3UB2A

Tir domain of mal/tirap
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
125
Chain Sequence
SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into TIR Domain Specificity of the Bridging Adaptor Mal in TLR4 Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
total genus 41
structure length 125
sequence length 143
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3ub2A00
4LQDA 3UB2A 4LZPA 2J67A 4DOMA 4OM7A 4LQCA 4FZ5A 3JRNA 4W8HA 3H16A 5FORA 4C6TB 3UB3A 5KU7A 2Z5VA 1O77A 1T3GA 4C6SA 2M1XA 4EO7A 1FYVA 4W8GA 5H3CA 4C7MA 1FYXA 2Y92A 4C6RA 4C6TA 2JS7A 1FYWA 3OZIA 3UB4A
chains in the Genus database with same CATH superfamily
3TL6A 4P4SB 3EUEA 4ZTZB 3ANYB 3EZ2A 1S4MA 1WZNA 2FSUA 1NRIA 1RM3A 3A11A 3DZCA 5GQSA 3OLQA 1YFJA 1CUUA 3R2JA 3ZHQA 1U3CA 2BAGA 3H3XA 4AXXA 2C57A 2AYZA 4GPIB 2HPHA 3ZK9A 4KPFC 1K92A 3E9YA 3LYHA 2R1UA 3R5XA 4HV4A 1G8FA 4MW7A 1C0LA 2QUZA 5KINB 1PUIA 1U0SY 2ZCVA 4GXQA 5HQ3A 2LPMA 5KQSA 2GPJA 4P1ZA 3O38A 5ALZA 1PGOA 2VIIA 4Q3AA 4RKWA 4DGQA 4HNHA 4YY3B 3UKDA 1XK6A 1FL9A 1Z0SA 2PGJA 2VHCA 3DCNA 3MNFA 3RFVA 1BU5A 3KT6A 4DDHA 4FYIA 3MJVA 4QRDA 4OXXA 3H87A 1E7QA 1MJHA 1WHSA 1MA3A 2P2SA 3AOEA 3K6KA 2VH5R 1KKUA 4R2IA 4X7PA 4DNPA 1VSUA 3P5SA 1F12A 5H0IA 1XP8A 4LNHA 3EBOA 1FFBA 2G9ZA 4MUNA 3ER8A 1KIMA 4XSVA 5HF6A 5ALFA 2V6FA 3G5AA 3RIYA 1S1MA 3LHIA 4JIGA 4H3HB 2PKWA 4EY5A 1QIFA 1D9ZA 1R0WA 2VXBA 1R16A 4Q1BA 2D1TA 4KQ1A 5HRAA 3P2OA 4QJBA 2QPLA 3WP0A 4N5MA 4YT4A 3O0TA 5C4GB 5J3JA 3P2MA 1F60A 1QOZA 2RC6A 2QLMA 1IJFA 2WPNA 4TS1A 1D07A 1JLMA 2FZEA 3GT7A 3DAFA 4K9SA 3PP8A 4EQZA 4K6MA 5C5IA 5KEIA 4XKJA 3B5JA 3L4SO 4FHEA 2D13A 3NM4A 2AI2A 4BJ6A 1UWVA 4ZZ3A 3DNMA 2A3RA 1GPYA 2FSFA 3BULA 5FADA 4YP9A 2AYXA 3OBIA 1WWKA 3G0BA 1KC1A 2P0EA 3CKMA 4PINA 3X43A 1NT4A 4B17A 2Z5FA 4EOGA 4ZKEA 4DZZA 5LKRA 1TT5B 3DOIA 4ZYTA 1QVAA 1SCKA 1II9A 4EY6A 4Q3EA 3PXXA 3I5AA 1D8TA 2XMPA 5TPZD 3PQ7A 1VYVA 2P3SA 5U1PA 2X0FA 2XCUA 2R6DA 1OX6A 3QXCA 3VGPA 2GB4A 4EHHA 4YP5A 3R3HA 5AOCA 1TUGA 4TLDA 1KFJB 1RKQA 1WETA 1UFKA 2IZZA 2PFKA 3GUUA 4BNZA 5I7UA 1TE2A 2HEGA 1OFUA 2OWEA 3PDIA 1YQWA 2HBYA 3WMEA 1GU7A 3W6OA 4YCLA 1DRVA 3GAZA 5FKJA 4V3BA 1C7JA 1N6HA 1ZZEA 1NFRA 4DLTA 1H69A 1IG0A 2DH6A 4QBGB 5DISB 3EVZA 4YAIA 2F62A 1W49A 2NZYA 4QDJA 3TQRA 3W5CA 1V6AA 3NOOA 1FMJA 4BMYA 4OLHA 1JE0A 5T4EA 2ZYAA 4Q3CA 1HQYE 4Y6QA 4OK6A 2E4AA 5AKEA 1R4NB 2IEDA 4L4RA 1T25A 1TT5A 3ISTA 2BDTA 4WCFB 4DCTA 4E4YA 3CUKA 1IH8A 3ORSA 1YJCA 3LZCA 3MGKA 3KP1A 1U8UA 4XVCA 4YONB 2C5EA 2VDWB 2F64A 1OBHA 3SIWA 1TADA 5KJEA 4YAUA 2WSBA 4W5OA 3F6EX 3DV2A 4IFTA 5CNMA 2XQJA 2ODPA 4JT8A 4O4IF 3VRHA 3QEBZ 3NWJA 1L8QA 5FWYA 1O4VA 1JZQA 1K8XB 1TZ2A 3IKVA 4MGIR 1VB3A 2XA1A 3QGMA 5HIJA 5IBQA 1XN1A 2VQ6A 3D0OA 4TPKA 4KRFA 3H9JA 2X2FA 1TLFA 4R0NA 1K8RA 2LKDA 4RA9B 5LC1A 3QLEA 2WTXA 3PE4A 1FXUA 4EQ6A 2XZTA 3T9CA 1QE5A 3TEJA 5DNYB 1N34B 1JKMA 3O2JA 3KQUA 1J7KA 2C4NA 3FNQA 4BWVA 2AW3A 1A8UA 2ZS9A 1HETA 3PXEA 3SKYA 1A5BB 4M9UA 4AP6A 2WM2A 1GN9A 3W6ZA 4BEVA 2AV6A 3FAKA 1VPLA 3G0GA 4W9RA 1F3OA 2WSYB 3AIKA 4CRWB 3CLHA 5L7TA 3IKMB 2CF6A 2JIBA 5ALPA 3UH1A 1VRWA 3STXA 4HYQA 3WNVA 5I8PA 4QBIA 3BGWA 4HSEA 4E11A 4WZAB 1T43A 1V8BA 1HGXA 2YIJA 3FM9A 1K3UB 1VC2A 4IDAA 2DRIA 5FWYB 1MX1A 3NPAA 4EFNA 3OAAA 4UOZA 1JDSA 2P6RA 3G6WA 1F0PA 4WINA 5BRNA 3D3KA 3ELBA 4MUEA 3NTQA 4QTYA 2QZJA 3WGIA 3HFGA 3KUUA 2IYVA 1TO6A 1CUCA 2OHHA 3WL5A 4DV4B 3VDMA 1KK3A 4YRQA 3EVCA 1RKVA 1ENOA 2JJYA 2VAMA 4M0CA 2WMNB 4E2ZA 1E20A 4NOMA 2Q0XA 2CCGA 3ASUA 3CLVA 3X2EA 1TJNA 2MMGA 1HG1A 3T8YA 1BWQA 3T06B 2PT5A 1RU3A 4PAOA 1FZTA 3SHOA 1YCGA 1EXNA 1NI5A 1OJLA 5G3YA 1XKQA 2V74B 3HLKA 1FYVA 1H8EA 1W4AA 1SUEA 1JXAA 1I3LA 1Q20A 3K4PA 4WXYB 1NUPA 3ZY2A 1D04A 4LJRA 1J00A 3EH1A 3EE6A 1P4SA 4XCVA 4NYIR 2ALJA 3Q85A 4BNHA 4X5OA 3TUIC 4D9HA 1QRDA 1YO6A 5LXTB 1ZNZA 1ZICA 3A1VA 1ZA2A 4DQ0A 3V34A 4UAUA 1QS0B 1RHJA 2WA1A 1Q11A 3HZZA 4H2DA 1DJLA 1Q7BA 2V7XA 3NHJA 1JFFA 1TMYA 5KOJB 4HZUB 3N5CA 3PG5A 4QE3A 2G8LA 1N6IA 3FHLA 1NXWA 1TAGA 4ARSA 5DLEA 1VGQA 4IXDA 2B2CA 3GRPA 1CUZA 4K9RA 4JYCA 3MWKA 3X1DA 1TF7A 4OK3A 4DMGA 1M2FA 1T6XA 2D2XA 2X7XA 3ROPA 3A4VA 1NW6A 3C39A 2FX5A 2FH5B 1A8PA 1XC7A 1A4IA 2PX0A 2ZJZA 3CT4A 3PHGA 2Q6TA 4KBGA 5BO5A 1O6FA 3SX2A 3U9TA 2GEVA 1NUSA 3CVOA 3NXKA 4LFAB 5BWOA 1J8YF 1YZLA 4RTMA 4RWZA 4AJJA 1XDSA 1ZG3A 2E87A 5CX1B 1RW4A 4W9NA 1CR2A 1KO1A 2R68A 1JSCA 2E18A 2F1JA 3K92A 3I73A 4GVPA 4DNFA 3H16A 1QIJA 2XV1A 2XVXA 5DGIA 1X9IA 3HP1A 4CKWA 2J0SA 5D6NA 2VDVE 3E53A 3SX0A 3UFXB 1EPUA 2HA6A 4R1UA 1WW2A 3O26A 4TWAA 5B1YA 4CN8A 1CJCA 1P5HA 1X7XB 3FTCA 5DNVA 2XMCA 1FDSA 1K3FA 3LY5A 4J7UA 1F2TA 3NTOA 1SUPA 1RQGA 1QHSA 4KPUA 3UWKA 3UUWA 3AL0C 3K9BA 1N4DA 4HC4A 1TVKB 1TEVA 4ROTA 1RJWA 1E9DA 2CXQA 2PD4A 2PX4A 1MC5A 2CFTA 2GLTA 4KO1S 4EBFA 2DVMA 3PC8C 1GJRA 2OMEA 3MJDA 5HS4A 1GRCA 1Q6YA 1Y1QA 3A1SA 4HDMB 2OAEA 3LLVA 5EKUA 3LBFA 5BSUA 4Q00A 4R4JA 4EX6A 3VVMA 3PL5A 1S8FA 1WNFA 4FEYA 4WMLA 3ZNOA 1ZSNA 2NXWA 4LNUA 4MVJI 5C5DA 2QAGC 1FK8A 3AERA 3G68A 2DUMA 5CLQA 5A1TA 2PZGA 2M6SA 4M76B 3GLGA 4JD5A 4J3FA 3VH2A 4X6UA 1ZITA 4EFLA 3DV0B 4K6CA 