3UB2A

Tir domain of mal/tirap
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
125
Chain Sequence
SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
publication title Structural Insights into TIR Domain Specificity of the Bridging Adaptor Mal in TLR4 Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 125
sequence length 143
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3ub2A00
1FYWA 1O77A 2Z5VA 1FYVA 1FYXA 5FORA 3JRNA 4C6TB 4LZPA 4C6RA 4OM7A 2JS7A 5H3CA 3UB3A 3UB4A 2Y92A 4W8GA 2M1XA 4DOMA 4C7MA 4LQDA 4EO7A 4FZ5A 2J67A 5KU7A 4LQCA 3H16A 3UB2A 3OZIA 4W8HA 1T3GA 4C6SA 4C6TA
chains in the Genus database with same CATH superfamily
4EF5A 3W8NA 3KQUA 3PPXA 4O4IF 1GARA 1GNTA 3SMQA 1LBIA 3CUWA 2RAPA 3D2AA 5H59A 1MQ8B 1RJWA 2QD5A 3G8BA 3BZWA 1CUWA 1JA0A 1RC1A 3LA8A 4LVOA 3SLKA 2OK8A 1E5TA 1LC0A 3T7SA 2HMWA 3EXEA 5JSQA 5ITZB 5BQOA 1PDVA 2IXBA 1B14A 1TC2A 1LF0A 3M1AA 3OY2A 2HUPA 3R40A 4BASA 3HABA 1T1IA 5HBRA 4A5OA 3P0FA 4EB0A 2H0AA 3HDYA 2D3WA 2XZDA 3H8JA 2O3SA 5JD5A 3ZUGA 2PM8A 2QMEA 3CLSC 4IQGA 4J2OA 1WW3A 4X6LA 1VG0B 4XQEA 5E3JA 1W36C 2O3TA 3AMVA 2ZJ8A 4EPYA 1PQUA 3V6LA 4MDEA 5IULC 5AIBA 1MIOB 2XVXA 5GOTA 1HI9A 3HGQA 3PR1A 3NDPA 5K0CA 5IVKA 1ZL2A 2BF7A 4NU5A 5GPBA 1EDOA 1XTRA 2J4DA 1JRLA 1E77A 1Y8ZA 1OLUB 3A9WA 3SHWA 4HMPA 4WDRA 4AJIA 3WMGA 1EUCA 2VZ9A 4GDMA 2XIJA 2WNSA 1TTPB 1RE1A 1V16B 4IXWA 4TMVA 4NH4A 1XDBA 5L3QB 2R44A 3T3NA 3LQFA 1G5TA 5JMWA 2NU6A 4O02B 4TQGA 4DYVA 2ZSEA 5MDHA 4WLVA 5FPTA 4A1OA 1Y1SA 1BWQA 1RADA 2FZ5A 2CL0X 2ACKA 3OJOA 3ZU6A 1VMKA 2G70A 5CJ2A 3OICA 1KGDA 4EH1A 1JPNA 1OX6A 2G83A 4L7QA 4NENB 1V47A 1KY3A 1WDLA 1ZW1A 4RK7A 4BRZA 4XIIA 2G0AA 2Z56A 2PZBA 2NYUA 2PBZA 3D64A 2O9JA 5K0GA 3WB0A 3BGVA 3E0XA 3HDVA 3KLBA 3QY0A 1DKMA 5AK5A 3O4RA 3EQ9A 1SB8A 1VECA 3RABA 4BO4A 1GQFA 1ECPA 1QZZA 3D5TA 1GQOA 4G0VA 3L6UA 2NVUB 3HEBA 5JJLA 4R7ZA 3NKFA 3O6VA 3BIJA 1R9JA 3N05A 3M49A 2CLFB 3KVYA 2AQHA 4BO9A 4AQ7A 3NB0A 2NPFA 5AJVB 4XZ3A 1MOQA 1QKIA 1QMGA 3MD0A 4KXFB 4B3DA 4HDAA 3FGOA 4Y7CA 2CFTA 4MR8A 4P7JA 4QDUA 2QE7A 4QXAA 2R6DA 4CM4B 3GI1A 4G26A 4C7OB 5EJ4A 1G21E 2X2PA 3THRA 3TWOA 1F0YA 3WTBA 2QTTA 1NJGA 4QDJA 1VOTA 3C3WA 2WLSA 4I46A 4BNWA 3KVOA 4W9RA 3VR4H 4ZDIA 5ABPA 5FTLA 1R8SA 1KMQA 2Y1XA 4LRUA 4CV3A 5GONB 2VJLA 3B8EA 5G4KA 4D42A 1XYGA 1UXGA 2H08A 3ZTTA 3G3EA 5JBQA 1WTCA 3GVXA 1R10A 3LPAA 4G9BA 4CU5A 4WY8A 3J7TA 3H16A 4AMGA 1AGPA 4JSRA 5DGXA 4DXAA 2XADA 4EHBA 3MG9A 1X1RA 4AJNA 4DA6A 1WXIA 5E8RA 5ADWA 1ZYUA 4JKOA 2MR5A 3I01A 3GLHE 3NEYA 5ALMA 3GDHA 2BC9A 2X3YA 3KSRA 3KBBA 4M1OA 4GWKA 4MYDA 2REXB 1PJSA 5CLJA 1J5PA 3MQFA 1WWKA 1Y5IA 3DV0A 4Y1RA 1PJ2A 2CLIB 1Z6PA 3JASA 3HVUA 3LS2A 3DS8A 5BN3B 1E98A 1V3TA 2QI9F 4G2TA 1YOVB 5ENDA 4NONA 4WAUA 2PCLA 5DHRA 2OGTA 4CIDA 1FNNA 2WUGA 3PD1A 1E99A 4H08A 4TMTA 1FOEB 4NBWA 2PKWA 1JNXX 5F2EA 5GM2A 3SOPA 4CI0B 2AOTA 2JASA 4B79A 2FEMA 2OCDA 1CJVC 2WJJA 4WY5A 1RQPA 3WP1B 4CMKA 4CM9D 1PQ4A 1RHRA 2BAGA 3W2FA 7YASA 3U61B 2GFQA 1XB2A 2JVIA 2RH5A 4YJFA 1HFWA 1EDEA 1VSQA 1CUVA 1FS6A 1K98A 1DEOA 4NF2A 4WJKB 2R8EA 3RFTA 3W6ZA 4UU0A 4A15A 2Y05A 2ZT5A 1U7ZA 2FU5C 2EYQA 3A2LA 1DTSA 1CR4A 3OUZA 4DIFA 1YS6A 5JNRA 3PJRA 3RU9A 5FBLB 5IJWA 3C4JA 2PTHA 4WN3A 3Q8MA 4Z3DA 1SAYA 4NPCA 3TJMA 4ZJZA 4N5HX 4LHSA 4BNJA 4XRGA 1Q84A 4KFCA 2JG3A 2HSEA 3TH5A 3V2HA 3A0UA 2O2JA 3NETA 5DV9A 3HB5X 3UPUA 2WU4A 3HZRA 1YL5A 3CLTD 3P2JA 1TZBA 1J8DA 3T3PB 121PA 4FMDF 5DK6A 3PEWA 3RLFA 2VCEA 3TZBA 4JLSA 3SBDA 3IHKA 3T1OA 5LD2B 3OM1A 4YMUA 4UNIA 1ZN9A 4HWSA 4CF6A 3KSZO 1PSZA 4DJDC 4NARA 4N03A 3PUWA 3V8PA 1AQIA 2WU0A 3U7JA 2D6FA 3U7QB 3HWX1 1R4MA 1Q91A 1R0SA 1R6BX 2Y0CA 3B7WA 3GWGA 3LF1A 4MDHA 4RX1A 3I37X 2PLAA 2P5SA 3UIEA 3REQB 1XZCA 3EXIB 3X1WA 3BD6A 1SXQA 1LPOA 4KX5A 3UOAB 4YMLA 5GADl 3OE5A 2HRDA 5E7IA 4W5HA 1SM4A 1ZN2A 2PQ2A 1KO4A 3RJZA 1DG3A 3MM4A 4MQ4A 4RD4A 1Y3DE 3WBKA 3BG5A 3IKVA 4DARA 4ZCMA 4HRAA 4D9EA 2IIVA 4EMUA 2XOKD 5HKLA 1RWWA 3KXLA 4K1LA 1GKKA 4AL4A 3CVYA 5ITZA 1RVV1 2WU1A 4HTFA 1CS4C 2CD7A 2GTIA 2Z95A 5LZ5A 4FWTA 1I7NA 2FPLA 1OF1A 3SSOA 4DCTA 2FWPA 1IEXA 1GCOA 3H6GA 3IDQA 3NEAA 4LNUA 3SQMA 1U4NA 3UFXA 1GSOA 4OGGA 3MVEA 2NU8B 1A71A 4DTIA 4IQ8A 4EO9A 4E46A 2ON6A 4DQDA 4B31A 3E70C 2H1OA 1XDDA 3OQIA 1HFEL 3WYFA 5C1BA 2WTAA 3JSXA 1M7HA 4OAQA 4PGGA 2BFBB 4NZOA 3FKQA 2ZYVX 1FS5A 1V25A 1OLUA 4FYIA 1T3GA 3N8NA 6AT1A 3I62A 2W8BB 5CPFA 1X9IA 2WDZA 2G36A 3S2UA 1NN5A 1XEWY 3LHKA 3UNXA 1UEXC 2ZPTX 1V16A 3H86A 1U8AA 4W5TA 1M2KA 4N39A 3WL5A 3KHTA 1OOEA 3P8ZA 2A84A 2FZGA 4KQWA 1Y82A 4ENVA 4YR9A 3TLGB 2VCHA 3C15C 3IPAA 3OCUA 1GL9B 2KB0A 1CUYA 1Y8RA 1J39A 2IDKA 3Q9NA 4A0SA 4YJ2B 2E37A 4XAQA 1JFTA 3QV1A 4IHKA 4UUBA 1DMRA 4DLRA 1IN7A 4QRHA 3BF7A 2P9TA 3GNQA 1V2GA 3W5AA 3CKKA 2MYPA 3KEFA 3Q3VA 4EZBA 1H2HA 1Y4DE 2YV2A 4WI1A 3K0HA 5C4IA 1JDNA 4M9QA 4CMGA 3PFGA 5CK4A 1XMQB 2ZBPA 5DX8A 1T36A 3DTVA 4MQMA 4ZVVA 5FP0A 3DW3X 2GHRA 1ZLYA 3WKAA 4EB8A 3JS5A 4OSEA 3VR5A 1FQWA 4PQYA 1HPLA 4RK0A 1Z74A 1JJ7A 3QHPA 1N5KA 3D2CA 1GCUA 3F3MA 2FQ1A 4OHYA 1NG1A 1QFXA 4K9DA 4ILEA 1QVVA 3SF8A 4D1YA 3H83A 1SKYE 1YCFA 4BIMA 4V1CB 3EUWA 