5FW9A 1XCMA 4Q1DA 4PO8A 3GFOA 2RAPA 4QNMA 1NLFA 2JGNA 2OCBA 3U3RA 5EXXA 3W8RA 3X1XA 2OLKA 5FOXA 5EE9A 4GOKA 1QHSA 2TMKA 1SVMA 3BRWD 3DM5A 4XJXA 1G7TA 4IOJA 3V9PA 4CT5A 4IDHA 2A28A 3ZL7C 3C14C 3NHAA 4FMDF 1SVWA 2BM1A 4JL8A 2D8HA 3O5ZA 2V9PA 2EKHA 4G5OA 3QXXA 2I1VB 4IDOA 3SBDA 1DARA 3QXCA 2O9VA 1GBQA 1P2VA 1US8B 3WNCA 1ZAKA 4ARZA 1TF5A 4B76A 5DN6D 3GLFE 3D7MA 3I8SA 1DO2A 1ZCAA 1B07A 2FFAA 2FSIA 4GI7A 1EFRA 2QAGC 3BIFA 4KXFB 5BYJA 5EZ6B 3BB3A 2ZYWX 3C4JA 4F14A 1N0VC 1XOVA 5KHOC 2RGXA 4TYWA 1YZKA 1KKLA 4HB4A 1GFCA 2AWNA 3FDIA 1ZBDA 4DCNA 3RSLA 2JAQA 2WJJA 1HEIA 3A98A 5G3YA 1N6LA 1F2TA 3UA7A 2H1LA 4J9HA 2CK3D 2P2LA 4TL7A 5JLJA 5JS7A 2ZPTX 1XWIA 2V1UA 2I1QA 1K0SA 3THKA 2ZM5A 1XTIA 3L8ZA 3GEEA 3NEYA 3TW4A 4I1OA 1DG3A 4HLDA 3PUWA 2AKLA 2BIFA 1Z0AA 2HF9A 1SXJB 3VX4A 5FUVA 2Z6VA 4Q5IA 2DL4A 1XTRA 4FMCF 4ASUD 4IDQA 3DM9B 1ANKA 4L8GA 3EC2A 5EXSA 2G88A 3CWQA 3GFTA 1ELOA 4MKFA 4RKEA 2AL7A 2QT1A 4UQOA 3X1YA 3FMIA 2ZJ8A 1I4DD 4LPKA 2JJ2A 5K8LA 2CE7A 1WXQA 1E2NA 3QOFA 4F93B 4CEHB 3CX8A 3Q85A 2J7IA 4DDUA 4A0HA 1MV3A 1N6KA 4NONA 2FSFA 5IHNA 3AF1A 5AUQA 2OBLA 3K53A 3A8TA 1FZQA 4B35A 3TGPA 4DT1A 5CYOA 5EJEA 1M3CA 3MAAC 3RSOA 2YZ2A 3VR4A 3AVVA 1E9SA 4OHXA 1SHKA 1GKIA 2OJ2A 1O87A 2VPPA 3CLVA 4DDTA 4A2PA 4BLTA 4BEJA 1W0KA 3OEHD 3Q7QA 1NJGA 1BS1A 1RRFA 1N0WA 4JJKA 2V1XA 1ZCBA 2IIMA 1XTSA 2ZRGA 4DXAA 2VVKA 4C9BA 5JHHB 1ZYUA 4HATA 3UPUA 4LYFA 2EYQA 1FNMA 3ZZUA 1GL5A 2GVZC 2AKKA 1LY1A 2GAAA 4MGIR 5IK2A 2YUPA 1UDLA 1Q3TA 1ZU5A 3RABA 1DG1G 1KK1A 1RYHA 3C5CA 4Q21A 2CSQA 4LBYA 4PFSA 1K6MA 2YNMA 1EWQA 3AQ4A 1JBKA 2JASA 1AS3A 1YVDA 2OLJA 1YNZA 2DNUA 2XNSA 1AD5A 3EZ7A 4JT2A 1R2QA 1AA9A 3TQFA 4PZZA 4I1UA 2RF0A 4Q9LA 5K8TA 1U8ZA 2BVNA 2FZ4A 4NCIA 3EZFA 3MMPA 1T5IA 4G5GA 4C0JA 3EPLA 2YINC 1MV5A 1LVGA 1FNNA 1NSTA 4GOJA 3D6TB 1JPNA 1XFAA 3FMPB 4B3BA 4J9FA 1U81A 3A4NA 1D6JA 1E2QA 1U0LA 3K8YA 2F1IA 1T3HA 3AB3A 1FUKA 2QNRA 2HSPA 1G7CA 3HJNA 3KTAA 1DBSA 1S4QA 1MO4A 1QHHA 2KWIA 4JVNA 1NMXA 1T3SA 2HJVA 2X77A 1BOFA 3BJIC 4Q01A 4E22A 1NVVQ 1AQYA 4MYTA 4AK9A 2ZE6A 2WAYA 3THXB 1Y3AA 5FL3A 4C0AC 2REXB 4TYYA 4LJYA 2D2EA 2ZJBA 1RI9A 1KSFX 3Q9LA 1JQQA 1N5KA 4DDWA 2AKYA 4TT3D 2H16A 4GMDA 1XEXA 3W6PA 4GSYA 4QHYA 3B1XA 1KGDA 2PZFA 4M1TA 2CJWB 3IQXA 4X8LA 5HZKA 3G82C 1HH4A 1K8RA 1OIWA 3L2OB 1N6PA 4HVUA 1BKDR 2DBKA 3MCAA 4BFSA 4L4UA 3IGFA 5FOVA 5HCKA 1PZNA 5JI2E 2KB0A 2NWMA 1Y0MA 4QBIA 1Z9QA 1E6CA 1Z29A 1KOFA 1KDTA 2FZLA 5LD2C 2XJ9A 2DPXA 2FNAA 2R6CA 3MJRA 4JLOA 2QUZA 1G20E 1A0NB 4M22A 1E32A 4Z54A 3LWNA 1ARKA 4O2LA 1JU5C 1PV4A 1NKSA 2GF9A 2JATA 4XSGA 3HR7A 3UMFA 5KTYA 4LN2A 2O8DB 2ZRCA 4ERNA 3TKLA 2LZ6B 1NRJB 2IXEA 2P5SA 4HXJA 3D3QA 4KYIB 4RCZA 5DI9A 1CJUC 3AEZA 5FPTA 3GLGE 2FX3A 2QAGB 3QVVA 1LFDB 4RD2A 3RS2A 4FWIB 1NF3A 3KDSE 4I4LA 2IYUA 4E6RA 4OMOA 4CEIB 2IS6A 2OO7A 3CWZA 3KB2A 2D2FA 1N6RA 2GTJA 5IHKA 3K9GA 3LVRE 3T06B 1IJEA 2AXNA 2ZUCA 1OFTA 2OAWA 1EK0A 2PJRA 1VCOA 3ZQJA 3P4XA 2DWPA 4UXJA 4RTVA 4H9GA 2EWWA 4RTXA 4AIIA 2YHSA 4W7SA 4F38A 5AK0A 4NYMQ 4GP7A 1RJ9B 4WZ6A 1X69A 2WZQA 1W0JD 3AVOA 2J0QA 3DOEA 2GRJA 1LNZA 2IHBA 2KEAA 4B3DA 1E1RA 4EFNA 1J99A 4OI0A 4NH0A 2QN6A 4R2IA 1E2KA 3EIHA 1F60A 2F2WA 1Z3IX 2HXSA 4ZDJA 1QRAA 1QG2A 1T5LA 4YMTA 3ZD6A 2AZSA 4B3FX 2ZSFA 1FOEB 3SHWA 1NY6A 5IDVA 4V0MA 3Q5DA 1PKSA 3U44B 