4LJSA 1OA0A 2CFIA 1BKSB 3RAJA 2Q28A 4LHEA 1DRJA 3A2KA 3UJ3X 4U4AA 4LFBB 1ZDMA 4LNAA 4N40A 1G6KA 4OK5A 3WV5A 3OICA 2BWJA 3Q7EA 2MMCA 3L1JA 2QM8A 3R7WA 3UWPA 1T35A 2ATEA 1CUDA 2AG1A 4K6HA 3T4PA 5C1DA 3NGLA 2QD3A 2ZREA 3D31A 3LKDA 3DVSX 3N28A 3W9BA 2GX6A 1XKXA 2M6KA 3WJ7A 3GG2A 4BDSA 4PVCA 1DCTA 4G63A 4KWTA 1U1EA 2HRCA 2R62A 3DEKA 3GK3A 4R8RA 3UMGA 2YBEA 3DDCA 3AVQA 2OCAA 1GZSA 2W90A 3IXQA 4G1VA 4LDQA 4DG8A 1JTVA 3STWA 5F2OA 4EIWA 2GERA 1X1QA 3UGJA 1I9GA 1EUCA 4JS0A 4HY3A 3IDOA 3M3HA 4EO4A 9ATCA 4RAQA 3L1VA 2PPVA 5ALGA 3TZEA 1NF2A 4PC1A 3OY7A 1SG6A 1OXVA 1IZ0A 3KZOA 4K0KB 2B92A 3QV2A 3TLEA 2Q3EA 2RE8A 1LUAA 1ODSA 3DA8A 1PV1A 1R0YA 4HH3C 5KHOC 3H75A 4DMRA 4XUGB 3H8WA 5IUKC 1KL7A 5IM5A 5GAJA 4FSXA 4GSKA 2JH8A 3GNLA 1WO8A 4IV0A 5A4KA 2F67A 4OJKA 4RFSA 5JSYA 3UAZA 5B4TA 4K81B 1T10A 4HNVA 2RHTA 4N12A 2IYZA 4NH0A 2W6JA 5BN5B 5CYOA 3V1YA 4Q05A 2DBVO 4J49A 5IT5A 1CRQA 3U7QB 1XRPA 1FCJA 1V2HE 3JARB 3T7TA 3ZLUA 3L82B 4MA5A 4B82A 2P77A 3B85A 1HEUA 1I2AA 3N86A 2ECFA 2FWBA 1XVAA 3Q98A 4HWOA 2DMRA 2WFLA 2I4LA 1T6BY 4KXQA 4RH0A 4UEWA 3TKLA 3LT1A 4DCSA 5AW2A 4PZUA 3KJZA 3BH7A 2R11A 2UAGA 2CLFB 1H42A 1ACJA 3S99A 4F86A 5AVSA 1OBFO 1UPFA 3ANXA 4ZQIA 2DG2A 2CBZA 2D4HA 1HUQA 2ZIWB 3B7PA 3GCDA 4QGGA 2QPAA 3T6KA 4I9GA 3CYFA 1UEIA 2Q4RA 4XX1A 5BVGB 1M1XB 1Z73A 2O3TA 3EHEA 2I03A 3R5SA 4NBSA 1OAKA 1YDWA 4BTLA 3OEHA 2V7VA 1BWPA 4P3OA 2WJZB 3FPAA 1NVFA 1NOIA 1YS2X 3PPIA 4N7MA 4IEIA 3C4VA 4BS9A 4RTSA 1MW8X 3GGJA 2NO6A 5KPDA 4EELA 4CM7A 2OESA 1A82A 4G56A 5T5QA 4JR2A 5BOSA 3M0EA 3G2LA 4COKA 1R6XA 2XVAA 3EDYA 4NPHA 1C7IA 3HJFA 2WF6A 1ENZA 5G1NA 3GGOA 4RVSA 1Z12A 2BEUA 1IWBB 1RM0A 1K3TA 4PF1A 2X5NA 3ZE9A 4KITB 4RYDA 3L8GA 4C0XA 1K6IA 3OIWA 2C7RA 1W2WB 2GPTA 4G5RA 2DWOA 3GAMA 4OD0A 4B45A 1CIJA 1CFJA 2CVOA 5EUCA 2JCVA 3PZRA 3ENVA 1W44A 5FNVA 1SQ0A 4IL5A 1MGPA 5AQ1A 1QG6A 1XMQB 1KNQA 4EKDA 1KE2A 4WLNA 1A9PA 5LWQA 1E98A 5JXHA 5JXIA 3S8EA 4Z0TA 2QLFA 2ZB7A 2QN7A 3QM1A 2ZSEA 4WOPA 4DC1A 5KTNA 1M1YA 3FMGA 1FP7A 3M49A 4G85A 4BAGA 2G04A 4DKXA 3HXMA 3W1WA 5A2GA 1JS1X 1WSWA 3L07A 4CMIB 3WNZA 4QUBA 1O8CA 3ZW9A 1AS0A 2CN1A 5K0SA 1E9RA 1POXA 5LL6P 3KYBA 2JBHA 3UW1A 3FWHA 2HMAA 2RG7A 4QUJA 2AR7A 1AZTA 5FLEX 4Z53A 1Y98A 3SNHA 3KUKA 2QE7D 2ZBFA 1N92A 3VAAA 1ISRA 3O6VA 2FFHA 2ZEJA 4BU0A 3G13A 3EISA 4LGCA 4YLGA 2ZJFA 2CXXA 1ICEA 1E2HA 1LNQA 1SZDA 1VRVA 4D42A 2Z2ZA 4JH0A 1L4EA 3DZGA 3IUJA 1WP4A 2GBGA 2GFIA 3AR2A 3R3WA 1RM5A 1KYZA 3HUDA 5LCXA 4RELA 4BRZA 4CLRB 1QZUA 3RQSA 4KW7A 1E6EA 1L7PA 1UJCA 1XLUA 2F3SA 1YB4A 4X1KB 2EXXA 2BUCA 2E48A 5CP8A 4B9EA 5JFTA 4IXWA 6LDHA 3W79A 3PENA 4GF5A 3RIGA 4BV8A 3EN0A 5I01A 3OTIA 1KI6B 3L1HA 1WKVA 3UMCA 2Y1GA 4UMVA 4M60A 2Z8YM 1RQPA 1GA4A 2HIMA 3V4FA 3K70C 3IE1A 4ZCRA 5DHSA 5H81A 2JDID 3JSAA 1OE0A 1R6TA 4R9UC 1XZ8A 2OQIA 3M5DA 3OKAA 3SGLA 1F0KA 4PFJA 3AUXA 2C4KA 2W2QA 1KTIA 1Y9ZA 1PVVA 4OMCA 1JBQA 4DDVA 5ALYA 1XQ9A 4YJ2F 4A5SA 1N6PA 5G4KB 1UKEA 4E5MA 1VSQA 4AWAA 1VPWA 2A0FA 4EKEA 5ITVA 3FOAA 4JFAA 1I24A 3PC2A 5JWHA 1MENA 2OORC 4GUDA 4CTJA 3ESAA 1B41A 1R9NA 5EQDA 1JPVA 2JIMA 3CLRD 3JPYA 2XF8A 3C45A 2O6HA 3DE1X 4DEYA 1WCYA 4DIUA 5AM4A 5JJIA 4G5SA 2R7KA 2HN9A 2K2QB 3G1WA 4KQXA 4KX3A 2EFEB 2DOKA 1KP2A 1RKXA 1JHAA 3IPCA 4FXOA 5KOHB 1EEXB 1T36B 2DLDA 1K86A 4L7QA 3KSZO 5FL3A 1JT2A 1JAXA 2D3WA 3E2MA 3MSCA 3O7MA 3O91A 2JEZA 4DCJA 2E5LB 1U1CA 1W4LA 1AXEA 4KFUA 3COYA 4WKOA 2I3AA 4E33A 1KGSA 1Z45A 2JHGA 3AC0A 4U6QA 3G0HA 5CEJA 3U2QA 2V7QD 2OV2A 5LP6F 5EG5A 5H9VA 1IN8A 2HDNB 1RE1A 1GSOA 4YFYA 1RP7A 4DWJA 1ZD3A 1NVXQ 5ESRA 3RT1A 3UATA 3I61A 1OUMA 1R0XA 3CO5A 5A06A 2C2OA 4PTLA 4BNGA 3PWSA 1JYEA 2Z6UA 2O5VA 3MBOA 5JADA 3I3SR 2VH1A 3P9KA 4DSTA 2CYCA 1V7CA 5FDFA 2NU9A 1Z28A 4IIHA 1A8QA 5KOHA 2GK6A 4I08A 3MCVA 1ZINA 5ALKA 4FUQA 4HN4B 4K8OA 1B26A 2C4MA 5LYJF 1Y3BE 3W2FA 5BSVA 3MPOA 1JN0A 1G3RA 2EARA 2PRIA 5G2OA 3HK2A 1YRHA 4WAUA 1ORVA 4NHEA 2A30A 3AR6A 4AZ0A 3CW8X 2QDKA 1HSZA 2J41A 4C14A 2IHYA 2O4UX 1P1KA 4ED9A 4YASA 4OXQA 5AVRA 1FTYA 1ODIA 3QPDA 1EVYA 1RXWA 2X2EA 2ZCUA 5JQGB 4UEKA 5FF9A 5K0BA 1W48A 2W48A 3GD7A 2RK4A 4MVYA 2EIHA 1X2EA 1IQRA 5H7XA 4H60A 5EXXA 3IUBA 5CDUA 4KXLA 2RBEA 3HYTA 3LDGA 2YXNA 2B7LA 2GK3A 4OSEA 3SG0A 4KZPA 2WZCA 5FI1B 5KQPA 4OA5A 4TSFA 3H86A 1RWKA 5LJIA 4LYGA 1YKFA 2OUIA 5BORA 1NW7A 3HCCA 5ELLA 4IKEA 2J3IA 1ECPA 2HWYA 5TPWB 3O8QB 3A4TA 2BFBB 4IDOA 3E23A 2WYOA 3IHTA 1OSNA 1YQQA 3HYNA 5AI5A 3LGAA 2OHOA 1EHIA 4W6QA 4R8VA 3PFNA 5FPYA 1FMFA 4HJXA 4QO8A 2G5PA 5D5HA 4MV4A 1BJTA 3KX2A 2O2SA 3EVEA 1V1MA 1QYCA 3NIDB 1W1IA 1NUTA 3KEQA 5BYBA 4E03A 1KSHA 3D6FA 2X41A 1XD9A 3LXRA 1Z25A 1HDCA 4MW4A 1P9OA 2O6LA 4TYPA 4PLGA 5EHXA 3BXGA 3VPDA 4QATA 4FDTA 4WLOA 3TQIA 1C30A 4UTZA 3TUJC 3GOHA 4HS4A 3B2NA 1Q84A 4XLZA 4IGKA 4NRDA 3Q4GA 4CF3A 1AN9A 4GOOD 4R5HA 1KZ1A 1TKAA 2FK8A 1XELA 5EMHA 1EWKA 3RYFA 3U9SA 4AROA 2NACA 3UICA 3CEMA 2R0QC 2WT9A 3COPA 2OHFA 5CM9C 1I33A 2LWIA 3EXHB 2PXXA 4LJ5A 4N8DA 4Z49A 1DUVG 3RSQA 3P7MA 2VJMA 3CEJA 1IN7A 2WUWE 1G64A 2GN0A 4XLLA 4C78A 2CJPA 1K06A 3H5VA 1IBMB 1U7UA 2P8SA 1EYZA 1XL1A 2IYWA 2J9GA 3H5OA 3RARA 3UPDA 4C6SA 2FUNB 3AJ9A 