3UB2A

Tir domain of mal/tirap
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
125
Chain Sequence
b'SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
publication title Structural Insights into TIR Domain Specificity of the Bridging Adaptor Mal in TLR4 Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 125
sequence length 143
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3ub2A00
4W8GA 4W8HA 4LZPA 2JS7A 4LQCA 4OM7A 4LQDA 1FYXA 1FYVA 3UB4A 5H3CA 2J67A 2M1XA 3OZIA 4C6TB 2Y92A 1FYWA 5FORA 3UB2A 4DOMA 4FZ5A 1T3GA 3UB3A 4EO7A 4C6SA 3JRNA 2Z5VA 4C6TA 4C7MA 1O77A 5KU7A 4C6RA 3H16A
chains in the Genus database with same CATH superfamily
3T54A 2AZMA 2ONYA 3FPEA 3LSYA 4H60A 3WDKA 2CW5A 4ITRC 4Z2AA 2PX4A 5DYYA 4MVJI 1KSHA 1L4BA 1NQAO 5KDLA 5HP4A 1YB5A 2RKBA 4C06A 1RQ7A 4TWJA 1RM0A 4EYKA 5BR7A 1P0CA 4M36A 4BMDA 4NG5A 3FOZA 2P9HA 3O3MB 4F72A 1UANA 2X2FA 3DMNA 3OQ1A 4K9NA 4Z4GA 1GRVA 3U39A 1GGNA 2YL2A 2XZDA 3H9UA 1VDMA 3NVMB 3V7YA 1QRTA 4L78A 4ROTA 2FHSA 1LTQA 3SZGA 3BXEA 4UVHA 1XPUA 1VYHA 3UUGA 3MJEA 4K9SA 3ORYA 3ECCA 1QYCA 5H16A 5CTAA 2WU0A 1KDRA 1IUPA 1H0SA 2QG6A 3PJFA 2DWCA 1E0JA 1R12A 5ALTA 4JIMA 4EIWA 2BFBA 3JZDA 3OJLA 3OKCA 2Q6LA 3GA0A 3BS4A 1LBQA 4DV1B 2ERCA 1IHDA 1GTZA 3NIDB 3QTLA 2PUEA 3R0XA 4J43A 1X3LA 1HL7A 1MQ9A 4KDRA 5DXFA 5ED0A 2A7QA 3NUGA 3T12A 2FEMA 2W83A 4AURA 4Y6GB 1DDIA 3T1HB 1CP2A 4L8LA 4XASA 4F4FA 1LS1A 3LUGA 4BMSA 1SC1A 2JHGA 1CWUA 3D4OA 3UOAB 1GNLA 3FI0A 5A0TA 5F2OA 4Z9AA 1EWRA 1R1DA 4WY8A 3Q85A 3I09A 1JLLB 5EMMA 5J2TB 2WAMA 1QHGA 5H9VA 1YZYA 3AYZB 4RZ2A 5ENVA 4LDPA 5HFAA 3PSAA 3STXA 3WGYA 3S81A 3AWDA 1NNI1 4WINA 1A72A 2I9KA 4TVKA 5E7JA 2HJHA 5LA6F 1P31A 5GOZA 2ORVA 5HG0A 3UK1A 4NX2A 4M38A 5K8CA 1WRBA 1URPA 3ASYA 3C43A 1TVKA 2I78A 3HZZA 3MNFA 3O7MA 4N0PA 1LSOA 2EWMA 1L9XA 1I4WA 2RHMA 1M10A 2WPDD 2YJTD 3Q0IA 4JOSA 4JEUA 3EUWA 4NYJR 2IHTA 1ZUHA 4TQAA 3TCKA 5HGXA 1H5NA 2JZNA 1T9BA 3T35A 3F4KA 1YZNA 3RVJA 3N0WA 1Y6GA 4D3DA 4RWZA 4XW2A 5HJ7A 4D2IA 4P33A 1GEGA 4E94A 4EHBA 2Z2ZA 1K7SN 3B1JA 4MV7A 3GPLA 1S7CA 3H8VA 1KDPA 4XDHA 3J81A 1TZKA 1KPIA 3REQB 3ADKA 3PEYA 2AF3C 3W77A 1A4RA 3CO5A 2O7NA 4J7UA 1P2UA 2DYKA 3MJFA 3R3XA 4FLEA 4ZRMA 1Q16A 2Z8YM 3M8KA 5ELMA 5G2OA 5HRCA 3VAAA 3SR4A 2X7XA 3JALB 3O0TA 2R6R1 3GIDA 1VSUA 2OCKA 4YO8A 1QYRA 4LXXA 3I72A 4RD0A 1WSBA 4WNYA 1IWBB 1EAMA 1BG6A 2ZZNA 1OWLA 4S35A 2J48A 3ZC3A 3FY4A 3EGOA 2AMVA 1P5RA 1K4KA 3DAOA 3HYLA 1ZUWA 2OAGA 2X58A 3EGVA 2FQYA 3WXBA 5IVKA 1RXIA 3D4IA 3PT9A 3BE8A 1T1RA 2GYVA 1N2GA 3K71B 3CX6A 4JT9A 5HKKD 3KLBA 5HDQA 1UXIA 2CMKA 2HK7A 4FD2A 4HH3C 5LD2B 4XUGB 4C2UA 5FWDA 2G0TA 4NAHA 3L5OA 3C0KA 4DJAA 2IS2A 3JVDA 1XV5A 3FNIA 3DBVO 2REOA 1J9ZA 1RLJA 1SKBA 4GYYA 5M04A 4V39A 4MINA 4U3JA 4ECEA 3KT3A 3G17A 3E58A 4CFSA 4DMKA 1JUDA 1L0BA 2C96A 2Y93A 2JCSA 2X6RA 1B16A 1WXHA 1QB8A 1SD5A 3IT1A 4FOSA 3V3TA 3PITA 4F86A 4Y9DA 1ZA1A 2YZ7A 5FV7A 4LHEA 4OV6B 1XZLA 3SC4A 3WAKA 4LVNA 1YR1A 4AY3A 3W5IA 2D62A 1QFYA 1XDZA 2ETXA 4RA6A 3UO8B 4B43A 4JROA 1OBOA 3ONWA 4UTXA 1YQ9A 2PLAA 5IU6A 2YV3A 3WGOA 1GAEO 5KTNA 3FMIA 2Q28A 4BKPA 4EG1A 1G8JA 1HY3A 2ZSUA 3FPBA 4ZEMA 2ZUFA 1BAPA 3DGEC 2QW8A 4NBLA 3WLSA 8ATCA 1NNEA 1U3TA 5TARA 3D2LA 1DXHA 3U3MA 1XD9A 4D9BA 4OHWA 4G23A 1A8SA 3NHBA 2X2PA 2DFKB 2XTMA 1E9AA 1TMYA 4B5LA 4KOEC 4I3GA 3AR6A 1PDWA 3A3OA 2BP7B 2QRNA 1JDPA 4FNAA 4ARBA 2FCAA 2JH3A 2JZOA 2DERA 3HDYA 3UNXA 4ND8B 5A9SA 4PYJA 3F6EX 3WO1A 1ZRSA 4PZDA 1IHOA 3PHHA 3Q0TA 1BXRA 4C0KA 2WMNB 2W2OA 5IARA 5C8YA 2NU9B 4RPCA 2GI4A 1ENOA 3T7TA 1NHGA 4MWSA 1X8JA 1AMNA 3CV3A 3GMSA 1XLTA 2ZRIA 2IUYA 1JG2A 1H1LA 4LJKA 2G1AA 4FD3A 5L45A 3YASA 1QH8B 3NYIA 2HBYA 5MHTA 4JLUA 3Q5DA 4N39A 3LGSA 3V1LA 3GJ8A 4Q93A 1W93A 1XQ9A 2H7XA 5E9JA 3WMEA 4IMIB 4RNDB 4D3ZA 2Y05A 2GM4A 3L8FA 3C6ZA 4EZIA 1KRXA 5D85A 3X2FA 4MIEA 4M8KA 2VKTA 3HSKA 5F64A 2QU8A 4BO3A 5KTRA 3RBXA 3NC1C 4FIZA 1D07A 1D4OA 1HDOA 3TR6A 3LVQE 4JR1A 1OR8A 1XRNA 2W4MA 3FBTA 3G59A 1BS2A 1DZIA 1HKHA 1CERA 2O5VA 4Q02A 4CM4A 3K9FC 4DSZA 2OV1A 1R0RE 3EXHB 4NPAA 4B45A 2OZLA 5SYAA 1MO4A 1IJKA 2X3FA 3H7AA 1GSAA 3P7MA 3WGUA 1ZVVA 3ELUA 4E14A 4EA9A 2NU6B 3EF3A 1PR0A 4AMZA 4CIBA 2J9GA 2VHQA 1RI4A 1JDBB 4Z4CA 2V59A 1U5AA 1Q83A 1O57A 1ZSYA 3H9JA 1IQ0A 1JPVA 2A5LA 1A9RA 4G5QA 2C88A 5I4IA 1Y3AA 4KXLA 1MEJA 2YN2A 2ZXUA 2OHHA 1SZCA 4CFZA 1BE6A 4JEIA 3PC2A 5J4HA 2LCIA 3BMXA 1PZMA 2A9PA 2V97A 2BIFA 4M7WA 4YCNA 2BN4A 3DT6A 3O7WA 4QO8A 4LYFA 2NU8A 1ONNA 2O3QA 4EJ6A 3GNLA 4CG0A 1OROA 4HWTA 4NE9A 2MSLA 3DVAB 4C7JA 3K3PA 5LYYA 1UH5A 2YYSA 1OCEA 3P97A 4TSKA 2CE2X 5E2AA 4Z0TA 4PQRA 4XDZA 1BXKA 2JCXA 2NSDA 2P1RA 1Z5OA 1O6GA 4Y1RA 4EG0A 1JWLA 3GZTB 5TF0A 2BKEA 2QF7A 3MWDB 4H08A 3DZDA 3F5FA 2P77A 1RWMA 1U3GA 4TTIA 3FHTA 3IIIA 1XGKA 2F59A 3OSUA 4AMYA 5TIIA 4LGCA 4BZZA 5FA8A 4H3KB 1Y9JA 4HEQA 5EP1A 3OOYA 1D1PA 1GA4A 1T2CA 1ZJYA 4J6EA 5TY0A 3WYBA 2OFOA 3GFBA 2WTMA 4DG8A 1TQ4A 5FTMA 4ND4A 4B3DA 4UU0A 1VXRA 2R1VA 4JP1A 4ID3A 5K8TA 3SSNA 5IAKA 2AJDA 1M1YB 2Q4EA 4ONEA 2PRSA 1K4MA 1YR8A 4Y1FA 5C8ZA 3LUJA 4PAMA 1T5SA 1CVIA 2P0AA 3LUBA 1JAYA 4U7HA 3TI7A 3KUXA 2NUAB 1GQ2A 