3UB3A

D96n variant of tir domain of mal/tirap
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
125
Chain Sequence
SSRWSKDYDVCVCHSEENLVAAQDLVSYLEGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into TIR Domain Specificity of the Bridging Adaptor Mal in TLR4 Signaling
pubmed doi rcsb
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
molecule tags Immune system
source organism Homo sapiens
total genus 41
structure length 125
sequence length 143
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3ub3A00
4C6TA 4LZPA 1T3GA 1FYWA 2M1XA 4C6RA 2Y92A 3UB2A 4LQCA 4FZ5A 4OM7A 5KU7A 2Z5VA 4W8GA 4C6TB 4W8HA 3UB3A 1O77A 4C7MA 3UB4A 3JRNA 2J67A 1FYXA 5FORA 4C6SA 2JS7A 3OZIA 4DOMA 4EO7A 5H3CA 3H16A 1FYVA 4LQDA
chains in the Genus database with same CATH superfamily
1C7RA 2R1TB 3X1ZA 3IURA 4ND5A 2IHBA 4UULA 2WC1A 5LMUB 3ZEIA 4TWZA 3T7TA 5F3WB 2JLRA 4TLEA 3E3OA 3W6UA 1G291 3K2EA 1TM1E 1VIDA 3HP1A 3PD7A 1EMDA 5K8UA 1JL3A 1N8TA 4AROA 3TJMA 3RKRA 3EDYA 3UJHA 3GRUA 1W25A 1X42A 3VVMA 4A1FA 1JEAA 4ZVTA 5IANA 4I9FA 4G25A 1EX7A 1QP0A 3C0KA 2CF6A 3LUPA 3GBPA 3D1VA 5AH0A 2HWYA 1UC4B 2QG6A 1L7NA 3Q5EA 5AI4A 1W4LA 4X91A 2GZRA 4BV8A 3AUJB 3TH5A 2FJUA 4DUPA 5JYBA 4G9BA 5DTEA 3AK4A 1YH3A 4V0ME 5DWQA 4M22A 3SP1A 1UANA 3N6RA 3TQSA 1NFQA 3ZGLA 5AI5A 3CNHA 2EX4A 5GZ6A 2IT1A 1QK5A 4HQOA 3EIEA 3UB2A 4E2ZA 2Q1SA 5AFSA 5A9SA 4MULA 4BX9A 2V9PA 3GUYA 4MW1A 1GUDA 3FCSB 5F5LA 3ADCA 1AHIA 1JYSA 4TVKA 5IKMA 1U2GA 4XWOA 2BBOA 4W82A 4RFVA 4YPOA 3LMKA 2HJGA 3SQOA 3NBMA 4GWGA 1EVLA 1T3LA 1I24A 3IUMA 2VP2A 2WVHA 2D8AA 3FPLA 3IMKA 3MILA 3WQSB 4DSOA 2ZQZA 1KWKA 4F96A 1CUUA 2OXCA 1A1VA 3ZVNA 1USIA 3EZ2A 1XJ5A 2AI3A 2HM7A 3KDPA 5ALRA 4WDRA 4D92A 4XTRA 6PFKA 4PR0A 5JECA 1FLVA 3G9TA 3OLCX 3SZMA 3I2GA 2C1ZA 1WQ4A 1YAHA 5CFNA 1O94C 1R0RE 3GAZA 3WMWA 1B4DA 4TQ9A 2ZZMA 1E6MA 1IPHA 3NIDB 5HS4A 5FF9A 4MQLA 2JASA 4H7KA 4TMWA 4LNAA 4B76A 3G1UA 5CFPA 1HT2E 3CMMA 2EGGA 3ANXA 3A2NA 1GKLA 2CWWA 1N1DA 3A7DA 4GI3A 4LI0A 3OZGA 4EHIA 2P6PA 3H04A 2WTEA 4XSVA 1VDZA 4WXPA 3AEUB 2D1SA 3L8CA 4MV9A 1ISJA 1BGXT 1K88A 3HYCA 5D5HA 2JGRA 1NOJA 1JNXX 3Q9LA 4MR7A 4PQYA 2AD1A 4F9EA 4P0PB 3PL5A 2VYVA 3GLIE 2Q2NA 1JG6A 2A4MA 2O2CA 2DQKA 2FPOA 5D6NA 4TN5A 3R0XA 3EF1A 2CV1A 1J1ZA 2JGKA 1XU9A 4AY6A 2DQYA 2XDWA 3H0EA 4GP9A 1G17A 5BNIA 4EATA 3OZSA 5HE9A 1FNBA 4G5SA 1NLYA 3L8FA 1AQ6A 4ESVA 2HYDA 2GF0A 3A9CA 1I2DA 1B2LA 2G70A 3SYTA 2KE5A 3V1TC 4EW6A 3E3LA 1FPMA 1X15A 3CLKA 4GSLA 3VPDA 5JEEA 3KQTA 3BIWA 2RK6A 3C41J 2VTDA 3FW1A 5DGCA 4YCLA 2IH2A 3UJCA 2G4CA 