1NBHA 1UMCA 2HTFA 4LDAA 4NBWA 4RJTA 5L4LA 4X54A 3VZPA 1DO8A 2PS9A 2QN9A 2XUQA 3FPCA 1JALA 2YJTD 4X1YA 4X44A 1NULA 2QNBA 1WTCA 3KYCA 4JLOA 4EW1A 4FQ5A 4TN5A 3WKCA 4V39A 2PLNA 1SOVA 2XYRA 4LF8B 4PTZA 3BHJA 3L0DA 4R51A 1W75A 1KF0A 2H85A 3ADKA 3R9XA 3OFVA 4M0EA 3KTFA 1V3TA 3VNRA 3BFVA 3WB9A 4KN8A 1PFKA 1USUA 2ZRFA 1C81A 4PG6A 2JAPA 3QFFA 4RFVA 3FDZA 2O8BB 1SUIA 3A4YA 1AZLA 4C4AA 2QK4A 5FQOA 3NWEA 3T1TA 3LCUA 4MS1B 1FFCA 3VV3A 4YV2A 4HLUC 4ZYLA 3EG9A 3PFBA 2CWWA 2EP5A 4LOJA 3BKWA 1IOZA 2ZT7A 3QF7A 3AZPA 4MGKR 1JG4A 3VYVA 1SIUA 1V5WA 1C9DB 3GT0A 4MJ3A 1O5TA 3HB4X 4TS4A 4O33A 2FJ0A 2W2NA 4OSPA 4BIMA 4YRGA 1R0LA 4FZRA 1JFLA 4OXKA 1UJMA 4BZXA 4EH1A 1CRWG 3CRQA 4FOLA 5HXAA 3C3KA 3ETLA 5C4IA 2ZKIA 4ARZB 3R9XB 4HYYA 4MJ7A 2H1VA 1E9SA 1ZK1A 3OLYA 4GP6A 2XXAA 3O4GA 5ED0A 1RHUA 3A6GA 1ZCFA 3ABOB 3H2BA 3OZVA 4RK6A 5EZQA 5C1PA 3GCWA 3ECCA 4UU8A 3Q1KA 1WNTA 1OZ0A 2FWNA 2PS3A 3C6QA 3FPEA 1EKXA 1C9KA 4A0GA 4BPBA 1AGPA 4JBXA 1FFSA 2VSOA 2JLSA 4PSVA 2MCFA 4C6RA 2FY8A 4DIDA 1LD3A 3VUEA 5AFSA 5KSOA 1MKYA 4TMTA 5JZVA 4I1RA 2NXNA 1T24A 3RFCA 3WAKA 3L7KA 1L7OA 4D98A 3ZD6A 3D59A 3V4PB 1FRQA 1OXMA 2P7HA 3A70A 1MVLA 5JMWA 2A1TR 3P9PA 4FYHA 3OESA 4MI1A 3RUDA 1ADCA 5DCYA 2VHJA 2GUGA 3I01A 3WNBA 3GLFA 5CCEA 5LD2B 3AVVA 1JVNA 2A7XA 3B6EA 4OV6B 3OMLA 1I0IA 3DHVA 3OZUA 5ALOA 2XSZA 3DOOA 1UIMA 3TB6A 1I3CA 1NBMD 4LWQA 1LB1B 5FBWB 3VHXB 5HW0A 2VRCA 4XWKA 3EXIB 3DFUA 3OZBA 4UJ3A 3D7KA 1VBMA 3HWSA 3MOIA 3TM5A 2EU8A 2GWRA 5INTA 4ENVA 3DTVD 4NNOA 5J2TA 5ILQA 2DCMA 3EOAI 4NG5A 1CQJB 2AN3A 5C8YB 3H4TA 3N2GB 4GI3A 4DV6B 4M3NA 3OZGA 1EEHA 1YQDA 3D2BA 2J0EA 2CFOA 3FXAA 1YVDA 2VFAA 4NENA 1XG5A 5J58A 1E63A 4ZOCA 4PGFA 5DK6A 3KJFA 3QITA 4Y3UA 5IJXA 3F9IA 3MS2A 3O31A 1B6RA 1NW4A 4Q4LA 2YINC 4KVAA 4L0DA 4NFHA 5GADl 4LPSA 2JJ2D 5JCXA 1J2UA 1QHFA 4MMZB 4YUXA 3DFIA 2BHTA 4A73A 1ZKMA 1KAEA 1G7RA 1SKYE 2F59A 2P11A 1V6CA 2FFQA 3N39C 3TXAA 1NATA 3U5TA 4KR3A 4RA9A 3O8BA 3DPIA 2FUG6 3SQOA 1CD5A 4MVJA 3U1BA 1D7AA 1R0BA 4EQ6B 1BYIA 3L8ZA 3Q2OA 4ZCMA 3K73O 4BP3A 3MN1A 1OJ7A 2IHNA 3FYSA 1IM5A 2Q2QA 1T0UA 1T2UA 3AY6A 3IUPA 2ZUVA 3S2EA 5T3UA 2R4QA 4HDKA 1K6MA 4EPTA 1GXSA 2Q8PA 4YRZA 1NVUQ 5DTQA 4XFDA 1XALA 5KIAA 3WQBA 5CJ2A 1SQGA 1Z2PX 2CEAA 3WYBA 3V9PA 5KOIA 2E4VA 2WWYA 2E5FA 2W71A 3B48A 3IAM6 3IAS1 3ENNA 3MUNA 5G0SA 5K8JB 4CKCB 2BFDB 1JU9A 1T1RA 4ZO7A 3F4KA 1I5OA 5DHUA 3DL0A 5EZ6B 5H02A 1RXIA 3IGFA 4CEHB 5EXTA 2RIPA 4IIJF 3WGYA 4WLFA 1G5QA 1OYWA 1Y5LA 2AUTA 2BGJA 2Y2UA 3IJPA 5LLDA 1T3ZA 4M98A 4OHUA 1PE0A 4QGAA 4AUKA 1KVUA 2UYGA 2AOTB 4EKIA 1HKHA 1GLGA 1U3DA 4U6SA 3WISA 1N5RA 1GY8A 5T7BA 3OQVA 3UO8B 1THGA 2F1RA 2W2LD 5LYJA 4GGPA 5JFOA 1EDZA 5AK0A 3VSBA 2O0HA 4BX9A 1M1UA 5AW1A 2Q9CA 3X1YA 3KUXA 2P4UA 4G65A 3U40A 2XTJA 4F21A 2RBGA 2GSWA 3SEQA 2B0CA 3PNLA 5FFNA 1G4UR 1TD9A 1PX2A 4ID9A 3MWYW 4L2IA 1UXOA 1TQHA 1X42A 3HR8A 3H1BA 1RLJA 1E6KA 1X1CA 2PKXA 2UZAA 1W6UA 3C8ZA 3QVGB 3CPSA 4LC0A 9LDBA 4Z9YA 2ZXFA 1IJKA 4XRRA 2P41A 1MO6A 1L3IA 1OR8A 4Z2YA 1EFDN 4JQCA 3RYTC 5HFAA 4CBVA 1VSTA 2A0YA 1OU0A 2VPQA 2Y4NA 5DW0A 2FCRA 4AYXA 4BB6A 3E9EA 5E8JA 1AUPA 3DOCA 3HSYA 5K20A 3IB6A 1DJOA 3QNWA 1PSZA 3H97A 16PKA 2FDXA 3ISVA 3C4QA 5CAEA 4IGIA 1M6VB 1Q57A 1R4MB 3KT3A 1EP9A 4OOFA 1IVSA 4WASA 1DIRA 4INJA 1X7DA 1D03A 3D3WA 1C80A 2HZBA 3LPNA 1QUFA 1UXJA 1QG4A 2H3EA 3ZDYB 4AO7A 4H1UA 2BHRA 2R8EA 2QD4A 4DLSA 2YW2A 3PDCA 2CF5A 2ZBUA 3BC1A 3JWIA 3O82A 3FR8A 1DG3A 1ECFA 5CXXA 2ECQA 3W5BA 4QQNA 5EL0A 5JPCA 4EFMA 3KTDA 5K8VA 3ESYA 2ZJ2A 3GLTA 1DCFA 3DAHA 3M6IA 4MS3A 3RKRA 5BPFA 4DLYA 5KQRA 5CT8A 3EX7C 3GNTA 4H27A 1GGFA 4N6GA 5KHAA 1SCDA 1TJYA 1H2YA 1SHTX 2ZJOA 2HYDA 3DMTA 3LWZA 1ESZA 5DXFA 3GBSA 4E6PA 3TECE 4ASUD 4XVUA 1U65A 3EUWA 2V7GA 4KJXA 4II2A 4J4BA 3ITNA 1K7XB 1P1IA 5EWMA 2GT1A 1QB7A 2BBOA 2IEZA 3KHKA 1EBUA 3PNBA 5SZHB 3VOAA 4AMVA 3RYCA 1EE1A 1AQYA 1NTOA 2QP9X 3KSDO 5CLJA 3VNVA 2Y77A 3D3WB 4INOA 5FTKA 3THWB 3VYWA 1X13A 2Y1DA 4R2KA 4D2IA 2HHHB 1EWTA 1I14A 2CUNA 4HEJA 2PSDA 4RLFA 4HNTA 2PZLA 5K3EA 4CDMA 5KWSA 4IO0A 2XCTB 2P6MA 1Z4LA 4ENTA 1R6DA 4CIYA 1T5LA 4WJLA 4LUCA 2X77A 2C82A 4YA6A 2HQOA 1DBQA 5CB8A 3K1ZA 4L9WA 2IQ5A 3C5HA 3M6UA 4R68A 3HO6A 4ZK2A 5MF6A 3ZUGA 2AN4A 2C29D 2BLNA 2GCIA 1J0DA 1N0IA 1NG1A 1Z6QA 2C3OA 2P69A 2FPPB 1T2NA 3DBLA 1EESA 1PR2A 1VL2A 4JP5A 4MRRA 5EA2A 1T6YA 5TF4A 1NYTA 3RE1A 1ZRSA 4RX1A 1YGPA 2IXGA 2H4WA 3HH8A 3HKCB 3AP3A 3AGPA 4GNRA 4FCWA 3FVRA 3UNXA 3AVPA 4DXHA 4JDPA 2EGGA 3OLWA 4KNVA 1PT8A 4B80A 2K7FA 4UDYX 3BN3A 1G5RA 1FUKA 1K6XA 3KC2A 1JAIA 2UZIR 1D1SA 2I55A 1XTSA 3FKJA 4WZBE 2G9VA 3WDSA 3KSBC 5H3CA 1THMA 4B85A 1EIZA 2BHLA 3DZKA 4CMHA 3GJTA 8AT1A 1OB5A 1X8LA 3PWKA 4N0EA 1KKLA 3CXRA 4AKSA 4GL2A 4A7PA 3E1SA 5EJ2A 4JZKA 1HR0B 2CL6X 1V95A 1SRQA 4MV6A 3B6MA 2BGTA 4KYIB 4P3NA 4JROA 4U3JB 3E0XA 3NIWA 2WNIA 4TV9A 2BGGA 4PC3A 4XYGA 2YWJA 2Q4OA 4PPGA 2O8DB 1FQOA 4LZJA 3K5PA 4H08A 4FJ2A 4QO7A 5LMZA 1RWQA 3ZV5A 5IT0A 5E0KB 5U9CA 3SXUA 1KAMA 5B2ZA 3ZHBA 2ZYSA 2C0PA 2HSDA 3ZBTA 1PUXA 2HKIA 2AHOA 2J3DA 2X42A 1JLRA 1FYWA 1SPXA 3DJYA 1TPYA 5CNJA 1Z4QA 2OA0A 2H65A 3CV3A 4UBNA 1II0A 3W4IA 2UVPB 