2NNWB 3LT5A 3T0GA 2XMSA 1ODTC 2BHRA 4IIJB 1OZAA 4IEFB 1ZD5A 3R7LA 4DF3A 1M1YE 4DSUA 1N5LA 1RSZA 2QRKA 4KREA 3KSRA 4EJSB 2IXEA 1H0RA 4KUHA 2WA1A 5KOJB 2X8LA 2AFIA 1Y5MA 3TQFA 5FOVA 2QPOA 3W6PA 4LBYA 1B0ZA 2XUAA 1S96A 2II6A 1X7ZA 3H1AA 3WOVA 4QDOA 4D9EA 2JLWA 4QFBA 3K4PA 1BJTA 1JAZA 1JI0A 4AL4A 3GZNB 4HTAA 3ZLVA 1WVIA 4ZVSA 1WMEA 1D6JA 4ZAWA 4DLLA 5HQ3A 3QH4A 2V0GA 3AM1A 1AKNA 2BPOA 2NAFA 1COZA 2VNHA 3BRWD 4X24A 2DPGA 4X00A 5K3AA 3BMCA 2YIVX 3R5HA 1CU1A 2WVHA 4IV0A 5ALQA 2NTJA 4HXEB 2P9QA 2ETVA 1NGSA 3T06B 4F4UA 4YRAA 2VDRB 2BVNA 3UXMA 1R7RA 1W88A 4ZJPA 3TDKA 4R3NA 4B79A 4FZJA 4N3AA 4D4MA 4B3GA 3ZI4A 2HCTA 3UK7A 3I45A 1F8GA 2AIRA 3VXKA 4UNRA 4AECA 5A3JA 1DAKA 1E20A 4TTPA 2AC7A 2XVMA 3N07A 4JQOA 5C1BA 3AR7A 5CB4F 4G6ZA 2VDUE 1ZEJA 4BNGA 3I6BA 3QX8A 5DW3A 1T2NA 2QZ9A 1D4ZA 1P5ZB 5AK4A 5GADl 2I2XB 2JJ2D 3A1TA 4XSHA 4BX0A 3SHOA 5KWIA 3ADCA 5HE9A 1IAQA 1PV1A 2JGMA 4HTFA 4FINA 1IIRA 2YCBA 2JIZD 3BA1A 3CX7A 4IJUA 4OJNA 4JOQA 5JVDA 2CLCX 1YJCA 4DZTA 2AYYA 4J0KA 4MUXA 3UXYA 3N2IA 4XJTA 1CP3A 3SXPA 3FIJA 4MRVA 4X6XA 4ISBA 4DRXA 5IVDA 3VZDA 5LDDC 2HN9A 5JJLA 1AD2A 2N42A 3DTVA 2EKZA 1M8GA 4MVJA 1DOAA 4URHA 4L02A 2V7PA 3CVWA 1Z9BA 2V9CA 1G8YA 4OHUA 1HE3A 4KLAA 1T29A 3D4NA 4US2R 3ND6A 4PR0A 5FPKA 1D2MA 2ZIVB 3FPKA 3IODA 4ALNA 4DCPA 3HJBA 1F8FA 4CF6A 5BMVF 3L9WA 4GX1A 4JI4B 2PUGA 1HYEA 5ER6A 1OXVA 1B8NA 3R3UA 3SSAA 4B7AA 4CT0A 3DG9A 2WD7A 4EWLA 2MT9A 2OBXA 1F5SA 1OH7A 3GFSA 1N0UA 3DUWA 1RP7A 4ZIRA 2HC9A 3E81A 4JXXA 2C2HA 2Q2QA 4M9SA 1KZ9A 1IM2A 4WUTA 2OCGA 3IV7A 4LPKA 4TMKA 4LJ9A 3IBCA 2YY5A 3S5JA 1X92A 5ENDA 1VE6A 4E13A 1SU4A 3ZCVA 5DNAA 3BEDA 3ETNA 4URUR 3OH8A 4N5DA 4P7BA 4PX9A 3KEGA 4U9HS 1NRJB 3PHLA 2QY9A 3H1EA 4Y67A 4G1MB 5JJ5A 1EUDA 1ZW6A 5BSMA 3K2BA 3CHYA 4A16A 4GUDA 4RPLA 4DJJA 4U7DA 2GR9A 3AZOA 3MS4A 2W6ID 2YV1A 4ZU1X 1E2JA 4RETA 4TMZA 1RRKA 1K89A 2R7AA 5BNIA 1OC2A 3IBGA 3C14C 4CM9A 1VPWA 3M33A 3ACCA 1YU9A 1UPBA 2J9FB 2Z9CA 2EAUA 1BHQ1 2PMWB 1P45A 4HPWA 4HPJB 5I9MA 3O4IA 1DMRA 3WI7A 4DIFA 4UFPA 3ZE2B 3NDRA 3LZ6A 1Z4PX 1YGPA 2HZ7A 3AF0A 5DLEA 3TRKA 4CKBB 1Y8QA 4IXDA 4HFRA 4RCYA 4U02A 4G2NA 2ZB8A 4GECA 3F49S 4O5OA 1QYIA 4NCKA 4DCOA 1JTEA 2FPPB 4XYLA 4J9VA 5LR6A 3WMFA 2FXVA 2J3HA 1BFKA 1GPH1 1CYDA 3JXEA 4MDEA 1U2EA 3AETB 2PXCA 4DLKA 4LF9B 5TDHA 1HKUA 3EVGA 3TPZA 3VQTA 4C0XA 2B1RA 2C0PA 4XJVA 5IDVA 4B4VA 3FFTA 5CFZA 3TR0A 2PL3A 1MAVA 2CMFA 2GAJA 3CR7A 1DCTA 1KQOA 1VHTA 1J2RA 4C7BA 4EPTA 2BHTA 5C32A 4QUBA 4X8LA 4X71A 3WWEA 3U61B 4H35A 3ZWAA 1G64A 5C46F 1CEEA 1BXZA 1ORVA 1PFYA 1Q0UA 3MLBA 4FMCB 4XKJA 1RXVA 1LK5A 4NJMA 1QS0B 4IYRA 1SKYB 3PUHA 4LF5B 1G7SA 4KNWA 4OQLA 4YRRA 1P7YA 5EJ7A 2VJNA 1QIIA 2PX2A 4JY7A 5G4KB 2GYYA 1GCAA 2O1XA 3H83A 4NBRA 2O19A 4K2HA 3OF5A 3A9UA 3AVPA 4IDCA 1IMJA 3D7LA 1NKTA 2ZRDA 3DE1X 1WIWA 2BM8A 1NN5A 2XQFA 1C3XA 1H0HA 2ZUTA 3S2GA 3AGPA 2YNMD 3C15C 3IAS1 3A14A 3M6LA 4FKZA 3T52A 4BWVA 1L5RA 4Q3KA 1JSZA 1RLMA 1E9FA 1NRWA 1WTCA 1BMDA 3RI3A 3MWLA 2VFAA 4PYMA 4O4HA 4XZ3A 5JAIA 4NP6A 1THTA 3GLIE 1DHTA 2GPSA 1GPBA 3DTTA 3FTNA 2A9RA 4D3SA 2X0RA 1IVSA 1FLDA 2H0QA 4XX0B 5AVTA 4PZLA 3KHKA 1BWPA 1XN4A 2RK6A 2WAXA 2Z2IA 2KMLA 2Z95A 3GH1A 4WN9B 4B80A 5JASA 4NOMA 2REQA 1X1EA 1XUOA 2AZTA 3B13B 3AIOA 4WBNB 5B55A 2EOAA 4ER0A 4TKZA 1NR5A 2BMFA 2JIBA 4EVSA 3EEFA 4OMUA 1N6RA 4ARSA 1K6IA 2JK0A 1W34A 1ZCZA 2HL6A 3KYBA 4PG6A 3SQXA 1RFLA 2AOTB 2GYWA 2JKZA 3BDVA 3F5MA 3K0AB 4WKNA 4I4TF 5A2GA 1C3VA 5KTYA 1EXNA 1HTBA 4W9NA 3AZPA 1T36B 4RFVA 4PFSA 1FDSA 1XLWA 2PZ8A 4W5NA 4N6GA 3ZI0A 2R8BA 4CM1A 1PHRA 1MA3A 3G1TA 4XQ0A 5HF5A 5AVYA 4Y7CA 4J2TA 4MI6A 4EGAA 3HG7A 3MAJA 2E5FA 4WZAA 4B74A 5LZ2A 5K01A 2JIOA 4N03A 5T8KC 4BJ5A 2B4AA 5E3HA 3DAFA 1L5MA 3LIPA 4WIAA 1DC6A 1V3TA 2DJ5A 4GMHA 5ESDA 4RK1A 3AR8A 4BO6A 1OSNA 1BGWA 2C04A 4CPDA 5JIBA 2B82A 3NCTA 2HHJA 3FTEA 3UG6A 3ILHA 4YCJA 3NHRA 4HLUC 2D13A 3W3AA 4UQPA 4UU1A 3PNQA 4ZOQI 1OASA 3GLFB 1JDJA 2O20A 3RSGA 3ZXUB 4BTLA 4EI9A 1LX7A 3RDPA 1N2SA 3WQSB 5F35A 4PCAA 4LY3A 1RDFA 2H54A 2BMDA 2AVDA 4XUDA 2FUG1 1G3RA 4OP3A 3IQHX 2M32A 3LD9A 3AOEA 1T9GR 3GY0A 4JB8A 2YMMA 3M1LA 4GF5A 3ANXA 3KYDA 1W0KA 1LV7A 3O4GA 3HVIA 3ORFA 4WVFA 4GVPA 2QSZA 4XIJA 4GC9A 5FD8A 1PSDA 3BT7A 4WCVA 5FUMA 1M2OA 1P1RA 3E15A 3S2EA 4YJDA 4CIXA 2QN1A 1T1IA 1X7YB 4P1ZA 3AJDA 3EC7A 2COKA 3WGZA 4RC9A 2XWSA 5BV0A 1GA6A 1AK2A 3KELA 1LTHR 1FTQA 2J59A 3MBOA 1VCMA 2QY6A 5IUKC 4HJXA 3AERA 4YCDA 3FPJA 3IPYA 3E61A 1BH2A 1N4DA 4HGZA 3S8EA 1Q6YA 1EFVA 2VK8A 3KOWA 3L02A 3R7WB 4FSXA 4CI9A 1O94A 3OZFA 1OQAA 1KYTA 1DKUA 3BK7A 3PUKA 3W4IA 1HZZA 1LSUA 2C2YA 3GP5A 1U5BA 5JD6A 4CQNA 5BQ3A 4DJFC 1V6AA 2X14A 3PEWA 4TTVA 4Q6BA 1EFRA 4C0JA 2EL7A 4Z4HA 3KTOA 3LQ2A 2AKAB 2QW1A 1PR1A 5CVJA 1FS5A 5EUQB 3VPFA 3ZWKA 3ER9A 1HNXB 5FHQA 2HBRA 3QVSA 4YP0A 5DPMA 1H42A 2GK3A 2Y71A 4DB2A 4FB4A 3L84A 1KDVA 3AONB 4AJJA 3I52A 4GMFA 4GOXA 4IDQA 1VJTA 2NUPB 4K6HA 3Q3CA 2ASVA 4Y9UA 3W2GA 5C1PA 3MC1A 5IZCC 1YFKA 3EZXA 4BO5A 4F3CA 4A27A 4CM8A 2HA3A 2FPRA 1K3FA 2FLVA 5GJCA 1E0SA 2I2AA 1Z5PA 1K92A 4RUKA 3ST7A 3MTQA 2DEUA 5CDGA 3T1YB 1Q74A 1PK8A 4R0NA 1XMQB 4REQA 1ADYA 1RKUA 