4LF6B 2PZMA 3LW8A 1BKSB 1G7TA 4M88A 5COQA 1TVCA 5FBHA 5KKAA 3NVAA 5LP6C 3TUJC 1HFEL 4F9TA 1P1JA 2PE5A 1DXYA 2IDJA 3E8SA 3PXGA 2ZR0A 5DIFA 3ZGOA 3W4JA 3KZMA 5ALPA 1KDVA 4G6ZA 3WBKA 1QIKA 1R6VA 2BM9A 2AOTA 4L5BA 1DWUA 1WW2A 3N2KA 4J1QA 3OETA 5I48A 1Y0BA 2IZ5A 5INTA 2P1ZA 2PWYA 3AILA 5TIIA 2WE8A 2DTXA 1UBOS 3ZIAA 1FNNA 3M89A 1U6KA 4LA4A 2NV2B 2XAAA 1HFJA 2ORIA 2ZRCA 4D3FA 3QEAZ 5F9HA 1Q0LA 1JSCA 1WCIA 2QA5A 4MV6A 4KE9A 5EIXA 3T41A 3OCJA 2PQ0A 1HTBA 4J0JA 3K4HA 5A7FA 4QQKA 2OC4A 1J8MF 1W0CA 3EW7A 3G2JA 4K03A 2PLNA 3F4KA 1RHKA 2AN3A 3BG5A 1ILWA 5JC1A 3T5BA 1T36B 4INPA 4MB0A 3ON5A 5DLDA 4HH3C 5DSXA 4IIUA 3VISA 2QLTA 2B83A 3JD4A 3H97A 3Q15C 3GLUA 2D4AA 4QWWA 1U8TA 1FRQA 1H94A 4TL8A 4RD2A 2VYNA 1VRCA 4FW8A 4KXWA 4NENB 5GJCA 1NX6A 4LG1A 4U2DA 3RH0A 3WWCA 2YXBA 3VSDA 4DLZA 5B7NA 4EJ6A 1D0SA 2QAIA 3H11A 1G4AE 3KSZO 5DHTA 5TF0A 5IF9A 3BDIA 1Z5UA 4UU8A 3UMYA 1Q74A 3AEKA 3O93A 2PJDA 4Y6QA 1P0CA 5D1HA 3G0CA 4XH9B 4L9SA 1M7BA 1Z38A 3UT5B 4O8ZA 4JS0A 5EIEA 4DR3B 4D79A 4ZARA 3OIUA 3D4PA 3WLLA 2FAXA 5BW5A 5H83A 5L95A 2DWCA 2IF0A 2Z8XA 3PDUA 4V0RA 5EWJB 2I1WA 1VM6A 4FCCA 3RKSA 4TWBA 2A5FA 3JD0A 1F6DA 1KDRA 2JFYA 5DCUA 1VL0A 3O4FA 4QJ5A 4NFLA 4Z1MA 1PWYE 4NI5A 3C7TA 1V9CA 4MGIR 4XPIB 2I4IA 5DH9A 4IIBA 2XRFA 1POWA 3IDSA 4Q4DA 1COWD 5EP4A 1KO4A 1PGQA 3ENQA 2LR0A 5M04A 5HJ5A 1PWZA 5K3FA 5HG0A 3HE3A 2BGWA 2C5GA 3M49A 1M6EX 4A8JC 4L8GA 4JQOA 4GPZA 1EESA 2ISSD 4FYKA 2WIGA 2CE2X 3OIVA 4JYZA 2CLEB 4M0MA 1UBJS 4P4NA 1FZQA 3THWB 4RXMA 3ETHA 2P6UA 4ZHQF 3VMMA 2GZDA 3MCZA 4XCQA 4E15A 2V7WA 4BMNA 4OHOA 5JDIC 1N2IA 4DFDA 2FSGA 1N6NA 3SPXA 5FUXA 1W4ZA 1ZCAA 1DXQA 1Y3BE 1JT2A 2JNWA 3KT8A 4UUMA 5LQRA 2O8CB 3NYRA 5FD8A 3W34A 3MWEB 1MD9A 1T1RA 1W5TA 4Q7JB 4YAJA 3TSAA 4NPCA 3D8HA 4MW5A 1NBME 5KSPA 5LP6B 3IMFA 2FP4B 5CA1B 1YS6A 1CJTC 1PSWA 3H5OA 4M36A 4RH1A 1PHRA 5CVVA 4TYNA 3JU3A 1P4HA 1N1MA 2O4UX 4YPFA 1V3TA 2FZLA 1NVBA 2C88A 2ZI7A 3A7EA 1YRBA 4BNFA 1T2CA 4LJYA 3PFFA 3C85A 1OHHD 1L5MA 5REQA 5J4KA 1IJBA 2JANA 3GAFA 3OFNA 4OJYA 3UG7A 4BYMA 3L2OB 1BMFD 4LRWA 1S2NA 5EHNA 3O0DA 1ILEA 2A9FA 4V38A 5FTKA 4WH0A 5HIJA 2HCBA 2C3YA 1UUFA 3JQAD 5CA0B 5GM1A 1U4OA 3QVVA 3H2IA 1SC1A 1GSOA 3ESBA 4CM1A 4CG2A 4TTJA 2ZBFA 1C81A 1SVIA 2RDMA 4IFTA 4HNRA 1VIVA 4L3WA 5JCOA 2BGIA 3K6SA 4RETA 3NHUA 4LYFA 3DKPA 2D3WA 4WCFC 3DLAA 4U2FA 2VUIB 1BCSA 1SUWA 3EMVA 2OCLA 4GG1A 1G2IA 4INZA 4HXFB 5GOZA 4TS9A 4AJ9A 3BN3A 2QI9C 4Q4AA 4R1SA 2W70A 1XEWX 3A4IA 2GCNA 3UF0A 2QRJA 1LQUA 1PTJA 3R7SA 3H9BA 5BSHA 3BE8A 4P7KA 5D3MB 4B7ZA 4B6JA 3GJXC 4XARA 3WKCA 2MSLA 