5B7QA 3PHBE 5SZJA 3T54A 5C3MA 5FUQA 2CUTA 2XR1A 1QDLB 3OHPA 5JSKA 3LQ2A 2ORWA 3IVRA 1GFWA 1NSTA 1P0FA 3AHJA 3HBLA 1LRKA 1ADGA 2WAOA 3UKOA 4C6HA 5KKNB 1J24A 3V4OA 4Z6KA 1ZCAA 1N2JA 3IP7A 1M66A 2VQDA 1JA0A 1JRLA 5KVSA 1PJCA 2NTEA 3U7EB 3GA7A 2FQQA 1QVRA 2JASA 5JXGA 4C5AA 1DX4A 1QR2A 4PGAA 4B4KA 5JBIA 1XNQB 1LRJA 1XWIA 2OFOA 1QIKA 2Z4RA 4HFJA 4EHBA 3I0ZA 3ROEA 2DSNA 1ULAA 2VK4A 4I55B 3QUCA 5KQGA 5LDGA 1TX4B 4KDCA 4JHLA 5HCIA 5K6TA 5A6SB 3IUEA 3F49S 1PFQA 3C2QA 3PEWA 1D4ZA 1UXGA 2H7CA 2YHBA 2YXDA 3G5LA 4Y6SA 4BQOA 1QS0A 2ZWIA 3E3AA 3LRPA 5L8VA 2GJ4A 3FI9A 3L1UA 4RPGA 3COSA 3RYIB 3QBJA 4O63O 1C1XA 1JQJC 2QGFA 1N5DA 4IYRA 2JJ1A 3DW1X 2EG9A 3LM8A 4IDPA 2X13A 3IR5A 4JVLA 2H1IA 3INTA 4HX2A 4DA7A 5TQVA 1J2EA 4O6VA 4MEJA 2C4TA 2QRVA 2YQ4A 3MLBA 3Q5EA 2QS9A 2CZGA 4LWPA 3S5JA 2FQ1A 5DGXA 3DMDA 5FO0A 4M0LA 4XXHA 5CVVA 5EMNA 4EWLA 3E2IA 2CLDX 2QQ0A 2RIRA 4AXBA 1ISSA 1F3LA 3BPSA 2N47A 3QXGA 1YXMA 3DNPA 3ETNA 4RHTA 1ONNA 4EJFA 1UBJS 3G23A 3GLVA 3NDRA 1M5TA 5JMOA 4Q4JB 4G6ZA 4LJAA 4Q4HB 4ODIA 3HXLA 2C7PA 3KYJB 1WAMA 1YULA 2ZGVA 1QYRA 3UBMA 2CJFA 1YRBA 3KKLA 3TTXA 3FPFA 1S5PA 2BFFA 2HUNA 3LX5A 5JT1A 2E82A 5C81A 1TRHA 3OU7A 3L8YA 3QVXA 2ZYIA 4QWWA 2VNKA 4GBED 2D3TA 2ZZKA 2DBZA 5AVWA 1PFGA 3VNUA 3D8NA 3L7JA 1XHEA 1Z0AA 2PAFA 5AVQA 3QU2A 4TMFA 1Z7WA 4ZVTA 2C3UA 2P6PA 1MPXA 3G2KA 1DXOA 4KXMA 1RRKA 4BX2A 3U49A 4Z9XA 3ZGLA 4Z1MA 4MWTA 1MC4A 3GZJA 4FSHA 4PPQA 2PUDA 3PNOA 1E1CA 5F12A 1EFPB 2FA9A 2AOVA 2VP2A 1EZ1A 8ABPA 5E9AA 2TECE 3BA6A 2O0LA 2Q4DA 1PR5A 2CK3D 1A2KC 1O0SA 4BO0A 4DWVA 2Q3HA 3FWYA 3TQSA 5ES4B 3OKCA 3CR3C 1CFZA 3C3BA 2IYUA 1U0EA 3NHSA 5HKBA 4ZGWA 2XY4A 3AF5A 3L1KA 2J48A 2JK1A 3RVQA 2Z3WA 1U0FA 2YV1A 2JAUA 2YYAA 1GTZA 4LRXA 5FBQB 3LOUA 5K3AA 5D86A 3NHMA 2EW2A 3IO3A 5BN4B 3RLFA 3JZFA 4MR8A 3CURA 3GDOA 3IDFA 1SWVA 4H7FA 2OQRA 3J80A 2YZ2A 3A7EA 4WFIA 2J0UB 3KEFA 5GJCA 2J87A 4G8CA 4KUGA 1WUTA 2RGGA 5IARA 1JKIA 3THYB 1X94A 5KWJA 3IHLA 4Q93A 4R84A 3E9QA 4WLVA 4U2KA 5BUQA 3IAEA 1M5RA 2C5BA 2LIVA 3CNLA 4UREA 3EZNA 4E0BA 1PVOA 1FTSA 1C7EA 4ZVPA 4JGGA 2OCDA 2YH2A 1A5SB 1H2BA 2C3PA 3KQNA 2YW9A 1KFBB 4CCYA 1ZR4A 3ENZA 4P6VF 4K7JA 5IJ9B 4CGYA 3FSEA 4PNPA 5BNZA 4DV0B 1AV7A 4Q7MB 5DMXA 1T8WA 4YMIA 3C3DA 2AN5A 1FUUA 2J7PD 2PBZA 4EB3A 2J9RA 1WSAA 1L1RA 3AWIA 4MR7A 4RDHA 5CLLA 5FJIA 1KZGB 4NONA 3E9NA 4P7GA 5AK3A 4WERA 1J0XO 3SLKA 4Q19A 2TMDA 1ZH0A 5JSZB 4TS3A 4A27A 1II8A 2JIRA 1HFKA 3G79A 3S7ZA 3DH0A 1ISIA 3UEOA 4CL8A 2ONKA 1E7RA 3SQMA 2BGMA 4U2DA 7MDHA 5TQ0B 5F35A 1MOQA 4MMXB 3WIOA 3RRNA 5K3OA 2YVAA 4ZVLA 1QWSA 3IA7A 4NBTA 2PUGA 2BZ0A 2XE6A 1PFVA 1YS6A 1I01A 2AG5A 1FJ2A 3QOXA 2Y27A 5KYWB 2HLNA 3UOAB 5I5EA 1Z6YA 5BNTA 1O1YA 2JPDA 3L7BA 3MTQA 4UBOA 3G7SA 5EJFA 1PR4A 2CXHA 4BZQA 1L8XA 1NKSA 4PLVA 5G0TA 5REQB 3AR3A 5BT9A 4QLBA 4PZDA 3EIFA 4B83A 4PIVA 4PZZA 2GI4A 1E2UA 3W2GA 1ODJA 2AYYA 1K8YB 2ERCA 2FG5A 1FFXB 2D06A 2IYYA 3TPFA 5LQUA 1AS3A 1RHMA 1OFVA 2V58A 2VHEA 1N5LA 3I6BA 1X3LA 2X5JO 2AFHE 3B1XA 5E2BA 5F5XA 4RCYA 3RNLA 4ZJYA 5AVXA 7MHTA 4I99A 2CNKA 1I2DA 4HD8A 3T9EA 1ZIYA 1KJQA 2F1OA 2QXYA 4HUQB 3TJMA 2J5KA 3TOSA 3DJFA 4DLWA 4DRXA 3U44B 1NJ2A 4ZVSA 4QELA 1G59A 5GIOE 2BEUB 4IDCA 3SLGA 4GE0A 1PWXA 1UBOS 1Y6RA 5LQJA 2P78A 3QA3E 1XTKA 3LT0A 4F5EA 2C83A 3K0CC 4WHMA 4H31A 1YJXA 2PZAA 2XYPA 4FFPA 4G9BA 2WD7B 1EBFA 2QI9C 4DR2B 3JATB 1RPAA 2A1UA 5EIFA 4PO3X 4YTEA 4EBBA 4MHOA 5M04A 4H0NA 3ZTYA 1TT7A 4HAZA 1FDRA 2H11A 3D3JA 1HPLA 1LTKA 1R0ZA 2I6UA 3QLJA 2NU8A 2OGZA 2V5VA 4FR2A 3F8SA 4KAJA 5DW3A 1XBTA 4QYWA 5EPOA 4DXAA 2RJNA 2B5VA 4L08A 3ZD9A 4EB8A 2CB9A 3OJCA 1Q1BA 2ZYVX 1GZ6A 2X4LA 3E7WA 4WFKA 4O4HA 4YRAA 2IWRA 1YB7A 3SX4A 4M1WA 3KAKA 3NBQA 1S0UA 2AC4A 2NYAA 4HFMA 5JD5A 2QBYB 1HT3A 3CF4G 2FLKA 4FIDA 3EZGA 2AG0A 5I8WA 3LSYA 3DBRA 3IBGA 1X70A 3ZHRA 1HRDA 1NM5C 3E22B 2C2YA 3QVVA 4R41A 1Q3HA 3SQXA 3TN7A 1TFUA 4F92B 1NN1A 2JHAA 3K6SA 1I4EB 2EW1A 3IR7A 1BQ3A 2XXJA 4JNCA 2H2HA 2O14A 3KVNA 4J0GA 3A6FA 4OHMA 4UXHA 1WUHS 1QGUB 1CEQA 3RFUA 3GP8A 3I04A 3U19A 4U0JA 3AUTA 1ZAYA 3LLUA 3UMFA 4JMLA 5CB0A 2FMIA 3R5TA 3OEYA 4Q7KA 1CK4A 4B8WA 2HY7A 2ZXEA 3TUZC 4EYQA 3QELA 3OLZA 1OFUX 3A2LA 3CBGA 3K9WA 4HAUA 4V0LA 3IP8A 4EHLA 5THXA 1U7WA 3NC4A 1XAGA 4GLLA 1P77A 4ZA2A 5ALHA 5SZIA 2ZIZA 4QT4A 1SN7A 3TGLA 2FAXA 4N5LA 4ARUA 2J85A 2QRNA 3E22A 1KXZA 4IOJA 4N3CA 4PRLA 1AN0A 4EL5A 1GARA 3MWJA 5ALVA 2ZIFA 1VFNA 3L92A 2QX7A 3CVVA 1DWPA 3E3MA 3ZY6A 3R0QA 4M8LA 1HZZA 3ITKA 3LCVB 4RM3A 3ZXXA 2XVYA 2GYVA 5HQTA 4Y9UA 2C1XA 3EG9B 4FKZA 1KEWA 3GA5A 2OILA 3TZHA 5BXQC 4RKFA 1KQFA 4NP6A 3D8HA 2VQFB 2EV9A 1E1RA 4ZQGA 1UC5B 4RS3A 2FZWA 2PV7A 3USZA 1YRLA 2P9ZA 3M3DA 4EVIA 5IXJA 1AH2A 3G2HA 3PC8A 3HVRA 3E5RA 5L3VA 1VXOA 4OAPA 4CW7A 5AICA 3ZDFA 4K0RA 3A6DA 2AS0A 4KGDA 1PJTA 4OFZA 3GJRA 4XYEA 1DMRA 2PSFA 5M5BA 5EYPA 2W8BA 3M82A 1XMPA 4A0QA 1Q83A 1DV1A 4CLDA 4EMBA 4HGRA 2C61A 4A0SA 1HNXB 1E9AA 4DJAA 3Q5GA 5CG1A 1Z75A 1G0OA 1C4OA 3K94A 3RYHA 4IH1A 3RPEA 4Q9KA 2B8TA 3JR7A 3HPQA 1AK2A 3O4RA 4PLHA 5HBGA 4ZDIA 2X0RA 4XPIB 4TKVB 1ULTA 4JYAB 3TTVA 1RSZA 4YXWD 5I6DA 3K70B 4OX9Y 3IQZA 4LBYA 4QT0A 4B5KA 3DLAA 