1FMJA 1X1QA 2NVOA 3C24A 5KQRA 5HIMA 3RVQA 4E5VA 2VHZA 4BOYA 3OCUA 2V1UA 2XCTB 4MKHA 1W76A 1NJFA 2JARA 4OHVA 4BMCA 5T3YA 1UIRA 2FRDA 2Q8PA 2PA3A 1OXBB 2YHAA 3L6RA 4TLEA 2JBWA 4FYXA 1JS1X 4JI5B 1W4LA 1I33A 1RAAA 3QX3A 3MUOA 1K8RA 2W2KA 1N9GB 3DUFB 3KC2A 2H2HA 2OKCA 3HDTA 4JJ4A 3EGCA 4UM7A 4FFNA 1JKFA 2JLVA 1R0CA 1ZUNA 3D6MA 5B53A 4PYRA 4AMVA 5E95A 4NPCA 4AJPA 1OXMA 1FLVA 3HN2A 2FPIB 2YN0A 3M6IA 5KQMA 3EVTA 3LCUA 3EIXA 5IC6A 1FZTA 1KP9A 1R5NA 1BVYF 3QWFA 4RMGA 3UHFA 5C52B 2B4YA 3EIWA 4JNKA 2KWIA 5G0TA 2ZAYA 3I64A 1M2VA 2Q41A 4DLPA 2ZM6B 4KPYA 3DKIA 1JBQA 2QBYB 2J67A 1U4NA 1P2FA 1UMBB 5G0UA 3DO6A 2VHUA 3QKTA 2FJ0A 1CRZA 1N0WA 1WXGA 3H2GA 1E4YA 4FNMA 4LKRA 3WJ1A 4FW8A 3URMA 4W9MC 5L3RA 5KHLB 4JI7B 2IS1A 3I73A 2VP0A 4S2EA 3FYSA 4MV8A 4G5OA 4NEGA 4C08A 4DDVA 1P44A 3F6YA 3OLQA 2PJRA 3KUKA 4OQXA 1T4DA 3WK9A 4EGSA 2BLLA 1KVSA 1W35A 2F4NA 3HEMA 1B7GO 3KQHA 1M8PA 3D6VA 1IXKA 3D6JA 4UBOA 4DW8A 1VLMA 2YWGA 3GAAA 1C0IA 5C1IA 2DR3A 4GQAA 1OLUB 3TZKA 5HW0A 5HZMA 2D2XA 4KQGA 4E2FA 3LKDA 3NTOA 3HR7A 3BHNA 4PRYA 5IJAA 4MUHA 4ID9A 1MO5A 2BR5A 1KI2A 2ZAIA 1C30A 3W2HA 1VHJA 4F3TA 2MINB 3O92A 4D4KA 5CG1A 4GP7A 2WJ3A 1AV6A 1NUQA 4I5IA 4C0BA 1YOVB 1ISHA 3EXEB 5FOUA 3WMXA 5DTEA 1LSSA 4C7XA 3FFXA 221PA 3N2ZB 3PQDA 4FR0A 1ZCJA 2BZ1A 5LCXA 2HMYB 1SK9A 3DOOA 4TPKA 4MQBA 1FMFA 5C1DA 2XAAA 3F0TA 2ZTHA 1NU8A 1XMVA 1XO1A 2BTEA 1VL1A 5DHSA 1OBCA 2H92A 2Y0EA 3HE3A 1I01A 2OV3A 5DW0A 3G2MA 3SXJA 3W8RA 3ZBQA 3HGQA 4MTCA 2OG2A 3GEMA 1YRYE 1AQ6A 4MAFA 3UK2A 1RRFA 3DGFC 1SKAA 3RRFA 4J4BA 3KU1A 1XPOA 4HY3A 4IXWA 1U31A 2ZUVA 2ZBEA 1HH4A 2DTXA 2E18A 1PNOA 2P0YA 3V55A 3R8XA 1GDTA 3COWA 3A2MA 5CW1A 1PG5A 1XL0A 3IAAA 3TUZC 5BRJA 2PANA 5EY5B 1SOUA 3FG9A 1N5IA 3VKVA 3JSXA 3QFFA 4Q05A 3NOOA 5AI9A 1RBMA 3WQBA 3ZZ1A 4L5YA 1PX0A 4TYPA 2IOYA 1KYZA 1MAUA 3MCVA 1UQRA 2FKNA 2C2OA 1YXMA 2QAJA 4IWNA 3B6JA 1HPLA 4CUKA 4ZVLA 2H2DA 2QVCA 2PK3A 4FGZA 4F2WA 1IBCA 2B7BA 1N7GA 4AWAA 4RH3A 1XZJA 1YVPA 3CRZA 3ZVNA 4QOSA 4R2XA 4NVRA 2EEZA 3RC1A 1Q2XA 2ECFA 1NLUA 4TSFA 4QLAA 4D9MA 5KOIA 1LSJA 1X80B 2DUUA 1O0SA 2DF8A 2DQYA 1I5RA 1NONA 2F9MA 3UWSA 3I62A 3KS9A 2QTVA 5AYVA 5E2IA 2P8SA 5HBGA 5FT9A 3TL2A 4BNNA 4DUGD 2C7OA 5BXYA 2NVUA 1J0CA 1H9CA 1ZM4A 4OYLA 3QU4A 1K08A 2FR0A 1YQDA 3H4IA 2IP4A 4KQFA 2ZJ0A 1P5HA 1PR2A 2LZ0A 5JJKA 2HF2A 1MB0A 4XUEA 2Q0HA 4BFXA 1K6XA 3MS2A 1AKMA 3BILA 4WXYB 3GMTA 1WCXA 4B6OA 1HUQA 2FSIA 2AL7A 5SYNA 1DTEA 2P1DA 4C4XA 3I53A 3H1PA 3QQPA 1EE9A 3QXJA 3RS5A 3T3OA 2BFNA 4R9RA 1SUBA 5E6UA 3WXMA 1XAJA 2HT1A 3EXG2 3TM5A 1HZJA 1CZKA 1FDWA 5JNTA 1E3WB 3WL5A 2IFTA 3SLRA 1YH3A 1ISFA 1KQFA 3B2QA 1ULBA 4U0KA 3KQKA 2H4ZA 3FNRA 1DQZA 3OJOA 2VK1A 4NU8X 4PS0A 4C0AC 1FYFA 1KXZA 2GCPA 2JGAA 2XQGA 4FDAA 4KQ6A 3C1AA 4YRNA 5FBVB 5ITZA 1DAIA 2B99A 4R1MA 4BQEA 5DULA 4RPKA 5LD2C 1C4KA 1GN8A 3QJ5A 5DIFA 4A5SA 2IV2X 4O59O 3TM4A 3DW1X 1ENZA 1OV4A 4LXUA 3PE6A 3ND9A 3DV0A 3JWPA 3R5XA 4IGAA 4JWKA 4PLTA 4B3BA 3NVAA 2ZAOA 2P9YA 3GFVA 4V0KA 3STUA 2EDCA 4F6LA 4AX4A 1ZU4A 3TCXB 1XXHB 4R05A 5LU8A 3CBQA 1PNQA 3EFEA 3KRTA 2ZIZA 3FCAA 3OWXA 4FK8A 4JHXA 1P3DA 3SIWA 3ZN2A 4O2RA 4F5ZA 3BIOA 1N1MA 5HQTA 1OX5A 4D9NA 1C81A 2NYUA 3IIJA 1QP8A 2ANCA 3CNBA 1JHMA 4KYVA 3IDZA 4TYMA 3M6MD 2OYSA 5EJ9A 3NGXA 3OJ0A 1TRHA 2XCLA 2Y76A 3N8DA 3HXOA 1XXHE 4R7TA 1RXEA 4JLBA 1XN1A 1XVUA 3KR1A 4PGHA 1Z4OA 3R0IA 2Q9BA 2YXDA 3CKYA 2BEVB 3U7JA 1N5OX 1TT7A 3PYXA 4FE4A 3VJRA 3R6TA 5LOVF 1CZUA 4YT4A 1KU0A 1ND6A 4RQUA 4BZQA 3UT5A 3DEAA 5A5DA 5JZ9A 5ARBA 3VR4D 3FSRA 2NTYC 3ZJTA 4CKWA 3HBNA 3G5UA 4TS4A 4LXTA 3VH2A 5KJCA 3A1WA 3C3JA 3D6AA 3E9RA 1ZMRA 5FOTA 1P74A 5FPTA 2WRZA 4F8JA 1DV2A 2WUEA 1ZG3A 2HHCA 1XFDA 3RBVA 3IL2A 4PINA 1G66A 3IIMA 3TLGB 4DWWA 4WEQA 1IMOA 2J5RA 1DWOA 1U8YA 2IW3A 2PWYA 2DR2A 1DPFA 2PT6A 3DAYA 3WGKA 3FB1A 3E23A 4FHZA 3LVFO 5FLKA 1Z8HA 4EJFA 5BSHA 3ZUGA 4C29A 1E5QA 3B1XA 2Q3LA 3TSCA 4FHGA 5EERA 3CF4G 5DNCA 4J4HA 1I3KA 3GT7A 4RK4A 5JPDA 3JPWA 1TK3A 2BJWA 2AQKA 3S1AB 2OGSA 5JFTA 3VSEA 3QVJA 4BV3A 1NF3A 2WT9A 3DR5A 3EBPA 5ABPA 3D3QA 4KWHA 1NFRA 3F1KA 3K16A 3FTCA 1Q20A 1U7PA 4PQGA 1QANA 5KVVA 4GOKA 1J25A 2QSYA 1NR7A 3N28A 4NC9A 4R8MA 3ORHA 3WL7A 1A9QA 4DV3B 1Y8ZA 1L8LA 1JT2A 4FDLA 1F17A 4KIJA 2ZJ5A 521PA 2EQ5A 3WK7A 2WG0A 5K0ZA 5CCBA 5NLLA 5IVPA 3RYCB 2HRCA 2C5AA 1SQ0A 2IV3A 1M7HA 2CV1A 3QEMB 2C7PA 2G67A 4RL6A 4UM8B 2D4HA 1UQTA 3EXHC 1AHIA 2I4MA 4DM7A 3ASUA 3FRJA 1BDIA 3ROXA 4LXHA 1YJAA 4ARZB 3V48A 3N2EA 2VDKB 3K9WA 4BUJA 3A1VA 2C97A 3OM9A 3FCUB 3OIDA 1N1DA 2ZGVA 3QVWA 4I14A 2IL1A 3MGGA 4BO9A 1CUDA 4CQLA 1O6BA 2QYHA 4TMYA 3IAFA 3VUEA 1HI9A 1L7OA 1JDBC 1E3EA 3FNEA 3T0FA 3VA7A 5DU2A 2G82A 2Q0XA 1WF3A 2NUBA 1IJBA 1TEXA 1WSAA 2QWXA 4LYYA 3AY7A 3FTQA 4AZVA 2VTKA 3RAGA 3AR4A 2K4MA 4A6DA 3E9CA 1X7GA 3DFIA 2E4WA 5E4YA 2KLHA 3DNFA 2NYRA 2VZEA 3BL5A 5DOZA 3NKFA 4TN1A 3COSA 1E3QA 4PC6A 3GD5A 1G5FA 1ETUA 4QTZA 1PGPA 1G8HA 3HWWA 3WWOA 5IF3A 4TX1A 2ZITA 4MQ5A 1PQUA 4OMDA 5IH3A 3T94A 3A2KA 3RYTC 4YDHB 3SFZA 1L7VC 3D7RA 3LQ4A 3DL4A 3HUUA 1UKVY 2OBYA 3IHLA 2DBYA 4KB5A 3LCMA 4QYIB 2WILA 3SX4A 5LFAA 3I61A 3V00A 1NW4A 3C48A 4ZAYA 3ZXSA 2IBSA 