4WZAE 3IO5A 1IXSB 2FU5C 3PVQA 2J06A 3KQUA 2L3QA 2QPTA 1FW6A 1MABB 4C0KA 4DLXA 2AD5A 3TSOA 4A0RA 1GM5A 1UBCA 4TZ6A 1NVXQ 2QSZA 3TAHA 2X19A 3B1WA 4MGKR 1ZM3A 2ORWA 1D5CA 2VF7A 5DH9A 2IYXA 2HCJB 2HJGA 1HE1C 1GDDA 2QRNA 5FR2A 1XPOA 1OFHA 2YWGA 1W1FA 3EG1A 3VS7A 2YUNA 1KAOA 3HDTA 3GJ3A 3AVWA 1P5ZB 4N3NA 5JRJA 5KYKA 1OKKA 1X8KA 1OW3B 3PUVA 1KSWA 2Y8EA 2HBWA 1E69A 4JLPA 4LWZA 1XXHE 2H92A 3W5JA 3EX7C 5EE5B 1G7RA 1SEMA 2VIIA 1FX0A 4ASUA 1CJVC 4HAYA 2R62A 4M1MA 3JZAA 4GT1A 4GRAA 1YR8A 1IO6A 2A5DA 1XU4A 1ZLMA 1IJFA 3HPQA 4PO9A 4M9ZA 2FPMA 1XEWX 2JJ1A 3OE7A 2R6AA 1P7CA 2QQ0A 1ZUIA 1XMSA 3H1TA 4P4SA 1X6BA 1E2DA 4LHXA 4HUQB 5CM9C 3CW2A 3B6EA 1ZJ6A 4KRTA 3QNUA 4Q9IA 1N5JA 3GMTA 2GZDA 1MV0B 1BYIA 3THWB 5L3VA 2ZXUA 3SN6A 2XSZA 3AF0A 3IQWA 4DKXA 3KKQA 2Z4RA 1Z28A 4M53A 4RZXA 2NMVA 1N6HA 2MMCA 3FHCB 2IEYA 5ELXA 1U99A 2F1JA 2L0AA 2J0UA 2GEVA 2VHJA 2RQVA 1N2CE 1AGRA 1M7HA 1W4AA 3IO3A 2J05A 2OESA 1RYFA 4Z8AA 1CR2A 3IKJA 2Q3FA 4HUQA 4LJ4A 5EXPA 1DVRA 1MO5A 4OMLA 2GJ9A 1GL9B 1JQLB 2IEZA 3MWYW 3PITA 2MOXA 2LKDA 4JJZA 3AF3A 1KI6A 2DCUA 3CKLA 1JEDA 3U4QB 1PKTA 4X8OA 1OB2A 4URWR 4HZIA 3QKSB 4DSUA 4D2IA 4DLZA 4DB4A 2Q3HA 5FTMA 5LB4A 3GJ5A 2ZRHA 1KO5A 3ND9A 1E3MA 3P32A 1HV8A 1TU4A 2JJ1D 3NIBA 1XD2A 2PLRA 3RLFA 1XPUA 1ZBJA 3I73A 4GOXA 1AIPA 1TMKA 3EIEA 3O8RA 4BRWA 1IY0A 1CJMA 3OHMA 3PUYA 3PVSA 2DE0X 5CJPA 3TQCA 4NYJQ 2DFKB 2GJSA 1IN8A 4PQFA 4IFBA 3WRXC 2ZR7A 1OH7A 3AVUA 4EFLA 1XMIA 3QXSA 2OEPA 1X6GA 1U98A 5IH2A 2GETA 4OKSA 4BRUA 3LNCA 1KI8A 5F2EA 2EYZA 1D9XA 3M0TA 4QOSA 5DLQC 1E0KA 3N2EA 3SJBA 4CF7A 3PENA 4LI0A 4QHSA 2CCJA 4GPTA 4B32A 4WCIA 2ABLA 2JDID 1FMKA 4TLDA 1Q1EA 1QKXA 2F6RA 5J5CA 5JWRA 1I0CA 1GUAA 3B9QA 3X1WA 2DM1A 1J70A 1P9NA 3EPJA 2VF8A 5J4YA 1WIEA 2AN9A 1H65A 4RTYA 2RCNA 3LA6A 3VX3A 3GLIB 1B3QA 4D82A 1K9AA 4RD6A 1E9FA 1RVDA 4D6PA 1BH2A 4I1VA 5DE3A 4QGFA 5IT5A 3U61B 4KSCA 2V7QA 3SC3A 1GTVA 5CB8A 4MDFA 2LJ0A 3EA0A 5SZJA 1UUEA 2ZTSA 2P4RA 3THOA 4DSOA 4EPWA 2LNHB 2GTPA 2GGRA 4B47A 2XXAB 1XMJA 4PC6A 5CK5A 1QHNA 3CF0A 1Q57A 1U2RA 5A0FA 5K8UA 1UM8A 2OFOA 3LLMA 3B1VA 3L0PA 4FCVA 3VS3A 2A9KA 2VL7A 5E7JA 5EP1A 4JMPA 5FPHA 3DVLA 3SI7A 3PFIA 4RSGA 3U7FB 1SVOA 5EE0A 5HKKA 2D3WA 1QVAA 3QJYA 1L4YA 1HQYE 4TMXA 2ZI6A 4OQXA 1LF0A 1QLYA 3TMKA 1BMFA 3SS8A 2W58A 4Q1EA 2JLVA 2Q9BA 4RFVA 4IEIA 3U7GA 3FHTA 2P0EA 4FCTA 2FN4A 1EFNA 4YMVA 2KE5A 3SDZA 1VIYA 3ASYA 3ULRB 3U7HB 5JJIA 2FG0A 4D4LA 1NJFA 2J7KA 4AKGA 4TMTA 5IRCD 2WSSA 3UF4A 3QPUA 3WMGA 5EE3A 2CL0X 2WIAA 4Q1BA 3GLIA 1J7KA 4AI6A 1QKWA 3GD7A 3K0FB 4FW9A 4D0NA 2IW3A 4NCJA 2W2TA 5P21A 1RRPA 4W5JA 4XD7D 1OXTA 1I4TD 2RGNA 2ZRPA 3LQRA 5J40A 2EBPA 4D25A 1JO8A 1N5LA 1P61B 3NHBA 3ZDQA 4CEJA 3ZZ0A 1E9DA 2BKUA 2IYZA 2OBMA 3H2YA 3EXAA 1N5ZA 4A82A 4FMDB 2V6IA 2ANCA 1HTWA 1NN3A 1XD8A 1NYGA 4LJAA 4PPFA 3BBPA 2V7QD 1E6GA 3DOFA 2YOFA 1GRNA 4BPBA 1IXZA 3UK6A 1NLYA 1YR9A 1IN7A 3PR1A 2NPFA 3K9HA 2WMNB 3REBB 3PVLA 4Q7JB 1PVOA 1AJEA 2ZRLA 2PLFA 2QSYA 1G3RA 1GAJA 5F9FA 2IA5A 4QJ4A 3ZVRA 2FPLA 5KSYA 3LQQA 1Y63A 4HB3A 5SZIA 4P0TA 4DT1B 1II8A 5CLQA 3EG3A 1SXJE 3MWLA 2O8FA 4EPRA 2XTZA 3B1ZA 1S9HA 3QWYA 2IYVA 3M0PA 2J6OA 1Q12A 2OT3B 4EJSA 2F2XA 1U3OA 1XRJA 3MG9A 1M8MA 2ENMA 4I99A 1DAFA 2OUKA 2CREA 4QKQA 3MSXA 1WDTA 3L43A 2KI5A 6Q21A 2OHFA 2RQTA 4AYXA 2PCLA 2VQSA 4NDZA 1U0JA 