4E2FA 1QAOA 1VCMA 3GCDA 5E7MA 3ZHZA 1XVIA 1RXEA 1WZCA 2NUAB 4W5NA 3D7MA 1XLUA 1VMEA 2PMDA 3A1EA 1KAGA 3QBJA 4JYCA 1GGJA 3W2IA 2I6UA 1Q0QA 3CZCA 3DL0A 1U3DA 4YRFA 2HIGA 3SC6A 5DNCA 2QUZA 2BRUA 1ZH0A 4F12A 3QPUA 4MB0A 1FUUA 3PI7A 1XNHA 1KTVA 1BU8A 3DZCA 5HF6A 1PGPA 2V0NA 1M9NA 2SHKA 4RVCA 3D1VA 5GONA 4UCFA 1YRBA 4HUQB 5C35A 4YACA 4IM7A 3PX2A 3K09C 4M1MA 1UK7A 1DHRA 2HEIA 5CH3A 2AFIA 2ORIA 5FR2A 4M37A 1I80A 5DNWA 2RBEA 3NEPX 4PVCA 4R0VA 3CVJA 2VQ6A 3FCEA 4FUQA 4TRNA 4IJ6A 4Z9YA 2WAXA 4WBNA 4XOUA 4EUFA 2OQIA 2QRNA 2DT8A 3F98A 3R9KA 3UB2A 2OT3B 2R6GA 4AAYA 5BVGA 3A25A 3I5XA 5TPZA 2CBGA 3AESB 3ZD6A 4CKBA 5BWCA 3EGCA 2EC5A 3ROQA 1V7ZA 1SIOA 1NRIA 1SKQA 3LDFA 4HVCA 1V5WA 3FNBA 4IFIA 3WY9A 1SXHA 3EDYA 2IIPA 2VP2A 3UO8B 3X1XA 4JT9A 1EX7A 1OWLA 2ZS9A 2WA1A 1I2BA 4FSXA 2J8ZA 3IAUA 1Y34E 4ERNA 5I5EA 3F96A 2PSEA 3S7TA 4FFPA 5DW3A 2JVJA 1OYVA 2D74A 1TCBA 3G0CA 4GOLD 3UKOA 1XAJA 3IXQA 2OFWA 4PE5B 2EBFX 5B4UA 2I8CA 2NXEA 3W5VA 1NE7A 2WZBA 3FFTA 2Z8XA 3QWFA 1YHYA 3EK2A 3RS9A 1AKNA 1ZPDA 4ZEMA 2ZI5A 4H6PA 3HCCA 4AKHA 3NX4A 1OZ0A 2QW8A 5IARA 1JG3A 2F3SA 4LMBA 4FQ7A 2JAQA 1IHDA 3H8SA 2VHQA 5HJ7A 4JXZA 5DNVA 1EB8A 3G2MA 4WUVA 3H1GA 3LXUX 1FYEA 4JP2A 5JXIA 1KIMA 2XNHA 2I9KA 2WB4A 1FDUA 1HDCA 3HJBA 4H18A 1VGRA 4JELA 4Q66C 4WGGA 1YMUA 4KUEA 4EB3A 1H42A 3FOZA 3HXQA 2JGJA 5DSTA 3RBAA 4AG6A 3G23A 3L40A 4Y2HA 1ZJ4A 1ZD4A 4KQMA 4E5YA 4YX9A 5A04A 1J2EA 3O0TA 5GIOE 3VHLB 1IUPA 3QYAA 5FD8A 1EESA 3INGA 1N0IA 3NHSA 5EVJA 1BKDR 1SCBA 3SYNA 1XXHE 3FR8A 5HKOA 3M6VA 2PA0A 3OZ7A 1OV6A 2ZJ2A 5DM2A 1XCOA 3FHCB 4WKCA 3CF2A 4QXMA 1NT2A 3GEEA 1VSBA 5AW4A 2SICE 1OHHD 3K9NA 3B1JA 1DLJA 4PLCA 3PNLA 4Q93A 1KQFA 2HPHA 3ZDFA 3KQKA 1L7DA 3OE4A 1Z17A 1MAWA 3P4YA 3U4QA 1NBEA 4FILA 1RBMA 3T3DA 3W4IA 4JIGA 1E61A 2V7QA 3Q8WA 3KO8A 3K20A 3TUZC 4HZUB 2EQAA 2IU4A 1L8LA 2CJWB 4LZOA 1JECA 1BIFA 4OBBA 3ZGOA 2JLWA 3FB1A 1VE6A 2P68A 2PUVA 2GQ0A 5LQRA 3AFNA 1ODCA 4MR7A 2GEVA 5DULA 1TL7C 3SZRA 3EPKA 4OQFA 4LFAB 3G88A 2YASA 4F11A 4MGZR 3KALA 5EEHA 4EHNA 4PLZA 3V8EA 3UK2A 3PIRA 1CUIA 2NU8A 4Z6KA 2WTXA 3D3WA 5LZ7A 3G85A 5AK3A 2X13A 3VFDA 1FVFA 3TUJC 1G5PA 1AUVA 5E9AA 5L95A 1E6WA 3VR2A 3GEIA 1KKUA 3JX9A 2W6MA 4URWR 4X45A 2M2IA 2ZYTX 4ZRNA 3RVQA 2R4UA 4A82A 2Y6UA 2ZVQX 1P9NA 5EXXA 4DBZA 1LU9A 4Z1OA 2PT6A 3DBLB 3M6LA 3W7AA 4L6AA 4XW2A 4BAUA 1EXNA 1T6NA 1UFRA 1O0BA 5BT8A 1DFGA 2CK3A 4Z9AA 1X1SA 4GDFA 3U17A 1B26A 2WT4A 2ZB3A 4BVLA 2O1SA 2PKXA 1BJRE 3BFJA 4C0XA 1MAAA 2VQDA 2Y1LA 1JE0A 5AHXA 3N53A 3AI7A 1O95C 2BZ0A 4JSTA 4YRMA 5FUMA 3EGOA 4IS3A 2FEWB 4JLUA 3CLKA 1DTWA 4L5YA 2HO4A 1MO5A 4ITRC 4BRUA 4LXTA 1W5FA 3H2KA 5EJ8A 1W87A 3C8MA 3PGKA 4EJMA 4KWEA 2GT1A 3KTFA 4KXLA 4Q3KA 3GCXA 4RXUA 1MX9A 1IG3A 4C4RA 1C9EA 4WLOA 1P1JA 5FEUA 1GPWB 3A4TA 4ABYA 4DR4B 2G7ZA 2VDLB 3MYYA 4D0RA 1HF3A 4LECA 1SJ9A 1KWKA 3EVDA 2WHPB 3VX4A 3TMKA 2B5WA 2FSHA 4KHZA 2JF0A 2H5LA 2ST1A 1GZDA 2P30A 3CMMA 3N7TA 4JT4A 1LH0A 5ALXA 3Q7RA 3ZI4A 1NFQA 2KX7A 2QRZA 3N2GA 5LWQA 4ZI7A 4DV6B 2HKIA 2Z30A 5LNK6 1IG0A 4UBKA 5T57A 2E4ZA 1L5RA 1SG6A 2J08A 3E9YA 4WOKA 4PYJA 1ULHA 4XJXA 2NUAA 5CW1A 4KBGA 2C9CA 2WEKA 3LBYA 2NAPA 5L3SB 4EHIA 5HQ3A 1GP2A 4PNPA 2GN4A 4M53A 3LYAA 3I9LA 3IUEA 5KJFA 4E6PA 4Z0PA 1BVUA 3L8MA 4M98A 2QROA 1U0EA 1AKWA 3CZ9A 4MMXB 5EGNA 2WSMA 3T38A 5JD6A 1EVJA 1VTKA 2VXYA 3CT4A 4WCVA 3WL3A 4AN0A 4BFUA 2VPZA 2CV2A 2H8KA 4R1TA 2VWGA 2VSFA 1ISGA 3L04A 1DI0A 1NLMA 1GA6A 1R16A 1YO6A 3B53X 4RD3A 3S27A 1L5KA 5EG5A 2JHFA 1TM1E 4DNXA 5AVXA 5FLEX 4BQIA 3DT6A 4DG9A 5D51S 3PDUA 4YRIA 2DLNA 3PLNA 3ZDEA 3AYXB 4N3AA 1UK9A 3PFWO 3SU8A 1GA1A 5GOZA 3PT5A 4XUGB 4LJ8A 2ZDQA 3LT0A 2VYQA 3B6KA 1YFZA 2HBQA 3H9QA 5DHAA 3BQNB 1BQ3A 3AESA 4Q9HA 3WG9A 4ANFA 2QZZA 2FYTA 3FCXA 4NBVA 1SUEA 1QC5B 3EMVA 5DZSA 3C70A 2GEDA 4FS8A 3IB3A 4EUKA 2PUHA 4K9SA 4RIEA 3BGIA 3BB3A 1AIPA 3IUSA 3U3MA 1CZRA 1U2DA 2IPAB 3GZNA 3K16A 3NIFB 5E9QA 4J03A 5LU9A 2P5UA 2PD4A 3P0EA 2ZJ6A 1BEEA 2BJWA 5DLDA 3SSNA 2P7HA 5MN5A 3AOEC 2WB2A 1XKQA 3FG9A 1S2OA 4OQNA 4M8SA 3DV2A 4ENSA 1OGYA 5AKJA 2NOAA 3IB6A 3D0QA 3P0JA 2OBNA 4KE8A 1QGAA 4QGHA 4H15A 5L3ZA 1IH8A 3KOMA 3VO1A 4CF7A 3S2GA 5JCXA 2QPLA 1TIBA 4K87A 2A30A 1GL6A 3OLWA 3RU7A 4O59O 5CEFA 1Z4MA 4C6TA 3EC2A 1ZOSA 1PVDA 2KLHA 2D7DA 2PNJA 4MV7A 1HE1C 1OWNA 4DWVA 3FUTA 2O6LA 4MQFB 1VQ1A 3AHCA 2HAEA 5HCIA 2G71A 3GQBA 3RADC 4GD3Q 4FOOA 3V9PA 1EQUA 2I7CA 3ANTA 3GLHB 1Q5PA 2Q9AA 2QUAA 3KJFA 1GL3A 1LW6E 3IAEA 4FD2A 1UXOA 1FPMA 1LRLA 2PZAA 1PR3A 3K5PA 4LRWA 2FMXA 2ZRMA 1N25A 4GT1A 4ZQGA 4YB8A 2R7LA 3HV0A 5B7QA 4OFZA 3EE6A 1CVLA 2VDWA 2X86A 2YYAA 1ZESA 4YS6A 4XLZA 1K63A 1EX6A 2ZB4A 5KPJA 4PPYA 4ZTBA 3IBFA 4GLBA 4DM7A 3ZXXA 2IYSA 1E3WA 3DLIA 2BYTA 4Y9DA 1GU1A 2GCPA 4FOPA 1TQ4A 2PX3A 4HAZA 4PRYA 1B6RA 2REQA 5FBZA 3U0BA 5C2JB 5AW6A 3OOEA 5BURA 4I6EA 1O5IA 5KDDA 2ONKA 3QJ5A 2IZZA 2H9AA 5LYJB 4QLAA 1FX1A 1PZMA 3NHBA 4C6RA 1PR9A 3PE6A 3JXEA 4UBNA 3U4AA 2N75A 3R3YA 4PZ9A 3RHSA 1REQA 2XB2A 3TKYA 5DWDA 1L4HA 5KAMA 3W2GA 5B6JA 3JQ7A 3K8QA 2HWYA 1PO7A 4ZEXA 4YRSA 5J4KA 1M74A 1RZUA 4HZUA 1W7AA 1RM5A 4U8GA 2P9HA 3T5PA 1HORA 2VPXA 1GCGA 3EZ7A 5LQMA 2WJYA 