3SF8B 1CZUA 1Z4LA 3AKZA 2BEVB 2R2AA 1KFKB 2ADMA 3EPRA 3KCNA 1Q92A 2XYGA 5KAPA 1JT9A 2G0AA 3LAWA 3HPRA 4H3HB 4RXUA 5EA2A 5HDQA 5IAJA 5TPWB 4D4GA 3UHFA 4FFPA 1M5RA 1NBMD 2CJWA 2REQB 5D86A 1UXKA 3AC0A 4EFLA 1R37A 2QIPA 1N2BA 2FPWA 2FX5A 3LYUA 2Y0BA 5FTNA 4EY5A 3WIDA 4A0QA 2WB4A 2BFPA 2UKDA 1VBKA 5DM2A 2F1JA 3L02A 3K4QA 1LPAB 4N0PA 3W5IA 1DEKA 1OBCA 4NARA 3KFLA 1UXJA 2NVUB 4PAQA 4CV3A 1AHNA 4HVAA 1RJGA 2EEZA 3BD9A 4BKMA 4BP8A 1U0BB 1CUXA 3K2BA 2EHJA 3MT0A 3PITA 4M7PA 1K7FB 1MVOA 4A8JB 2Z2IA 5JPIA 5ICSA 2BHLA 5A1JA 4WV3A 4NXNB 4BYGA 3ZNOA 4UAVA 5JH7B 1Z07A 3ZLJA 4EUFA 1KI1A 2FQ1A 1YHNA 3CHYA 1WUIS 3I5MA 2OV2A 1OLXA 2C82A 4D4IA 5ITVA 3CBQA 4EJSB 8GPBA 5IDQA 1L7MA 3L0YA 2FGKA 4Q7QA 4JJ6A 1ZZEA 1SBQA 4MUIA 1CQJA 3DYVA 1LSJA 1BSVA 1KAQA 1Z5VA 1TVKA 2X3UA 4MIYA 4N9QA 1PR6A 3B6ZA 5E95A 5G02A 4IVRA 4C0BA 3MXOA 1MH9A 3HRIA 2OMKA 3SWWA 5H9VA 4FCVA 3HB1A 2RH4A 3P2MA 1F14A 3BM5A 5E3JA 2JLSA 5CCBA 1HRDA 1U04A 1ZCFA 1A9QA 3PEFA 3T38A 2BGJA 5IPFA 3LRXA 4AN1A 4OY3A 4PFJA 4UATA 4HOYA 4D9GA 2F3UA 3CSDA 1CY8A 1U3GA 4WMLA 2II6A 5GADl 1JNYA 1GR0A 1Z4IA 1KO1A 3G1TA 4LJ4A 5JRZA 3N9IA 3O8BA 3H3FA 4XSGA 5DM4A 1H65A 4O4LF 5DJ5A 4CM5A 3DAYA 2WA2A 3HKDA 2F55A 3WV5A 2H29A 3B3GA 2ETVA 1JW9B 4K81B 3BMOB 1XNQB 4HGYA 5EUCA 1EWRA 3D02A 2FG7C 3D31A 1Y3CE 1AE1A 2ORWA 4X8MA 2VAMA 3D6JA 3QF4B 3WIEA 1J99A 1MPTA 1SOMA 3T6KA 2Z3ZA 3E3AA 5J5VA 4A6PA 4B43A 2QTBA 5JNWA 1Q5PA 1RP1A 3KR9A 4R9UC 3DPUA 1UADA 3H7AA 4FIDA 3DT8A 4HMQA 1CY0A 5HGXA 1MQ8B 3TKYA 1T2EA 2VHZA 1CUCA 1VJ1A 4JLPA 4NJEA 4ALNA 4BEBA 4E2WA 3EDMA 4FMDF 3FFTA 4H7FA 3ND7A 4JHLA 3S8EA 3QX9A 5I7EA 1WXDA 4BMCA 2RBKA 2FWJA 3D54D 1USVA 3RVJA 1CZLA 1RMTA 4BPRA 3E35A 3IELA 5LWQA 1DWPA 2HPZA 4R5MA 4QYIB 4KDFA 4J8PA 5DHFA 4PLYA 1BS9A 2G8LA 2Z04A 3HKCB 4PGMA 2FHSA 4L50A 3G9ZA 3ITDA 4OTZA 1KIMA 3M5CA 1FW8A 2Q4TA 4PPNA 1X3LA 4YRCA 4Z8XA 4DDHA 3DCJA 5JAHA 1V95A 3GRKA 5DZSA 3KT3A 2Y1DA 2LBPA 3VX4A 3IUBA 2JD2A 1RPJA 3C3MA 3R0IA 2QZ9A 3EB9A 3ODPA 3PENA 2H11A 3HUTA 2EP7A 2Q3FA 2WKSA 4EG4A 1FFCA 1VG0B 4LQ4A 1G5FA 3M6VA 4HWRA 4MEJA 1FS6A 4DILA 1P31A 1FB5A 1PFVA 1SUCA 2G17A 2R84A 3NUQA 4KQKA 1W6UA 4DIUA 4E21A 5HZGA 3IPRA 4PSUA 4C2BA 2V1UA 3NAZA 3EGCA 4E14A 4LDZA 3TL2A 3N8IA 3ZTWA 2H1SA 3AUKA 4A5OA 2C99A 3ET4A 1F6WA 1I4EB 5B4TA 3NVDA 4DBLC 1L5FA 4A2QA 1JI0A 4WW0A 4LZPA 4OFZA 5LQSA 3R7FA 1OU4A 1GCGA 2X8LA 2RBGA 2UXCB 3E1KA 2JARA 4LRYA 2CUZA 1WB4A 4PHTA 1JR4A 3MRVA 5E8RA 3ORRA 5AVUA 1SM4A 1ZVKA 1YGPA 4MKIA 1TCVA 2ZSFA 2IEBA 3ESRA 3GUVA 5K0NA 4AXBA 3SG0A 2WM8A 2BBTA 2ERXA 2OHJA 3DMGA 4UBNA 