3NG1A 2UKDA 1HURA 1W49A 4LK2A 2J45A 2QM7A 2BHRA 3VR3A 1XB2A 4TLBA 5FL7D 4LUCA 1WP9A 2RGAA 2ODNA 5G53C 2JLUA 2A5JA 2NGRA 4M21A 3NGPA 1Z6AA 1HYQA 4HLQB 2IUUA 1U06A 4IHQA 4WOPA 1GZSA 4DCTA 1B23P 3GLFB 4AG2C 1VKJA 2YUOA 1KK0A 4BLRA 2RNAA 4OQMA 3TUJC 3RS4A 1QG4A 2AR7A 2RGEA 4IOMA 4Q4HB 1XXHA 3VKHA 1GRRA 1KMQA 2WM9B 3AUXA 1T91A 5FTNA 3R7WB 4II7A 3GJ4A 4LX0A 2D1XA 1NLOC 2R6DA 1GNQA 3HYTA 4TN1A 5DYGA 3UIEA 3WP1B 4HB0A 4KFRA 1OXUA 3GEHA 2QAJA 2BJVA 3LAWA 4LCBA 3RANA 2H7VA 2X1VA 2OM2A 621PA 2VHUA 3QKUA 2DILA 1G4UR 3DMNA 4KFTA 4PSKA 1UFFA 4C0SA 1SHZA 2NO9A 2I4IA 1RUWA 2VWFA 3CF6R 2WWWA 1W36D 1NBMD 5IHIA 4WZBE 2GNCA 1IOZA 4M0LA 1JR3E 2GVDC 5KPDA 4J9DA 2ZJYA 2YWFA 2ORVA 2K2MA 5EP4A 4WXRA 1P2TA 4LZZA 2XOKA 1KMHB 4IRUB 3R9IA 2GCNA 5AUOB 5SZHB 2KJQA 3E70C 4P3YA 5JCPA 2LJ3A 1U90A 1R7RA 2UVQA 4KJZA 2NZJA 3BS4A 3NBYC 4GMXA 4M1YA 1D2EA 4Q66C 2G83A 3W9YA 3A4LA 2D8JA 3HYRA 1NN1A 1G16A 1G8FA 1UPTA 3CPEA 2HLDD 2NG1A 1S1MA 4DUGD 5BXQC 2A37A 1AQUA 4TTRA 4DLUA 4HUTA 1IAQA 1EFHA 3IDQA 1K1ZA 5E7MA 3PEUA 4A6PA 1XJQA 2O31A 1YE8A 1ZINA 3D8BA 3F3YA 1P6XA 5JFGA 1F2TB 5AJYA 1KSHA 3FPAA 2JEOA 4V0KA 4X8MA 5HE9A 2QPAA 1KZ7B 2ORIA 4HLCA 3IUYA 3PEWA 5CDFA 1F5NA 1DPFA 2YYZA 2MCNA 4YC7A 4Z1MD 2PTKA 3EWSA 4P4SB 4BZQA 3K1JA 3QUSA 1RIFA 2DYBA 3L0OA 1SXJD 4K11A 1JAHA 3QIAA 4LDJA 3EG2A 4LOAA 2YDLA 1VYUA 4MYHA 2QY9A 1H92A 4LJ8A 3N70A 1W1WA 3RHFA 3CH4B 4Q7LA 4D0GA 1G291 2IHYA 2YUQA 1N3BA 5BW8A 1E9EA 4TMZA 4FMBB 1IBRA 3AVYA 1KNQA 2CXXA 2QMOA 2J7PD 3B60A 3O8CA 4LY6A 5E3HA 5H8WA 2GJAA 3CO5A 1CRQA 4MRRA 2WJIA 1YN8A 3PXGA 4B33A 4IOLA 4TTQA 2K6DA 1WXUA 3K0AB 3CH5A 3CX6A 3DEFA 4AKEA 1TEVA 2AX4A 2ZSBA 4URZR 2VP4A 1GKUB 1ABQA 1W47A 3AVTA 4BZPA 4NHOA 1ZP6A 4HVVA 4XWKA 4Q02A 3I35A 2GBLC 2ZI3A 2GILA 1HUQA 1BYUA 3W6OA 4C0QC 1RZ3A 4RZUA 1AS2A 2A36A 2BM0A 1KO4A 1YRBA 5DHFA 1BIFA 2GTOA 5JEEA 3CRQA 4C7OB 1SRLA 3RDPA 5LPNA 1II9A 2ROTA 1U0HC 1Z2CA 2EW3A 4K46A 2V8OA 2CUDA 1UKVY 1YZUA 1NLPC 1KDRA 3TUZC 1W2GA 2VKNA 2WWHA 4ARZB 3OEHA 2J9RA 2BZ8A 4U00A 3GJ7A 3CQTA 4LV5B 3K9NA 4HAXA 4MYUA 5L3SA 5F9HA 1QBKC 4AG1C 1LB1B 2NIPA 2CJWA 2W6JA 1ZUYA 3I1FA 3EPHA 4YDHB 3BORA 1X2QA 3GJ6A 1WLPB 1YR6A 4JLBA 3ZH9B 2X2FA 2XTMA 3GJXC 4HYYA 3KUCA 3I61A 4QBGB 2RHMA 1HQCA 1XF9A 3FKSA 4MA4A 2DRMA 4C0LA 4OHYA 3R20A 4XVRA 1I07A 4RJLA 1YZLA 2IX3A 4V02A 1DAHA 1ZRHA 2PZ1A 5BN5A 1DTSA 4BZXA 2GEUA 3TAUA 1TF7A 4HZUB 3QI2A 3FKQA 1LS6A 1S8FA 1VG1A 4O25A 1FTSA 4J9IA 3DKVA 2FEMA 5EP2A 2EYUA 2V54A 5JZVA 1W36C 1OJLA 4ESRA 5KUTA 2IUSA 3ZS8A 2L3PA 3H0IA 4JKYA 3CNLA 3EASA 2P5TB 3FOZA 3NTUA 3P1JA 4NYJR 3KQLA 3T12A 5JJKA 2VP0A 2L0XA 1Q20A 3GQBA 3T61A 1JAIA 1OOTA 1W46A 1DEKA 2SHKA 1WF3A 2JLSA 1VCMA 2IXGA 3P27A 4FCWA 1U8AA 2QPOA 3AP3A 3UKDA 2ERXA 4UXIA 5HCNA 2O8CA 3MD0A 1CKEA 2ZSAA 2GQIA 4MRSA 1Z83A 5FBQB 2P6UA 2F7SA 4M9XA 3L82B 1Z47A 4MITA 4DC9A 3EAQA 2ZAMA 2E1RA 2HV8A 4RZ3A 3D31A 2RGNC 3W3ZB 2BZXA 5TY0A 3R6NA 1PLKA 2QM8A 5JECA 4LYAA 2H17A 1CULC 1YKSA 2DJQA 1AEYA 5HE8A 1ZU4A 4ZI3A 1FFHA 2W00A 5ANRB 1NEGA 3RS7A 1KY3A 4PTLA 2RMKA 4GL2A 2FG5A 2EYXA 3P4YA 4QFMA 1WA5A 2O8DA 5KDLA 1N6NA 2W2VA 2EVWX 3ONWA 2FFHA 4KODA 2G77B 4LRWA 2BMJA 3QBTA 3LVQE 1TNDA 3KL4A 3E2IA 3IPYA 1T0JB 1XP8A 1VMAA 1YZTA 1Z9ZA 3EZ2A 5LDDC 3RRZA 3BH0A 1JXMA 1NMYA 4US1R 1M3BA 4B43A 2JJ8A 1Z0DA 4G5RA 