3OIFA 5IT0A 3AHIA 2B2NA 4QGHA 4XWGA 4P5DA 3REGA 3EPHA 4KPUB 4OCZA 4QUJA 1G38A 1VL2A 1D03A 1ZSVA 2E1PA 2OL4A 5BYAA 3SU8A 2GX6A 3BF8A 4MCAA 1PP4A 1R6AA 2ORIA 1CNMA 3DWGA 1HM5A 3LY7A 4NK4A 3A9CA 3M2TA 4H4CA 3KQNA 3QP9A 2ZBDA 1S89A 1Z8NA 2FR8A 3RSQA 3MYRA 4R83A 3H75A 1K6MA 3H5RA 2C84A 2WJVA 4JSTA 4ML3A 3VVMA 1C3OA 1T4MA 3EA4A 1W5FA 1E2MA 1NYRA 3L04A 3L8DA 3M49A 3K5PA 2R751 2PD6A 3BIWA 3VR1A 4E2XA 1UK9A 2UAGA 4I6EA 3T3EA 1Y80A 5AHWA 5DWQA 4AJ1A 2V7UA 4Q9IA 3TOXA 5KYUB 2C8VA 1GTL1 1Y3HA 5LZ9A 3HZRA 2XA1A 3D2CA 2GN2A 3THOA 3F98A 4WRRA 1Q7CA 4P80A 2ZI6A 3T99A 4EJSC 1W5EA 4O8CA 1KTVA 1SUFA 3I92A 2GUWA 4KQMA 5BT9A 5C35A 1O0BA 4LRUA 2OGUA 1UJBA 3TNDA 2Z5FA 2ZRHA 5ICCA 5CLLA 4FDVA 3NTUA 3P2IA 4G5RA 4J91A 3EFOA 4OQFA 3NG1A 2NOAA 1WXXA 4K9LA 2YHBA 3NT4A 4P2GA 4DZRA 4B76A 5CD9A 3FF1A 2JLAA 1R6DA 3WLQA 3F7MA 3MD9A 4D6XA 1NX6A 3ESQA 3OP1A 3PGA1 5TVGA 5I51A 2X1HA 1P4HA 5J23A 3PJRA 2EYUA 3WL3A 2FH5B 3ZZTA 4IIVA 3HL0A 5DP2A 3VI4B 3WLEA 2O8NA 1UINA 4RS3A 4HNRA 421PA 1SVOA 3I9KA 4HRAA 4YUWA 1FTGA 1XMPA 3ZBPA 2HA0A 3N2YA 3PL5A 5SZHB 4EYQA 4KXUA 4CMEC 1WB9A 1J21A 4Y2UA 1PX2A 4CL2A 5JRJA 1GWNA 1Z45A 1NAHA 1YQTA 2Y0BA 4MKGA 4B8ZA 2J33A 3OSZA 4E4RA 2O57A 4UDNA 1CRPA 1YL6A 1KTIA 4XSVA 2CSXA 2RHLA 4AZTA 1TPYA 5KBYA 2VJMB 5CFMA 3ESCA 3DBLA 1F9EA 2RHJA 4MA4A 8OHMA 4XFDA 3PUVA 1UZLA 4MP6A 1VJ0A 3PPWA 2HMWA 5JV5A 3U26A 2VPTA 3U9LA 2KE5A 3Q3JB 4N5MA 4ZO7A 2XYPA 1LQTA 4NIMA 5L3QA 1MRNA 2QM0A 5HJ5A 1GL9B 1NP6A 1SN7A 2ZTLA 1ZUD1 4IKPA 5D01A 1CB0A 4KXYA 4EPRA 3V8QA 5AR1A 3HYRA 2QTTA 1AGXA 5AMXA 1GA1A 4V0ME 2BZSA 3W6OA 3GELA 2VHVA 4MR9B 4Q4HA 4DUZB 2IX9A 3D5TA 5LMZA 4RQBA 1JKJA 4OLAA 4H27A 2IUUA 2WIKA 2PS3A 6Q21A 3I4CA 3VAYA 1O58A 4XPIA 3V4VB 5KS2A 4MUFA 4PLVA 3RYHB 2AUMA 5AKGA 3L0DA 4Y7DA 2OC4A 1C41A 5DGCA 3JQGA 3DV2A 3FCEA 4MV1A 4AULA 5I7RA 4OU5A 1O5OA 1DARA 1Y4AE 3GRCA 4KN8A 5BUQA 1U1FA 1R9GA 4TKLA 4TKVB 4ZOEA 4YAIA 3KZXA 1YK1A 4JAVC 4X61A 2C98A 4E5DA 1WMSA 3WDLA 2R8ZA 4LHZA 5JNSA 3K2IA 4REOA 1JB9A 4KG7A 2UYHA 5D7NA 2OWEA 4K9QA 5LBUA 2V3VA 2P9CA 1VG9B 2V9PA 1JPNA 2Z8ZA 1P9RA 2N1BA 3EB9A 4TV9A 3OPYB 4H1UA 2MTBA 1QTNA 1FX0B 1NI3A 1GYRA 4FGUA 2Q8QA 1N5DA 2FRVA 4RTMA 2P30A 2QQGA 3AW9A 4U7WA 5EQJB 4LJYA 4XLLA 1D1SA 5GOTA 1RJFA 3PG5A 1U3DA 5AQ1A 3DHEA 1Q0SA 1X15A 2F48A 5K0JA 4CLXA 1UBLS 4QYWA 3LLUA 2VTDA 4YCMA 3VSCA 4L5CA 3QFRA 4ZYZA 2I76A 3HP4A 4HEHA 5D7BA 1V6SA 3HLTA 5CT5A 2RG7A 3DEYX 2IS6A 4TVOA 3PFWO 1BSVA 4Y1EA 3BXZA 1EFUA 2BZGA 3OG9A 5EEGA 4BDTA 4QQ8A 1DC4A 3T9BA 2C9CA 3G2NA 3IEIA 4WK4B 3UJ3X 4WD3A 4TS3A 1NW6A 2DULA 4PZAA 4HGOA 1FFGA 4Q03A 1W9HA 2M1XA 2VHYA 3NATA 3WBBA 1UMCA 4QYMA 4XQEA 3LDUA 3EODA 3HXTA 5CCDA 3DDWA 1VHLA 3KT0A 3EG5A 3H8SA 4JV5B 4CTOA 1WZCA 4ACBA 5BR4A 3OJEA 2I8AA 3CA8A 2JNWA 1NNUA 4GWKA 1B1CA 3W7AA 4C5BA 3BXOA 3JSAA 4RACA 2XKKA 5KWEA 2WY2D 2LPMA 1LI4A 1AN0A 2PE5A 1OYWA 2BFBB 4Y8VA 1ZD1A 1E1MA 4OO3A 2XVZA 1KARA 4OQEA 4OMFG 4OA8A 1RWQA 5EWLB 4O33A 1L5QA 4FT4A 8GPBA 1TI7A 1XZMA 3Q8XB 4GBED 1L1EA 5A3VA 4K9DA 5CRIA 4PLZA 3QWBA 2RBEA 2R44A 2PKEA 1NF9A 4GBMA 3KB2A 3PB3A 4PHFA 4WY5A 4Z4QA 1E77A 1NU6A 2QL9A 1WOYA 4Z5XA 1NOKA 4YREA 3RWMB 4CIWA 3FWHA 4M1EA 4P3KA 5F4ZA 4I3FA 2HXGA 1H2XA 1HNWB 4UATA 4DQLA 2PEZA 2ZBQA 3FXAA 1AQUA 1C9KA 1EBBA 2PWPA 2YV4A 2VNKA 3QYAA 2ISCA 2QD5A 3KPYA 1I32A 3VR4H 3TIVA 4EVIA 1XAGA 3EQZA 1M1NA 1TVKB 2XUQA 1CR4A 5KDDA 2C2BA 3MTBA 3MINA 4UHCA 5ALWA 5H81A 1DU4A 2JKYA 1ZM7A 2AG8A 4ESEA 1TJ5A 1QP0A 4BPBA 4IAOA 3SK0A 6LDHA 3ZZNA 2JJ1A 1G9TA 3AZQA 4W1SA 1NMEA 1Y1PA 2I03A 1LLFA 1QOPB 3EQ8A 4A1OA 1N5KA 3E05A 3GWZA 5EJEA 4JQSA 5KTKA 3FYHA 3RS8A 2I67A 3R3VA 1F6WA 1E4OA 1JHQA 3FPGA 2PSHA 5DN9A 5C8YF 1ZVQA 2EWWA 5JQGA 1YB7A 1JFSA 4N49A 3JQ8A 3M4ZA 2XB6A 4Q1DA 2E7ZA 4U2DA 1S2IA 3GVCA 3K0CC 3O47A 2SCUA 4PTLA 1GNPA 4DXAA 1GNRA 2F6RA 1KI3A 2QUZA 4TVBA 3RIXA 1HYQA 1UMKA 1V8OA 4MGZR 4EGQA 2YQ5A 3QPWA 3QKRB 3WQRA 4M1YA 3LQFA 1NI4B 2CF6A 2P67A 2I8LA 4U4AA 4BNWA 4F3YA 2JI4A 3IUJA 5T4FA 1E7SA 4X1OA 1SEPA 3RRJA 3AHGA 2QA5A 3CS3A 5EHXA 2VCEA 4CETA 3GLGA 3HBAA 1YQWA 3ZE1B 2QL7A 2DB3A 1JV2B 1FFWA 2JD0A 3ICPA 3K20A 2N46A 4HVAA 1BKYA 2KBEA 3E1GA 2AX4A 2BLNA 3GU3A 3N7AA 3BGWA 1DBRA 2A3NA 4JB2A 1G8KA 4N8SA 4UDOA 5I47A 3A4YA 3HXPA 2C2WA 2M6SA 3F5DA 3PENA 5TT0A 9LDTA 3CMCO 5AM3A 3O8QA 5JSKA 3AHDA 1IUKA 1E79A 3MK31 4IILA 3GRYA 1JKXA 5JNWA 1YRAA 2XBLA 4HDNA 4RTRA 3TPCA 5TS3A 1XCBA 2CWWA 3VV2A 2OBLA 4BMOB 5KC8A 3GYGA 5FCDA 5I7OA 1NP3A 2CUTA 3QKSA 1QCDA 2HMUA 2Y6UA 4FT2A 4R2HA 4HLDA 4MROA 2NPIA 3A1NA 3IHTA 1EBUA 3BWVA 4C20A 2XIQA 3OM8A 2YXBA 1FUKA 1FDOA 3ICOA 4AWXA 1XD8A 2IPAB 4HMOA 1P2SA 4DPLA 2AW5A 2W0MA 5DNWA 3FYTA 3BB4A 1TK2A 4HX9A 3ND5A 4BU1A 1JFTA 2ZJ3A 1NBOA 4F8EA 4HNAA 5B1YA 1JHUA 1SRRA 3IUNA 3UB2A 1YL7A 2HA7A 2VN8A 2Y1DA 2J4DA 2ECQA 2R3SA 3GK3A 1TT5B 1ZUIA 1ZZEA 1R6TA 1L5VA 2C4NA 4UXIA 2D1YA 4ZCQA 3ZHUA 4ETMA 2PR7A 3W06A 1SZPA 4DGQA 1UPCA 1JF8A 3L1IA 5BN3A 4BXOB 2W7TA 3O82A 3OTHA 2FSVA 4L7VA 4XPZA 4YUAA 5AUOB 1N2CB 2ZR9A 2PTGA 1KKLA 1MEEA 2EF1A 2G3YA 4PIPA 2H57A 4GZ5A 1EEXB 3D81A 1EK1A 2EP7A 3GJRA 1GXSA 3KTAA 5FFMA 3LXUX 3N8IA 3N0TA 3LSTA 