3O8OB 4JSTA 3ZE9A 1UPUA 3GJYA 5T6MA 1KFBB 2Q1TA 1LXCA 3QPDA 5BWCA 3JYLA 1NMQA 3ED5A 3PC4A 3S8YA 2WIAA 1PHPA 1KDOA 3QLUA 2IYOA 4MWOA 1CEEA 2O2DA 2RJ3A 5K8LA 4CVNA 2BFBB 1ZY2A 3KSRA 3T7KA 4FZJA 3KTDA 3VYVA 1Q0SA 3EVFA 3H87A 1NUPA 4HWKA 5BNTA 5KVSA 4F60A 4QXOA 5E9AA 3T1QA 3LQ2A 1J39A 2QMYA 2W6ZA 2WSYB 2ZSHA 3B6MA 3M1AA 3OQ6A 4HD8A 2X5KO 3TZCA 2O19A 3T52A 3P5SA 4ZQIA 4TMTA 2YWJA 4Q93A 2GAJA 4D3XA 3PUVA 1DTSA 1NYTA 2PGAA 4E0BA 3RK1A 4DLKA 4WVLA 5C8XA 4PNPA 3A11A 5DRYA 3UWPA 2XPCA 3N0TA 2IZ6A 5JI3E 3GNLA 4PWYA 2BDEA 3CVOA 5K5EA 1OWLA 3ZDRA 1PX2A 2XCQA 4O4JA 4YVFA 2Z56A 5EP2A 2YN2A 4XW2A 4GRAA 5EGNA 1YR1A 2R6DA 1D1PA 2XKBA 3CWCA 4QU8A 3I04A 3NVKI 2QW8A 3MF4A 2W8ZA 2I8LA 1V1RA 2ZUWA 3LFHA 4KU4A 3FTCA 1EK6A 1MAWA 3CIOA 4Z9AA 3KD2A 1V4NA 1ONOA 4MQ6A 3I1JA 3R20A 3AF2A 3ZD7A 2BM0A 3ETDA 3N8HA 3WX0A 4A6EA 4C04A 4BNLA 3REGA 1P1FA 1WZCA 3E7FA 3K8OE 1RYBA 2XUOA 4TGLA 1W88B 4ZZ0A 2A4KA 5JYEA 1UBCA 2G36A 3T0FA 2DM6A 4JH0A 3ZBUA 2GPTA 2NU7B 4WACA 4EI7A 3AUAA 5D6OA 3V1MA 3W3ZB 1CR1A 2DFDA 3SZGA 4LOJA 1KZ6A 1T3ZA 5FAKA 3B20A 4RA6A 1AC5A 3LC2O 1N0WA 2PO5A 2AI1A 3ABRB 2B4YA 3F0TA 3FUVA 4OGKA 3JATB 2O4CA 1IEQA 1UJCA 4B32A 2NWQA 5A03A 1ZIXA 3LC1O 1LDNA 3W6PA 4QM6A 2OLJA 2WWIA 3GD5A 5EINA 3H2GA 4RDXA 4JT8A 5CEJA 3ZDYB 1IJKA 2NLOA 3LGAA 4BVAA 2VTBA 1AS3A 4XQCA 4GKJB 3CKYA 2XXJA 3EZNA 4UE2A 3ZUGA 5M7EA 1C0LA 3EOAI 3DBHA 3OBIA 3B89A 3IP7A 1PO7A 4CEHB 1YUBA 5EMHA 1A96A 1YB5A 3DGFC 4U4AA 3HBNA 1JKXA 1L5VA 3MPOA 3BMQA 3Q0IA 2V0GA 2BKEA 1EJ2A 5KTOA 2Q8PA 1XD2B 2IIVA 2X1VA 1U2QA 2XMSA 1MFZA 3Q8WA 4QEKA 4QBGB 3SJUA 4J9UE 1U3TA 2UVPA 2Z9BA 4HFRA 4KRXA 1AV7A 5EIBD 1CZNA 5EJEA 3SSOA 4D9KA 2YV1A 1GYQA 1G20E 3K30A 2PRZA 2B0JA 4FD2A 1FXSA 1H0RA 4XWWA 2XA9A 4NQRA 3Q1KA 1G19A 2WZDA 5JJIA 1KNXA 4H16A 4HADA 1IULA 4KV9A 2Z2ZA 2NU8A 4Y1GA 5C51B 2C2KA 4B71A 4KP7A 4OHFA 4IS3A 1UDRA 2D06A 2V7QA 3DE5X 1DPFA 1PK9A 3HGQA 3I39X 5CXSA 4QGSA 1WKVA 3LVFO 2IIQA 2JI9A 2Y1EA 4JSYA 5BOSA 4OD0A 1D2RA 4FTWA 3RUIA 2J9FB 5DDIP 4D8WA 3U0VA 1IM8A 1VHJA 4RK6A 4Y2VA 4AO8A 4PNEA 3IJ5A 1HR0B 2Q99A 1Q7RA 1P9OA 2JFQA 1OPXA 4EG7A 1YACA 3UK1A 3GUCA 2WU3A 2FE4A 2GA9A 2IHKA 4OP1A 4DMKA 2DR0A 3Q11A 4MVJG 4NECA 2X0DA 1AN9A 4BKUA 5AO9A 4YUVA 3OWOA 4PBTA 3HACA 1L1EA 3DMFA 1Z8FA 4PU0A 1Y8QB 1OT5A 3JWEA 4CM3A 2OOKA 2RSLA 5IS2A 2I33A 3WLSA 3ZCSA 2NZ2A 4MITA 3LA8A 2ACWA 1BWQA 4EVSA 1R3DA 3ROZA 1QKIA 4I4CA 4RJKA 1CR6A 1SBTA 5CT6A 4GX2A 1Z4QA 5FX2A 3AF3A 2OQVA 2CK3A 4C7VA 5JAUA 1RIIA 4EX7A 2CVOA 2QD4A 3FX2A 2ZRLA 4YI3A 1ULSA 3LPAA 1QGED 1Z6AA 3SEQA 1HE1C 3IP9A 5GJVC 