3K70D 3JZMA 2CLCX 2R8RA 2WSMA 2FPFA 1J90A 4QT7A 3MFYA 4QXAA 4Y0VA 4F91B 4JZKA 3KQKA 1Z07A 3SJAA 1SVSA 3LXXA 4V0LA 4EJSC 2BV3A 1QZXA 1PLLA 1OSNA 3RRMA 4UXHA 2WWYA 3X1ZA 3WHLA 1NP6A 3BH6A 4LV8B 1R5NA 4OMNA 4BASA 2CVFA 2ZSEA 1B0UA 5G3ZA 3MUFA 4URVR 5M04A 4A2WA 1SVLA 1N5IA 1NL3A 2D62A 2VHCA 1U9IC 4BLPA 5C46F 1UF9A 3C15C 4ZDWA 2QGNA 3NVAA 3R8CA 3EGUA 3KTAB 2EQIA 3A58B 2AFIE 2GXUA 4WVFA 4D4KA 4E07A 4RD3A 2QP4A 3QG5A 5GJCA 4OMQA 4L9WA 2O0JA 1K4US 2Z4SA 4D26A 2IS2A 4LBVA 4XWOA 3TE6A 2B7CA 2GK7A 3QENA 4TL6A 1GSIA 2KYBA 1WDXA 1E9AA 1E1QA 4B3GA 2GA8A 5L23A 4ZCIA 2C9CA 3CRRA 4WBSA 1HY3A 4MDEA 3E1SA 3Q7PA 2VSFA 2ZS8A 3AP1A 2J87A 1Q21A 1UBEA 2GNOA 4HEJA 4CIDA 2BBTA 4RUGA 2RGBA 3KX2A 4G3XA 1G18A 3U3KA 2G9NA 5FPKA 1UAAA 1VHLA 2Z83A 2VBCA 2E5KA 3U6BA 1KMHA 1VCIA 5FOSA 1E2IA 1P75A 3KQNA 1UG1A 3SJCA 5E95A 4EQ6A 1V1CA 2ZI9A 4M2LA 4GDFA 2WJGA 4IDPA 2JMAA 5CM8B 4BQSA 3ZJYA 1SVKA 1P72A 2J0SA 2NZ8A 1JALA 1M3AA 1NVUQ 2CDNA 2EFEB 2KRMA 3CZPA 4ESHA 2HYDA 5CIWA 5B2ZA 3RS0A 5DN6A 5DO9A 5EUQB 4OHWA 5C1BA 5F98A 2ZYUX 3FFBA 3OESA 4JJCA 3IEUA 2ODEA 3FYHA 3DL0A 4G01B 4FSSA 1FX0B 3A4MA 3OE7D 3HR8A 2IF2A 3R7WA 3WMEA 1H3HA 1SSHA 3C5HA 1HA3A 3TH5A 1CBUA 1NKTA 1ZM2A 3ADKA 2DVJA 2CL7X 2GZAA 3LW7A 2W0SA 3GLFA 1T4GA 4KI0A 1H8HA 3I5RA 5KNCA 1G3UA 4KBFA 5LB2A 3UMRA 4G0NA 4L15A 1AWXA 2ZRKA 3BGWA 3RS5A 5FTLA 4MRVA 5BWMA 2KR3A 3A36A 4LJ5A 1CS4C 2BBSA 3A1VA 1Y57A 1GIAA 3BH7A 1KIMA 1M34E 1M7BA 2B6HA 2GCPA 3NBXX 4M1OA 2YWHA 3GP8A 3B2EA 1MO6A 5FH9A 4B34A 4AFQC 3NBFA 4QM6A 4JBXA 3A1SA 1TL7C 5JHGB 3UANA 1FYNA 1OXSC 4DLTA 2ODBA 4ESVA 3VNVA 2IT1A 4JZ4A 1RKBA 4JKIA 4HVWA 3GJ8A 4Q4JA 4DEYA 3TBKA 1PHTA 1XEWY 4U02A 1KIKA 2WSSD 5EP3A 2MSEB 4D8KA 1Q1BA 5JS8A 1ESNA 5GVSA 4RTWA 2JM9A 1COWD 1KI1A 4Q48A 5A4JA 3IPXA 2IC5A 3H84A 3IQLA 2HXYA 1GILA 1ONBA 2ZJ5A 3QPWA 4Q1FA 1XNJA 2GF0A 3SE0A 4YLGA 3IIJA 5KNBA 1GITA 1UEIA 5FTKA
chains in the Genus database with same CATH superfamily
2GZ3A 2CHVA 5H16A 3IIMA 3SC2B 1VE7A 2E85A 2ZBUA 3GDGA 2HMUA 3I53A 3HJTA 4BP1A 1NATA 1K5HA 2HIMA 1XCBA 4M1SA 5AJVB 1KSGA 2CP3A 1KFEB 1GZ3A 2GZMA 5KNCH 3DOIA 3IDFA 3EGXA 1JJAA 2JVKA 3LCMA 4RGVA 4TRMA 1EWRA 2OCPA 4G5HA 3OAAD 5FUMA 1BS2A 1JFRA 1PT5A 1X15A 2V7PA 1ZD8A 1IOVA 4WIAA 5DHSA 3I8XA 4MGYR 5JBIA 2OGTA 1N4AA 4RTJA 1XVLA 2XX3A 2GUGA 3QEMB 1SCQA 4P6VF 1TE2A 2QL6A 1G3QA 4HDRB 2J9FB 1C4OA 3SC2A 1D0IA 3MS4A 3HLKA 4W1RA 3S2FA 2LQNA 2WSFE 4FE4A 4B7ZA 1WQ1R 2I67A 2VP6A 3BTUA 4QTYA 1WW3A 3TMAA 1GBRA 4LOLA 5TVGA 2WJYA 1TECE 4FJ0A 2YFYA 3D8HA 2BMFA 5G2OA 1N2SA 2JLZA 4D9MA 2IY9A 4Q16A 4BXOB 1IREB 1CTQA 2ZVPX 4TXMA 2KRSA 1K6XA 2QZ4A 4Y2UA 1D6NA 1GP2A 3LX5A 3OCCA 2LT4A 3RF6A 2W8BA 1H1LA 2WR8A 3BMOA 4WPGA 2NUZA 1K7YA 4MPRA 3TRIA 4BJ1A 4V0SA 3EFHA 1K8AC 1W70A 4M8IA 5TR9A 4M78D 2CT3A 1J56A 3V4OA 4DIBA 1WMAA 2F4NA 4TTVA 4PICA 4RZHA 2X0FA 3GOHA 4UBNA 1Q95A 1NV9A 3TSWA 2OB2A 2ZSJA 1Y8ZA 4IUCS 2DJ5A 4J43A 4TQGA 4C05A 1SKUA 1ECLA 1XEXB 1DKRA 3ZDYB 1U2GC 4J76A 3FTCA 1HYOA 1TUBA 3BD6A 3IUMA 4F6RB 3VVBA 3VFDA 1DGQA 1YL6A 2DKOA 4GMGA 1EFTA 4RG8A 4ZK6A 1XROA 4E5KA 5HZMA 3I37X 3OEEA 4LRUA 1GNLA 3WYDA 2QLTA 3G4SA 3P52A 2W93A 4Q03A 2VTVA 4MH0R 4R2WA 4NNJA 3RIGA 4WV3A 5KOHB 1V29B 1UBNA 2J08A 4IJWA 1UT8A 2BBWA 3FYTA 4WUTA 2ET6A 4UHEA 4UPEA 5CXUA 4AQDA 3CRW1 2Q9CA 1P6QA 2ODQA 