3OTGA 4BLOA 1PN3A 1FP6A 3K9QO 1Z82A 4MVJD 3SZUA 5AI5A 1E63A 5A9SB 1V4NA 4QATA 1Z4JA 1FFDA 1SQ6A 2HSZA 1VBKA 2P3OA 4KP7A 2V45A 2OPHA 2EVWX 2Q5LA 4FNOA 2R8YA 3H99A 4W9RA 3TEJA 5J2UB 4XVHA 2VF8A 5K8IA 2JGLA 4P3XA 1AUPA 3GEEA 1JLHA 4XLZA 5UKDA 4UHEA 4D79A 3L2OB 4X60A 5CDUA 4WKCA 1AV7A 1TF5A 2J0EA 1K7CA 1E9EA 1SHTX 1ZH6A 1Z83A 2I6TA 3LFHA 5KTOA 1U0JA 4ZOLB 5LQCA 3EEBA 1Z0SA 4HP8A 3UH0A 3IP1A 3GVPA 1NVEA 2XOXA 4S1OA 3TNLA 5KMGA 5LYJF 2EP8A 1ECLA 3TCNA 2BI7A 3PGMA 1XDUA 3E4DA 4UVEA 2SKCA 3O5AA 4HNQA 4CKZA 2G1PA 1A9ZA 1GFWA 3BJZA 1IRXA 3PC4A 4A15A 5EOVA 4KPGA 2D1FA 4LJ4A 3UHJA 1PJZA 1Z0ZA 4QODA 3L93A 1AZWA 1ZNWA 3TLJA 4P6VF 3LWBA 3IMKA 5AOAA 4G0XA 4IUBS 4QGBA 4UCXA 5T4HA 1C2TA 2HWYA 5B1SA 5IXSA 2QGZA 3A3PA 5BSEA 1IFXA 3UY4A 4CG3A 1XEXA 2GGSA 1QYWA 4X95A 1ZR4A 4CM9D 2FPSA 2XY4A 4BB5A 3AY3A 3VNRA 2HNAA 2EJWA 2WT8A 4AF7A 1WHSB 2A84A 2O7QA 3JQ7A 4NDNE 5BN1A 1KFJB 1UEXC 5JAPA 2WFMA 5H3CA 3ANMA 2D00A 1ZY2A 4JX8A 4FXOA 3T7CA 3UXEA 1C7RA 1DB3A 1ZKDA 3A9RA 5IDXA 3F2IA 2XKAA 2DHEA 3LHFA 3PFIA 4R3UC 1AGPA 3M1IA 2HGZA 2NSLA 2XVXA 4MXDA 3SJZA 4DNOA 4FZRA 1B42A 3ROKA 1G18A 1U7DA 4XI9A 5AOVA 1KYVA 3KJQA 3TXAA 3TG2A 1N6KA 2OOKA 3P9CA 4KKVA 4KVZA 3E84A 4W4TA 3VR0A 9ABPA 5JZSA 1X19A 4GGMX 4N40A 5A0VA 3ZG6A 6YASA 1TNDA 5DM0A 5AQEA 3MBIA 4P92A 5CLJA 5EYPA 1E7YA 4LJAA 4BE9A 5H8WA 3LF1A 3LCVB 4H31A 2FXIA 3HV0A 4X3PA 1YACA 3TEFA 5KWJA 1CNEA 1JBKA 1AU9A 2XX3A 3E82A 4EYEA 4FWTA 1J7KA 3OJXA 3WJ7A 5FI1B 1A69A 4GR9A 4R6XA 5IWAB 3FIUA 1Q22A 3RIHA 3HCDA 1JWBB 3B3AA 2FDXA 3V4LA 1ODSA 2B5OA 2H5LA 2VHXA 3HO6A 1CQWA 1HETA 3N0XA 4I36A 1G20A 3I2IA 3V4RA 2GLXA 4XIIA 1JR2A 3PPYA 1QYDA 1U0RA 3GA5A 5FWXA 4RIHA 4PTZA 1LI5A 3OHPA 2FMFA 1XDBA 1YMQA 1I24A 3KJIA 3HCCA 5JARA 1H93A 2R1VB 5CYPA 4ZYVA 3IR6A 5CFNA 5L51A 2CSUA 5C5DA 4B3SB 1DAOA 2ODNA 1BMTA 1E2DA 1GUZA 1ACJA 4AICA 1ODIA 4G0ZA 1W2HA 1ISRA 3Q3HA 4QBHA 4QTTB 3A6KA 1VI6A 1LWOA 4POAA 3K96A 3OFVA 1P1KA 1QPBA 5F5NA 4YRPA 4A0SA 2V7XA 2UZAA 4KE9A 3WZMA 2WUGA 1GL7A 1GIAA 3FNQA 5C5CA 3NDIA 1W4CA 1A8UA 4O02B 3W7VA 3ADPA 1U8EA 3O83A 1OU0A 3FNGA 1V7PC 1NY6A 4NJEB 3BGOS 1O0CA 4CKEA 3JYNA 3VOBA 4RCVA 2IF0A 3IMCA 4PXSA 2RAVA 5KVQA 1B6RA 2IDJA 1FNMA 1XL1A 2AZ4A 5JSZB 2AFIB 1N0VC 4KO1S 3A3KA 1MC8A 2GJKA 3IMGA 3BQ9A 3OFNA 1ITZA 1G3QA 2V6MA 2QNRA 1YI8A 4XCVA 3RVPA 4YMGA 4RLQA 1TUGA 2BAGA 1X7ZB 4I50F 5CYOA 4RJTA 1TYZA 1WETA 2QPTA 2YWHA 2JFVA 2V3WA 4B3JA 3SQOA 3U37A 1CEQA 1VB3A 2F1HA 5HQ3B 1DCMA 5EMHA 1ZH2A 5E8JA 3CWZA 2AFIE 3C4JA 3RQIA 5KKCA 4IWYA 3BMCB 5AKZA 4AZ0B 1E6EA 1M6HA 1TZJA 3MRXA 3IUSA 3VOTA 3W5SA 5ADVA 2FUCA 5I7VA 1H4SA 2IEAA 1O08A 3DD5A 1L5HB 1O89A 4ZRNA 4YCCA 3BKWA 4ISCA 4Q01A 5LZ8A 1I7LA 1MORA 1L4KA 1ZCAA 4G81A 4PN7A 4FFRA 4F0JA 4JVLA 4ENWA 5ICEA 5ELXA 1YQGA 2CDNA 2QGFA 1R4MA 3LCRA 3M4JA 3OFKA 1NX9A 2GRJA 3GQBA 3MHPA 4FLFA 1E2QA 3TK1A 4DA9A 1CY7A 4YCLA 2GEBA 5BR8B 4WKPA 5DV9A 1SUDA 4HDSA 1U1DA 1JLMA 3D4BA 4IMPA 1R8JA 1TMGE 4LAFA 1Q7GA 5JSHA 2Z3ZA 2GB4A 2ZVJA 5LBIA 4QZVA 2YJ5A 3L8MA 4G56A 5JVDB 1NXXA 4JC0A 2B5WA 4WECA 3WLJA 1SXJA 1V8FA 3DDHA 3E18A 2G0NA 4IL5A 5FKJA 2AFRA 3BTUA 4HGYA 5EXXA 4PE5B 4R1OA 4CF7A 1W0KD 1XP5A 2RMKA 4MW1A 3CPEA 3DZCA 3U4DA 4CHGA 5IAAA 1FVOA 5H4HA 5CVUA 1FTYA 4ALLA 2XGJA 1TKRA 5LN1A 3TW8A 3DTVB 1GHTA 4CUZA 1SC4A 1WKCA 3C7DB 5GIOE 2QD2A 5GGYA 1DNPA 1E4EA 2C31A 3FZGA 3OBIA 3IBTA 4Y2YA 3AKDA 1R0LA 1B0UA 4MKIA 2RCYA 3I37X 2OYCA 3GLQA 1UBSB 1VSBA 3IFSA 1U7WA 3F3KA 4KWCA 1G16A 2OCBA 1OT3A 1GKUB 4MVJE 3FZEA 1O94D 1R0YA 1Q1EA 2J4FA 2WD7B 2WSSA 4KGDA 5BOSA 3CTMA 4KCGA 4X62B 4YAKA 3K6JA 4ZIRB 4X1KA 5GZ1A 5DSZA 1VPTA 3FRHA 1XNRB 2AOUB 3VKHA 2IVZA 2ZBPA 5DK4A 4EGJA 4ZDKA 1GUYA 4D0RA 3NTLA 1DIGA 4BUCA 5BWMA 2IYFA 2KS6A 2D06A 2C5EA 4RVFA 3MOGA 5DCWA 3KETA 1EWKA 3G02A 5H02A 1B3BA 2PV7A 1RXSA 2E6KA 4JP8A 3T7IA 4A0HA 1DEHA 2JI6A 4GXNA 1E1YA 1HDZA 4Q1EA 1EUDB 1AQYA 4A10A 3U2QA 2R7NA 2WM9B 1P2BA 3A36A 3GNSA 3X2EA 4JVMA 1VPEA 2OHGA 3KAQA 3H1BA 2VKQA 4PAGA 3D8UA 3L7CA 1C80A 2Q2WA 5AVOA 4G8BA 2PMDA 2CC2A 1FP4A 2YQ4A 2DXIA 1FRVA 3ETLA 2QRJA 1E2KA 4WL0A 5EUBA 3IP5A 1QHFA 2ZSEA 1L9KA 3EZ9A 3I6MA 3PDHA 3L7OA 4N01A 3WV4A 4WZBA 5LMUB 5F52A 4CQJA 1T26A 2YMPA 4I6JA 5TPWB 3FGOA 1XF9A 3KEQA 3INYA 4GLFA 3MGBA 1FJHA 1NVBA 1R3DA 1L7EA 4ZEOA 1G291 5K3FA 4J6FA 4BC0A 3SD7A 1VE1A 2BDTA 2E4XA 4FNGA 5KTPA 4AM8A 4TS9A 3CUVA 1IJFA 3UJNA 4HGRA 2BCGY 4CGYA 1SCAA 2GZSA 4Q3BA 1UKYA 3KXLA 4ZYLA 5AHKA 2BBTA 2QIPA 3JQ6A 3QPUA 1OMOA 4DS3A 4KQJA 1A7KA 1AS0A 3CLSD 3EUAA 3PUYA 1J2EA 1SBZA 2QN2A 3UA4A 3W0LB 4YT2A 3R6LA 4YJ3A 5LXTA 2BH2A 3LCCA 4AUKA 3ZIUA 3N2NA 3KSAC 2ZRAA 2O0LA 3IRVA 3LP6A 4M21A 3WADA 4KGZA 1JQJC 1VCIA 4NJMB 3KB8A 3FOCA 4FW9A 2V96A 2ZB3A 2IY7A 3QUAA 2C0QA 4OUKX 4PC1A 4G5HA 4Q4DA 4YBZA 3THXB 2GN9A 3DM9B 1CQIB 1XTQA 4G84A 4BAUA 3FLMA 4M1WA 3Q2IA 1GFIA 1KSFX 4DV2B 3SDSA 3BORA 5BNZA 4HT3B 3KEMA 5CDFA 3RFVA 1PT6A 3TMYA 2QN7A 3WZ2A 1UBRS 1VGQA 3KU4A 5CPFA 2V65A 4EELA 5CA1F 5KZMB 2DLCX 5JD4A 4HWGA 2R1TA 3M82A 4HN9A 1UAAA 4K8RB 2I91A 3HCAA 2R2AA 1PJBA 5K8UA 5HFJA 4JLKA 4N3NA 4F45A 1KJYA 2CCGA 1O54A 3QI2A 4ZQGA 4L0QA 2HW8A 1KZ6A 1NLMA 1M9NA 