1K8ZB 4FD3A 4G5HA 2FETA 3OEED 4JQOA 2VPYA 5AI6A 2Z9BA 1I1QB 4A2PA 4LYHA 4BLQA 5JC8A 2YXLA 1OH8A 2RAUA 2EJTA 3T5DA 1ENPA 3WQSB 4CIYA 3IC5A 2HCFA 5SYAA 4DZRA 1HBJA 4GG1A 1K86A 1U0RA 1VG1A 1JQJC 5AJWA 1IBKB 2QUIA 3JRNA 4B4VA 4ERXA 5FEMA 3A1UA 4E03A 5K0LA 3ZYCA 4UJ5A 3RTAA 5ALGA 1U2TA 2Z08A 3AM5A 4HNRA 3HGMA 3NZEA 4U3JA 4E5DA 1W5EA 5A4AA 1AMUA 1NVVR 1QHNA 3GA7A 5KYKA 2GO7A 4B7ZA 3HJNA 5BQFA 4MB6A 5DTRA 4JVSB 3SZ3A 5TJ9A 3DBLA 4C22A 1UKBA 3ED1A 2QW1A 2W2KA 4P58A 3VQTA 5JADA 3RSQA 2OZKA 1POWA 5EMNA 2JDID 4FE7A 5FOTA 3D1JA 4LZWA 4I1OA 1SA0A 3SQOA 4EUNA 3I2GA 1B1AA 4P7KA 1HLPA 2MSEB 3H1EA 5EIXA 2IWRA 4ARZB 1QPGA 1ADGA 1H3FA 3EZYA 3LX6A 5K51A 4IOKA 2EX0A 4AULA 4FDTA 1HT3A 4BAZA 2DQSA 4OPMA 4DUGA 4L22A 5DLPA 3NHJA 1KS2A 3B1FA 4AN1A 2HSWA 3H2GA 4XX1A 3BXXA 3I4CA 4O3FA 1B41A 3LK7A 5EY5B 2O8VA 4CL2A 4DR3B 1YS9A 3L4BA 3BXFA 3WMFA 1GCIA 2OVFA 5J5VA 5B2ZA 1WL8A 3H1TA 3N3BC 3EXHA 4HCJA 3R7LA 3T7JA 2DXIA 3BK1A 3OMXA 1BHO1 2XMQA 4LF4B 3AUXA 2PZKA 1O8BA 3GUVA 2HQBA 2WNIA 3JRXA 5C1DA 2HLHA 2YYZA 2XUPA 3HCWA 3P0IA 4U2BA 2C61A 3BB1A 3U48A 3I1IA 1EEHA 3OKPA 2O8CA 4P4UA 4CBVA 4KE9A 4MCJA 1MABB 1H2EA 1XRSB 2NTEA 3D0OA 3DOEA 3GA0A 1DEXA 4F04A 4N12A 2AW3A 1H1LA 1P2GA 1D9XA 1KZ6A 3EA4A 3GHYA 4WLFA 5KQMA 1T1JA 1QHXA 1RPAA 3R6WA 4BKUA 3KUDA 1I2DA 1Y3FE 2GYWA 3RNOA 2QMYA 1IZZA 2CHGA 4UXIA 4ZAZA 2KPOA 4H7HA 4PG6A 5KSPA 5K4GA 5L3SA 1T4BA 3T3IA 2RGWA 4E51A 4EKYA 4HNAA 4JEHA 1B7GO 4PICA 1ODKA 3BTVA 3N9IA 4ND1A 1EU1A 1JWBB 1VIDA 4NYMR 3HM2A 4RWEA 4ZOEA 5K6AA 1JBEA 2IEDA 5HF8A 5EJAA 5H68A 4S1WA 2VP9A 2TMGA 4H31A 4Z9FA 1P8JA 1UDXA 4UD2A 3HFRA 2ZPAA 2J9ZB 3ASUA 1IZYA 3QPDA 1X94A 2ETVA 4R6XA 4TXLA 4YGYA 2XT9A 2HU7A 1ZSVA 5J5AA 5THXA 1GVNB 3EPPA 4ALMA 4PX3A 4NJOA 5LP6B 4AJLA 3PUVA 4HRYA 4MVJG 1UL1X 2PFGA 4NCJA 4OA5A 5K2OA 1JBKA 1XALA 1X3LA 1ZUHA 3ZS9A 2FUKA 1P4SA 3PI6A 1XTQA 3A6HA 1NOJA 5D3ZA 2ZRCA 3I42A 4ECEA 1AC5A 3OECA 4EJFA 2UZ3A 2E4XA 4ITUA 4NR0A 5DGTA 5HSGA 2PA3A 3T1NA 4E2YA 2PL9A 2Z6AA 4BBZA 1XCGB 5DO9A 3B48A 5CB8A 1XIVA 1V4VA 1E1NA 5DCLA 3SZGA 2WWIA 4JLBA 4RH3A 2JFUA 1YDEA 2VQEB 1QQ6A 5F64A 1DWOA 1AURA 1ZUD1 3I6BA 3DHWC 1G21A 4QTZA 5EINA 3S2ZA 4EOGA 4YUAA 5U4QA 2Y1WA 1DKLA 4IIJF 5HM6A 3AH8A 5A3VA 3VYWA 1KK1A 4MLDA 2OTCA 4IDEA 4L9WA 4BY9E 1UT6A 2ZR9A 4RMHA 4JP1A 4WA8A 2KLBA 3OETA 3NHZA 5E1MA 2FZKA 5GZ3A 2J45A 4ZAFA 1U90A 4KR0A 1X74A 1BMTA 3KQWA 1Z5GA 4IYRA 4G25A 2GPNA 1CFJA 3EFHA 3O2SB 4R51A 5CH8A 3ASZA 2CNDA 2YJ6A 4JQSA 5BR7A 4RVGA 3SGLA 3F47A 5ALTA 4HO1X 3UJBA 3BQMB 4NFHA 1B0AA 4QEDA 2M6LA 1JJFA 1WF6A 2YJ5A 4YIKA 5CG2A 3RDPA 1JG2A 3K0CA 4P8RA 3VR1A 3E7DA 3C43A 1WVIA 3GLHA 4FCWA 1E6KA 3ZVKA 1P4RA 3E8XA 3JTEA 3LW8A 2B1JA 1X14A 1TK9A 2QXTA 3IMEA 4TOIA 4Y1FA 4FMCB 4CKEA 4D9IA 2ZSJA 4JYZA 1M6HA 4M99A 1M83A 1ZIXA 4F84A 4W1PA 3VDRA 2V0GA 3WXMA 2GGSA 5C7LO 1AO3A 4Q3LA 2G5TA 4A2CA 5BRJA 3F0TA 5HEKA 3E8MA 4WERA 3U7IA 1IBRA 4PYKA 1ETHA 2QT9A 2ZAOA 3M1YA 5IWCA 4EHLA 2I6QA 1TRKA 3KKQA 4RGBA 3WNVA 3NGMA 1WMBA 4MVJP 5F9FA 3RAFC 1U2QA 4B4DA 1V1RA 4UNNA 4YQZA 3SHOA 5IVIA 3K9WA 1O94C 1BDJA 1RWBA 3H5NA 3L1JA 1CNEA 4I4NA 3RJMA 3SXJA 4F06A 4JJZA 1HDGO 1Z28A 4JLMA 2H06A 5L4LA 3D43A 1LDYA 4BCDA 3PPYA 1B15A 1JDVA 1WXQA 4L5JA 4PYRA 5EE0A 5FWDA 5JYEA 3TX6A 2QF7A 2H5JA 2I7TA 3TIXB 3BH0A 1CU1A 4PSAA 4HPXB 4RTQA 1QIMA 1F8UA 2H00A 2LKDA 4A0FA 5BSKA 3KZ1E 3ABQB 2C7OA 3DLAA 2WFMA 2W2LD 3ELWA 3QFRA 5KVSA 1PG2A 4YT2A 3K35A 1ENZA 3Q3JB 4HYQA 1RJ9A 2CXXA 4A2WA 3HXKA 1WKVA 2DTEA 1VJCA 1QHFA 3CUTA 3JD0A 4EY5A 3WNZA 2E18A 2Q8QA 4EHDA 4BUCA 1ABEA 3I9OA 1M1NB 1N33B 2EW1A 1ODSA 2JFPA 5KC9A 1WB9A 2D0IA 3AM3A 3D8RA 2IEIA 1O77A 2HRZA 1CP3A 1CUJA 1R6XA 3B52X 5BN1A 4OBWA 4N41A 4FGWA 3R09A 4HFNA 4UC0A 5YASA 4WNIA 1ISMA 4Y6PA 4G24A 3WBJA 3ES9A 1E7WA 2F1JA 5AKHA 3AVWA 2C8KA 3EG9B 2FPSA 4CT5A 4WINA 3RC1A 4BYMA 3RYCB 1Q0TA 1L5HB 4XM1A 1SKAA 2J1LA 4CLXA 3KYCB 2VFAA 3KKMA 1RMQA 1JYFA 2DSTA 4LXYA 3IUPA 1PZGA 5HCUA 3WLEA 4RM3A 4EG3A 4F46A 4GPEA 1IXZA 3P2IA 4ESVA 1E9SA 1XLTA 1SEVA 2QRUA 4PLVA 2K7ZA 1KSJA 1XF9A 2EJUA 1U7UA 5DYTA 4MVJI 2RGEA 2QN1A 4CDMA 4N8DA 3TZQA 3L7BA 3QI2A 3ZWKA 4DMFA 1POXA 3N8GA 3I2IA 1H6BA 4WK0B 5JPIA 4UU1A 3I1FA 2P5TB 1TO6A 2FAXA 3ANYB 3EDQA 1NLUA 4B09A 3N8KA 1ZH2A 2XR1A 4PNHA 4WXPA 2LIPA 5I8ZA 1AQNA 5KYUA 1KWGA 1V7QA 4KHPB 2W48A 2ZWPA 5HCNA 5K3BA 1VKRA 3CONA 3JQRA 3B1XA 1F1JA 3G8CA 4KWHA 5FI5A 4D6XA 4F4IA 1TKCA 4LY6A 5FHRA 1YC2A 3M81A 3DXFA 1R6DA 3GLUA 3GPLA 1P77A 3VGJA 4DCUA 1U3VA 4P80A 2BMVA 4FCVA 4Z4CA 1S2NA 4OQPA 4XIGS 2MYNA 4CVNA 4YV7A 1ZD1A 1B2LA 1FDOA 2KBEA 3PVSA 721PA 4ZVOA 3OIFA 4MINA 3V1UA 2Z4RA 4AUMA 3TFOA 3V34A 2A9OA 3H0EA 4K88A 5EMHA 1DJOA 3RK4A 3TR0A 9GPBA 1VKNA 1LZKA 1T9CA 3KB6A 3QXXA 1BEUB 4QDTA 1TM4E 3H04A 5E38A 1U0GA 3EA5A 4ZAYA 4KQIA 1OFTA 4V3CA 4GX2A 3GT7A 3WV4A 1LK0A 3C5WP 4U5QA 1FU7A 2R96A 5KYWB 3C1UA 3VYUB 2HNKA 3TQHA 5M04A 3R0IA 5KOHB 4MW6A 3T1TA 4M9SA 4B6RA 1HNWB 3O26A 3JYOA 2BGRA 3CF4A 4L8VA 2OL4A 4UVHA 5F7JA 3IEKA 4G81A 1E79D 1N78A 3OTQA 2GHIA 1YS7A 3ME5A 2BONA 1YZNA 4J0CA 9ATCA 1JBQA 4E22A 4N3GA 3LC7O 4UREA 3WJAA 4I4LA 3HADA 3NTVA 4PO9A 4G56A 3EFEA 