4P7BA 2MYTA 1MN6A 3AESA 3DMGA 3LLVA 5ALSA 1USKA 4AZ0A 4AUMA 2ZZDA 1W5FA 2VP5A 3MYYA 3OETA 2D1SA 2CYZB 2JLBA 1P0QA 1UXJA 1M6VB 3VDXA 4GI5A 1CUVA 1D09A 5LLSA 2GCIA 1FX7A 4W6ZA 3IP1A 3KQPA 5GZ6A 2QTXA 1IDN1 2P9QA 1MC1A 3MC1A 4HADA 1T9KA 5EIAA 3SQWA 1YD7A 2OUIA 4IIMA 3SDSA 4KAXA 4URFA 2PAFA 4ZQIA 1HRDA 1M66A 1X42A 3HU2A 4Q4LA 1TJYA 4Q39A 4JI3B 3COZA 3OPMA 1EEHA 4AMCA 1NF2A 4B4VA 4EPTA 1ODCA 2QI9C 4C92D 4BP8A 2K2QB 4NP6A 5FUWA 1GAWA 3QVSA 2VTBA 3INNA 4IVNA 5ALRA 4QX6A 1TJ5A 1XWFA 1HLDA 1KSJA 2G17A 1M2WA 3JQ8B 3K0BA 3WWZA 4ZJYA 4H3SA 4EJMA 4HT3B 1K6EA 3QZUA 4C22A 2JA1A 3S3NA 3EQ7A 3AT1B 3OS1A 4W5RA 1G8MA 1SXHA 4OXNA 2PT7A 4M7AD 2XA2A 5JISA 3I5SA 3UHAA 1Y4DE 4B4WA 2MYSA 1VQNQ 2BZSA 3IBFA 4UU0A 2OA0A 3ZCRA 1GU1A 2R8PA 1C3OA 2R4QA 1V9SA 4OMMA 3W34A 4RKWA 4A8TA 1BBZA 1S9DA 5ICMA 2ZAOA 2H5LA 3C6MA 3E3NA 1YHQT 1SBYA 1W87A 5K0ZA 1EZ4A 4N0AA 5A9SB 2H07A 1LCIA 1D2RA 2XT6A 5HYVA 1QNFA 4HBZA 3RVKA 2WINI 4G9GA 4CV2A 1KVUA 3JB9I 4OYHA 2PLNA 2XB6A 2IYRA 2GXSA 1S5PA 3G5MA 5D6WA 4BBPA 1IN6A 3DHNA 3ZHCA 2H57A 3AW9A 4GECA 4B6FA 5I2MA 4KH1A 2NNWB 3VZRA 1QPZA 3HU1A 5B3JC 2JLWA 4F86A 1P44A 1DOZA 2VRWA 1NE8A 4ER6A 4RXMA 4COKA 1Y9EA 3K1YA 5B55A 4HH1A 4EELA 3JQ6A 4Y9TA 4A1FA 1K4KA 2QA4Q 2PHZA 4NU8X 2WKPA 2PVOB 4U2KA 3TK1A 1OH6A 2XJ4A 2HJHA 3EXEA 3PEEA 4LC1A 4X1OA 4WN9B 3JCMV 3DJFA 1EKXA 5TARA 1N7JA 4FSXA 1SHLA 2DFDA 4EMUA 2FETA 5AOVA 2F2VA 5UKDA 4D3YA 3WICA 4DNPA 3BWXA 3S4YA 4A5OA 2K5UA 2BH2A 4JBHA 4G8DA 1TYZA 1Z6TA 2NO6A 2X8LA 4FW1A 1FJXA 5KHAA 1I2DA 3QKIA 4MUBA 3BFXA 1RXSA 3CRMA 5DYWA 1MA0A 2HDAA 3KQQA 5DSXA 5ER6A 4UUQA 2JNWA 3DFUA 5AVZA 2M6RA 1VMKA 5J26A 1ZEMA 2C2MA 2JFYA 2ATEA 2QG9A 1F06A 3A6ZA 5TJ9A 3DAPA 3DL2A 3ETHA 2QJWA 2CLSA 1J07A 4JXJA 4K6OA 1OTXA 1ZVMA 2CFCA 4WL0A 3I92A 4ZVLA 1VG8A 2PMBA 1ABOA 2VTDA 5A9TA 1UM9B 4A8JC 4AL4A 5JSHA 2FLKA 3M83A 1MO2A 1G59A 5JROA 1WUIS 3KUUA 5JPIA 5BN3A 4XQ0A 1E4VA 2BD0A 5BR4A 3ND6A 2YJGA 3Q5EA 4P53A 3N75A 4HDKA 1S96A 2Q5IA 5FR1A 3TTVA 1JPVA 5E7IA 3DOJA 2CSUA 2O1WA 3BE5A 3O3NB 3KJQA 4P3KA 3CT4A 5HK9A 1SIOA 5C31A 3RARA 1T8PA 2YV5A 2YRDA 3V00A 1ZO8A 2AC4A 2N1BA 2XGGA 3FVRA 4OVAA 1L7VC 3PRHA 4URUR 1AZGB 4WCFB 4X84A 2Q1UA 2DJZA 3V8RA 4C8QE 1N9KA 1W2HA 2ECOA 1Q6YA 3PPYA 5KPJA 3CZQA 5GAOm 4NPHA 3CZ4A 4JNCA 4K3UA 3LJKA 2X23A 1YIJQ 1HJDA 4I55F 4QU8A 4C8QB 4GFDA 5K2MA 4PHGA 4B73A 1OFIA 4I14A 1N2ZA 2FJPA 2WLTA 1WETA 2E4HA 1JN0A 5GOZA 1UCFA 4BMNA 4C7KA 4MVJD 2W6IA 2OCDA 4KXVA 2JHAA 3QELA 4MV4A 10MHA 5JQGA 2Q4DA 1C14A 2CUTA 2Q2VA 1C6VX 2DKNA 3NUQA 1YS2X 3OOEA 1KFJB 4AG3A 3GZTB 4EAAA 2IIQA 4UE3S 5K6AA 1VGQA 3L7NA 4HRVA 3SZLA 4XTRA 1MRNA 2E48A 2RBEA 2VWPA 1UXIA 1NMQA 4F7UE 1VECA 4L16A 4MRNA 2RM4A 1IPEA 2YV3A 1GV0A 3OWOA 4JS0A 3U09A 2UZ3A 2Q45A 3SFZA 2ZWMA 1R16A 3T1NA 3V1UA 1LC0A 2D7DA 4KUIA 3B6JA 3EOZA 2EDCA 1SY7A 2PMDA 2EYWA 2FN3A 4YDQA 3BFPA 4MMKA 4OBWA 3SWNC 3LC7O 5KVCA 2VPZA 3OFND 3NXSA 4BO5A 3QE2A 5H1YA 2W2OA 2ZPGB 2AQ8A 1G60A 3WB1A 3QJGA 4F85A 3BWMA 2FSSA 2GWRA 3OCXA 4EG4A 3IJEB 3O7WA 2XAAA 3QLEA 2PMFA 3KZXA 1II8B 1E8MA 3QFRA 4PLTA 1UJ2A 4Q4AA 4CMBA 4OI1A 1QRTA 1AO3A 1M1ZA 2HUPA 1MGPA 4YRTA 3W90A 2VHTA 3SHTA 2DEUA 5B58T 4Z99A 4OBXA 1SQGA 2LPMA 3MTQA 5ELMA 5B7QA 2P2CA 1CJTC 2J9ZB 3AETB 2NWQA 3BWDD 2A6PA 4H7IA 3F6SA 3R6LA 3EXHA 5DWDA 1MB9A 2R7AA 3LBIA 