4JYMA 4MVJH 2Z8YA 4RXMA 5JTTA 1A1VA 3MGKA 4E2YA 4ZODA 3PXBA 1C8BA 1ZM3A 2ZDGA 3CEPB 3H5AA 4O4HB 5EXDA 3TIIA 2R4TA 2GARA 2F17A 3BEOA 1QIFA 5CP8A 4P82A 2MIIA 2NPOA 5B30A 4NBKA 3TGLA 3VZPA 3MERA 1O6ZA 4C43A 4DA6A 1ZGHA 2QTZA 2QT9A 3CLRD 2F9LA 4NMHA 1GKIA 3IP6A 1WXFA 2REQB 2PO5A 4MUAA 3ODPA 1T6YA 1KSJA 3DWEX 1FSSA 2WNHA 4WAUA 4C3OB 4HAOA 4CCYB 2C1ZA 1OPXA 1Y3IA 2A14A 3CX8A 3I04M 4WOCA 1BDMA 3IALA 1B15A 4XYEA 5AW4A 3A9SA 1IY2A 4KWTA 2NW6A 2Q46A 1DJPA 2ZBVA 2RI0A 5EIOA 4EF5A 2DPHA 3TD9A 3FCOA 1EVQA 3AX6A 2IZ1A 3C5CA 5MN6A 1E6CA 1IHPA 2ZIAA 4YYEA 3OOJA 3LY9A 4AJEA 1PFKA 4M3NA 4A2WA 1BX3A 4GX2A 4LX8A 4YS6A 4WZAB 1Y8RB 2DQ4A 2AH5A 4IDAA 4KVGA 1CDZA 1SBCA 3RO7A 5KSWB 3CKMA 3QA3E 4JWTA 3IBYA 4NXNB 3VZRA 1ZK3A 4RKFA 2OYRA 2MSDB 1C4WA 4FOOA 4MI9A 5LQSA 3TRFA 3UV6A 4JI3B 2YOGA 1UFRA 4CJXA 2ZYRA 4GX0A 2CMDA 1F5NA 3ZVKA 2POQX 2WC1A 1U4OA 4WZAE 5DM4A 3NHZA 4UDYX 3S2YA 5DT2A 3A1CA 4KLNA 3OD1A 1U0OC 1NLYA 3CNLA 4FMCF 3V4PB 4QPCA 5AK3A 3UGKA 2QUAA 5ALSA 5KO2A 4DGSA 3P9PA 1WXDA 3VU1A 1EUYA 4FVTA 4NBVA 3LUCA 3KYDB 3DL2A 1QKKA 1ECBA 4L15A 1XZKA 4NABA 4OJQA 3VYTB 4P35A 1E94E 1ZIYA 1XZPA 4L76A 4I3HA 4TSFD 4DIMA 4E1AA 5JAOA 1OUMA 1MEOA 1M2OB 2X9QA 4M46A 1CUJA 5JDIA 4J94A 2V7TA 5ARDA 4ZV7A 4BQNA 5IBRA 2BEUA 2GPWA 4UU7A 1D3AA 5TMEA 4BGDA 1VE9A 4QM6A 3A2LA 2A33A 1DLJA 4PGFA 3NGMA 1VXOA 3LZDA 1XZHA 3Q3EA 2FUG6 4RV9A 5D00A 3WHIA 1NJ8A 4CW7A 1WZIA 4DV7B 1SB8A 4GU5A 5EZSA 3CEMA 1JIUA 1EFVB 1U28A 3GX1A 4KFTA 4HNVA 3QU7A 4E15A 1U81A 3KALA 3G2QA 4QRDA 1E6WA 4JXZA 3W2FA 4DUYB 4CV2A 4TWIA 3H5OA 5B2FA 3FPCA 2UUCB 3GF4A 3HY4A 4CMJA 4A0FA 2O8CB 4N9WA 1UT5A 3HU1A 1OYOA 3HBJA 4XM1A 1DKLA 1WW2A 4MAMA 4D4JA 4ZZ1A 5IJWA 4ZALA 3KP1A 3K2EA 1W5TA 7MHTA 1IBRA 2QRGA 1UOPA 2M6LA 2RGNA 4M8IA 4FR2A 4S1NA 5MGBA 1ZVJA 4CF3A 4ZQIA 1LFAA 1SXPA 4QBTA 5BOVA 2KM1A 2Q6OA 4RX1A 2CD9A 4XTCS 4E5SA 3AEKB 5CH5A 2IH4A 4BGVA 1DDOA 1CW2B 1ECPA 1XVIA 1JU3A 2O2ZA 3ANNA 5COQA 4XUCA 2ZPAA 3CIFA 2NG1A 2BSXA 2WF5A 3AB7A 1H85A 1TW3A 2HF7A 3QE0A 1A97A 1BWSA 4WNAA 3BFPA 3FPSA 3HDVA 3LC7O 1NVTA 4NZNA 4MUKA 2IU0A 1CIPA 1D5WA 3M6UA 5A7HA 1L7BA 5CT4A 4YYZA 3DBIA 2ODWA 1VCNA 4EVRA 2YWFA 1NM5C 2QI9F 1R88A 1TTPB 2O14A 3H7IA 3KO8A 4NESA 1LUAA 4UTZA 4PONA 3RUFA 4CMAA 2W2KB 2XGGA 2YRFA 4YY3B 1W4BA 1YS7A 3H0CA 2QZSA 4B4DA 1ZUNB 1OWPA 3W5JA 2AN3A 1Z6GA 4H6XA 3FTPA 2QVYX 3IKMB 3ZDYB 3HVKA 4X90A 5J4YA 2BEKA 2JVKA 4UM9D 3NWOA 1KE1A 1MC1A 1HE8B 1YKFA 4W82A 1DBVO 2EF0A 5HZKA 3NMUF 2IYPA 2P9EA 2CLSA 2DECA 2GAAA 1B00A 3WFZA 4A82A 1EJBA 5K3OA 1QQAA 2IZOA 1M2VB 3AXSA 4MVJG 3PHGA 2QMUA 1Q1GA 1KVQA 2VJKA 3NUQA 4QLOA 4B81A 2BFEA 1FFEA 2R6ZA 2AD1A 1G3IA 1T9AA 1UDWA 3AFHA 1LLUA 1Q14A 1DZ3A 2EP5A 2GRUA 3IILA 1NUAA 1KNXA 4WWHA 2IH2A 1N1EA 1TM2A 3FDFA 1AKTA 3L4BA 4K88A 3TB4A 4XOUA 2QR5A 1L3CA 2IPXA 4POOA 4TLAA 4W63A 5TJHA 3U7QB 3U4HA 3IVMA 5BQXA 3FUVA 2QN6A 4D9HA 1ZXXA 2EGHA 1IK6A 1U5CA 2CXNA 2JGKA 1PGNA 2QSUA 3JARB 3KXDA 3BRSA 3F7OA 4ZO9A 1U80A 4XWWA 2ZBGA 2BMVA 3IQZA 4LBVA 1GPWB 2Z5VA 2A0XA 5J5CA 2X1MA 3FYUA 1PDVA 3N2GA 3IJEB 4LDAA 1D9XA 1JQKA 1OIXA 3D9QX 1EAYA 1JALA 4TN5A 4AJ2A 1CRQA 5GP1A 3PUIA 4O1HA 5IAOA 3OZSA 1Y4ZA 3NOQA 5FQNA 1NI5A 4K05A 3TFQA 4BRUA 2PSFA 3MWEA 3QELA 1T1EA 1TAHA 3KDPA 1Z0IA 4G1FA 4FIDA 2F4VB 2XDAA 5BMOA 2DKFA 3EN0A 2XMGA 1C30B 4I19A 3VZBA 1CDDA 5TS2A 2AX3A 1M6VA 5AW2A 3CSDA 3NV9A 2OBNA 2C7QA 5JBQA 1CE8A 1KI1A 3ETEA 1U2DA 3BVPA 3M83A 4LCBA 5H83A 1QDUA 2COUA 2ZJ7A 1Y5RA 3KQMA 4WOBA 4ZANA 4WLUA 4KXVA 4C6RA 2MDTA 4OTZA 2IUTA 4P3NA 5P21A 1ZMBA 4MSUA 1UT8A 4W8HA 1T10A 3VKFA 4A23A 3QOXA 2G36A 3ISTA 2OO7A 1A9PA 3CRNA 1PVVA 2EJCA 4IOLA 4M1SA 3KOZA 4BGEA 1L7MA 2PFSA 1V3UA 3ZWXA 2YRXA 1RMYA 2QJWA 4K1XA 4MRRA 4PZ9A 3CURA 3MCZA 1I7NA 1BO6A 1Z38A 5B3JC 3KD2A 1P0QA 4PYQA 1V9SA 1YJQA 4NKRA 1Y82A 3PUZA 5KVSA 1KJJA 4XGRA 3B5IA 3Q8LA 1YS1X 1H1TA 4AKSA 1EFPB 5EPEA 1R4AA 2OBMA 3SJCA 3FBGA 2IYLD 3CW2A 1XVVA 3KKMA 1O8BA 5D6NA 3B6MA 3RYIB 2QN3A 4CCAA 2QG9A 3KSDO 3O4RA 1EVZA 1SBQA 4LQLA 4N1AA 2ZB7A 1WUYA 1YRBA 5FO0A 2H1WA 3K70D 3KZOA 3PUWA 2NACA 3C6XA 2EFGA 4YC7A 4MVJP 3TUJC 2BJVA 3UAVA 2JRLA 5IAJA 1PG0A 1H9BA 3A06A 1NMYA 4EHFA 4R9SA 5BUSA 1DJNA 1SUAA 1N75A 1VHWA 4DLZA 3SE0A 1ZC4A 3UWPA 2J09A 2WTUA 4MRAA 4G4GA 2WNIA 4B48A 1B2LA 1GU0A 1WA5A 3K1AB 4Y6QA 3UB3A 4BNJA 2OLKA 1YZVA 2V7QA 3RTAA 3TR5A 2IU4A 2QTVB 4WBXC 2AUTA 3ZY6A 2W4QA 1KYIA 1Z5UA 1ODLA 3LBAA 4BTVA 1ZJWA 2GZHA 4NYMQ 1X9GA 2J4CA 2BEJA 4BB6A 1PL6A 4I99A 1T8YA 2H65A 1T35A 2HY7A 1YR9A 1VLJA 3MVEA 5F12A 2VNJA 2P27A 5TQ2A 1BHO1 4TWRA 5EKSA 3OQ6A 3KQYA 4D8UA 2I2WA 5D84A 1AE1A 4ZCMA 4RDIA 3T7SA 2ICAA 3ZCRA 4EKDA 4YROA 3M4YA 3PQ4A 3E7XA 1KE2A 2R4QA 2J32A 3BTOA 5D1NA 3I01M 1DFIA 5CCXA 3OZIA 3CZMA 4EJ2A 3TX6A 2C1EA 1NL3A 2DUMA 4IIXA 4EHJA 5HKAA 2GO7A 2JJ8A 3WLKX 1NLZA 1QF9A 3CRVA 5H80A 4LSMA 4N7RA 4EPXA 1XTJA 1SUWA 3KQSA 2AJTA 1CCWA 1PIWA 3BZWA 5U1PA 4FGSA 2Z08A 4IUCS 3OZ7A 1JSCA 4B09A 2IDMA 3ZU6A 2EIHA 5ITZB 1AUOA 1ULUA 1V1RA 4IRUB 1NVGA 4JBWA 2NZVG 2GK6A 4OU4A 3A1DA 4LK2A 2CXPA 3DZKA 1AQIA 2RB5A 1AJEA 1WCIB 4RPJA 4XD7A 1KOLA 5BNWA 1K6EA 4PNPA 4GSKA 1U9ZA 5GPBA 1JDZA 