5LXTF 1DC6A 4AN4A 5LDDC 4BU1A 1XV5A 2EZ9A 3EWSA 1T5HX 2EJCA 4R1MA 1CJMA 4CV3A 3RUPA 1E2MA 3A25A 3MJTA 4CHGA 5GINE 5IH7A 5CTAA 3NBXX 2FPIB 1OC2A 2ZRPA 1J9GA 3IUSA 3PQEA 5I51A 2I76A 3EEQA 2RH8A 3LIIA 3C8UA 3FGPA 4I4CA 4YLEA 4ZCTA 4YQFA 5JFGA 2RHHA 2C8VA 4RTNA 2H07A 3ZZNA 4MVJP 1NI4A 3LPLA 1A9YA 1GTMA 4IQGA 1W0KA 3I23A 4HN2A 4Q16A 2G6TA 3EXIA 5JXJA 3D6UA 3E5MA 4DUGA 4TT3D 2FOIA 3S5UA 5H5JA 4K86A 2A5YB 3PPYA 4AY4A 1MOPA 1WQ3A 4IX9A 2MWMA 1FLNA 2YY6A 2DUUA 2A5LA 1ISPA 5I9LA 2AZDA 2YZNA 3ANSA 3GT4A 5THQA 4P0TA 1YBHA 3M8KA 2GZDA 3K0AA 5CVCA 3GEIA 2CJWA 4FNMA 4LISA 3KE9A 3WGHA 4FX5A 1H0HA 2PJZA 3BJIC 2Y4OA 4YECA 3CE6A 1DE0A 5TT1A 3W3ZB 4F4DA 1SFRA 3AX6A 1PJ8A 3N76A 2M6RA 2FVXA 4IV8A 4HQRA 5FTNA 5K8UA 4P0QB 3H9CA 3I76A 1J09A 3OT4A 4J0EA 4KXXA 3OZFA 4M37A 3UGKA 2BFCA 4NR0A 1W36D 1KI4A 2I4OA 3I9V1 3O4VA 5CDFA 4U5XA 1CJKC 1E2BA 5ALNA 4G0QA 3FJ1A 2CV1A 1RR6A 2NYVA 4G26A 4MVJD 4RK5A 5CMLA 1R0SA 1KMHA 2LDBA 2R25B 1EFRA 3WMWA 4EENA 3KYIB 2I9KA 4XUCA 2WPDA 5E1DA 2PV0A 1FLVA 3AU9A 4N3AA 2BHNA 1H5NA 2J3MA 3D4PA 4D02A 3V55A 1AG9A 1DXQA 1KOFA 3A6KA 3BGIA 3GJ5A 2YZMA 3BJZA 1JKFA 1KJZA 4DEXA 5CHYA 5CB4B 4KK3A 1PHPA 2G76A 3OMXA 4NFYA 4EB6A 5A4FS 3TE6A 2WILA 4ANFA 3K9FC 4A03A 1PT7A 1AS2A 1R4ZA 3TAXA 1BFUA 4UDNA 3E35A 1EUDA 3LNCA 1JIJA 1KDOA 3MB8A 3ZKWB 1UBGA 1ZI6A 3URKA 2XUJA 2CYBA 1AA6A 2QRJA 2PT7A 5KCZA 1TXGA 1DIHA 1NR1A 4K40A 4AN1A 4HMOA 4MUBA 3LUGA 3TW8B 5E4YA 1YT5A 4ZMSA 5HR5A 5MGNA 2YXBA 4DG9A 1IXRC 1H3EA 4G4IA 3KZVA 2BOVA 2WD9A 2PH7A 1N1EA 1SBYA 1GPBA 4KXUA 4BZPA 5TGDA 4A6DA 1CUGA 1S2GA 3AOEC 4V38A 5E6SA 3VISA 3BBLA 1W2HA 2HWUA 2N0SA 4AAYA 2R9VA 2A4MA 721PA 2A9PA 1GTG1 3PNMA 3EZXA 2R87A 1R8JA 3HS3A 4M7OA 5H3HA 1H6AA 3VR4A 4AK9A 4LV6A 4YRMA 2CMGA 3CVUA 1L3CA 2TMKA 4JYPA 1QH9A 1CUFA 2IKSA 2Y1CA 3NBMA 4YGYA 5LMCA 3T3PB 4YN3A 1H6CA 1UT5A 4IXTA 1A4XA 4G0WA 1W34A 3F5MA 1X7HA 2MSDB 5T6MA 1S2MA 3BCSA 3V1UA 4G8JA 1XYGA 2D00A 3N07A 1T9GR 2BMDA 5C37A 1IUPA 4URZR 3QA9A 5KS2A 4JASB 4F8EA 4S05A 5AXBA 2GM5A 4QG7A 1WDTA 2AZMA 1NYRA 2XB8A 1OZAA 3PJRA 1FXSA 4GZ5A 5A02A 1G0NA 2W58A 2AOUB 1UZMA 3B12A 3JTEA 3EGWA 3KSRA 4YRBA 4CKBB 2QR5A 4MAFA 2YFHA 4DOMA 6YASA 1ZISA 1T4BA 3AEKB 2GVDC 3I8XA 4AMYA 3T3MB 1R8XA 1HRKA 5T4FA 3NHYA 2IU6A 3AI7A 1YZQA 3NYWA 2IW1A 2YYYA 5TMPA 4JL6A 4WCDA 1BE1A 3H1TA 3RC7A 3D5TA 1U7HA 2XQVA 1AXRA 1L7AA 1ZIXA 1P9RA 1DBRA 2B94A 4OHXA 4WNAA 1USWA 2A1IA 4YCBA 4OHZA 1WP9A 4MAAA 1QO7A 3SDZA 1GAXA 3HP7A 3WC4A 1WU7A 1C4XA 1M6NA 1FXWF 2I8CA 4GR4A 4IG9A 1AZWA 4I19A 3GEPA 2ZUCA 1EDDA 4KXYA 1L0BA 3P19A 4L9AA 3ZWPA 2Z57A 4N5NA 2KMLA 1SBQA 5BSTA 3AIOA 1ZD1A 3VPGA 4F5WA 3HI4A 2IHUA 2PSSA 1CB0A 1FRFS 2Q6IA 2XOXA 4ZFNA 1IBLB 1NKTA 4TWJA 1IDOA 3JYOA 1IBSA 3L7AA 3TQFA 1HNWB 2YV2A 2P9GA 2Q29A 5DOZA 1XAIA 5JNSA 1RMYA 1NC3A 3T41A 3VO9A 4MKXA 3TFQA 3PHLA 1AKQA 3CJQA 5DU2A 1Z74A 4MP3A 4YAWA 3ORHA 1JFTA 4D9GA 2E3JA 3RDPA 1DSSG 1JL3A 3PD7A 2OT3B 3BZBA 4BHTA 1XX6A 4XQ9A 1JIKA 2ONYA 2NPOA 1CQJA 3IJEB 1UWKA 3D8BA 4FYKA 1GPJA 2FF7A 3KALA 4FNOA 4GRAA 2WU8A 5A9SA 1E92A 3P32A 1Q22A 4W7IA 3IIJA 3NWOA 5EP1A 3SD7A 3PFCA 5D51S 2Q5IA 5KQMA 1DBWA 2HHJA 2GCOB 3AP2A 3EBPA 4U02A 4UNSA 4WDRA 1J5XA 1T34A 1TO1E 3QXSA 1RAEA 3OE7A 5JCJA 3IEPA 1QV7A 3ZDAA 3AI1A 4GC9A 4QGBA 2CHGA 2PMCA 2VYCA 3JWGA 2WPDD 3EXEA 3JQAB 1E18A 1ZVQA 3TI7A 2CXUA 4X45A 2YS6A 3WIBA 3D43A 4URHA 1G2PA 1HLFA 2PMKA 4OJNA 3MRTA 5D3MB 5C7LO 2W7TA 3OOWA 2WJJA 4LOLA 2OBMA 2DUWA 3IBSA 1L4MA 1SK8A 4KMMA 4EPRA 1H4VB 3FA2A 1ZIDA 4MA4A 3S1AA 3OCUA 4GR5A 1NF3A 4URXR 5KJ1A 4ZTUB 1E0JA 1PDWA 3IAS6 2Z09A 4ZT5A 2ZBVA 4C0BA 1QHHB 1YA4A 5IAOA 5J2UF 2UZ1B 2ZLBA 4HEHA 5CBPA 3MFYA 2O7SA 2GCOA 4ECAA 2R3SA 4ND4A 3H9UA 4BPRA 3RS3A 3W8EA 2CHEA 3MW8A 4P2GA 1H0KA 3BTVA 2IV7A 4BB9A 3HB1A 4HNUA 1ZUWA 1CEXA 1S6YA 2D74A 1WEKA 3V4ZA 5B3JC 1C14A 1LK7A 4TT3A 5A62A 3ZDCA 4MHTA 1X0XA 1KYXA 1L5ZA 3MT7A 4BO3A 3UB4A 3ZHTA 3MVEA 1ZOOA 4CQMA 2FLVA 3QPUA 4J03A 4OUDA 5LQKA 5HSGA 3PQFA 1SC3A 3BHMA 2PQ2A 4U7FA 1EH5A 3T34A 2Q7DA 5K8IA 4YMUA 5IM4F 3FN4A 3NM5A 4E5DA 1E62A 1U6KA 1HDRA 1TM3E 1HE1C 2RMKA 2Y05A 4MPDA 4JI3B 2HSWA 4O3MA 1IQPA 2L0XA 2CLOB 2Q3JA 5L3SB 3K05A 2FEWB 4JI8B 4IUYA 1DC3A 3SFZA 1MZVA 3NVAA 1JPNA 3E9DA 2DUJA 1J8MF 2QG9A 2CXTA 2KLBA 2XF2A 4RQTA 4WNCA 4HRAA 1RYMA 4YVFA 1UPUA 3JPWA 3U37A 2GKSA 3CX3A 1NU6A 5T3YA 3RYIA 1F51E 4TRRA 2P1DA 2XADA 2XNJA 4LOIA 3NEJA 5HP4A 3JRXA 3S2FA 3KZCA 1QCZA 1LDBA 3CH4B 3HEBA 4C1NA 2D6FA 3PNYA 3SYTA 5HGJA 1T3HA 3N8GA 4S1OA 1RWOA 4C08A 3IUYA 2P9QA 5MN6A 1XZHA 1B8OA 3WHLA 4DBLC 1MB0A 2DX7A 4JXKA 4UBLA 4CJXA 3HV0A 5HJ2A 1SHKA 4CT0A 1C7FA 4Y1RB 4ND5A 4G36A 4CF6A 4BNYA 2HAEA 3HB0A 4DIBA 3A1EA 2YICA 1OBOA 1D1PA 1NF8A 2BJHA 4XGKA 4AG3A 4B7ZA 4F85A 4GP9A 5E95A 4EYKA 3SC2B 2IY8A 4QYIB 5JY1A 1TC2A 2BKXA 2ISSD 2GEJA 4HF7A 4CIWA 3IV6A 1DJMA 4KGVA 1HY3A 5IX8A 2ZZMA 1D2CA 3SFTA 3LOQA 1MDBA 5DCLA 1EU1A 1IHDA 3GLGB 2OD7A 2WG0A 1LZLA 3VR5A 3HI6A 4X64B 3TBHA 4B7XA 1AGXA 1SXQA 2OD2A 1REQB 1UCFA 3EQZA 2XUGA 5K8TA 1G8HA 1R0CA 1ML3A 1SHJA 4G1UC 2Y0CA 4E6EA 1ULZA 1JILA 5DT9A 1N5MA 2Y8EA 3PITA 3QPBA 4DM7A 2DBQA 3H2IA 2H5EA 5K9ZA 1YB1A 