5I9TA 4H1TA 4RKUE 1G20B 2E5FA 4DMRA 1NDHA 1BCRB 2W2NA 1E4EA 4NCBA 4KREA 5GIPE 3W6NA 1CJKC 3PXEA 2VNJA 2UAGA 4KTVE 2EFJA 4QEKA 1Z8DA 2R2GA 3BGDA 3DOHA 1NJSA 3ZS9A 3QRWA 2PZGA 5AK4A 1LPMA 2L17A 5AUNB 1I36A 4YMIA 5IZ4A 1Z75A 3UJCA 1HE3A 1K8XB 3D4IA 2PZEA 4H27A 5CK4A 4JYBA 5LQKA 1Z7YA 1I2AA 4KE9A 1M2OB 2DXIA 4G0VA 3T9FA 1Y7LA 3U2QA 2E2WA 1GQRA 1UWVA 5CFNA 3TG2A 4GF5A 3ZE7A 3JWIA 3MMXA 3S1LA 1V8FA 1H8EA 3C4VA 3D6MA 2OTJT 2VUBA 1LI5A 4Y6QA 4NZPA 2JTMA 2QLLA 3W5SA 2AR0A 2F62A 2C98A 2QA5A 3IMEA 4ND4A 4C2AA 3UAYA 4FOOA 4DHEA 4TWAA 5FPQA 4X3PA 1KQOA 4EJ0A 2AG8A 3TZ6A 1J23A 2FFBA 2RC5A 4LX8A 4M8LA 3TNYA 5J2UB 3DYIA 4KFSA 5A62A 1K3UB 4UHCA 2FF7A 2HMSA 1K0FA 4LVNA 4OYRA 1EE1A 1GL7A 3C3PA 4R3WA 4BI8B 1GGFA 2OC4A 4KLCA 3IOBA 2ID9A 1Q16A 3U62A 1ECJA 1F2UA 3BYZA 4JU9A 3CNNA 4AD8A 3CCFA 1SD1A 4OB7A 3T9AA 1Z4KA 3RGWS 4BFXA 2XI9A 2BAGA 4IF4A 3ANMA 1U9IA 2ZRAA 1A71A 1CZHA 3DXZA 2FUG6 1ITZA 4IUVA 2Y0EA 4DGQA 3GRUA 1YI8A 3B8HA 5LQCA 3OKPA 3RWOA 2CUNA 4AP5A 1V7CA 2QRZA 2P9JA 3O31A 3TIGA 4PNEA 4Z2YA 2DKGA 1JEAA 2PNJA 1B8PA 1LD3A 2ZE7A 2NVUA 3CCLA 4TL8A 3WK5A 1GL6A 4FKZA 3WLLA 4L3VA 4QUDA 5KKCA 3U4QA 3G2NA 2A0FA 4C8QG 4LYJA 4UUMA 2ECQA 4YO7A 3H7AA 5IT9E 4A27A 1S1CA 4F3NA 4BTVA 4DPKA 3I6ZA 3B1YA 1GGVA 4GLKA 1EXDA 3LLSA 4UTOA 1S8AA 4BE0A 5T4HA 3U3JA 4EITA 1KO7A 4D1YA 2P67A 1A9TA 4J9CA 1RSZA 2WWTA 4EO9A 4LYGA 3FTPA 2VT6A 3ASZA 4NBNA 2RJFA 1WMDA 2PRIA 3KUDA 5DBFA 3D5QA 3K1ZA 5JXIA 3NYQA 4OHBA 1R8SA 1YOBA 3DPSA 4OMCA 2OE2A 4DARA 1FJHA 1TIKA 1HOTA 3FZEA 2VZ0A 2E0IA 4GXTA 2DF8A 5JALA 4LXTA 3AR2A 1PQUA 3DFFA 1BVRA 3JQBC 4ALLA 4L8WB 4D0RA 4IJMA 3T5TA 1RLQC 1XDWA 5E1OA 3WLOA 1SOWA 1X6VA 2F48A 3UG7A 2F00A 4P98A 3UXYA 4GXQA 1CDOA 1E7YA 2BC9A 4HWSA 4B87A 1EHCA 1ZW1A 5K6AC 3T9EA 4REMA 2XZOA 1T5SA 3RR6A 3IP5A 5KYYA 1R0ZA 3MCTA 2FUEA 1LRKA 3EEBA 4JSTA 3FWZA 1CE8B 4OK6A 3I04A 1CVIA 3VMFA 3ZI7A 1HTBA 3WK9A 4CI9A 1UKCA 5JD6A 5KVSA 1DS6A 4QOEA 4XUEA 3PLAE 1E94E 2C0OA 1NMEA 2IY8A 1G17A 4AFZC 1SPKA 1CIVA 2D2VA 3K96A 4HMQA 1SC9A 1IZYA 3U4HA 3BJMA 3G1UA 2IZZA 2JIZD 1VQ4Q 5F3WB 1Q1ZA 3UJ6A 2YC2C 1BVYF 2RI6A 5JZOA 1MORA 3DSRA 4ZPJA 2HSJA 3HI4A 16PKA 1AVTA 1NC1A 1AQIA 3C6BA 3N2IA 4E33A 1E0SA 9GPBA 1Z88A 2XCTB 5EZ5A 1O9BA 2NU8B 2PK3A 3HEBA 4V3BA 3D1LA 1W2BA 3TNDA 3ZWAA 1WCYA 2P9EA 3S8YA 5IH7A 2BKAA 3ETDA 3UWMA 9ABPA 4G5XA 5JSZA 5IT0A 1JJIA 2WY2D 1NPYA 3FVWA 1W4RA 2PMCA 2IODA 3AC0A 3EXEB 4R1NA 3W6ZA 4EQ6B 3OFJA 3CV3A 2QMEA 1PJ3A 2BHLA 3GT4A 3Q72A 4PGHA 4R3NA 5DYYA 1U9YA 3TL6A 3UCXA 2H1OA 1BCSB 4QJ3A 1AWWA 2VKQA 1ZGZA 1IN5A 5K3CA 4J8OA 3EGDB 3PC3A 3MQFA 3RTBA 3MA0A 4O5OA 3UZUA 2H52A 2OM6A 3WKEA 4RIIA 5BVGB 3TGLA 2QENA 1WCV1 3L7KA 1HT1E 4TM7A 1JFLA 1IHYA 3AEUB 1K6JA 3I01A 1YJ8A 4F7UA 5E8RA 2ZBVA 3P8DA 1U28C 2O5VA 3BL6A 3D7NA 3FGZA 3PQ7A 3O0TA 2JAOA 3OKFA 2LWIA 2L2PA 2W98A 3PNQA 4IJVA 2CK3A 4FN4A 2XMBA 4G63A 4YRKA 4KR3A 2QR5A 2PUKB 2Y1XA 1RXCA 1GG5A 3EXFB 3W7AA 2I8LA 3VVCA 1JXAA 5GAJA 5CNJA 1QX4A 5JJ5A 3BMQB 2VZ9A 1QFYA 4Q7MB 4ENRA 2ISQA 4YR7A 2ZJOA 3Q6MA 5CA0F 2OHHA 1BSVA 5K0JA 4JXZA 1XZ8A 4BI3A 1AWJA 2CB0A 1WL8A 2D06A 3KJGA 4FYYA 5LYJA 1S3SA 3WB0A 1D0YA 1DE0A 2V26A 2V7UA 3BVPA 3PIIA 4A1OA 4C08A 3SWWA 1QGUB 2P3SA 2X0JA 5JCOC 2XGMA 3ZQ4A 1WPRA 1YWGO 4JL6A 3P7MA 2CYAA 2BCJQ 3FCUB 3H1BA 2OI3A 5CX1A 2KROA 3IIIA 