1D2HA 4IFEA 2GDZA 3DV0B 4ECAA 4EW2A 5FJJA 2Y1KA 1RHUA 1F4PA 2A0UA 3LX5A 1QGUA 3FDXA 2OOSA 3ENQA 1NXSA 4ZYUA 1KJIA 1OXSC 3J7TA 3O94A 3QVXA 1SWVA 1L5WA 3FNHA 5AVJA 5JRDS 1E7WA 3W8FA 5KNDA 3G2HA 5E1OA 5G41A 5JHHB 621PA 4TMTA 4IS3A 2I7XA 5D2CA 4KDFA 4F8YA 2HCBA 3V9AA 1BYIA 2ZQZA 4KIWA 2FDCA 4JBYA 3N87A 4KV9A 3KOMA 5AJZA 5IT9A 1DBQA 1K5GA 3ADBA 4WFKA 4JZYA 4OK3A 1LZKA 1KK1A 1I9GA 4JELA 2FDRA 3HWSA 4QT0A 4EENA 2GN1A 1R15A 1TYDE 3AL0C 4X85A 3EIOA 3PNSA 1GVNB 3HJUA 2X42A 3HJHA 3ECAA 3QUBA 4IEIA 3IVGA 4O4LB 4YUZA 3IV9A 3B12A 2QQ0A 4UM9B 1TA4A 3UT5B 4OXKA 2AYZA 3NVKI 3R6GA 1FDVA 1R4ZA 2JFZA 2JGFA 4X7RA 1GEEA 1R6BX 1UBCA 4IG9A 3BBLA 4CKWB 5F7ZA 5IF9A 1GNVA 2RAPA 2NYAA 1A7AA 3NNSA 3PFKA 1IOVA 3R3ZA 4L95C 3OE5A 3QPDA 4DXHA 2CT8A 2RBGA 1P9NA 1RIIA 3E9EA 3WB9A 5J4VA 2JFFA 2WHPB 1VI5A 3PUJA 4D9KA 1P81A 3N2LA 2YW9A 4RD4A 5GQSA 1K7XB 1XYVA 2NGRA 5JLJA 5MF6A 3X1JA 3AP2A 2GZ1A 2O1EA 1QOQB 4CM3A 4DKXA 3RNLA 2FJPA 1QWSA 2X0IA 1HDYA 4WDRA 4D6PA 1PUIA 2HZBA 3IELA 4ZYTA 3A4TA 2XNHA 2X4IA 5F3WB 1BH6A 1FU4A 2D5IA 3WFIA 2VATA 2VK2A 1VSQA 3ONNA 1XLVA 3R40A 4OAQA 3C7AA 2JASA 3SFTA 4F46A 3ZGYA 1SC3A 3CUUA 5LDGA 5BW4A 1P80A 1QX3A 1UXJA 1VJRA 1JEDA 2C5HA 2FPOA 1GQRA 2QUIA 1LPMA 1J0AA 4JKOA 2FVXA 1K88A 5F1KA 5L3SA 2KJQA 4OX9Y 1VP9A 3HDQA 1GPMA 1N5RA 3EMBA 1TCBA 3EASA 3FWYA 4ARCA 3CW8X 1M67A 2BFFA 3SIPA 3JATA 1U7HA 2E9SA 3HXMA 1JRLA 1CY1A 1QOZA 1ZL2A 2O0KA 2H51A 2WPNA 1ZO8A 3QF4A 4ZT4A 3U56A 3DT8A 1I51A 2QZZA 5JSUA 5DNVA 1EFAA 2FSGA 2JEOA 2DPMA 3NEPX 2CVFA 1G8GA 1PV4A 3FSJX 2JLXA 3UYKA 4UCWA 1YHNA 4I66A 3WP0A 2I9PA 2N1MA 3E2MA 5CA0F 1EGAA 2IHUA 4ZQCB 1TUIA 2DFVA 1V3VA 2W6ZA 3KOOA 2YYZA 2L18A 5IS2A 4ZI7A 5KQSA 3I6ZA 3IUQA 4S24A 4CR8A 4C76A 1SCNE 4F96A 2AJBA 1DUSA 1TKAA 2OCIA 3HMQA 3EISA 1RIFA 1JHYA 1HLDA 4FDMA 3NHJA 4ZJYA 3H1FA 4G2TA 4I8XA 2UXBB 4ARIA 4G0VA 2F8TA 2NIPA 4LWQA 4J16C 3NBQA 1B93A 1M74A 2H1RA 3DXXA 4GLOA 3UMVA 1QKJA 2UZ3A 5ALLA 3ZCQA 5HKOA 2VH1A 5ICMA 2ZYVX 1RJDA 4HFJA 4F1JA 5LKRA 1SVIA 2A1UA 4H3VA 4R8KA 1N8SA 4GVXA 2WWXA 3E27A 4ZT6A 1ISGA 1EMDA 1X8LA 3H5LA 3HA5A 3HCWA 3N53A 3QOWA 4G0OA 1CQXA 4J0CA 4NV3A 3VPDA 5EGSA 1JA1A 4DLXA 3FUXA 5L8VA 3FFBA 4BJ1A 1FMTA 1W30A 1XRRA 1Q17A 5HJ2A 3T5TA 3NI2A 1S1MA 2VJQA 1OGJA 1KY5A 2NO5A 2ZJ4A 1YDHA 3CCCA 1DWUA 4HPXB 2V7BA 5IYZF 3RD5A 4A92A 2PZFA 2XXAA 3EIQA 3AR5A 3DP7A 3Q7QA 4N47A 2EBHX 2HSGA 2YMQA 5G3YA 3TFWA 4UNQA 1NMXA 1T1JA 4HK4A 4YRTA 2YJGA 3M6FA 3IR5A 3UV7A 1BROA 1G9XA 4URYR 4W1RA 5E7MA 4BBAA 4E08A 1DI0A 2F3PA 1IN1A 2P7IA 2R0QC 5THXA 4C4TA 1M7BA 3CF2A 3QNWA 4H7KA 1D2EA 1SHKA 1C3OB 3CZ4A 4LOLA 1F2VA 3CE9A 4TUYA 2ONJA 3KYIB 2HU5A 5CLHA 5HUJA 4FYIA 2VWPA 3WHPA 4DLNA 2ZYIA 2Q4OA 2NUTA 2JJ1D 2Q4DA 2FQWA 4H2DA 1KPHA 3W2EA 4G5SA 1N6PA 1NUTA 2FPGA 2W6JA 1E3IA 4DCTA 2MR5A 4Q3NA 2H17A 2ZSIA 2GKOA 1EX6A 2C5LA 2I4NA 2AWNA 3PA8A 5JUWA 1L8XA 1M2WA 4HB3A 4JUIA 5I9TA 4C3ZA 1IN8A 1YBVA 2DFDA 4LQDA 3R3SA 3LXMA 1BHJA 3PEVA 5IAGA 5CBKA 5EIAA 1R8YA 1UFVA 2HPHA 1BRMA 1LK7A 1CKEA 3OT1A 3PQFA 4LZOA 4WACA 2GF9A 5GTDA 5DBFA 3T5PA 4GZ3A 4MW9A 4HVCA 3TZEA 4RE6A 2WWHA 4YBRA 4DT1A 3CNHA 5HHTA 2FWNA 4KWEA 1BE0A 3NT2A 2ODAA 4J1QA 1KI9A 1Z2AA 4R01A 3C87A 2RGYA 2HSJA 3G0GA 2FUNB 2I6SA 4D8XA 2DP4E 2Q9UA 3WLNA 4B47A 3H97A 2OG1A 2NXWA 2DWPA 3PBKA 1E79D 4LY9A 4EFMA 4QQKA 4M37A 1ATZA 3CZ5A 2XRFA 3I9V6 3GEIA 3C1TA 5CFOA 3ASVA 2P62A 1LVHA 1VLHA 3FOBA 2GBLC 2YWXA 2FG5A 3ZEAA 4CQMB 4HGNA 2ZVPX 3ZDRA 4G1VA 1DO8A 1RXUA 2E21A 2ATIA 4DDMA 4R8VA 4Q4CA 5MGNA 3DBLB 2IE8A 4HAYA 1MV5A 4FFBB 4R7GA 3T3PB 3WC4A 3WK5A 5CX1A 2P6UA 2VUUA 3AF2A 3OETA 1RHKA 2H9AA 5AJXA 5KAMA 1HQKA 5HPYB 2HGSA 5DZSA 2HA5A 2ID7A 1S8AA 5DYWA 3T3DA 2A0YA 1W4RA 3OC6A 4PYLA 3ZNNA 1I6MA 2E5WA 2CL5A 4RSHA 1XQVA 2NU7B 1ZKMA 2NSYA 1YIOA 3EARA 1SVKA 3JQ9A 4E33A 3PD0A 3CY6A 2A5FA 1I3MA 1YONA 5FUVA 3H6KA 3F8SA 2I6XA 2VR1A 4E11A 4XPIB 1DT5A 2NQTA 5LVAA 4LZAA 4IWXA 3SKXA 4IV5A 1ONBA 3ZBUA 3JQGB 1JDVA 1NUHA 1WDLA 5HK9A 4IIEA 2PV0A 5CB8A 3F4BA 3K0FA 3SDZA 1IY8A 2VYVA 3JD4A 4C6SA 4PZUA 3FD8A 4PHCA 5TLSA 2V7EA 2ZVQX 5AW7A 4KTTE 4IINA 4EARA 3ZJ4A 1FB5A 4IIFA 1GV0A 2VP9A 2X9VA 4HYTA 4PZPA 4H3SA 4BASA 1ENPA 2G63A 5BWLA 1Y89A 4GI3A 2QYOA 3HYTA 3WLIA 1LB1B 1R0SA 3QIVA 2D5LA 2EL9A 2ZR7A 2VHWA 3ORQA 4N0QA 5A3SA 3ZXYA 4TV9B 3IMFA 1CLEA 4PICA 4S1VA 3THRA 2ZUSA 4ZV4A 3HJFA 1P4JA 3G82C 3L05A 2TMYA 3RFTA 3LP5A 3LT0A 3PXCX 3MBKA 1QXSA 2A30A 3W04A 2XSZA 1MZPA 2Y0PA 5ES3A 4IDOA 5CLQA 2P5SA 2H2WA 1Y1QA 4Q12A 4OHOA 2IU3A 4TL7A 2OCPA 3M9WA 4J7AA 4JR0A 5JWRA 3ZGXA 1A8PA 1YKGA 3DNPA 5JEDA 4ENTA 1KY2A 4HXGA 4B17A 3SF8B 1PEKE 3TINA 1SVMA 2V98A 3T3GA 1JIQA 1U9YA 1WPRA 3BUSA 3HDHA 4M9RA 3B1ZA 3ROTA 3SNKA 4EHLA 4RVNA 2I3BA 4WXRA 1JG6A 3DE6X 4Z0HO 4DJDC 1BFUA 1RBZA 2GH1A 2NZ8A 2P78A 2B5VA 2OLJA 1BFDA 5EIHA 3ZVLA 4C4SA 1UMCB 3O8DA 3I6QA 1IVNA 4JQCA 4NECA 4ZO6A 1L5YA 5AVKA 3ZQJA 5ER9A 5I9SA 1FQOA 5EJFA 1PZGA 3NTVA 3Q4GA 5DKFA 2L2QA 5DXAA 2VSQA 1E2HA 1BD3A 4MRNA 1MOSA 1N2BA 1QDEA 1XZ8A 4EGCB 5BV7A 5IH7A 3PX7A 4FFSA 2ZR0A 3KUCA 4EY7A 1SXQA 4TMFA 3TH5A 4HRVA 4Z53A 1FSFA 4LSWA 1QZZA 2HT6A 4NF2A 4UZSA 5FF9A 3IOCA 1EA5A 