1O95A 3HYRA 3IH5A 5ECWA 3GFTA 1CR4A 3OE7D 2I1VB 1KERA 2IKQA 1RRVA 2HK6A 3LV8A 4BFCA 3KQVA 4S2UA 2C97A 4XJSA 4M0DA 4YUWA 3W8NA 5E3IA 4DRYA 1GQFA 5KZMB 10MHA 3VBCA 4FFOA 2WU0A 4IMRA 4YIKA 1OXKB 3KG2A 4L28A 3GWGA 3RRJA 1Y63A 1UFVA 4NAVA 4ECEA 2C2MA 4F38A 4GZMA 3KB2A 1I8TA 2JARA 2W5UA 3LHKA 5GOTA 3G8AA 4X97A 4AUMA 4PNZA 3GUYA 4FB5A 4WKCA 5D8DA 1MGOA 4DNXA 4UU1A 3UUFA 4B35A 2HV9A 4G5XA 4L8FA 3GFBA 1LBSA 2SCUA 1UBKS 3EVDA 3KELA 1BN6A 1K66A 3PUVA 4GNKA 4Y2QA 3R0IA 3U4GA 3PXDA 4XPZA 2RK6A 1BGVA 1O97D 2ACWA 2DH5A 3E8XA 2HA2A 3OA2A 4AX8A 5FLXA 4O2BB 1MAAA 4K2HA 5JE8A 4YDQA 1JYFA 1CE8B 1W5AA 1XPJA 2BFAA 1DIBA 2X4GA 4MZDA 5AK5A 3U3OA 4IIGA 2H2WA 1Y1SA 4R6XA 2OLEA 1NVVR 3QLVA 3PFFA 2I5PO 4G1MB 4N8EA 4ZV7A 4EZBA 4HB4A 5ER6A 3SY8A 3QFSA 4RTLA 2IOYA 2Z8XA 3LIPA 3NNSA 3I2FA 5E8RA 3V97A 5C31A 3PWTA 1KORA 3CLKA 2AMFA 1DAIA 4JJ4A 3WMXA 1OD6A 2C4HA 3SBXA 2QLTA 3Q9SA 1Z38A 2CXNA 4L78A 5FV7A 4JCOA 2PUTA 2UYOA 1KY3A 2XRZA 2W6NA 1U3GA 3RVNA 2NZJA 3TQQA 3J81A 4OI1A 2QMUA 5ICCA 1Z4KA 3DE6X 2XNSA 1FBTA 3MEQA 1E32A 2HK9A 3AFIA 4KODA 5TV2A 1ORTA 2FWAA 3DBIA 3BWDD 2VXCA 1U8YA 2HHLA 2NYUA 2YWDA 3HB5X 1SUAA 4KRYA 4LMAA 2ANBA 5E6RB 5E1MA 5CFPA 4KBYA 4OKNA 5M7EA 1RABA 4RPHA 3L8CA 1GG5A 4BNJA 4CIVA 3COJA 2Q5LA 1IWOA 2ZR8A 3AR5A 1M34B 2QR3A 1ZESA 1D6MA 2MU1A 3OLVA 4GKBA 3TX2A 4CZ2A 4EG1A 4IHAA 4HP8A 4YK7A 3R75A 4KE8A 1NJ6A 2ZOSA 3CRMA 5A6VA 2QLJA 4P22A 4C7OA 2VSQA 4CG3A 4MRPA 5CDYA 1QKIA 1XDBA 1L1QA 2Z9CA 3EBLA 4YBRA 3ZHVA 4N82A 2UXCB 3ZVLA 4D4JA 2YZGA 1MFPA 2PG3A 1R6BX 3PEYA 5CVJA 2YXPX 3CUEF 3ZIAD 3AKZA 1AUOA 1K89A 4RD6A 3QIVA 1FMCA 2ZSBA 4FTWA 4BX3A 3ZHZA 2WVAA 1QAMA 2CVHA 1XZFA 4RHFA 2P5UA 3SZRA 1U7TA 2IT1A 3VXKA 4A9AA 2W6QA 3K0BA 3TSZA 4M7RA 1LXCA 1V8PA 3H9BA 1K27A 3HJCA 3LT4A 4RL6A 2N1BA 4F3RA 1A1VA 1QLHA 3AI3A 3R1IA 2WHYA 4O3FA 4WZBA 5JLJA 3ZY3A 4ALJA 4EGSA 3NALA 4J7AA 1NQUA 3NP7A 1XD8A 2E37A 1N2CA 4QDUA 3R40A 3H7AA 3ISJA 2GJAA 2IHZA 3MZ0A 1TTPB 3B51X 4LDNA 4P36A 5HUJA 2WMYA 4AY6A 2BEJA 1BA2A 3CTMA 4UD2A 3QEMB 2P62A 1FIUA 4OXYA 4PYRA 2D2VA 2REQB 3GMSA 3BYZA 3QJ5A 4GD3Q 1WJGA 2E1RA 1GZ7A 1ULHA 2BFPA 2VNIA 3L0IB 3PGVA 4BBPA 1L5RA 4Q3LA 1EQ2A 4YJHB 2L18A 5L3ZA 3QX8A 2WWXA 3ZX5A 2KYRA 1SXJB 1HQKA 3PD0A 1J9EA 4PAGA 3E58A 4H3KB 3M4XA 3IJRA 3KZMA 3CCBA 3HSKA 4BKQA 4DQDA 1KRWA 4BYMA 2FOXA 2M9MA 2FN4A 821PA 3BGVA 3BM5A 2JAHA 4I66A 3IEXA 4N1AA 1U94A 4RHEA 1SBZA 5IJZA 3MMNA 3DWIA 1DBIA 3L79A 1N2CB 4LHSA 4ZO9A 2W42A 2IUFA 2AMVA 1QWOA 2G9UA 1KI6A 2HFJA 3TXXA 5I9SA 2NQTA 3RHFA 2PZBA 3HDYA 1JNYA 5KSZA 3H4IA 3QEMA 4JUBA 5DXAA 1JIIA 1KBZA 1DBPA 1UT8A 3NHAA 3M7IA 4K1XA 3A6LA 4TWIA 1QH1B 5TQ2A 4E7OA 4G97A 2OZKA 3BDVA 2CY0A 4YJHA 5NULA 4YJ3A 4PYLA 2E21A 1RNLA 1GD1O 1JIQA 1IL0A 1SEPA 3FLMA 3WHPA 4X95A 1U4NA 2JGIA 2Q3LA 3P2EA 4OAQA 5HILA 4EG0A 5D7NA 2W00A 2HGSA 3HJTA 1QYIA 5CB6A 3AJDA 2L82A 3JSXA 2JIQA 4KXNA 1V41E 5E1OA 4ZXPA 4BJ3A 2X7HA 1U1GA 4RF2A 2HSZA 3MS7A 2E4ZA 5CTJA 3ZW8A 4I9HA 4QBFA 2YIVX 3SDBA 2H1FA 2N75A 4R1LA 1Z8HA 4XI9A 1Z5ZA 2CE2X 3PCXA 5IEBA 3LY9A 4J16C 3LQFA 2VCYA 4KRXA 5KBYA 1YNSA 4WGFA 5ULLA 2HDHA 4QBTA 4YJ3B 2R8OA 1O54A 2JFNA 5EPEA 2WR8A 3EODA 1OXSC 4KXWA 4UUPA 5J2UA 1P8AA 2OG2A 5JMTA 3K0HA 3Q8WA 1JWAB 3K7EA 4GXTA 4MVJF 1E4EB 2XI4A 3EQ7A 5BUSA 1NLUA 1SCUB 1FY2A 1R4NA 1P3Y1 2B4QA 4PGGA 1M0EA 2C42A 2AD5A 4O2AA 4JKOA 1GA6A 1PK8A 3I2KA 3K1TA 3RTCA 4RK7A 2A94A 1I7NA 3I83A 1L5YA 1OVGA 1LRLA 5ALSA 2EW8A 2V6GA 4NDZA 1KXJA 4R2HA 2FUEA 4LDZA 3RRFA 4L51A 4MDHA 3BE8A 4KH1A 1H0RA 5IVIA 4MV7A 4L1KA 3EXAA 1WDMA 1NJSA 2CW5A 4P81A 1NXTA 1ZW6A 2OHIA 4OQEA 1XLTA 3A6PC 1Y82A 1DJNA 3W6NA 3RYHB 2XDQB 5KJFA 3WSVA 4DR7B 1SUWA 2OGWA 3FIJA 1KMQA 4XPIA 2B1GA 2P1ZA 4BDTA 5HJEA 1K68A 4B3FX 1AKEA 1G21B 1NVBA 4YXWA 3DLPX 3V8NA 1GPNA 3OQIB 3MMXA 5I5GA 1J99A 3AHFA 1O08A 1SIWA 2JIZD 3UMMA 1UBMS 5FBKA 4X63A 4ZQCB 5KC8A 1E79D 1WXXA 1M8JA 4B3RB 1NFFA 3GY0A 1BFKA 4RZQA 1I51A 3M1IA 3KQQA 1PT9A 3KB8A 1PGNA 1UANA 4Q02A 3L04A 2HF8A 4CLXA 3N1UA 1XXHE 4M9CA 2QTLA 4MWCA 3ENQA 1UR5A 1G2OA 5K3FB 5LPNA 3AG6A 3B1JA 2ZCJA 1YVPA 1XMIA 2MYNA 2XUZA 1ZO8A 4HS9A 4HX9A 2H5LA 1W1UA 1KVSA 3DDOA 2PQ0A 2VNAA 5P21A 4F5ZA 1ADFA 2ZDHA 1Q6ZA 5BSHA 2BGRA 1MIOB 1RRFA 1G9XA 1KIFA 1MLDA 1QZ3A 2GVZC 4MVJG 3LGXA 3N2NA 3P0IA 5JHGB 1UODA 2RD2A 2HADA 3B89A 1SH7A 4YT8A 3AIMA 5DGHA 1KO4A 1IYZA 5JNLA 1URPA 3DDHA 5U4XA 1SU7A 3HZHA 2Y6VA 1MHPA 2ZE6A 1FVFA 3ZCPA 1G4AE 1N2GA 2QSZA 4FGZA 1M54A 2JFQA 2O8CB 1ZJYA 3JZDA 2Z2XA 4S1WA 4B6FA 3TF5A 2BFOA 2K7ZA 2W43A 1IJBA 2Z9BA 3ONFA 2FSHA 3RTDA 3OJLA 2P6OA 3GPBA 3O93A 2VDMB 2ZQYA 2OG1A 4YBZA 2WNHA 4AW9A 4GLBA 1XPOA 5DDIP 3KV1A 1RAHA 4AMUA 3RJTA 1LK0A 1JG7A 3VOSA 3TGPA 2AX3A 3S3TA 2H54A 5E2AA 3MG9A 2J5RA 3JALA 4YPVA 3B60A 3NRBA 1OVMA 1P2TA 1QV9A 4GYJA 4XDYA 3ROGA 3W5SA 3ZW7A 3CZ9A 3HA5A 4G9EA 4MIEA 1T9GS 2VK2A 1K63A 1Y4ZA 4HNAB 3R4VA 4B3DA 4C20A 4EY3A 2DT8A 1RLTA 5HOQA 5KNDA 3FTEA 1FTQA 1GAJA 1NYLA 4Q82A 5I7SA 1G41A 2FZ4A 3E7XA 2A0UA 1HZZC 4B40A 2HU8A 4RQAA 3W05A 1GVHA 4REQB 5LA6B 3WGGA 5IFKA 4CQNA 2PWYA 1SCBA 2N46A 3A8TA 1PZHA 1ZGBA 1P73A 2KHZA 5C9ZA 3W2HA 1OH6A 4NK4A 2PWPA 1A7UA 