2QLJA 5T4FA 3JQBC 2C84A 1YNOA 1Z29A 2I8LA 4R40A 2GBGA 2BFOA 3BL5A 2AMJA 4K28A 3O94A 4LF7B 1TXGA 2B2NA 3IP5A 2GPJA 4JA2A 2LUOA 4ROTA 1K2WA 4EBFA 5LQJA 4HL6A 4J1NA 2VYCA 1BYIA 2I80A 2PUFA 2ASEA 1T0HB 2MINA 2PRIA 1D03A 3P9SA 4JK3A 1SVOA 1ECJA 2VPWA 1YZ3A 2UZIR 5C3UA 4RJJA 3KYJB 4MK4A 3GFTA 1KSGA 3ZX5A 3UICA 3OWXA 4K6MA 2GPAA 4HDKB 5G3ZA 1W85A 1DJPA 3DFUA 5JS6A 1H4SA 3OOHA 4BMNA 4DJAA 1KF0A 3PGLA 1M0SA 1G8JA 1CULC 3N2IA 1RKXA 2WG1A 3AG5A 3IP6A 5AFSA 5FNZA 2AYXA 1UEIA 1SHLA 4RVDA 1QS0B 3HVRA 5DGHA 2MCFA 3AUTA 3KEGA 1PHRA 4YP1A 3VZSA 1WE2A 2HMTA 3C24A 4K7JA 2R2AA 3KR0A 3MTDA 3R7SA 3ZGYA 3GFFA 3TUIC 1CRLA 5H0IA 2P9FA 1J8YF 1NE2A 5COBA 3TYXA 1L7QA 2DH5A 2OKGA 2RHJA 3LWZA 3QVSA 4P32A 4R8VA 4FHZA 3TEJA 5AKKA 1KKLA 4AJPA 5J2UF 4EJSB 1U2RA 2XITA 5EZYB 2XNKA 2JLVA 2PYZA 1WCIA 1XX6A 3H9JA 4GVPA 3C6QA 2VTVA 4E2ZA 1UXIA 3LFTA 2GK7A 4L07A 5DBEX 4Z8YA 2XNSA 2IYTA 3AIKA 4US1R 4F0JA 5HKKD 3FGPA 3ROKA 1I3MA 1N5LA 3LCJA 3CRNA 1RJDA 2CB9A 2DPMA 5KWEA 3IQDB 3RVJA 3IOMA 4XWWA 1EE1A 4K8OA 3R0XA 2A2ZA 3Q85A 5KJEA 4BVKA 3L6BA 4BV3A 5C7IO 3COVA 4RPKA 4YJ3F 3GUZA 1J0EA 1DBIA 1GZVA 2A0KA 5CCDA 3UJ8A 4NYJQ 2F67A 2IYOA 4IGFA 3T9AA 4CI9A 3ZWVA 1WNTA 5JUWA 3H3XA 4G8CA 4JBHA 3DZIA 2ISSD 1ZHHA 5CK5A 5HILA 4WBNF 4ZI2A 3FDJA 5BNZA 3KL4A 1YVPA 4ZZ3A 4AG3A 1KZ4A 1RYMA 5CBPB 1QNFA 1DV2A 3CJRA 4HBGA 3QX8A 3PNPA 4M4SA 2ICAA 3MMSA 4Q9DA 1YJ8A 3DW1X 4QGAA 3UAOA 4D57A 4U7WA 1CY0A 1S3SA 3HXOA 4X41A 3EXG2 1TK2A 4M9UA 1GPLA 2Q9CA 1I8TA 2BE7A 3RVDA 4EG7A 1ZWLA 3FTFA 1QTIA 1LDBA 4N7MA 4BQRA 3U3RA 2Y93A 2ZI7A 3G49A 3CEJA 5DWQA 1PK8A 4WNCA 1WO8A 3WWPA 4P81A 4PHGA 3WK7A 2FRXA 3KAJA 2E4WA 4C5AA 3HUTA 3IGFA 1KO8A 1NZFA 3OBIA 4IILA 4M1QA 5CNMA 3NDIA 4AF8A 4YAKA 3K96A 1P4JA 3A0RB 1LBEA 3GMSA 4CKYA 3THWB 4C03A 3QF4B 4IDFA 1ADYA 1JF8A 5IKXA 5B4VA 1SOMA 3OX2A 3I2JA 1KDTA 4F8YA 1N2OA 1BQEA 2XTMA 1XAHA 3E7PA 3PSAA 3R3HA 4ZVKA 1XL1A 2OCAA 1Z4PX 3NBKA 1C50A 3JQGA 3RYHB 2C7RA 1F1BA 1TK3A 1M1NA 1VHQA 4GC5A 4N5MA 1B2RA 5G1NA 5AVVA 3A14A 5DM70 3WLLA 5EPEA 2HPVA 2YWFA 2FMKA 1SBYA 3MUOA 4QBHA 3SJZA 1DQNA 1TJ4A 2Q1UA 3BFKA 1KOJA 2EF1A 4M76B 4TYNA 3JQ6A 2GVZC 1XXHA 1E7QA 4X1IA 5JYBA 1Z4LA 2EFYA 1FNDA 4J7CA 1DIRA 3GZ4A 4RYDA 2Q4OA 3FOWA 2HHLA 1QH8B 4P4SA 5G3YA 2XQKA 2Z98A 3KYCA 1HK7A 2CXQA 1NBHA 1W48A 3UUWA 3WWZA 1QBKC 1EFVB 4KB5A 4OEHA 3TTVA 4A2QA 1KO5A 1T9AA 2G25A 4IBOA 4F92B 3KZVA 5A6VA 1RLUA 3GJ5A 4NEQA 4LOLA 1UZAA 4U9IS 3UJ6A 5ICSA 4TMFA 4NJEB 3NWEA 3HJTA 1XZFA 4TYMA 3CLSD 2BLNA 3GJ3A 3ODGA 1QHEA 1KH3A 2PU5A 2X9LA 4IXMA 4KDCA 4OHKA 3B85A 2EKPA 3PXXA 4BKOA 4GX0A 4W1SA 3TRDA 3BKWA 4C4OA 4ZQHA 4UPDA 2UYCA 3WK6A 3O74A 1R4AA 1TJ3A 4S0ZA 4U2KA 2PGLA 3SEAA 1D5WA 4IF6A 4D9NA 2J87A 2HZ7A 3DWFA 4I5IA 1LFDB 3BSFA 2GPWA 2BGJA 3KT8A 3I6YA 5HXAA 3NBYC 4P38A 4X65B 1FYXA 2PV7A 2QQFA 2FCAA 4FN4A 3RSZA 3WS7A 3O8CA 1MTZA 1W2WB 1SOUA 4Q0MA 5FJJA 1I2CA 3FNHA 1MPXA 3VOAA 4QLOA 4AK9A 5CB4A 4DHWA 3ZWCA 1VFPA 1NUAA 3PD0A 5KEIA 4DDUA 3AP1A 2BKEA 2ILVA 3NIDB 2QRVB 4UXHA 3CUUA 1J42A 3T94A 1U8EA 1O6FA 2IT1A 2WICA 3QRWA 1VSUA 5CPBA 3QX9A 4FKZA 1UBOS 3CIOA 4V24A 3VO9A 1WCV1 1V5EA 5G02A 3TW8A 2WQ7A 2VYFA 4BO2A 2VKTA 2IHTA 2ODPA 3GNLA 2GD2A 4IZOA 4N6NA 2AJBA 3QEJA 4QDOA 2HJHA 3GF4A 4I1UA 4MYHA 5C5DA 2CBZA 2II6A 3WMEA 4DCGA 4NBLA 3AO0B 1RI3A 4KPUA 4NZNA 4O0MA 4DT1B 4KUHA 5LSAA 1LVHA 1Y9EA 3VR6A 2E89A 5F2NA 4WWHA 1II0A 3PDIA 3GUYA 4F4UA 2IPLA 3HVJA 4GUDA 4RTJA 1BD4A 1RWVA 1WRBA 1LLDA 2IY8A 3COWA 3V8VA 3IQIX 2Z2XA 4QAJA 4P0PB 1EFUA 1MOZA 4ZPJA 4D99A 2GVNA 3EEBA 3WIUA 5ADVA 5IF9A 1GTMA 4JJKA 4CEHB 3GLTA 3H9GA 2A5YB 2GEUA 1TM7E 1USGA 4CTJA 5IUNC 1PJ3A 1RTTA 3A1WA 4KSYA 3KX2A 3NAZA 4MQUA 2FSVC 3MTGA 4A16A 2BMWA 2VTDA 3VR4D 1J1ZA 1J9EA 2XYRA 1Q7BA 1SU8A 2IZOA 1JKJB 2UYQA 4L4ZA 4RDCA 3W5UA 3C3XA 3HU1A 4IGEA 3SICE 4B8WA 4JHXA 2QTRA 1IVYA 4BQOA 4F5EA 1A9XB 4Q4LA 1PDOA 3IVCA 4NNPA 4B6SA 1TUGA 2CXRA 2HW8A 5K1ZA 4PLTA 4JOQA 3KFVA 4A8JA 3KXKA 4IHJB 1K88A 3TBFA 4TKVA 3PX7A 3LQRA 3RLIA 2QMUA 4IQFA 4M1ZA 2J6BA 2ZJ3A 1IN4A 2HUNA 3QM1A 5FOQA 1KRXA 3A4MA 2HQ1A 3FCYA 1YDGA 1LQ2A 1NY6A 3R24A 4HDKA 2HCJB 3F9CA 1KK3A 3F46A 4LK3A 4AM8A 2F90A 4UAJA 5KU1A 2FMTA 1LPMA 2GMWA 1TRHA 5ELXA 3BL6A 3D4NA 1DBWA 4DSTA 2XGSA 3NW9A 4C0QC 1QS0A 2JFZA 3L05A 3OWHA 4N01A 2VEDA 2EWMA 5DHPA 3NNNA 4DR2B 3C6KA 4ZI7F 8OHMA 1JL3A 3KPVA 1OBOA 1AKMA 1J4AA 3OZSA 2IH4A 2O2DA 5JMPA 1OXXK 2IUTA 1KU0A 2UV8A 3ITKA 3RQSA 4DLWA 2XE6A 4RS3A 3L0ZA 4P3XA 2JFFA 1Z0JA 4HEJA 4Y0AA 4NYIR 4B3IA 3JALB 2O7NA 1T9BA 2P2LA 4JYBA 3V8RA 3FKSA 4E1BA 5TLSA 3B7PA 1LS1A 2D54A 3N5CA 4PHCA 1TYAE 4JOSA 2YX1A 2EG5A 2OQ2A 5EWJA 5EZYA 5HUQA 2GZRA 4B0PA 4KGXA 1NF8A 3BVPA 2P1ZA 2Z04A 2P8SA 2CSXA 1NKVA 1KYYA 2EDAA 1TEVA 3PC8C 1N5IA 4TVBA 4XWTA 4QASA 3EWAA 4II3A 1QGUB 5BV1A 2DR2A 1A2KC 3BIXA 3NBXX 3OU2A 1A9SA 4GXRA 2MSCB 3EQZA 3TIGA 1KDYA 1QVZA 3BWDD 3CU5A 1FFSA 4NMMA 3VKWA 4HN4B 2Y1GA 2DFKB 4II2A 4RMNA 1CY6A 1IM5A 2HIAA 1M6VA 1TCUA 3AP3A 3DP9A 3LRXA 4LY9A 3SYRA 3UJ3X 2X19A 2O2SA 4KG7A 2FDRA 1KFCB 1YJBA 4OUDA 5GVRA 1A5ZA 1HYEA 3BMQB 5AVRA 5D3MA 3KQHA 3JQFC 3VH2A 3IR6A 2B4QA 2B4YA 4KSCA 1VP3A 3CLUC 4QU0A 