1NXQA 1TQ8A 2Q27A 2P69A 4IIGA 4YACA 5HE8A 3ZWPA 3LVRE 2EQAA 1QH1B 3H2BA 1XZCA 3AFNA 4CVNA 2VYNA 3JWJA 4GE0A 4FCCA 1C8VB 3EX7C 1LDYA 1KDOA 4BVLA 3SS7X 1DEAA 1AK1A 1Z4KA 4JL5A 4W1PA 3ZS9A 1JQ3A 5BUZA 1ABFA 1V5EA 2GCOA 2QZ4A 2RHDA 3BZBA 3G9UA 4GSYA 4TL8A 4XLTA 1BKSB 1U3UA 1ODJA 2AQHA 4J8PA 3THYB 4FKBA 4M8NE 3AKCA 2W2XA 4QICA 2BGKA 5LIPA 5CCEA 3RS2A 3PWSA 1NN3A 1T9CA 1QVZA 1L4FA 5F7XA 2HRDA 4MV3A 2DCUA 3TXYA 4G5YA 3KFXA 3PGJA 2J9XB 3FDJA 3W3ZB 5H5JA 4BMYA 4CR6A 1KO4A 1WJGA 3MINB 3N8HA 4DMMA 3SVZA 4BP3A 2GDJA 1YSCA 4DLYA 4LTNA 1F0PA 1XMIA 1RLOA 1QGED 1F2UA 2VYQA 1R3UA 4RK6A 5IZ4A 1QGAA 4JLVA 4Q0MA 4EX7A 1BC5A 5DHAA 2R2GA 2O5RA 1ZD4A 1E0AA 4C87A 1E8NA 5JQGB 3X1ZA 4CV1A 3A4IA 1JG1A 2PL1A 1OXKB 2ZIGA 3G5LA 2BOVA 1MN6A 2SCUB 1DBPA 1UK7A 1DOZA 1GGEA 3U60B 4WGGA 2B1JA 3IESA 2VEDA 1K7YA 3V1YA 1EUZA 1BX1A 4FU0A 3U40A 1KFBB 1N3YA 2CY0A 1ZJ4A 2NM0A 3A6HA 3Q9UA 3HABA 2FE4A 1NYTA 3OLXA 4HOYA 4J76A 3WE7A 3GLGB 4M0KA 1NDQA 1KRHA 2CLHB 4MI3A 4XFJA 3SJBA 4KQKA 4W9NC 3C3YA 3CNQS 4Y9RA 2ESRA 3H5NA 2VDOB 1VC2A 2WZQA 3OFND 4LNAA 1XJWA 2XQKA 1KEUA 1AM4D 4Q3EA 3KQWA 2IEZA 3OCXA 3Q7EA 2ECKA 3ZVRA 1R27A 3SEFA 4UFOA 3H87A 3S2IA 3GLGE 3WKEA 4AJ9A 4FYWA 1CD5A 3T9AA 4HDNB 4DQXA 5GVRA 3Q7IA 4QTYA 2MWMA 1C14A 4E5PA 2PMCA 5DDIP 2POCA 4G4SO 4MRMB 2ZE5A 2X1VA 3B85A 4KWIA 2O2DA 4WERA 1ZA2A 1WP4A 2OZPA 4IQ0A 1ONOA 3MT7A 1Q5PA 2P0EA 5AI0A 3ZD9A 4EO9A 1LX6A 3OCYA 5CJPA 1DQSA 4MWCA 3ZXXA 2QVGA 2V8BA 4IMJB 1V11A 3OZTA 4BWYA 3FCCA 4HQ0A 3O2SB 1T0UA 3H2YA 2VPWA 5DB4A 3HM9A 4AC9A 1S4QA 4OQDA 5LA6A 4ZZ3A 1T1GA 3WICA 3WGNA 3SJAA 4BX9A 2ZEJA 4YLYA 2I3DA 2EC5A 2P6RA 1P5JA 4OQYA 1XCGB 4C78A 2R8EA 3H13A 3QOYA 4MOWA 2I2DA 3BIJA 3G79A 2ILTA 3WYGA 4BRWA 5BN3B 4MVYA 1SXJD 4C0WA 3TX2A 5ECWA 2I6QA 1EA7A 3LIIA 3R5TA 1XWFA 1ISPA 5JE8A 1A50B 3SAJA 3WR5A 1O94C 4GKJB 2VRNA 2NSJA 3QPBA 2YCLA 5E0KB 3BM5A 5K99A 2P8JA 3AL3A 2ZT7A 4MUEA 2R5WA 5GIPE 3QBTA 3HDGA 1IOLA 2DQZA 2Z5GA 4A8JA 4KPEC 3I9NA 2PN1A 2VUIB 4R81A 3RRMA 3B9QA 3ONEA 3VR3A 1GN9A 2W6PA 4HYQA 2HNBA 1Z5GA 1TVEA 3EW7A 4BMNA 1C0KA 2Z2JA 2WSSD 4EABA 4IBOA 5G3ZA 4GI1A 5JU6A 3AIMA 4P0PB 4DCNA 1C3LA 1VMEA 4ZK6A 1KETA 4JLDA 2ECPA 1US8B 1XU4A 3JD2A 1WCYA 4I0WB 4LHWA 1L6RA 3OQNA 1GQOA 3Q1LA 4M9ZA 3BGVA 5D51S 1JECA 3MLAA 4UNIA 5EIWA 2FWIA 1XTSA 1OBFO 3ICCA 1YZGA 1XE3A 2CNOA 3AFMA 3ITEA 2BEWA 4DC0A 3PKIA 3B78A 1TJNA 4MQEA 2EYQA 1IG3A 1W73A 2GNOA 3GOHA 4ZU6X 2YVKA 1W2GA 1ESCA 1E3JA 2FRDC 1MGPA 1QCZA 4FN5A 2X2EA 5HKLA 2A6PA 4I4NA 4UAGA 5HF9A 1TADA 2A94A 3LK7A 2ZQYA 2J85A 2OQIA 2V5AA 2IA5A 2W98A 1KVUA 1FDIA 1IOWA 3E9ZA 2P5TB 5EXEA 3GVIA 5A9RA 5DASA 4NSNA 1ACMA 3EGDB 3CGGA 5JECA 3BD6A 3EPPA 2FMHA 5THQA 1J49A 4KR0A 3EUFA 1L2TA 1K6JA 3VRHA 1RWKA 4EY3A 4P4UA 3JD0A 2YV2A 2WZCA 3LTEA 1KIFA 4A26A 2ZB2A 4Q9DA 2WKWA 4EPVA 5AUQA 1T0PA 1F3LA 1BJKA 2DY0A 2XCIA 5I7SA 1P4GA 3LO8A 3P9IA 1NW3A 5HF8A 4NMMA 1LLDA 2GT1A 1T5DX 3TWOA 2WIDA 2RGXA 3X1XA 2CXTA 4QJIA 1A4XA 3NNNA 4DTIA 1Z4MA 3P9KA 4CYMA 4FSDA 1AQNA 2AB0A 2R84A 5DT9A 2C7BA 3E5NA 4NOLA 3UUFA 3UWMA 2ZETA 1GT6A 3V5NA 1XJQA 2NO7A 3EA0A 1JXAA 1MIHA 3VGPA 1U8AA 2B61A 5A1TA 4LZZA 5FBKA 5JAHA 3KE8A 3KLOA 2LCFA 4HWPA 5A2QA 4BVHA 7REQB 4CLEA 1U9JA 5PNTA 1AK9A 5BSVA 1IHYA 4NCXA 2X5OA 1I6LA 3GCDA 4MGIR 3LPDA 4RY9A 3T4PA 4CR7A 3V1TC 5B5SA 1ID8A 2I54A 3NHUA 1G8PA 1WNTA 2GETA 5FORA 4ACAA 1KP2A 3HEBA 2BELA 5FPQA 5EIXA 2ZYDA 3WX0A 1SUIA 3QMPA 3DC2A 1HLPA 1GAXA 5DM2A 1P39A 2B78A 4O25A 2C29D 3PNLA 1T4CB 3RSOA 2JKVA 3QHAA 4JB0A 1FSPA 2FN8A 2Y0CA 4DDHA 1VOTA 2WHRA 3M1AA 2I62A 3II6X 3AF4A 4V24A 4IY1A 2ANBA 2YY7A 1RS0A 4OUDB 4R0VA 4I46A 4EUSA 4DCSA 1F8YA 1B26A 1V8PA 1YUMA 3C16C 3TTUA 5ICSA 3NEAA 2R6FA 1HG1A 1VECA 2VEOA 1JG3A 1FRZA 2VXCA 4CKEB 1WLSA 2G9QA 4GMGA 3K6SA 1GFZA 1R9JA 2IZ5A 3QX7A 1WDMA 2NQ2C 4MLPA 4EH1A 3JR3A 1UEJA 3ZWVA 1G6OA 1OAKA 4Z4FA 1WPXA 4A8HA 1P17A 3CG0A 3AEYA 3ONFA 4M8SA 1SCUA 2ZI7A 3NZEA 3ZGNA 2PJZA 4NFSA 4TLCA 3D5EA 1PS9A 3RIYA 3TZBA 1T5IA 3SHVA 5HCUA 4LJRA 3LOPA 2QM3A 3U4AA 2C4UA 4RZIA 2X13A 1JIKA 1P4RA 1USIA 3OE4A 2P4EA 3P4YA 4RZXA 1ZRMA 1A9SA 1P0IA 2IXDA 3PVCA 1QK3A 4H9GA 3FLBA 1FX1A 4CIAA 1PQYA 4QGGA 1ABBA 1IBLB 3QE9Y 1PFQA 4RGBA 2Q62A 2FWRA 1PYDA 3NJRA 1TUBB 2HDWA 2C59A 3BSYA 3QLVA 4GG1A 4OJYA 2P5UA 5AI6A 1K5HA 4ZEVA 1WZ2A 1R4MB 5F5LA 1KMCA 1HDCA 2AHRA 4TLMB 2ZI5A 4LN1A 3O26A 2FMTA 5AXCA 3OU6A 4G07A 1DIBA 4Q24A 4YV2A 3IQXA 2FSSA 2P35A 4HHEA 1XWWA 4HDSB 3AEQA 1P1IA 2B6HA 1A9XA 1T15A 4M9QA 2ID8A 1K68A 1XKLA 3IP8A 2J5QA 4LK3A 5HZHA 3CF6R 3OZWA 3AF5A 4BMXA 4YJ3F 2EHDA 1WNFA 5GM2A 2HX1A 1NPYA 3EULA 3L0BA 4FJ2A 2KBFA 2LWIA 2PGXA 4YFYA 4JLJA 1DAGA 5SZKB 4LFBB 3VPHA 4HN2A 2OT3B 2P2CA 4DJTA 1H9AA 4JVSB 4RA9A 1PR4A 1D2RA 3IP7A 2E48A 3CR3C 3R3HA 4J2HA 4L07A 4QPDA 4O2AB 3ZE8A 4D8YA 4GVLA 4NXMB 1NVVR 4RKWA 1E4EB 4R9UC 1J5PA 3EEIA 3UICA 4XQCA 1SXJE 2JGJA 3LHDA 3GVXA 2FSHA 1MA0A 3NO4A 3MPOA 4UEWA 3LM8A 1GO2A 1NV9A 2QPAA 4K46A 4KUEA 4NZZA 1AG9A 1G0NA 4OH1A 2NAPA 4RJKA 2H08A 3BWEA 4G41A 1YFJA 5E6RA 2X2OA 3SZRA 1QYXA 3LT2A 3H9GA 3P9SA 4RLFA 3ZDZB 2SBTA 3EH2A 4DAOA 3FZYA 2PMKA 3VVCA 1Y9AA 4BLUA 4G4JA 3TZQA 3AGQA