4LE1A 1BWSA 3W1EA 3JTMA 2XRYA 2WHPB 5A4IS 1ZGJA 3KR0A 3OCWA 4KYTA 4MUIA 2ATIA 1HYHA 2XOEA 1R9MA 2XE4A 4Z5XA 3TLKA 1L7NA 4MCJA 2QX9A 1QBKC 1WZCA 1HL7A 2AFIA 1P45A 3F2IA 4NOJA 2ZM6B 1S3FA 1GV0A 2BMWA 4BCCA 2XLCA 4Q1EA 3DLHA 4ND2A 1T5DX 4YRCA 3S55A 4WCFC 2IEGA 1E99A 1DAFA 1HL3A 2PGLA 1GN8A 2QJOA 3GMTA 4KWIA 5EFZA 4G84A 3ZE2B 2VK8A 3MUOA 5DRTA 2P3LA 5DHQA 3M2TA 4RVHA 1VB5A 3V2UA 2IHKA 2W6ZA 4GXRA 1UBNA 1LQTA 2GZRA 2OCLA 1DFHA 4G8DA 3UJPA 1MJNA 3D7RA 4RF3A 1S1CA 1DINA 1LK5A 3EEIA 3H6GA 5CFQA 3ENWA 4KBFA 4GPD1 4RDCA 1ZUHA 5K51A 5KYKA 5FUWA 2E4WA 1QAOA 2NO7A 3O03A 3O7WA 3BTSA 5DCWA 2HJGA 1D2AA 1V2GA 2QAGA 3FTPA 3NTLA 4HDMA 4WY2A 5BQ3A 2FV8A 4LHZA 4ARZA 2AKAB 1U9IC 1PJ2A 2X19A 4WXEA 5ARCA 4CNQA 3CN7A 3OQ6A 4UQOA 5EN4A 4KDRA 1TAUA 3BWYA 5L3QA 2W6OA 1NMZA 1KR5A 1EINA 5DCUA 1JQKA 1YHNA 1F0YA 3EGCA 1ZP6A 3KTAB 2QAIA 1NLFA 3DD5A 1I3NA 4OQPA 5E7MA 4HO1X 4R2XA 2ZYRA 4DA0A 2ZXUA 1M2HA 3OX2A 2G71A 1IPFA 3G0CA 2GAJA 3DQPA 1ENPA 2V54A 1O0CA 3VQTA 3VZRA 3WWZA 2YN0A 2PE5A 5DBGA 1VJRA 2OBLA 2YNMD 4JKIA 4OATA 4ESEA 4L4SA 2AW5A 1R6AA 4EPYA 3L6DA 4OX9B 1A5AB 1P7ZA 1SHUX 1U04A 2VAXA 1AQNA 4JVSB 1ZNXA 4G0UA 3K8QA 2VSYA 1LV8A 2OPBA 1BE6A 1E6WA 4MCHA 2WM3A 3PD1A 5AOAA 2W6PA 4BKPA 2WYVA 1Q19A 3B13B 3IQEA 1A50B 1BAPA 3QKRB 4WUVA 2B3DA 3PEVA 3BXHA 5J63A 2D54A 3S8MA 5EJGA 3VR3A 4BVBA 3HR4A 4OXRA 3E9MA 4ZICA 1BCRA 4K9DA 4EEXA 3FCAA 3DL7A 4YMGA 1VYTA 2JFZA 4PIMA 2GJSA 4PSCA 3PFGA 2HQSA 4G4JA 4L4YA 5DVZA 3KHSA 1GZUA 3HG7A 3LBAA 4ZEMA 4GGOA 2W98A 3AJAA 4RH3A 1C7RA 2I22A 4CF4A 2VDRB 2GJ8A 3LOPA 3WYGA 5AKHA 4YQEA 1TI7A 2NWQA 3TLGB 1EM6A 2A57A 1Y9AA 1H1LB 3BEOA 3CLSD 2L17A 4FM9A 2HT6A 3ML1A 1V7ZA 3PC7A 1PT6A 3JQDA 4K1LA 5BMVF 3ELUA 4EY4A 2ZU6A 1VDMA 5TDHA 3UW3A 1GGNA 3MUEA 4OYRA 3W2EA 1LS1A 1RXYA 2H51A 3BFJA 2IY7A 2WI8A 1D0SA 1NHGA 2HXYA 3MCAA 3QYPA 1F8YA 4XDZA 1MV5A 5T6BA 2ROQA 1N7GA 2P40A 2X0NA 4BO8A 1DAOA 2V55B 3ROQA 1N7JA 1GXSB 2ZK7A 3H8JA 4I2VA 4JSRA 4S2EA 4UHHA 4A6EA 4DAEA 4EDHA 3GIDA 5A9SB 1BH2A 1JH8A 5AP9A 1QHXA 1JH9A 2BE9A 1GTVA 3HDJA 2Z56A 2GNOA 1TUEA 2FW9A 2W4MA 3IIEA 3VKVA 4AZ3B 1BHO1 3QHQA 3RVJA 4AX4A 2JS7A 4FC7A 4KAFA 1LLQA 1P0IA 1L8LA 2LNDA 3EVNA 3P9QA 5FQNA 2RHLA 1FS4A 4HWTA 4XE5A 4PSDA 3F4LA 5FR1A 2ZQZA 4AURA 5CT5A 2V0GA 2A35A 2O2JA 5EHGA 1T4MA 1UJBA 1YK0A 4KC0A 1JMYA 3DMTC 5JSFA 1CF4A 3EJ6A 2VT7A 2NO1A 4CUKA 4J2TA 5IULC 3L6BA 3VKHA 3WLQA 4H7KA 5SY4A 4R8LA 1Q74A 3GFGA 2IU3A 1Y3IA 1MQ9A 2RAUA 3HXPA 3SZGA 3KZXA 1VG1A 2WJ3A 3KJQA 5SY6A 1YTUA 1KJ8A 4BQQA 4REOA 4ZU1X 4CU2A 2ADOA 2YY7A 1MAVA 3R5FA 1RWVA 2YJ4A 3EK2A 4AZVA 1TCAA 1ZNWA 2GS9A 4FOTA 2QVLA 3DHNA 3ZQKA 3M6WA 5K0LA 2F48A 2R47A 2VL7A 3A31A 2PKEA 4JSYA 2OYCA 5A0TA 1PU2A 3TCNA 2XDYA 4B4UA 1I3OA 4PAWA 1C7QA 1LDMA 3KB6A 3MJRA 4TYQA 4P7KA 5IU6A 1AUQA 5JNVA 1Y3CE 3OECA 1E2EA 3OQNA 2HK7A 3AM5A 3GF4A 3S2ZA 2NU7A 3QUTA 4S1VA 5CT9A 3FUXA 4D0NA 2PWBA 2EHJA 5FOQA 5HRCA 2DZDA 4ALLA 5C1IA 4NBVA 4L50A 2YMMA 4O4IB 4P84A 4QC2A 3UXEA 3IE0A 5EJ9A 3ZXSA 4CYMA 3FTQA 2XKKA 1B2LA 4IY1A 5EUBA 5F3RA 1XFDA 4LFCB 1FU4A 3SEZA 4BWGA 4E7PA 4EJ6A 1H4QA 1YHYA 1T5BA 3HVHA 5KOYA 2V9ZA 3VR6H 4D25A 4I1IA 2YRWA 3N53A 4B0OA 1ONPA 1UT6A 4IJVA 1I2MA 3NJRA 2BCJQ 4Q4JA 1EFVB 1R37A 1P7YA 2GPYA 4AMGA 1LX7A 3ZGXA 2QYSA 4MUHA 5B6PA 3EHDA 4OJMX 1KBQA 2XIJA 3CZCA 7YASA 4Z4QA 1GU1A 4JT4A 2YWEA 1PT5A 4LNUB 5E2IA 2P5YA 5K01A 3SKVA 3CNEA 4DYHA 3C1OA 3DV0A 2X9LA 4IWXA 1JIUA 5KTPA 1U2PA 1SXIA 3HFRA 3K0KA 1M7HA 4I3GA 5GJWC 3ZV7A 1YCFA 3KOWA 2O52A 4BFLA 5C5EA 4C2UA 2QG6A 1HXHA 1FMTA 1J39A 2XB6A 3OEWA 4BQIA 3UJ8A 2H52A 1MJGM 1N36B 1E0AA 2XT9A 4WJKB 5A0VA 3ZGNA 3TLJA 3C3MA 1H2RS 4W82A 1NN5A 2DPHA 2GCNA 3ZE1B 1TZJA 1AA9A 1NVAA 2D1SA 4X0EA 3NYQA 1B93A 4A15A 3HUEA 4IJKA 1HFWA 1WQ4A 3G8CA 2ORVA 2P2DA 3AO0B 2YNMA 3HABA 2RH9B 1RYDA 3HCAA 3N75A 1L7EA 4PBTA 2VK1A 3JWPA 4FFBB 4J91A 2IWHA 1KEZA 4H6XA 5IAEA 3RKUA 2RGWA 3T7RA 3GFSA 2H1OA 3B3GA 4TKZA 2WWVD 4M0FA 3ZWNA 5DHFA 2XMDA 4KXVA 3V48A 2Z4TA 1Z2DA 5BSEA 1I7PA 3RQIA 1XA3A 5KNCD 3QKSA 5C51B 3GP5A 4I7EA 3MD0A 1KU6A 3NUZA 3OX3A 3VTKA 4GH5A 4TL9A 1T3SA 4O8CA 2WDPA 3MTEA 3HKEB 3R41A 4U8HA 2O5CA 4PXAA 1FNCA 1LTHR 1KEPA 5L7YA 4I9UA 4X7BA 3QVWA 5HE8A 2IODA 3I9NA 4QEDA 5J4VA 5CJPA 4TKUB 4E5NA 4Z3KA 2Q6KA 3FFXA 2ODWA 3HKDB 1ZMTA 3ZR4B 4NNPA 1BSVA 1M1NA 2Y9MB 2ZTVA 4R7ZA 4IF6A 4EI9A 2XCRB 2GARA 2GBCA 2ZS8A 4ML3A 3U81A 4BBZA 1MNAA 221PA 2F1IA 5IDYA 1ZIPA 3OPVA 4LJYA 4M2LA 3AF6A 3KJXA 1TVCA 2GNAA 2IXAA 1I5EA 1UDWA 3O0DA 2A78A 1CS4C 2D5IA 2OBBA 1VJ0A 1KJWA 2SCUB 1F7VA 3I6ZA 1SOAA 2JL1A 2TYSB 4P98A 5T41A 2V8OA 3QHPA 2NVUB 5J43A 1U8AA 4J0DA 3VAZA 2X8WA 4Q39A 5JMPA 1C3LA 2VZEA 4C2TA 4PPYA 2JZNA 4A4DA 3WKDA 1C8VB 1G5HA 4FNGA 3MRXA 3PL1A 1DQPA 1P2SA 5BSMA 1TU0A 3DXYA 4IRMA 2C00A 3OC0A 2PKQP 3KV3O 2OXFA 1SG9A 3KTOA 2F43B 3DDNA 1QHIA 4N48A 1JWBB 2OCBA 1VPVA 1Z0FA 5LOVB 2VBFA 1SELA 1KEEA 2QTZA 4IQ8A 1GAEO 4PM4A 4P3PA 2H1LA 4MWZA 4RKQA 3WGOA 2B2XA 1P2GA 2O9JA 2V4MA 1KFCB 1M3SA 3D1JA 4L6IA 2C9OA 3VGJA 3GVIA 4HDOB 2RHBA 1TQ8A 2G5GX 3K9LA 4WJZA 3U7HB 4MR9B 5BV7A 1U63A 3O8QA 1LBQA 2FN9A 3QIAA 2IZ7A 4MIYA 1YKGA 3BXZA 4FX2A 