2IIQA 1KJYA 1NI3A 2GDJA 3IRUA 4ARVA 5LQAA 4W8GA 1OKKD 2BMJA 4Q4HB 4URYR 5LZ8A 1ST3A 3WTCA 1UM9B 2W2QA 1GNRA 2VNAA 4KXUA 2NP7A 1D2EA 4LRXA 1PSWA 4X20B 1Z4JA 5FR1A 1ODIA 2CUTA 3D7KA 4FEYA 3LSTA 2Z57A 2QTVB 1NW7A 1D7AA 5B6IA 2R1ZA 2X77A 1XZHA 4JQYA 3FJ1A 3FLEA 3PKJA 3N6RA 4FEAA 5CT6A 5CITA 4E08A 2IPOA 3QF4A 2WSSD 4OQDA 1G8PA 1W0KD 2X15A 4MVJH 5A5EA 4QU9A 2RJ3A 2QG9A 1JT9A 1H0HA 2H85A 4BNDB 5EPUA 4JR0A 3ET4A 1C3VA 3QVTA 4QVGA 4DL9A 2PYDA 4PHTA 5G2OA 4BMPB 1KO7A 1ZM3A 3ZV7A 4DCMA 3BMOB 1SU7A 3RVBA 2FI1A 1DJNA 4GGMX 4LS3A 4ZTZB 1E0JA 4N6GA 2ZQYA 3EEQA 4M9RA 2X0EA 3TK1A 1M2WA 1OYOA 3SSAA 4AIIA 1L5FA 2XQJA 2X0RA 2IXAA 2GJ8A 2VN8A 4RZ2A 2G1PA 3UGKA 2IV2X 2IW3A 4OREX 2CKMA 2EIHA 5TV2A 1DCMA 1C81A 3TZKA 5B7NA 5LLDA 1ZVMA 4HLUA 4OXKA 1MHPA 3HL4A 5BPFA 4KMSA 2Q6VA 3R1IA 3JD2A 1E8DA 1EFVA 4ZREA 3WSTA 2YWGA 4GMKA 2G09A 1E3EA 3L0CA 3VPSA 5ECWA 1Z73A 4BVEA 3D7RA 3H8WA 3MERA 4UBLA 1DTEA 4M7WA 1CWUA 5MF6A 5M2QA 2IS4A 5KTTA 3E84A 1E62A 3JWHA 4YQFA 1ZX1A 2FB9A 1GILA 2I2XB 3NP9A 5A5GA 4XCQA 3LVRE 4GS5A 2F3RA 1KMIY 1FTYA 5K0NA 1U3TA 5L9AA 4CHTA 3H87A 4LQDA 1GD1O 1TVCA 1QIKA 2WHQA 3FH0A 4UFPA 3E3NA 3HCPA 5KWIA 3U62A 2XQIA 3U31A 4ENPA 4C04A 3PXDA 3MXTA 3A11A 1QZXA 1W4CA 1WZNA 4QO7A 2O50A 2HDWA 3FRHA 2GS9A 4GMFA 1QX3A 2R3SA 5KYTA 1QYRA 3AUYA 3LT2A 3IBYA 1C0LA 1XKLA 2CNWD 2XWPA 3BMNA 4C4XA 4C3VA 5IJZA 3UQYS 2C07A 3HZZA 1WUJS 2I29A 1NUSA 2FPIA 1PZXA 3N6VA 4AZWA 3FHOA 1G38A 5EJ7A 3DVRX 1XJWA 2FOIA 1OFHA 3RS7A 5CNJA 4Z0TA 4A0RA 5CIWA 4EMSA 1YVEI 3EF1A 1TVMA 1XNRB 1UDAA 3SXUB 1JT2A 3WGGA 1YZQA 4LXXA 3IEMA 4DT1A 3FNRA 2ZPUA 2H2GA 3G9XA 1A5AB 1B4DA 2OFPA 1YULA 1P0FA 3QMWA 2C3UA 2BI4A 1V0JA 2BFPA 1D6MA 2I7VA 5TQ0A 4BRWA 1ZU4A 5AJUA 1SUSA 2J32A 2P2DA 1HRKA 1YRQA 3GUHA 4WK2B 3X2SA 3CN7A 5I7EA 2ZBEA 3VC2A 5ARDA 4TLCA 2WOOA 1JN0A 3L82B 4P3KA 4LMPA 4HADA 1HEUA 3LCRA 1LTHR 1QG0A 1C7RA 2BI8A 5SY9A 1K8XB 1Z6GA 2ZB2A 4Y9RA 4KNVA 4CEHA 3B1KA 1YNSA 3P9IA 3S29A 1TCAA 3OMWA 3DD5A 1AX9A 1NNLA 5JLAA 3ZEIA 2EF0A 1PAUA 3CA8A 1JKJA 4AICA 5FIUA 2OM6A 2ZSUA 1H1DA 1NVDA 3Q40A 1QM5A 5KNDA 4W82A 1A9XA 1VCNA 1ABBA 2Z5GA 3GZJA 2IGTA 4GQBA 2FXVA 1ULAA 3TTUA 4DIUA 4DB2A 2R0QC 4IMRA 3HB1A 2GWHA 1JLHA 2NO7A 1WSAA 2TYSB 1VJTA 3VSDA 3Q8XB 4PZPA 1M3SA 1XTTA 4IIXA 5J2UB 3MUFA 3T5CA 4X95A 1VPVA 2LD4A 1Z0UA 3DE2X 1IEVA 1WPRA 1XO1A 2CFOA 2IE8A 3I76A 5B1DA 4C5BA 1IZ7A 3LVQE 4LJYA 2EKBA 2APJA 3C6XA 3FSJX 5C4MA 5AOCA 2X76A 5TF0A 1A50B 4LV8B 4O29A 5C4GB 1Z33A 3SD7A 3SKXA 4B82A 1K5HA 3DULA 1NI5A 2QD1A 2XWBF 4BGVA 2IPNA 5DBOA 2Q4DA 2AUTA 2IXTA 5AJYA 1YZGA 4MKFA 4NC9A 3MCAA 1LX7A 4ZVLA 3WIVA 3EXFA 1T5IA 3V00A 2F4NA 3D4LA 4QUIA 5E9WA 5G0UA 5IJXA 1TPYA 2CNBA 1SPBS 2H4WA 3VZRA 4A6XA 5IKPA 1RWQA 3OPYA 3VNVA 2OBMA 2VHTA 1ZMRA 1DRVA 2WIFA 2JK0A 3EGIA 4OGWA 4QUJA 4BJ5A 1JEJA 3QA3E 2C88A 1VCOA 2CYAA 2GF2A 1YAJA 4FOSA 1N6KA 3PVZA 4RFSB 5TARA 1NT4A 4DWWA 1PG5A 2VHCA 3X43A 3RS4A 5JATA 1T0UA 5JH7B 4K8RB 3KAQA 4LF8B 1NJ1A 1QGUA 2GZ2A 3EARA 4IVPA 1AQ6A 4XARA 5DXAA 2J4FA 5KMGB 2DWPA 2X6RA 3K9GA 3ASVA 4BB0A 4I8DA 1AV6A 3G9TA 3T5MA 5J4VA 2ZXEA 4JBNA 2ODAA 4FNGA 2DFTA 2C9ZA 3IODA 3ISVA 2C2YA 3I28A 1O96B 1ODLA 1KO1A 1R0XA 2CJXA 4C6HA 3AVTA 2Y1CA 3PC4A 1NV8A 1J7KA 2PWAA 2R5NA 2ZUCA 3CE6A 3DCNA 4NFLA 1C7IA 1NA5A 4H4CA 1E8NA 3GD7A 1P0CA 2VZEA 3RUDA 1N5JA 3LM8A 3K4PA 1JB1A 2H07A 2WIDA 4HZGA 4M0EA 4XX0B 5THQA 4UQOA 4YJDA 3V7FA 4PGFA 4XD7A 1RS0A 1SRQA 4LJLA 2FQXA 2PUTA 5COQA 3L7LA 3QMMA 4BU1A 2IEYA 3GXBA 2P65A 3USES 1P62B 1UM9A 3AKEA 4L8WB 4NZYA 1RAHA 4X20A 3PL5A 1ACJA 4HDQB 1KYZA 4AXBA 2IZ7A 2QTVA 3K71B 3FNGA 2QMHA 5BN4B 1DRKA 3E9RA 3CJQA 4B4OA 5F7XA 1NQWA 3LX8A 3FPLA 4BEBA 3F49S 3C8HA 1C8BA 3O0DA 3PXCX 1JPVA 5C1OA 4LC1A 3V7YA 1WXEA 1GJRA 2V58A 2JGDA 3MMZA 4ID9A 3NOQA 1UQRA 3B2NA 4YJHA 4BZXA 4ZYZA 4B74A 1YD7A 3DB1A 1E59A 3W7BA 3V3TA 1DX4A 1C7QA 5D7BA 2WP8J 4RSMA 3T99A 3E0QA 5J59A 3TJRA 1N36B 4FGUA 4IFBA 1W1UA 2VTKA 2OHFA 5T67A 4CLDA 5L7WA 3MBKA 1DB3A 4JI1B 3HGTA 4H6XA 5CYPA 3SKVA 2WJVA 3GN1A 1LA2A 1CY1A 4I66A 3MSXA 4OYRA 3VU9B 4DDVA 3JD1A 1VA5A 3OWOA 5C8YA 4IX9A 1JSXA 3H5RA 5HBGA 3KJZA 1HMPA 3ZLUA 3BCHA 4LHYA 2FNAA 4GLLA 4S0XA 2HNBA 1AMOA 4Y6GB 1Y42X 2X7HA 2BWJA 3CEMA 4WBSA 3GB9A 3VBEA 2HCRA 5F5XA 4D8XA 3QY9A 1E1RA 2X0DA 1ESMA 2QLMA 3ISJA 4LHVA 3VTAA 4ZVQA 1L7BA 1THTA 4PM4A 2JLAA 2BSQA 2I54A 1N7JA 3BIOA 4DJTA 4W5OA 3U44A 5CFLA 3PC3A 4XJTA 2GTPA 2I78A 1MQSA 1WD7A 1NDHA 2WR8A 4H0FA 4YCJA 2NO6A 5DNAA 5JOQA 4C0AC 3LLVA 1WXHA 2X1LA 1WBDA 3EPHA 1F51E 1YL7A 2BTQB 1A04A 2FWBA 1AKTA 2IYVA 4DDMA 4Q3CA 4KJXA 1GWNA 3H9EO 3JZFA 3TO5A 2H4HA 1C0EA 2L0XA 4OXIA 2PZMA 3R3JA 2J3QA 1DG9A 2W43A 4DYHA 4V1CI 1FJXA 4KYIB 3AUSA 2XCSB 3QKUA 2JH8A 3AZOA 3IJ5A 3KKEA 1Z5PA 4N65A 5JWHA 1UAAA 3C3PA 4KWTA 1FSFA 1IAQA 4JFRA 3ZY2A 1S1MA 5JVDB 4ZYVA 5I7WA 4XI9A 3PCTA 1NQVA 1FTSA 2I4OA 5KTRA 4XYBA 2P3LA 3KT6A 4CM6A 2FH5B 2I22A 1OFGA 3DTYA 4EK9A 1TKAA 1WU8A 2WFAA 4HH3C 4NFSA 1PWXA 4KDFA 1Z56C 5DDIP 2G9ZA 1FPQA 2FFHA 2AOUA 1KAHA 3UK1A 4E31A 2MSWA 3G8YA 3I72A 4BV8A 3K2IA 2QX7A 4ZQFA 4OIMA 1LWOA 1VLLA 3K9BA 3LUFA 1MC4A 2VDPB 2YXDA 3DJFA 4JASB 5FTJA 