4JP2A 5H3LA 4IINA 2NSHA 3RFFA 4QICA 5C18A 3NDJA 5B2EA 3V4PB 3R3ZA 1CUSA 2F90A 3LFTA 1P7VA 2O5CA 2ZYUX 2X0IA 1DJNA 4KAFA 2VDRB 4RIFA 2M32A 3SEFA 2HW8A 1Z5ZA 4A36A 1N5KA 1RXCA 2PGDA 1DGQA 1UWCA 1R1DA 3C2QA 4D4KA 2X5JO 5I9NA 5KOJA 3AESB 3L0OA 2CMKA 3MTJA 2J3HA 2WHEA 4MUJA 3THSA 1KQPA 3QOFA 3PNSA 4YUWA 4C0JA 1V6CA 1RYMA 4RVOA 5HF5A 4MYUA 3N2GB 1NSYA 4QQFA 1ZRNA 4UM7A 5B3JA 1M2NA 1TZ2A 1IZ0A 2JFHA 2EGHA 5FLYA 1RJFA 3OHMA 3TTWA 2GFIA 5KZMB 4ZZ2A 1SK8A 1AURA 5AMXA 2JFBA 2XOKD 4ZKEA 1GG2A 4BNGA 1P6UA 4ZV4A 1RYHA 2WYWA 3FKJA 2ERYA 1BNCA 3LZ6A 2CLIB 2JIQA 3R0JA 3H1TA 3KYBA 4JOCA 4OM7A 3Q0EA 1BXZA 1JMKC 5IBCA 3ORHA 1P3JA 2GPYA 3HJGA 4DHWA 4DZTA 5J43A 4MDFA 1R0YA 1V4VA 1ZM9A 2XECA 2YVLA 3G0OA 5JNSA 1KOGA 4DQKA 3JRNA 4CKEB 2FN7A 4OCZA 3PIRA 3N53A 2IXFA 4OMFG 4XIFA 1ZRSA 5JCXA 4JU8A 1AO3A 2AFIB 3N07A 3PYLA 4H3SA 3O5AA 4N9WA 1RWNA 3VQTA 5JARA 1YL5A 2CFCA 1K0FA 1HEIA 2ASVA 2QX7A 2V7PA 3PEVA 4UHDA 2GCOA 5ANRB 1I7DA 5F35A 4M1OA 3BZBA 4HN9A 4UASA 1ONSA 2PLAA 4PO8A 3GZNB 3RRNA 2HGZA 1PKEA 2K6GA 3EIFA 3LUGA 4RESA 2XMZA 4X1KA 1C4KA 1XZ8A 4XDYA 1M1NB 2ZT5A 2J7KA 3UZUA 1BVYF 2A5LA 5K0EA 3CSSA 5FJIA 3T4PA 1JA1A 2FXIA 4DWVA 5G4KA 3GZJA 3CNOA 1GNTA 3UXEA 2MSEB 1Y42X 4FFOA 1IK4A 5EHIA 1TM5E 5DI3A 3W5JA 5EYPA 5C4GB 1E79A 1RMYA 2VDQB 2CJYA 3IUJA 3W5UA 2XQGA 2OYSA 2VLIA 4L95C 5ADWA 1ZC4A 4E5MA 1S89A 4LVOA 2PKQP 2RHDA 1C9DB 3PQFA 3H7IA 4QQRA 4MGKR 3EXFB 3KJHA 1E8MA 4E08A 3C8ZA 4O4IF 1S3IA 3ICEA 3JARA 3A6KA 4I1YA 5B55A 1PW5A 4S12A 3L6UA 4CHGA 5LOVA 2IZ1A 1WB9A 5IYZA 1RJWA 2Q5LA 2FZEA 3HA7A 1WXGA 3MELA 3H6HA 1A5BB 1NVWQ 4HY3A 4KWHA 3R8XA 4ER7A 4HPXB 3TRFA 5C7IO 2WSSD 4HAIA 1WV0A 4E1VA 1S9DA 1AH2A 1T4GA 2RJOA 1RJ9B 2QR3A 4G5XA 4LCEA 4U9UA 4BX8A 5JPDA 1BVUA 3Q7QA 2VP0A 1Z0UA 4C9BA 4PY2A 4ZGGA 1EM8A 2IEIA 4MCIA 2I29A 3KRTA 2VI5A 4BB6A 3U4IA 4O02B 2QR5A 1HGXA 3L7BA 3WOHA 4X54A 1RLMA 2N75A 1J2EA 4B3FX 3H16A 4NZMA 1WOMA 1VPWA 5FOUA 1KMQA 1CBUA 3OICA 3ED1A 5F2NA 1LPNA 2IIBA 1QX4A 1VLVA 2BF4A 4KJZA 4G81A 3FZYA 1LDGA 2CL6X 2R85A 2EARA 3Q7IA 3R6DA 2YASA 4HDSA 3RIMA 1KPIA 4OXQA 4EA8A 5JW6A 4OGGA 1PJRA 2HQ1A 2RH9B 3DDSA 3LPDA 4X93A 5EE9A 4MVJP 3PX7A 2RC6A 2LIPA 1P2BA 3I72A 1QF9A 4JVLA 4PZYA 1E92A 1QAMA 2ZREA 3N2YA 4MZXA 4B45A 4ENPA 1AQYA 1EDEA 4D8UA 3G0DA 4DA8A 5J4HA 2VOEA 5BSFA 3JASA 1NN3A 1SURA 2GPNA 3QQ5A 1A9PA 2DUWA 3OQ1A 4F3NA 1B1AA 4MW4A 3JYPA 2HEIA 1LI4A 4D0LB 1B8NA 1SVOA 3R3HA 3E48A 3G59A 1A50B 4HYYA 1H1DA 1NN1A 2OGSA 1GTZA 4KE7A 1AZSC 4A3SA 3ASZA 3N59A 4XPZA 2AOWA 4JYCA 2Z5VA 3NBUA 4J1TC 2A1TR 3DXXA 1XZDA 4FI3F 1Q0PA 