5FTWA 4CTMA 2HEIA 2PK3A 3IIMA 2AK3A 2XMZA 4X6XA 1E8DA 4BE7B 1NZFA 3EWNA 1KWKA 3K6JA 4MVJE 4NOLA 2EVWX 2BC9A 3GLKA 1QX3A 2BY4A 1J2YA 1F6BA 1JJ7A 2HM7A 3M4ZA 2CVQA 2VPWA 4CIXA 1HORA 3U7RA 2X9NA 4ALNA 4ZYXA 2EWMA 3NHUA 4LBVA 4L15A 2GN8A 4E3WA 4BASA 2XZDA 1Y3FE 1D4OA 4LZAA 4TZTA 1N8KA 5F51A 1M2EA 2PSHA 1COWA 5LR6A 4W5NA 1MN6A 3MJFA 4HQKA 4UULA 1GT91 3P97A 4LC9A 3GAAA 5D87A 5DKFA 1YUBA 4ARVA 2PFSA 4BNFA 5DBOA 4KLRA 1U2SA 3N3AC 5BPHA 3DDWA 2EKBA 4RDXA 2O05A 4QNMA 2GZ2A 3WJ1A 4CIAA 4Q34A 3I62A 1JPUA 2IV2X 2JI6A 1CZHA 5CDFE 1BX1A 1T0PA 1Q2UA 1ZMOA 3C97A 5DX8A 1FA9A 4HEA6 3AZOA 1E9EA 2LTAA 1X1SA 4EK9A 4Q4HA 3T94A 4OF4A 2RKWA 3TFWA 1EJBA 5FLYA 3A04A 2WJVA 3IDAA 4HGOA 3M4NA 3FTDA 2CMDA 1NPYA 3T4XA 1F2DA 3PS9A 2JRCA 3LW7A 4JWTA 3PGLA 2JGDA 4AMZA 2A33A 5LQRA 1RYBA 1J9ZA 5B1EA 2P2NA 1MVNA 2FHSA 1E5TA 3LUHA 4OQ4A 5KVVA 1E60A 2YXEA 2Q49A 1JBEA 2EEPA 2GZAA 2GRJA 3GRYA 4EGJA 1M2JA 4CF7A 2BFNA 1RI5A 3NBFA 3LI2A 1Y3DE 3N7AA 1VFPA 2HMTA 1XVUA 2JATA 2YFQA 3RTBA 3SKXA 4CQLA 2GAIA 2G70A 4OXNA 5JY6A 5KTTA 4QTTB 5F1KA 2CFRA 3PQ8A 1XK7A 1HBJA 2IXEA 3C70A 4JC5A 4BBJA 4KIGA 4UXJA 5DJ5A 1AC5A 3TRJA 4FW8A 4WXHA 2WU3A 2YJNA 5C1BA 4BMXA 1IZ8A 3TZCA 2C0QA 3BRWD 3HHPA 4F6CA 1GU0A 1N7IA 3PXAA 2XLBA 4MVCA 3BDIA 4XQGA 2D59A 4M4SA 3NAQA 1DGQA 2RKBA 2QMZA 2FUG1 2B8EA 3HJNA 3E48A 2I62A 4EHJA 3NC1C 5BR4A 4A8PA 2POCA 3G9QA 3F5QA 2FFAA 5JOQA 4O08A 2WICA 1UDRA 1NVKA 4KQ6A 2D2EA 3DLTA 4UE3S 2MSLA 4IOMA 3ST7A 2PXCA 2BTQB 3U3ZA 1E1RD 4CXMA 4JBGA 4UTOA 1TEZA 1JZSA 2LE0A 3DGFC 2IP2A 4RMIA 3ELYA 1SQSA 3P5BA 6ADHA 2YY5A 2KS6A 1IUOA 1TIBA 1N6NA 3JQ9A 2ZUTA 4KO2S 4CM1A 5LZ9A 1W0JA 5KQLA 2WZQA 3Q7TA 2XBMA 3R3JA 3IP3A 1AB6A 4JVOA 2BF4A 1ZBDA 1VE6A 2GLXA 1Z33A 4OHPA 3GELA 1XMXA 4P08A 1DQYA 1G8PA 2IJGX 2O2DA 4HGQA 4QSMA 4JZYA 3S1SA 3NDJA 3PVSA 3VNBA 4KI7A 2D5AA 2TS1A 3MHTA 4DV1B 3ROTA 4PHFA 4K9QA 3A9RA 4XB6B 5JD3A 3GLIE 2DM6A 4O02B 2ZYWX 3TD6A 5K4HA 1ZJ5A 1TCVA 1U98A 4RY0A 4Z7JA 1EGVB 4BJ1A 3RBAA 2BTQA 2GKOA 2EKZA 3LFTA 5JZMA 5KNCH 4Z4EA 1QOQB 4NWIA 1K7EB 2B5WA 2WJAA 3OHSX 1CQIA 4FW9A 4J9UE 5H4HA 4INAA 4ZI7B 1Y5RA 2CMHA 2XB9A 3UFBA 2P6NA 3GMIA 3LW8A 2MSKA 4B3XA 4E15A 3NG1A 4WPGA 2XSZD 3NM6B 1U5AA 1HI9A 4DZRA 4UEQA 1W6RA 2GCPA 2CV2A 3CG0A 4BVJA 4I1PA 4HDSB 3N0VA 1V43A 4O2BA 2HNAA 2WMOB 4Q7EA 1LLDA 1SOMA 5CPFA 5DE3A 3BK7A 3MMPA 3WWOA 3SR0A 3D4NA 2C5GA 5BV1A 1TTHA 4IS3A 5IANA 2DB3A 3ZJ5A 1T0HB 1H22A 2JBAB 3W7BA 4H35A 3FF1A 1ULUA 2NG1A 4Y2YA 3R7SA 1ZL2A 4DIOA 1DUIA 1FNNA 4FYJA 3PQ3A 1I80A 2KE5A 1QOPB 1OFTA 1QIEA 3N6XA 4LAFA 4JSTA 3WLHA 4D0GA 3EFOB 4BWFB 4TTRA 2VPTA 2ZVDA 4MPPA 3STYA 2ENUA 1N6KA 4BC0A 4LK2A 5CK4A 1Z4OA 2QQEA 1ZD4A 2ZRDA 1M0WA 1C9YA 3OPYA 3RU9A 3O47A 4YMWA 3SSNA 3CJRA 1YZFA 3QPWA 4M9QA 1K6EA 3NJ4A 2QG4A 5HTOA 1SC1A 2PX6A 1N77A 4RIEA 3ZDEA 2I87A 4CI0B 1GRNA 5EKXA 4GLOA 5TMEA 3UKJA 5CH8A 4FYVA 5FNVF 1Z2CA 3DOJA 5I7AA 3X2FA 1Q1EA 4GPAA 4U8GA 4MIOA 4EPXA 4TRJA 2BN4A 3DZJA 1DT3A 4TLMB 3HNOA 3ZI4A 3ZJUA 1IULA 5ED4A 1G20B 1W85A 5SICE 3OZ7A 3T3OA 3OZEA 4JHXA 1QFYA 3LH5A 4QQ8A 2WY2D 1BMFD 3X1KA 1S8AA 1W25A 4CEJA 2GAOA 4N3GA 1K08A 4RD2A 2GO7A 4W99A 3QLUA 1CJTC 4NBNA 2NZWA 5E9QA 1P2DA 4DV5B 3CR7A 4HWPA 2FN3A 3KD2A 2JCSA 3QMVA 5EMKA 4BAUA 4BJHB 3GOQA 4DYVA 1G9TA 1NLYA 5BSKA 4Q9NA 3WLJA 3HYCA 3QWFA 4FOOA 1MBZA 5EHZA 4MV8A 1IN6A 2K2WA 3DM5A 1SCQA 5CXSA 1YRAA 3LDAA 3OETA 1CF2O 5K8CA 2HTEA 3M9WA 4BFZA 3IMGA 3TZ6A 1UJNA 1DAKA 2IYQA 4HUTA 4NAHA 1MDFA 2HLDA 3I72A 2I6FA 3WA7A 2O3UA 3JVUA 1GZDA 4L6AA 3AEUA 4II7A 4DPLA 3EPHA 4QOSA 1BS1A 3WLLA 1T9HA 4JGBA 4Q3DA 1CF9A 2Y92A 1W94A 1WM1A 2QRKA 5GMOA 5K45A 3I1YA 4EAAA 2NIPA 4EAQA 1Y48E 2FSVC 5SY9A 4CL3A 4WFQA 4AULA 2VXOA 3AQ4A 4KQ9A 1G63A 5CGZA 1M8PA 4DPMA 5ICEA 4J1QA 4F4FA 4WT7A 2O5RA 3VDRA 1H2FA 3WYDA 1ZC3A 4H4EA 4YP6A 3K71B 3HJHA 1Y1PA 4RANA 2AT1A 4D3DA 4N0PA 3EASA 2I6XA 2QXUA 4PO8A 1QFJA 1VYHA 4EJSA 1L1FA 4L5CA 4L4UA 4HYEA 5BWNA 3PIRA 3PB3A 1TKCA 4DR5B 4P5DA 4R3NA 2RAPA 1KIAA 3C7KA 4KQWA 1KDVA 3D7SA 1HEIA 4RPLA 1XXHB 2VVTA 1XTTA 3HCPA 5FV4A 2EX4A 3BRWA 4WBNB 4HXYA 4WCFA 4C4ZA 2ZSUA 4ABYA 2WHPA 4BO5A 2PCJA 1E1NA 3NKFA 4ID3A 5ANRB 2AL7A 3MHPA 1K7YA 4ZOLB 5BN3A 3KJIA 4UBKA 4G5HA 4WN9A 4RVUA 1NQTA 3HMKA 3MINA 3QU4A 3AVUA 3W8FA 4BMOB 2HA0A 3BXXA 1XJ0A 4AM8A 5I7RA 1J42A 2QPOA 1DRKA 5D84A 4G0MA 3UIEA 1PJAA 2QOEA 4DG5A 1ZMXA 3F3SA 4TUYA 4D74A 4D81A 1Q0UA 2EFDB 2WLTA 3WV4A 2VJKA 4RXTA 4B09A 4UPVA 1FF9A 3E82A 4NFSA 4PC7A 4CE6A 3GPLA 1WZ2A 4DNOA 1I4WA 1WG8A 3PICA 4KI0A 2V1UA 4DQLA 4XQ0A 3D6MA 1YR3A 4ZK6A 1L7MA 3TQOA 1KQGA 3R8FA 3DT6A 5FWNA 3FFTA 5CIYA 3HN7A 4ZPXA 3RG2A 4ZIRB 4OO3A 1WKCA 1LPSA 2G82A 2EF0A 4J7CA 2MSCB 5HMLA 4NLLA 4QECA 3WLIA 4ASUA 5LQDA 1Q0HA 3KQTA 2O1SA 4DQXA 4WEQA 1ETUA 1AD2A 1UJ2A 5DX0A 3JVVA 4JI1B 2XUAA 3ABRB 3KK0A 1T3TA 2Q62A 4MAMA 4L73A 1MD9A 2ZDGA 1FDWA 4MULA 2XJ9A 1DTSA 4DB2A 4B2LA 3WFIA 4LRQA 4V0NA 1C1DB 4XQCA 2GBLC 3UTCA 5KU1A 2FFBA 5ABPA 1IOVA 1SCUA 3VU1A 1I7LA 2WUVA 3OA0A 3K9CA 1ZLXA 4IH9A 3MJHA 3QVTA 1QYVA 4L57A 4G0YA 3WOVA 2GZSA 4LJKA 3OPYI 3UV3A 2E5WA 2J9FA 3Q0IA 4WZAA 1A77A 5HIMA 4CMEA 3W5AA 4QUAA 3U39A 3DEAA 3CA8A