3SQXA 3RU3A 1WU7A 3KQLA 1HFJA 1U3WA 1Z15A 5AW3A 1P29A 5C31A 1C4OA 3F3YA 4EY7A 5CFRA 1JHDA 3NVMB 3QXSA 2E5FA 3RGGA 2Q07A 5CVJA 1GPH1 2P4SA 4BTEA 5K0SA 1LY1A 4LTDA 3T1VA 4BQSA 2IDJA 2J3IA 4IGKA 2DE0X 4W6QA 1NN3A 5PNTA 1Q74A 2WT9A 1F60A 4X91A 1EFAA 4L3VA 2I4RA 4R5HA 3ZLTA 1KOFA 1FW8A 2QAIA 3EIWA 4KXVA 3I32A 2IZ1A 4H35A 3AR7A 3GFBA 3BGSA 4MMYB 2X4GA 2I1QA 3HCAA 3HKEB 3NG1A 4PXAA 1VGVA 1JDTA 4MW1A 4DLTA 1RT9A 1Z5UA 2JLZA 3MXOA 3QVGB 4L8LA 2OB1A 1Z3IX 5AESA 1OAKA 4PCLA 3NT2A 2J9FB 4LJ6A 3DMTA 5I9SA 1Z16A 3URKA 3AVYA 2NN3C 2PSJA 2VJQA 2ZYWX 5JD3A 1QU3A 2DY0A 1DC8A 2L2QA 3DBRB 1X7WB 2HBYA 1GTVA 2ZBVA 3EGWA 3CNOA 5CNIA 3ZHBA 1TUBB 3D6AA 1RKBA 4MDFA 1CIJA 2V65A 3Q7SA 3Q2KA 1T6ZA 1I0ZA 4RAQA 3SR0A 5BN5B 3UN1A 3RK1A 1YDHA 3HR4A 4LSZA 2O5RA 2QYTA 2A9VA 3CRRA 3BEOA 4CFZA 5BMVA 1S4QA 1MG0A 1EFKA 1L7XA 1BJKA 2O6HA 3DE3X 4BOYA 4MXDA 5AHKA 3KUKA 2QD3A 3P1JA 5GP1A 1TQ2A 2IBTA 2FX5A 1GUBA 1ZOLA 2YWCA 3PRHA 1BNCA 5KMGA 4R54A 4G5YA 1CVRA 4C0HA 3R4VA 4YUWA 5KKAA 4NS1A 3HKDB 3W4KA 5FYQA 2JFOA 4N8EA 1PK9A 4BTVA 2ZJ4A 4ME6A 4PO1A 2K5UA 2HLDD 1CUZA 3LXRA 1QPZA 1PR6A 5IHPA 3G2KA 1SCKA 2EKZA 4HNQA 3RC2A 3GWZA 4J9UE 4E1VA 2ZIAA 4FBLA 1L8OA 1U9IC 2P3SA 5KTKA 4XX0A 5KYNA 3ND9A 4B0OA 4RSHA 3MAJA 4C2UA 4CMCA 2CV1A 1VJGA 3E15A 4RQTA 4DQLA 1SHUX 2XH8A 2W93A 3BDVA 3EW9A 4JJ4A 1J2TA 5JAQA 4RCYA 3NXSA 1PP4A 1CF2O 1KHTA 2F3TA 3KEQA 4E94A 2O54A 4FFNA 1R8QA 1WULS 4NDAA 1L4FA 2PGIA 1XMSA 2GN0A 2WM9B 1Z4OA 2Q5IA 4B6JA 4K9MA 4R69A 3NDBB 4GOJA 3OMLA 4P31A 5CAEB 4PXYA 1XQYA 1M2EA 4DS3A 5BN4A 1N2EA 1E6MA 2FP3A 3DLPX 4NFYA 4OH7A 1I3OA 5DLYA 2WDPA 4GOOD 3ZG6A 5I01A 2WF8A 4CMIB 1O6BA 4FI3C 4AKGA 4PAWA 2QTGA 3T1YB 2PVCA 1X1DA 2QRJA 3CX4A 3DCJA 3ORFA 5J2TB 4RMJA 1KMNA 3ZGXA 1B8NA 1F3OA 1MRNA 2HRCA 3SMVA 1F4PA 3QTTA 1BDBA 1S2MA 4HAVA 1HY3A 3EZ2A 4I4TA 1JFLA 1YIOA 1RAIA 4PBSA 4P7FA 3ZXUB 4FFMA 2J46A 1N2CE 1LC3A 5ALUA 5DI3A 2WZQA 2IV3A 4QGSA 4YMHA 5B4TA 2ZIXB 2ZSDA 4FINA 2ZE7A 5CA0B 2Y71A 4U8HA 2NWQA 5AW0A 1TQHA 4FT4A 5AVZA 5SZKB 3W1EA 5H81A 3DHEA 4M87A 2PS3A 3IUJA 2UXBB 1TZ2A 1D6NA 2BKAA 2PCJA 3EQ6A 1IPFA 4UFNA 3B3QA 3ROTA 3VI4B 2H5EA 3NP7A 4Z7QB 4B3RB 5T5QA 1Q92A 3V7NA 5EXSA 1FSGA 2BPOA 2Z9CA 2HM7A 3L2OB 3U13A 4RZXA 4YJGB 1DWQA 1SO8A 3KLNA 4DG5A 2C7PA 2O3JA 1U4SA 4EG4A 4HB3A 1EJ6A 4UM8B 1HH4A 1N6IA 1SXPA 3TDMA 1E0AA 4RJLA 1ZXBA 4LF5B 2HCTA 3NRJA 2CHFA 3E81A 4EFDA 2PLRA 3HCEA 5L8VA 5ENZA 2P4UA 2FDCA 3QKWA 4DMCA 4TTAA 1LSSA 2ECFA 3JQ9A 4JB2A 5DBHX 3GLRA 3WYBA 2R7KA 1HLDA 2QN2A 3O4HA 3FCSB 3DZJA 1F7VA 3KZMA 3ZJ5A 1P7VA 1RSZA 1W1WA 2X14A 1X87A 2NADA 1YRLA 1JG7A 1X7XA 2E5WA 3B1VA 4HGZA 2OBBA 2HF2A 3KOZA 5AI4A 4LF9B 3TPFA 1XZLA 1NW9B 4LN1A 4CMEC 4MIYA 1Q11A 1B3RA 5MFZA 3LY5A 2YWXA 5JZSA 2EXXA 1L8XA 5A6SB 2FWRA 1E4EB 4YHHB 2PEZA 1KNQA 2J0VA 3N0XA 4UUPA 1A1SA 4XJVA 2GYYA 1S96A 3Q3HA 1OWOA 2YL2A 3K6KA 3KFXA 2QIPA 2P3OA 3B3FA 4FZ3A 4D79A 2CWDA 1ECGA 1E5VA 2HEGA 3BDAA 2FQQA 4OM7A 4NPAA 5AKEA 3TKLA 2LGJA 4UOQA 3CZAA 1ZM4A 1P5HA 3ZV6A 4J4BA 2CJPA 3TZCA 3TMYA 3UQZA 3BWXA 1L5MA 3UZUA 2QRQA 1KEEB 5K8VA 2NV2B 3UENA 1XZAA 4HFMA 5IX8A 3JVEA 3BFVA 4KO8A 4E4YA 1FSPA 3HBNA 5AI8A 3WMXA 3ZV5A 3PP8A 3WGVA 4DHEA 4KITB 3CMCO 3Q9LA 1ZGGA 2G88A 2PT9A 2X8AA 2GAIA 3UF0A 4F72A 3H75A 5IVHA 1U0NA 1K75A 2G63A 2WWVD 3S28A 3NCHA 4OHWA 2PAFA 1P9RA 2VYVD 4QUGA 3OCZA 4BO1A 3THXB 1J9GA 2V97A 2XGGA 4QOSA 4WFKA 4Z51A 2OCXA 5A0FA 1BFDA 3GEBA 1ZI8A 3H18A 4DIDA 4WCFA 2OAGA 2Q1TA 1EKXA 4QJIA 2I3AA 5LD2C 4D26A 4AUNA 4BVGA 1FFDA 1UBGA 1VKZA 5AKIA 3PICA 5HDBB 2C1ZA 2R1UA 1P72A 3A8TA 2JAUA 1Z7BA 2QJRA 3QPCA 3LQ4A 4IMIB 4MVWA 4TTTS 3DNMA 3K0AB 4DIEA 4CTOA 2PJDA 3NATA 4MAFA 2R4TA 2W42A 2P62A 2WM3A 4KLAA 1PWZA 3FYCA 4BX9A 3LGXA 4IRUB 3QVGA 1TVEA 3VXKA 1EUDB 1SXIA 1T5DX 2GF0A 2VH1A 1GQSA 3ZK8A 3WV5A 4V0RA 4IMPA 3LO8A 4QJ3A 2C2BA 2AXQA 2HA3A 3FFAA 3GG2A 4U9UA 1LJLA 1X0XA 2C3MA 4CKXA 2YKGA 2AOWA 2DUWA 3PCXA 4CL0A 4LGCA 2OXRA 5JPCA 3PJGA 3TL6A 4DGQA 5IG2A 1X7WA 4MHSA 4O2BA 4L3OA 4RKWA 1TUBA 1L6IA 3AJEA 5CA1B 4UAVA 1K8RA 3V4SA 3QYPA 3LUBA 1ONBA 1Y9ZA 2WSBA 5BN5A 5F12A 2JK1A 2C9DA 2N9UA 4PPNA 1E63A 3NM4A 4MPDA 5CX1B 3OX1A 1GZ6A 1FP4B 3QU2A 1MPTA 1TZKA 3DH0A 2I4TA 5J1TB 3D3KA 1U7PA 4CLHA 5KTMA 4IVNA 1XJ5A 4UUNA 1E2FA 2AOVA 3LVBA 1CZLA 2I2WA 4LHZA 4QXOA 4C0LA 2GAOA 4DCOA 1T5BA 3OIWA 3HKDA 2RE8A 2QTCA 2XTJA 2B7CA 5GMOA 1P33A 4HS4A 1Q14A 4UBJA 4CKCB 5EQDA 2YOHA 1LJUA 3WNQA 3PEVA 1L5QA 5K3AA 1XVUA 3S1AB 3RUHA 3H2BA 2XZOA 2W2OA 1I94B 1WQ1R 3L0PA 3SP1A 5IAOA 1GT91 1CR6A 2J3HA 1TADA 2OORA 3ZCVA 1LBHA 1T0JB 4TT8A 2ADMA 1XZGA 3GPDG 2BGLA 3V8BA 2CXSA 3VZQA 3PT9A 3KHUA 1DRUA 4Q7LA 1DAMA 4AG5A 1VI6A 1WW2A 4BFVA 5JS1A 2INGX 2LV8A 1GQQA 1JW9B 3NVDA 2EBHX 3KKNA 4NPHA 2WM2A 5FTKA 5CAEA 3KQMA 1NUQA 5LFAA 1XCBA 5IAEA 3OOJA 1MU0A 1RDFA 1D07A 1FB5A 1L5OA 1P9LA 1LRKA 5DM60 4F4HA 3PEEA 5AKXA 2JAPA 2YIJA 1V2HE 3JYHA 5FCDA 1E1QD 4L8FA 3NVKI 2ZT7A 1BXKA 1QRTA 4R2KA 3AY7A 2ROQA 3ILHA 4Q82A 1FP1D 1GIAA 3FCUB 3L18A 5IC4A 4PVDA 2CDRA 2B36A 1Y89A 1UMDA 4AY2A 3AIIA 2EBWA 2Y9MB 5K0BA 2GXSA 1A98A 4JLJA 1THGA 3IQFA 3RW9A 4DLYA 3L77A 2DT5A 3KE9A 5I48A 4GWLA 1P9WA 