2BTTA 4BE7B 1NZ9A 3KBGA 1R6VA 2BFNA 4BNNA 3M57A 4J16C 1UIMA 4NL4H 1K73C 1VKNA 4JHLA 4GE0A 3S2IA 1RMYA 1SQ6A 1SUEA 1WR8A 3E0QA 5FF9A 1K4MA 1NQTA 4WNIA 4CQMD 4YXFA 1L1RA 5ALPA 3UJPA 3DG9A 4V0ME 2CLDX 3TOZA 3D1JA 3GK3A 3ZY5A 4Q4CA 1NGSA 3EPPA 5K0NA 5JAUA 2DR3A 2ZYSA 1ZGGA 4DR3B 3RUXA 1PK8A 5IHPA 3AU9A 2POQX 1W5AA 1MCZA 3LGSA 4C7VA 2ZSHA 1G6OA 3W5DA 4IMRA 5GMKl 1S3IA 1XJ5A 3R4VA 3TJZA 3ME5A 2HGZA 4MYDA 4X60A 4Z0HO 3TNFA 3ELDA 1AQNA 1HM5A 3OJEA 4XX0A 5DK6A 1NP7A 3EA5A 1AMOA 1MNQA 1HSQA 2W10A 2ESWA 2NYUA 2QTVB 5CMLA 4GYKA 1TAUA 2AQKA 3LYAA 4AWAA 5FU7C 1LPBB 2II6A 1RACB 4OQNA 3PFWO 4OLFA 2FE1A 2XVAA 4X5OA 1ZLYA 4I1SA 3SP1A 1C3OB 2P6RA 3UV6A 1I14A 3KSUA 5G1NA 1SKYE 3META 4IDBA 3PX7A 2FJUA 4LJSA 3YASA 2AYZA 4FYMA 1KO8A 1VSBA 2XB4A 4GX2A 1QKIA 2HRBA 1EJ2A 3GIBA 4IHJA 4PZCA 3H3FA 1SUDA 2ZU0C 4RHCA 5BUQA 1FYDA 1YCYA 4JYPA 4AY6A 2BKLA 1IY1A 1WJSA 1UKEA 1ZZEA 3OUUA 3ZK7A 1VI5A 4RDIA 1POXA 4UU8A 1B34A 3NWJA 2P9ZA 5CG1A 2EZ8A 4JS5A 1KC1A 1NF9A 2GFAA 2QB5A 3JQ7A 3P9XA 3Q8WA 3A8OB 1G3MA 2XDDA 3OKAA 1KZ1A 4HQOA 4IV5A 2WEKA 4M77G 3I2KA 1Q2UA 3KT8A 3NYRA 4UM5A 4R7GA 1MH1A 1QVVA 3F3MA 5IF3A 1Y8QB 4C5CA 2QX6A 4TZTA 1GCQA 3A8MB 1RC1A 2XNKA 4Q4JB 4U2EA 1DDGA 1G2PA 3BTVA 1V2HE 3LX8A 4UBJA 3UV7A 3U6KA 1DIRA 2BR5A 3B36A 3WQSB 2CZQA 1MX5A 2Q3CA 4Z8YA 2B94A 4P08A 1NJ8A 3NNNA 5K09A 4PFKA 5D00A 1ZM9A 3FJ1A 3Q7IA 5GOTA 3TU4K 5DH9A 3TVYA 3ZWVA 3RROA 4K26A 3D3WB 2OV4A 1BWQA 2FZGB 1SSFA 5BY2A 2JIZA 1ILEA 3KPWA 4RFSB 1IVNA 2VQ6A 3F1KA 1KXJA 4AKHA 2CVOA 3TXYA 4DHWA 2UZIR 2XWJI 1YJAA 3CNQS 1VE1A 3OJLA 4J0JA 2DK3A 1JIVA 5KNBD 3EARA 3RT9A 1L3CA 2A5LA 4M37A 3EA4A 3CT6A 3ETJA 4GR4A 4EFKA 3N2GA 4RKRA 1NU8A 3LC1O 2PL3A 1O58A 4NVRA 2RHLA 3EHEA 3PYXA 2XBMA 2X6TA 4MMZB 5B6PA 1VPWA 2NZVG 3NAGA 1ZMXA 1H4QA 5C8YF 5HX7A 4MUAA 4DKJA 2HDNB 4ODIA 1GRCA 2I6XA 5C1DA 2FEOA 1I7PA 4ACBA 1YRAA 2RHWA 4Y2HA 4LKRA 1LUAA 1EFPB 4UM9D 3QKWA 3KKOA 2QUAA 2FP4B 4K9NA 1OLSB 2CMKA 1PI3A 2QLMA 4QTXA 4U2FA 4ZI7A 3S7ZA 3ACBA 1X2BA 3W9SA 1CEEA 3DZKA 4V03A 5KWIA 4BCDA 3KZ1E 3PRKE 3VYGA 1AKYA 2X5XA 3FEOA 2BL4A 3MOIA 4H16A 4IZIA 4L74A 2ZBEA 5J23A 5C0OE 1PWTA 1Y89A 4UNNA 4CODB 3CBPA 1IU9A 3IUQA 3C6XA 5JQWA 2YHBA 2HAEA 2JJ2D 2Z8YA 3L7MA 1R6BX 1GCPA 1W4LA 1NM7A 3PLRA 2WTBA 3I2FA 2ZDHA 2BWJA 3MWKA 4FXPA 1TQ6A 1FDTA 3ET5A 2ZROA 4NLLA 2RPNA 4NYIQ 1FU7A 2WYHA 1OBOA 2DAPA 3I3OA 1VA7A 4YRRA 2CGHA 1ONOA 2TMGA 3I0NA 1XRRA 3V1LA 4DR7B 4OGKA 2OHJA 4MVJM 3A0UA 4XB6B 3EUFA 1OWMA 5BRAA 5CYFA 4N4IA 2C5GA 4PYMA 3ZXXA 4YT5A 1Z39A 3L3BA 2P2YA 4DBLC 2XRYA 2FZ5A 3KBBA 3WYCA 1MNAA 4O4HB 4J3JA 4Q9KA 1E3LA 1P1IA 3AKEA 3CEYA 4YFYA 2J3MA 1ZH2A 3CSDA 4BJ3A 4KQHA 3DULA 4A36A 3VA7A 1NPPA 3OWXA 3RVJA 1A72A 5ICGA 4QGGA 4YRIA 4NOYA 4ZGGA 4G67A 2QL5A 5H68A 2WJ6A 1F5SA 1R4NA 4ZAZA 3RFTA 4HV4A 3AJRA 1W4SA 1X80A 3BQMB 2O52A 4OK3A 3IT0A 4M78B 4CEHA 2AK2A 1YJQA 4D96A 4R1SA 1F8FA 1UBFA 5HR5A 4R6WA 1VKHA 2DSNA 1N8RC 1QIEA 4TZ0A 4D4IA 4GZMA 4OYLA 1YB4A 2HBRA 3N3AC 2OTLQ 3CCVA 1YJWT 2IEBA 4INAA 1O08A 1E7SA 4UMEA 1T8WA 3TLAA 2GYVA 4IWYA 4XH9B 2ECFA 2IU0A 1RZVA 2QAIA 4PZPA 1Q1AA 4MJLA 1KAEA 4BYGA 1BI2A 3CUSA 4ZAXA 4R69A 1GA4A 5JIBA 2OLEA 3LDAA 4NMHA 4EW6A 3MO8A 4PXSA 1FYVA 5LP6A 3FH0A 1WPQA 4WOCA 2JTEA 1PHPA 1VYTA 5B53A 4B7CA 2GHRA 1FU4A 2DRKA 2QZSA 1LLDA 3DZ8A 2WU3A 4EHJA 3W4KA 