3EC1A 3FF4A 1LCIA 5DISB 1ZH4A 1I94B 1OXXK 2KQUA 4I6GA 4L5AA 4EJSC 1KU6A 2F67A 4FHCA 3A6FA 4JLJA 1AD2A 2V5VA 1Z6GA 1M6VB 5HX7A 5IT9A 2JZNA 3OLVA 4EHHA 4HX9A 1EHYA 2I7CA 4KX3A 4YO8A 2O8DA 2G28A 3FAKA 1G8KA 2EKLA 4YAUA 3ZDQA 4LX0A 3DWGA 3IDFA 5ERGB 1XDSA 3V5NA 2LKDA 4JJAA 3KOWA 1SBCA 3PGA1 3PP8A 1MABB 4QEZA 2B1RA 2QTVB 4UCFA 5HE8A 4ZI5A 1Z08A 1NF2A 4BLWA 4ZYLA 1A77A 2J6IA 3A3NA 4UCQA 4BGIA 3R5TA 1OYYA 2HXGA 3L4BC 1LRLA 3VNRA 5DB4A 4G2TA 2C98A 3NHKA 4KO1S 1OJ7A 5D87A 4LPKA 3D0KA 2HJVA 4FFBB 3QFTA 2ZSUA 4I4TB 3ZOZA 1G5HA 1OR8A 2TRSB 1OX5A 2Q4BA 2R7LA 4Q24A 3ENKA 2PZFA 3K20A 3T99A 4AMUA 3GLIB 1C8LA 1DOHA 5FI3A 1E0JA 4L0QA 5TSDA 4AUMA 3ANMA 1U6JA 3EWIA 4LNHA 5THQA 2E5LB 4GXQA 3KQQA 4FHDA 5FWNA 4JLAA 2O5EA 3HJRA 3N8DA 5E7IA 2YFHA 3D2LA 1U8UA 1ATZA 1VCOA 2RCYA 3LA6A 1QONA 3NBQA 4LYAA 4PQEA 4WOPA 2DGDA 4YROA 5IT4A 1T8WA 1GKKA 1V8ZA 5L45A 4E22A 2WHQA 3NNSA 2AQHA 2Q9BA 4YJ3B 3K0SA 1S2IA 5JZ9A 2P68A 5J9FA 3KYCA 1EUDB 4D6XA 1JB9A 1VB5A 2Y6UA 4P53A 4KXLA 4K87A 3PSHA 4BMVA 1ZIYA 1N25A 2ZB2A 1CUDA 1YZKA 2PT6A 3K09C 4V2UA 1E3DA 3HA3A 3VNSA 3L7KA 5DYNA 4XA8A 1JQLB 2AWNA 4V2IA 4ZT7A 1E96A 4XJVA 3WMGA 2WTXA 2XEDA 2GHRA 3DDCA 4CDGA 4EBBA 4U2CA 3R9IA 1WG8A 1GQSA 5HWSA 5ALYA 2HHAA 1MG0A 1UM8A 4ZAYA 3GLRA 4E2YA 2UUAB 2P79A 4HMPA 4CL2A 1JG3A 1FYDA 5DNDA 4BKQA 3TAXA 4RY2A 3RREA 3URMA 5KTKA 1BOFA 3BRCA 1T8SA 3FH0A 3PICA 4FLMA 1Y4AE 5D7BA 2IKQA 4PAGA 5IUKC 2B3TA 3PQEA 4RIEA 3LQRA 3G8CA 4LMBA 4EF5A 3TTVA 5AD1A 1OH6A 2AR9A 2QWXA 3WB9A 2IXEA 1NHWA 4HEA1 3ZI0A 2CJFA 3BGWA 3JAWB 4C1NA 5KYYB 3I9FA 3QELA 3IA2A 3P9CA 1RU3A 3LCRA 3GJQA 3TLXA 3JV7A 2CEKA 4I6JA 2FW0A 1VL5A 2C8JA 5IUJC 3PC8A 2KJQA 5K2MA 4F3RA 1GPWB 3HUFA 2ZSEA 1NOKA 1NMSA 3B6EA 3WBJA 4L9WA 5D84A 1SKMA 2JGJA 1FFSA 4QYXA 5H59A 1YMUA 1T9DA 1X74A 2RHOA 4Z1MD 2J6CA 2H2GA 3WP0A 1UDAA 3IAUA 2VHYA 1UBKS 2AMVA 2OO3A 2I6XA 1IIRA 1X7YB 2PNFA 2ZANA 1G5PA 3AVQA 3JQBC 3G9UA 4OQNA 4OSEA 3AW9A 4LW8A 4V3CA 2AUMA 3G0HA 2WUGA 3OY7A 5JJBA 1C1HA 1DAOA 3RD5A 4DV2B 1HDRA 2REBA 3IJEB 2Q7OE 4R05A 1YRLA 3NMUF 2PAFA 1R64A 3SI7A 3V1YA 4OGWA 3ZK9A 2E1PA 2R8RA 4RLSA 3WB2A 4LXXA 3OE4A 2VWGA 2OCGA 4MV1A 5E3HA 2X3YA 2QTFA 1BX1A 3HB5X 4ZVUA 4X6YA 3PIIA 4FGWA 1PUJA 5F33A 1O9HA 2CDAA 2HC9A 1P4AA 2CXSA 4TTPA 3JQAB 4HDMA 1QYWA 5FOQA 4LJ8A 3UC5A 1AOXA 2PWZA 2VNIA 2RGGA 4BY9E 3F9RA 2IPLA 1ZIPA 1YQGA 5EZYB 1R4AA 2E9SA 5EGSA 2QL5A 3LP6A 4LJ6A 3ZWOA 3VVLA 4MP3A 2VWPA 3E9QA 1XTUA 5D51S 1I0ZA 2CNBA 4DAOA 1XROA 1ND6A 2VPTA 3C98A 3ESDA 4HJRA 4XGNA 1VRWA 3SC4A 1F1JA 1B7GO 2ZTHA 3H4TA 3N0VA 4CL3A 1VKJA 