3SFVA 2ZIXA 4LC0A 5CA0A 1S9DA 4FEGA 4FM9A 4H3SA 1PT6A 1Z6ZA 1AA6A 3E22B 4MS4B 3J81A 2ZRQA 4D4MA 1WXXA 1NGSA 2W11A 2JS7A 1E6EA 1N92A 1P2FA 3HLKA 4NXNB 2X4DA 1M6YA 2ACVA 2I3GA 1NBMD 3E1KA 3OZXA 4I55F 4CTNA 5BNIA 4KO2S 3IIMA 5D01A 3PLRA 4MS3B 1YZTA 4PYLA 1RYFA 2PL3A 1JEDA 3S1LA 1UMCB 3CB2A 3BPSA 1SCAA 1UMKA 3IS3A 3OEHD 5JJKA 4CUKA 1NXPA 2A9QA 4PO8A 3EEFA 3PQCA 1XR3A 3BE4A 5E1BA 4PZYA 4WESA 5A2GA 2OCPA 1KAEA 3ETHA 3Q0TA 4FKMA 4POOA 1N6NA 2H2AA 1N0HA 1CJMA 1FDRA 5K8IA 4E5SA 1XZBA 1YH3A 4QM7A 1CG6A 1IK4A 1JZSA 4NICA 4PZCA 3PUJA 1LI4A 3AILA 3C74A 2Q3FA 3QPBA 2Z2JA 3LUAA 5AWFC 4CM9A 1JQEA 2DUMA 2W8ZA 1I3CA 1MW9X 2XRZA 4B35A 4B85A 5DTIA 3OF2A 3FB4A 2QG6A 2XT0A 4OD0A 4S1OA 2XIQA 4KVAA 1TDJA 1U2GA 1RMTA 3F4KA 2Q99A 1O87A 1E4EA 2GBCA 4E1AA 5CXSA 5EKTA 1JWAB 1V26A 3G7NA 4D56A 2C3PA 4I4CA 3K0FB 4AQYB 5BV7A 2ZCUA 3GRAA 3VR4A 3T5TA 4EA6A 3CJTA 2O8CB 1ECBA 3KUCA 4C07A 3QK7A 3TSOA 1KDPA 3UMVA 2FZLA 4UEWA 2BFDB 2EGUA 3Q7PA 4DV5B 4EKNB 1PWHA 2AR7A 2NTYC 4GR4A 4HQ0A 5EIBC 2Q8NA 2YXPX 5T8KC 3G79A 4B3HA 2IZ0A 4C4PA 4CHGA 3GLIB 4GYKA 5DH9A 1BCSB 2XNDD 1GXSB 2HYDA 4LK2A 3I61A 5DB4A 2AZDA 3A36A 2GOYA 4RE6A 4TZ0A 3UT5A 2HRRA 3V8QA 4ZP1A 4KOEC 2BKLA 3GYGA 3A6FA 1TE2A 3P9RA 5EAIA 1LI5A 5ITWA 2QT0A 4RYLA 2PNFA 4UATA 1OGJA 4HXEB 2F3PA 4I19A 1M2OB 1PZEA 1VYVA 1SIWA 3DZDA 4JUBA 3THXA 2BKVA 4MRVA 3RI3A 5EMKA 1OBCA 2Q5EA 4WZAE 5TX7A 1SN7A 3T3EA 1TFUA 4JKIA 3A2KA 1PKEA 2ACEA 2RGUA 3ELUA 3RFCA 3T7DA 3THSA 5IJ9B 1E3LA 4FHCA 1OYYA 5HNKA 1OH5A 2PQMA 2OFOA 1IDN1 3ED5A 1S1CA 1XDUA 2QJFA 4ND3A 3VM6A 4JD5A 1ZRNA 5BY2A 2HD4A 2BE9A 5IK2A 2PPLA 3DD1A 1P17A 4EYQA 2QY6A 3WVNA 2E49A 4ZGGA 5JJIA 3CSSA 3RVNA 1RABA 1ZAKA 2NM0A 4WGFA 1BSVA 2B5VA 3D6FA 5DVZA 4D02A 1E5DA 1EUDA 1KERA 4OHCA 2HGZA 3SLGA 3MA0A 2Z43A 4RTSA 4RBNA 3DOCA 1HEIA 3D3EA 1DX9A 1KMMA 4IOJA 2A9FA 4BNKA 3W34A 2OE2A 1JJIA 1QLWA 3P7MA 3ID6C 3ONWA 3I6IA 4TXJA 1JG6A 2UUBB 3FYUB 4KR2A 2NUBA 1GUDA 4KK3A 5CA1A 2JBWA 1PJBA 1ULTA 4DC1A 3FVWA 2Q46A 2UUPA 4B4WA 2C4VA 3FXAA 3N2YA 3B7GA 1N9GA 1E66A 1HRDA 4AP5A 2J3KA 5LZ9A 4PYOA 3JAWB 1JFFB 2RDMA 2FP4B 2EV9A 3O1JC 1B8UA 4HX2A 2RAVA 4RV5A 5F5NA 5JSHA 4TWBA 4D8UA 1ZD2P 4LWPA 2HQRA 4XD2A 3EIOA 4DMMA 4TVKA 3FZNA 2QZ9A 2AG5A 5JSKA 3HWWA 3PV0A 4TGLA 1OILA 1QO0A 3PPWA 5IAKA 1DIBA 3GVPA 2C5GA 3VAYA 5FOXA 5H4HA 1GDTA 3GFRA 3PZRA 1NUTA 4NP6A 1ZCFA 3IAS6 4EVRA 3FI0A 1EUQA 4PQRA 1XCPA 4CKCA 5FUYA 3EF0A 1KOGA 5KREA 3H2IA 2XCLA 1ZAYA 1BFUA 1P73A 1IM8A 2BZSA 2DLDA 3HSSA 2WTMA 2X0NA 3JWEA 4W8OA 2BUCA 1V6AA 3KSBC 4R5MA 3TTWA 1G291 1OWPA 4Q37A 3TSZA 4F3KA 4K6KA 1O7JA 4RMGA 4AFNA 1TJ5A 2NUTB 3SJAA 3IHLA 4CW7A 1IHPA 1A69A 3OH8A 3VC7A 2P35A 4E4TA 4R1PA 4WADA 1T0PA 5C3MA 5DT2A 4FW9A 4RFLA 3WISA 2JFVA 2UVPB 2IV7A 4RTKA 2IS2A 2MJLA 1NVGA 5CD9A 2B30A 1LX6A 2QYSA 1U7TA 3OQBA 5FQOA 2PJUA 1T0IA 1IVNA 1I0LA 3WK4A 3VPFA 1QOQB 3BWEA 2V74B 1RYBA 2FRVA 3MQ4A 1QV6A 2PDAA 1W0JD 1NKTA 1H1TA 3G5MA 3L7OA 2PQ0A 2Y6VA 4NTZA 4AP9A 1Q0SA 1U31A 3CLRC 3HBMA 5FWXB 1I7PA 1C9NA 1ESNA 2LRHA 2WJHA 1DAFA 2XUKA 4BB5A 1CUSA 1A7AA 5BSGA 1TT5A 4QYSA 3RVKA 1WCYA 1H2YA 2HADA 1W44A 2IOFK 5F2KA 3RKRA 3RRYA 4OQMA 4HV4A 1ZK2A 5JHHB 3N7UA 1RRFA 4JLOA 1GU0A 3KJHA 3OLCX 1O2DA 4S1VA 5C34B 2GFHA 2HJRA 4HPJB 2AZTA 1XRPA 4QBFA 5EZ5A 2YZGA 4NL4H 3AR8A 3AF5A 3TM4A 1Y3CE 2C2OA 1WSDA 3ENQA 3O1IC 3QW4B 3U1TA 8AT1A 1L5ZA 2NW6A 4B3JA 1MTOA 3E22A 1OGIA 3UPTA 4XSGA 2Y68A 2FW6A 2IUUA 1G7SA 821PA 1S3GA 3FYDA 3KL2A 1WCXA 5HF5A 4BNTA 4L6CA 3UJNA 2DHEA 1HT0A 2OZVA 1J2RA 2CNWA 2ZXUA 4MS3A 2JJ2D 2BM1A 1XMPA 3KQNA 5G1PA 3HZOA 1QKKA 1WV1A 1DJMA 4TSKA 1L6RA 2UYGA 4DQXA 2ZSIA 4BWVA 1UWCA 3CUYA 4L50A 4DN6A 3TM5A 2CF5A 2QI9C 5I7HA 1XRMA 3NKLA 4BMCA 3MZ0A 4AXXA 4ONEA 4U7HA 5BSFA 4I2VA 5ARBA 3OKCA 2XCTB 1IONA 2HV8A 4AJJA 4EJ2A 4HFRA 3O73A 4NCNA 3OIUA 1RPTA 4AJEA 1MO2A 2C7VA 4DZZA 1NVTA 1BKYA 1P5ZB 4DJFC 3IL2A 4KQCA 1TIPA 1IEQA 1FF9A 4F7DA 5CCEA 4F3RA 1RBYA 1RAAA 5JCOA 4HAYA 1WXFA 3DLCA 3IQZA 2V96A 1AXRA 3SX2A 5KOJA 1T2AA 3ROFA 1CJCA 3SE0A 4C3ZA 4P5EA 1S0UA 4XTRA 5FBQB 2GN8A 1UPFA 3A3OA 1Z06A 2QT1A 4B87A 2UZAA 5IHXA 3KR1A 5JNSA 1Z88A 5AKGA 2AFVA 3G8AA 3L6DA 1CIPA 5C7OO 1XVLA 4HAOA 1JX6A 1IJEA 2BFDA 4V2UA 1T26A 1YK0A 5IN5A 1O9BA 2C8LA 2AFHE 3BE8A 3C5HA 3DWEX 5FTMA 1G8SA 5EHGA 3E3MA 3MUEA 4A5SA 4HGPA 2FSUA 4AUEA 3WGLA 3AKDA 3AVVA 1EVLA 2GEBA 4QNRA 1JHVA 2ZYSA 4WTOA 2FMHA 2JZCA 3NOOA 1PI3A 4B80A 4RQUA 2BMDA 4Y2XA 3J80A 3AJRA 2HBRA 4NZ9A 3VHRA 1NYTA 1P19A 2JLBA 2YFYA 3K09A 2ZYUX 4IHQA 5JC1A 2TMDA 2RJNA 1QYIA 5JZOA 3PEYA 2FN9A 5CT8A 3FPFA 2YR0A 1M2OA 3MLEA 1C7ZA 3QOWA 7REQB 1H4QA 2AMLA 4BP3A 3GP8A 4Q1FA 2HJWA 4V38A 5G0VA 1CUBA 3NNSA 2NVOA 3R5HA 3I2FA 5E7JA 5BQXA 4QELA 5EHZA 5KDLA 1YZFA 5ALDA 1BVYF 4ZOLA 1GG5A 1DXOA 1TMGE 2QZPA 3U40A 4S24A 5CDSA 4M6WA 4E13A 4R3NA 1Z5NA 2DTXA 3SXPA 4F1WA 4W9NC 1W52X 3WL7A 2VAXA 2BKXA 5IBQA 1NBWB 4Q4JA 1WMSA 3TDNA 4S04A 1X8XA 2X5OA 3KYDB 3QHQA 4LNAA 2QJTA 2D2FA 2PIDA 3CZMA 3LL7A 5C8VA 1KU6A 2E1PA 3UWOA 3OKFA 1MX5A 4MQ6A 1NMZA 4FHFA 4RETA 3NYRA 1P2VA 5FH9A 2CL5A 4OL9A 4X0EA 5I9LA 2QN9A 5KSOA 3GJ6A 1Y7LA 3X1YA 4D3YA 4JI3B 4Y9TA 