1GU7A 4AURA 2CL5A 3M3PA 4L6IA 2EZTA 1M30A 1MJGM 2R8ZA 2IEGA 3B7GA 3P20A 4PO3X 1G8PA 5HTKA 3VU9A 5ALNA 2VNIA 1A9QA 1QIMA 3C8MA 5BOVA 3F8SA 5DI3B 4P36A 5DU2A 1H1TA 2EW2A 2WHPB 2ZS7A 3AEQB 1BB9A 2QLFA 3GPIA 1Q83A 5IC5A 4M77C 4B5LA 2IHUA 5CTJA 2QEXA 4AZVA 2KYMA 2BZGA 4DRXB 2BSXA 1LPLA 4AKSA 3HY4A 4N5MA 4B31A 5AVQA 2VUUA 2H54A 5MFPA 4M54A 2HKQB 4L2IA 5ABPA 1U1EA 4Z3KA 2OPBA 1AMNA 2F43A 2VDVE 4Y9UA 2A2ZA 2ZYHA 3FPHA 4F16A 4RY2A 4YIKA 5DXFA 4OY3A 2P2GA 1XJCA 1YB2A 4J9VA 7REQB 2WKQA 3DTYA 3KLPX 3W7VA 1Q3HA 3F7NA 3FTQA 4QBKA 4KLAA 3SYRA 2G3YA 1B2LA 1T24A 1JVBA 2IE8A 1EZZA 1C7QA 4HQ6A 2VJMB 3IL2A 3MWFA 5J4KA 2VB6A 1VSQA 2BUAA 3MLEA 5HFJA 1QHIA 4DEVA 5CFMA 1LRLA 1Q44A 5L3QA 4ONEA 2FUKA 3RB8A 1GQSA 3QKTA 7MDHA 2DG2A 4TKLA 4N47A 3HB4X 4FMCB 5D6XA 3VSBA 1VBNA 4RMJA 4JD5A 4TQ9A 3I4CA 4OJYA 3MEVA 1TQ4A 2IBMA 1X39A 2Z98A 1ZW6A 3KZMA 3RC1A 4EKNB 2YRXA 3D6JA 5KINB 1Y6RA 2R44A 3UWNA 4NOJA 1M2VB 4RVHA 1P81A 2QEQA 5IWCA 2WF9A 3QLTA 2HU7A 1GRQA 2BI8A 3AEKB 3E84A 4ZKDA 3EWNA 4FHEA 2BR4A 5AKYA 2IG0A 1NOJA 1L4FA 2ZTLA 3LBYA 4KMOA 4WXPA 3H1GA 2HCBA 1FUEA 1AKTA 2F9MA 4A8JA 3INYA 2O8BB 1PJQA 4DV2B 1RWOA 2DL5A 4MR7B 1P60A 1RYZA 1BJKA 3AI2A 1FMFA 4U2DA 1OV4A 4F4JA 1KY4A 2HF7A 3ZUPA 3EG9B 1TUCA 5DLOA 3OO0A 3S1AA 3D6HA 4KE7A 3CCUA 3SE7A 4GLFA 5H9VA 3CM0A 5HNKA 1C9EA 1O3YA 1E6EA 3Q98A 2GCGA 3MRVA 3CUVA 3QU9A 4GPD1 4I36A 4GM0A 1L5WA 2GLXA 3L79A 4Q19A 4XYGA 1P5JA 5B7GA 2WU8A 3A1TA 3IBCA 2EG9A 4UU7A 4Q3AA 3P8HA 1P7ZA 2BBOA 2VSXA 1GQYA 2P30A 2WE7A 2XUPA 3H2JA 3O9VA 5TB5A 3ZW7A 4DR4B 4OLJA 4C0FA 3FHJA 1JI0A 3FB1A 1TMGE 2B2CA 1BXKA 2NO7A 3F8TA 3K30A 1UGSB 4XM0A 3AI1A 2A9QA 2FEPA 3F2VA 2ZOSA 3QDFA 1GFSA 3DHYA 4IIYA 4ZVSA 4G36A 3RVLA 1N0HA 1IHDA 3UH1A 1K6IA 3KHTA 5DNYB 1NN5A 1R10A 2WF7A 1V39A 4N39A 1FP6A 1HKHA 3VR0A 4BNKA 2OCGA 1IY9A 4UAVA 4F97A 2Z8ZA 4IJ6A 5HIKA 3EZNA 2ZT7A 4PQEA 4JR0A 1ZUNB 1NG2A 2IXBA 2O7VA 3AV0B 4OJQA 4ZGWA 2ZIXA 5E2AA 1YK1A 1GPAA 4B9XA 1MNEA 1F0YA 3EG5A 4OHOA 2D59A 3R0XA 5AVKA 3FYUA 4KRXA 2C4KA 3SYLA 5FO0A 2ZUWA 4J6XA 4M0PA 3W6UA 3PS9A 3OZXA 5BWBA 3CC4T 3G6EQ 1JWBB 3E8XA 4B3CA 4RD4A 2I4TA 2AOTB 3KZOA 3L6DA 1P3JA 2FPEA 1N2BA 1B8NA 4QDTA 2B86A 3OWHA 4M9SA 4O02B 4Q00A 5IAKA 4LV6A 2G8NA 1HYBA 2VF4X 2BONA 4JZ3A 3AIKA 4NTZA 5F64A 2I78A 5FTJA 1L8QA 5JYDA 2SCUA 4LUEA 4TN5A 4NH4A 3K6KA 1SHFA 3QXHA 1MO3A 1D2AA 4WA7A 4JBWA 4TLEA 5D6NA 3M6AA 3L4EA 5TF4A 1DAPA 4PGFA 2QUJA 4ZYLA 3DAGA 2XNDA 2VLBA 1QS0B 5COQA 3ORSA 5CGQB 3M6XA 3THXA 5CTAA 1N1DA 4N82A 3L42A 3G59A 4L73A 4KO3S 2PU5A 3JAKB 3NGLA 3TKYA 1V48A 3A9CA 4CC4B 1IBCA 1FWZA 121PA 3GLHE 1U9CA 1NVEA 2IZ1A 3URGA 4ERXA 1KI3A 5ICFA 4RM2A 3R7AA 4EZIA 1XKTA 5T4FA 4HJRA 2ASVA 2D0DA 2VT2A 3NGMA 1QWFA 3DAFA 3MZ0A 4ICIA 1VQ9Q 4IL5A 2QP9X 2OFXA 3K0AA 4RESA 4UUPA 3T5BA 4BMCA 2NP6A 2CXQA 3RYIB 2LT1A 2J46A 6CHYA 2Q0HA 1SUWA 2K7FA 3BAFA 2J6FA 3UUWA 1V3VA 4OHFA 1RE0A 3GDHA 3WAKA 3Q8LA 4YT2A 3L8YA 3EMDA 2Y1DA 1NBEB 5HZGA 1OX9A 3N0VA 3V6MA 5CLLA 3RI3A 1TEHA 2W6ZA 1NBOA 3Q9NA 4NEQA 1ZMBA 2H8GA 1EXMA 3ITNA 1X38A 3L9XA 5DHPA 3UM9A 5AICA 4BO8A 1PDOA 1A8QA 3FE2A 3FHLA 1SULA 3NHWA 4L9AA 1J24A 2CUBA 3QEKA 1ZK3A 2C42A 3H41A 2ZVJA 3PBKA 4QL3A 4TYPA 4BECA 4KQ6A 2ZIFA 1ZX1A 4OA8A 5TV2A 3BZBA 5DI3A 1NJIR 4E5DA 2X3WD 2CH4W 1TZKA 1Y37A 1WE2A 2EZ9A 2OHXA 2QVXX 1UANA