3WIVA 4B6FA 2YWRA 1K68A 2EIHA 3R09A 3B9QA 1O54A 3RKUA 4R98A 2COUA 1QV6A 5CPFA 2HRDA 1P5HA 3G17A 4RPGA 3ZWKA 4CMKA 2WWYA 1AY0A 1GPJA 5JS6A 5MGBA 5LQNA 3LIIA 2QUJA 1RADA 3CF4G 2W5UA 2G1KA 3PHBE 1JEYB 3BGOS 3KWFA 4GRDA 3JD3A 1ITZA 2VJOA 4NZNA 4Q18A 4BO4A 3EEFA 3AL0C 4UDOA 2OK7A 2QNBA 1KYIA 1P91A 4DCJA 2Y4OA 5DX1A 2CVZA 2EFGA 4WOJA 5IXYA 3I9MA 4OAPA 3HGMA 5CP8A 3ADPA 3RVQA 1M2KA 3K0FA 3A8TA 2PWAA 2I5PO 3LT0A 3QE3A 5CM9C 5CYOA 3A0RB 2ZITA 4KK3A 3LGXA 3B9RA 2X2PA 4KMMA 5BV0A 2FDRA 2VDWB 4UHEA 3T7SA 4BDTA 5D8DA 1VG8A 2A94A 1SN7A 1RRVA 2OYRA 4D3DA 3LPCA 5HMLA 2YHUA 4JYBA 4P36A 1E2GA 1ADBA 2OC9A 1OFGA 3G5AA 1BDBA 4KIWA 3KB6A 1L1FA 3ZVRA 1GTVA 1NNLA 5AYVA 1LWNA 1SJ9A 3KUXA 1YQ9A 3RBXA 1VJ0A 4HZGA 4A92A 4CKBB 5FA8A 3RQSA 4GXTA 4PSCA 4WEQA 4F3YA 1XU7A 4U8GA 4ZK6A 3LNCA 1XMIA 2WW8A 3STWA 3RU3A 1QBGA 4DSAA 4DLXA 3NAQA 1K92A 2ZRJA 2VDVE 4ROSA 1EQAA 4V1CI 3TBFA 5FNVF 4KYVA 1U7HA 1XZEA 2OB2A 4CKCB 1ZMTA 3ZXXA 4YONB 1SHUX 5AI8A 2JKYA 3GI1A 1L4GA 1S6YA 3MUNA 1GZHB 4ZT2A 3TBKA 3UOWA 4URWR 1QE5A 3B1VA 3ML1A 4UHCA 1A3CA 4BXOA 3WXMA 1U9JA 4P08A 3KQHA 5KKNB 1QPBA 5JFGA 5JALA 3VI3B 1VGRA 1TNDA 2QPLA 5LA6A 4PO3X 3VJRA 1SH7A 4F9FA 4OA8A 3DT9A 1KC1A 4TMVA 4DJTA 3I9LA 4MB2A 3VUFA 2WA1A 3LWNA 3E2IA 1W52X 4NYIR 4QTUB 5IJAA 4BGDA 4HDKA 1ZH2A 1UJNA 2B8TA 3JQ8A 3A2KA 3KUUA 2A1UB 1P4SA 4MTLA 2WJAA 4BRWA 1NSFA 3WS7A 3G9XA 4FC6A 3AV3A 4YAEA 3S2UA 3QJYA 4G37A 4R51A 3BJRA 4IRXA 4RA9B 1KERA 3C6ZA 1TRHA 2RB5A 3PWKA 4LF4B 4LF9B 1F7UA 3LI2A 3G8AA 3HWSA 3KZCA 3R1IA 1EHIA 3ZKWA 5B57C 2IYTA 4V0NA 2ZBRA 4OP2A 5JV5A 1IOWA 3LLSA 3TEJA 2JLCA 3AJRA 4PVDA 3SXUA 3FVWA 3GDGA 1OASA 3TRDA 2H8KA 2XQKA 5ARCA 2I7TA 3DE6X 2GM9A 3G68A 4F8EA 5CCEA 4WADA 5U9CA 2V4UA 3FYDA 4ZALA 1Q14A 3NO4A 4OGLA 3PT9A 4PCAA 1KAEA 4LXQA 3DEFA 3BK1A 4O2AA 2IUUA 2ZJOA 5JZMA 1CX9B 1ISGA 4BNDA 3EC7A 4AZWA 3LTEA 2IYFA 5AVKA 4CUKA 5LXTA 3L77A 2R1VA 4C4OA 1IEVA 1HK7A 2VPIA 1A27A 2BTQA 3HDYA 1WOYA 3Q72A 1VE7A 1OUMA 3F1LA 2RFLA 4K6OA 5KCZA 4A0SA 3IPAA 1MNQA 3PJGA 4MRRA 3CZAA 4DA9A 1QHNA 1JUDA 3GGCA 1DARA 2AUNA 1XZGA 3O73A 4Q6BA 4FJ1A 4JJ4A 1GUFA 4E11A 6LDHA 3X1JA 2PRJA 5LP6F 2M2IA 3V8VA 1ISIA 2VFAA 3L7OA 3DTNA 3AB3A 5CA1F 1B2RA 3MTAA 3L9WA 1JIJA 1D2GA 4QSMA 4QDKA 1X1DA 2W2PA 4ICIA 2QJWA 1JKJA 2J3EA 4EHNA 4PYQA 2NU6A 1NQXA 1Y9ZA 3QYPA 1G3MA 2C59A 4URUR 3SNHA 3WBFA 3OTIA 1L5OA 1B42A 1O97D 4M2LA 3UIEA 5EN4A 1Q21A 5FBZA 2NO0A 1MB2A 4HX5A 1JZTA 2ZJ8A 3PYXA 1E5TA 1R66A 4J90A 3LTNC 4NEGA 2PV0A 2QM3A 1NXPA 3ZDAA 1Y7LA 4DLAA 1JJFA 2QRVA 4QRHA 3DB2A 1PT6A 4X62B 2FF5A 1FDUA 