2KSQA 1ESZA 4L5IA 4G36A 3M4YA 1L0BA 5CHYA 4TUYB 4JI5B 4V0OA 4AY4A 1HQCA 5EHNA 2J9RA 3CM0A 5EA2A 5EE9A 1TEZA 5KINB 1Q6YA 2OUIA 2FFRA 1JFFA 3JAWA 4PQFA 2VP4A 2FR1A 2GDZA 3U4HA 1US8B 1BXRB 4K9OA 5E3HA 3I64A 1OJLA 4IP0A 4LUCA 4ZO7A 5A7HA 3I4FA 1E2NA 1OC4A 1QQAA 1ZWKA 3I2KA 5J40A 3FMOB 2R9VA 4D92A 2G82A 5ALVA 4HDSA 4QQKA 4LXQA 3FBTA 4QJ4A 4RZIA 3ZZUA 4KO4S 3FOEC 1G63A 1W34A 4INPA 1TU3A 5EC8A 3LC1O 3FYSA 2LW7A 3KTAB 2AC4A 3W5JA 2VWQA 1WV0A 1TO2E 3GUCA 4JJGA 4QXRA 5F52A 2XYVA 5KAPA 3W06A 4LF6B 4IS2A 2BHRA 2NT4A 3ON5A 3K6SB 4BO8A 1WUYA 4JJ8A 1JMKC 3O4IA 4MLZA 3ZBTA 3QI7A 3EBPA 4UD6A 4B81A 3IP1A 4DOMA 1G5HA 7ABPA 4ACAA 2GN6A 4LOIA 3WLIA 3VNUA 2H16A 4OLFA 3D6TB 1P1FA 2A88A 2C99A 3B36A 3EEIA 3DVAA 1RCUA 4DMRA 1LW7A 1XQWA 4MWGA 4TYPA 5KHAA 3IVXA 3BFPA 1MX3A 6LDHA 1W76A 2EJBA 3KCQA 1QP0A 2AXEA 3KB1A 4KMRA 3UBTA 1BXZA 1U1FA 4D8VA 5FWXA 1M1XB 2WF5A 3SJCA 3I9FA 3CVXA 1SGWA 4DJJA 2GN1A 4LCBA 4C0BA 4Q19A 5J63A 3CUEF 4GNRA 3UWPA 1G2IA 1VE5A 1JA9A 4L9RA 1IWBB 1FMJA 4CCAA 4EYOA 4ZEOA 1KH2A 3C8DA 2FR0A 3TGWA 1SFRA 2H0RA 3P4UA 4PCVA 2AVDA 2B78A 1ONOA 2WJ6A 1KYTA 2PS0A 4HG2A 4A03A 2VOEA 4G37A 5DN6A 3BF8A 4NVRA 3SDZA 2GLTA 1K2VN 2WJIA 1KQNA 2JARA 1FXWF 2ALJA 2Y4OA 3IOYA 3TEFA 4GEGA 3VKVA 3QE4A 1EVIA 1TW2A 3OG9A 2IYQA 3T35A 5HHTA 1OXBB 1NOKA 7AT1A 1LCIA 1EG2A 1LSUA 4S2EA 4C3UA 1Y48E 3CGWA 4U4AA 1T34A 2RCYA 3OIDA 2XWSA 3OJWA 3UT0A 5JU6A 1WB6A 1C4WA 1U1GA 2X1VA 1T1GA 4GMHA 4LHXA 1WHSA 3JWIA 3HFSA 2XXBA 3C7KA 4CV0A 4KWCA 5TT1A 1ZLXA 2AF3C 4GI1A 5HYVA 5JNWA 1YZHA 4F5ZA 5CXUA 1H85A 1CUUA 2Q9BA 2SCUB 1O95A 1NLYA 3F5DA 4N4AA 4G4GA 3SEZA 4E0BA 4WN9B 1V8OA 4HN9A 5B1SA 1QV9A 4XPIB 3NFRA 1Z68A 3GJTA 5AO9A 4UHEA 3SHVA 2HU2A 3NBUA 4JN6B 4LDJA 4JZYA 4ND2A 1MAUA 2HBZA 3BXEA 3DDSA 5TQ2A 3N8IA 5LP6C 4LE2A 3RWMB 1SC1A 3ER8A 2ZUTA 1VRWA 1TYBE 4WJLA 1VB5A 5B30A 1NW4A 4LQ4A 4OO3A 4E5VA 5U9CA 3N2ZB 1PFWA 1XELA 2VVTA 4H0CA 4YUXA 3TL2A 1COZA 3V48A 1YA8A 5H16A 1XMXA 4NDNE 5HFAA 4B43A 4H7KA 1EIZA 1Z7YA 1I5OA 4HLQB 4D9HA 2ANBA 3C8UA 1N3BA 4L3WA 1N2CA 3L4KA 4I5FA 2OG2A 2QL5A 3R6DA 4DLLA 3SC3A 3I83A 2QBYB 1NU6A 1V45E 4F1JA 3ESDA 4YRBA 3KJIA 2QRHA 4I4TF 1XP8A 2RB5A 4GI3A 3N0TA 1AK2A 1I5RA 1TCVA 2GEFA 4GR9A 2RCNA 1USIA 4BP1A 2NSYA 2PX0A 3CLTC 1YS1X 1QR6A 5K99A 1UANA 4K1XA 4GE3A 2EFGA 1XKTA 2GZHA 2A92A 2YYYA 4ZFNA 3DZBA 4LZJA 5JFTA 2I6TA 4UE6A 1XEFA 4JL5A 2XXAB 2N1BA 1FVXA 3TDKA 4Z4QA 1COWA 3OTGA 3AXSA 3L5OA 1YTUA 1S7CA 2X9QA 2ZWMA 3A2MA 4QPCA 4AMBA 1QCZA 2P2CA 4B6PA 2H52A 3AEYA 2OXIA 1HDYA 3VSAA 4D6PA 3GBPA 4H3HB 2WU8A 1GGKA 2QUBA 1NATA 3TCXB 4NAVA 2YHIB 4GP7A 1OZHA 2X0JA 4O4JF 1G20B 5FA8A 4AZ3B 2QD4A 3IMKA 4MUFA 4WCDA 4YDHB 3AVOA 4KV7A 1V3VA 3R5TA 4MAAA 4PZ0A 4WSOA 5FPYA 4D9JA 2IEZA 5JNTA 1TX4B 3DTTA 2QAGC 1N1MA 3KB2A 1RM3A 2C5HA 4L9SA 1E3QA 5IM4A 2A1UB 4B6EA 4MQEA 3EASA 3GLFB 2PV0A 4ZA2A 3NXKA 3PXEA 1DO2A 4R68A 2QM0A 3CUSA 5ICEA 5JRZA 3NT4A 2X8BA 1UJ5A 4BLVA 3KEOA 1U4OA 3DKIA 2P5YA 5EI5A 5BQ5A 3REOA 1KXJA 3OZFA 4GPIB 2RK6A 1RMYA 1XLVA 2VP6A 5SICE 1N3IA 2FRDA 2PRYA 3RODA 1AXGA 1XROA 2RHCA 2YY5A 4KZKA 4HY3A 4YK7A 4OKNA 3OI7A 4L5BA 2UYOA 3OJCA 1T4CB 1GKLA 4RUKA 1WEHA 1O9GA 4MVJE 3W1VA 1R6AA 5JT1A 1CB0A 1I4TD 3FRIA 4LQLA 4O5OA 3UY4A 3W9SA 3AOEA 4GKBA 1HSOA 2X5NA 4OJKA 3NHPA 3OU6A 2WKQA 3HN7A 1U1EA 1N3LA 1XVVA 2IYUA 1GRCA 5FAKA 1FLNA 1WQ4A 4FDUA 4Q1AA 3O8RA 4C2AA 4B3BA 2EZ9A 1KYWA 4JJFA 2I4NA 3PHGA 3DFFA 3ONFA 1NUHA 1V6SA 3KRTA 4HTAA 4JSYA 4PY2A 3ZIAA 1Y7TA 3DSRA 1EWYA 1QHGA 3K4QA 2WTNA 4PQEA 5EQTA 4D8YA 3V4PB 1FNCA 5TEVA 1GDHA 1MBZA 3WLPA 3ZNOA 1Z36A 4E5UA 1CP2A 4W5WA 4NE9A 4Z54A 5JMTA 4QEZA 4NWIA 1VYUA 3IT0A 3Q98A 4UOZA 3PGA1 1F3LA 2HLNA 5JTUA 1GN8A 1X8KA 4AMUA 4R01A 1Q0HA 3NC0C 3MJVA 4WZAB 5AJZA 1W0CA 3QBDA 1YVDA 2IEBA 1MJFA 1CEYA 2X7XA 4G0ZA 4JBWA 3IBTA 4O6VA 1MVLA 5HGJA 3B20A 2NO5A 5IDXA 1E0SA 5A4MS 3M7IA 1QQ7A 1AH2A 3T41A 4R9VA 2R00A 1SK9A 2H18A 3E9QA 3X44A 4E12A 4WD3A 4C4YA 4I1YA 4N49A 3OCYA 2DWOA 3GFSA 2R47A 3HCOA 4QOHA 3T7CA 1PL7A 4PLYA 2WYUA 3TKAA 3ZCRA 2OMKA 4D82A 1KBQA 4XQ9A 5I9NA 4ZQIA 2EZUA 4LI3X 4Z4HA 1R5JA 3SC2A 4OP2A 1H5QA 3OQ6A 4MKHA 2FUCA 1WB5A 1YB4A 1AKEA 1QRDA 4L2IB 4TTPA 2JFGA 1BC5A 4IZHA 2ZRNA 3EC7A 3QU4A 3L8YA 4JH0A 1P5JA 4QU8A 3UV6A 4Z49A 1FUKA 3F1KA 4XCXA 5KYXB 3ADDA 4KIGA 3ZU4A 2QTAA 4H4EA 4O2BF 3R7WA 4UCWA 3BHMA 3N28A 2M6KA 2DHQA 5AVKA 4MS1B 2J6IA 2HDNB 3GAFA 1ML3A 1EFPB 1JXMA 2GK4A 1GAEO 1GPYA 3HVKA 5AT1A 1SQ0A 3WHLA 1U65A 4IJMA 4YT5A 4RVOA 1XTJA 3VZBA 1P44A 1DV1A 3O47A 5K09A 1KJNA 4UVGA 1EJ0A 5FOUA 2AUNA 2C92A 2ZGVA 2COUA 3UUFA 2OOSA 2JIRA 4XQGA 4RVNA 3VHXB 3WHKA 1CF4A 3CH7A 5BVHB 5B3JA 4AW9A 1Z9BA 4C2TA 2AMYA 1G5IA 1ES9A 3PJFA 1MOSA 1OI2A 4EL0A 2QLTA 4QZVA 3GVIA 3KZOA 3VC1A 5HWSA 3FLAA 1QIGA 3FCOA 3UAWA 2B1RA 1VM6A 1VHTA 3ITEA 1TAQA 3EC1A 4H1HA 1DOZA 3PWSA 4JYPA 3TPZA 2XCIA 3NYQA 3QYJA 3K32A 4ER0A 3QOFA 2HPAA 5JO0A 1BGWA 3U56A 3R9XA 5F98A 1YU9A 1Y8CA 3L0YA 4J4HA 4PWYA 4E07A 4UKDA 5JLJA 3IAS1 3FVTA 4UPVA 2OO5A 2WFLB 4WN9A 4Q7QA 3U81A 2IYZA 1Q2XA 3JQAD 1JHMA 3JVVA 3MT8A 3EIXA 4ZALA 3CVOA 4LGMA 5IYZF 4EYKA 5LBUA 1JLKA 1K5PA 1KMHB 3LOQA 3FDFA 4PSK