2VJPA 5CD9A 1CRZA 3KUDA 2OO5A 3QWHA 1OLOA 3ZWWA 1YV9A 1S2DA 1X7ZA 1YL6A 4LJ5A 5CA0F 3T1HB 2VC2B 4AIIA 4M9QA 3OPYI 1X1CA 2ZB8A 1D3AA 4M6WB 5M29A 1SY7A 3GA5A 4G1BA 5G3ZA 3QY0A 2GXUA 2A1IA 3H3JA 4AP5A 1ULAA 3C7DB 4XJSA 4MQ4A 2FEMA 1FJHA 2XMRA 1G8JA 5AOAA 3EULA 4TTAA 4ZVPA 3IMEA 4GS5A 4DLRA 1D07A 2EC5A 4RJ2A 4PLWA 4WXRA 1N5OX 4DZRA 2ZJ4A 1JQJC 1UK9A 2GN2A 4G2NA 5E1BA 3F6SA 3NM4A 3AR5A 3PBKA 4PTZA 4ALMA 4CG3A 3QTBA 4YH1A 4C6RA 3U60B 1NX9A 2ZAOA 3CWZA 3EVNA 4OLFA 5FULA 4YRSA 2I4TA 3QVMA 5IDVA 3ZU4A 1XZPA 4P0QB 2IDZA 1NVTA 4Q3CA 5JNUA 4YFYA 4E2XA 3A04A 2VO1A 2PUWA 3IFSA 4BTLA 1I0LA 1YR8A 3HCOA 3V6MA 5GMOA 1GLNA 3N0WA 2EF1A 2IVFA 4LJ7A 3U4CA 1WETA 5EIHA 4DR4B 3I1YA 4MKFA 1VYHA 2AA3A 4Y2XA 4NAHA 4Y7DA 1PF7E 2YYSA 4HDNA 3CRVA 5DEIA 3WLIA 2EKBA 2C9MA 3MJEA 1A0OA 1XZJA 4LS3A 3NWOA 4Q4JA 1TMKA 2AS0A 5BOVA 1T6XA 4NMHA 2MWMA 4KUGA 5C3MA 1N9GA 3K16A 3PK0A 4JA0A 5ULLA 5BY2A 1O58A 1GA1A 2XE7A 5SZKB 1KEKA 4TSFA 5FADA 4HF7A 1OJLA 1NBAA 3EG9B 5LNK1 3NTUA 3U7QB 4IHQA 3E81A 4DY4A 1BS2A 1SQ6A 1IMJA 4G1EB 1BA2A 2IF2A 1ZD3A 5JH7F 3UWSA 4MROA 3B1FA 4GC9A 4A82A 2H0QA 1T2AA 3LDUA 4FFWA 4UPDA 3GJRA 4WNIA 3R7DA 1NUAA 1ZOSA 1E7MA 1FFYA 3L06A 3GLGE 2YMQA 1V16A 4RHUA 3TKAA 5A04A 3R9WA 5JOQA 2ABWA 1H4SA 1WHTB 2WWTA 4CIDA 3KWJA 4BMZA 2UUOA 2FW9A 2ZJ7A 5HBRA 2YIDA 5KTMA 3QEOA 2QBYB 4J4HA 3IBCA 4QUJA 2IU6A 3R7LA 1RQ2A 2CMFA 2FMXA 4PSDA 1UJBA 1ZQ1A 4B3DA 5F1KA 5JAPA 4FFDA 2QZPA 2Y66A 1FPQA 4FJ2A 3KALA 4RK7A 3M81A 4JLUA 4AD8A 4E5NA 2X86A 5E9QA 4YRQA 3MJFA 1N9KA 3HI4A 4J0FA 3VR4A 1XVAA 3G6KA 1CQWA 3DOIA 1UZUA 2J85A 3CEJA 3UT0A 1T9KA 3HCCA 2G1PA 2OBNA 5SZHB 2YZNA 1XQYA 3LY7A 3KJIA 5LUBA 4DG9A 5IARA 3AF1A 4JX8A 4U6SA 4DPMA 3AP1A 2BBSA 3OEEA 1H4QA 4EI2A 1ZISA 3C6BA 2P77A 2WIFA 2ZBEA 4XFJA 1FLDA 3RSGA 3BIJA 4J0DA 3IAS1 2ZQYA 2FK8A 2GCPA 4BFTA 3RAFC 5G1OA 5LJLA 2FFQA 5CX1A 4E7PA 3AVXA 3QVTA 5IKPA 1EXWA 5EAIA 3Q85A 2JPDA 1LNQA 4GPIB 4L8YA 4D9HA 4UNRA 1WU8A 4IDAA 4FSHA 4PZDA 4FHEA 1JTEA 5J2UB 4C05A 1SC6A 1SCUA 1RXYA 3FDXA 4TRJA 5K6AA 4IYRA 2YC4C 4WHMA 5BMVB 1G8YA 4XI9A 3VXKA 3NHPA 2E3JA 2SCUA 3ACDA 2DBYA 5F73A 2P62A 2QI9F 4X1IA 4DSNA 3DCIA 5FUVA 1A4IA 5AVQA 2WZCA 4P5PA 2ESRA 2XEXA 3FNGA 5DTRA 1JE0A 4IP0A 3GWZA 1EDZA 3H1BA 2VN8A 2YZMA 2X77A 2CKMA 4YO7A 4CM9A 5M5BA 4EUSA 2BTOA 1NDHA 2VJQA 2ZRBA 1O0CA 4EW2A 3GMDA 4QXAA 3SS8A 1O6FA 2PKRA 5D1NA 3EIUA 5EESA 3UTDA 2FEWB 3VR2A 4HVLA 2QAGA 1N33B 2X5OA 4BZQA 4QZVA 2J9YB 2GZ2A 1PLKA 1US8B 3D2BA 3VDRA 3DE2X 4JEUA 1GD1O 2E82A 2MSKA 2XDYA 2JGIA 3O38A 2V7QD 2DPLA 4TZ0A 2HJHA 1GV0A 4AI6A 3PRHA 3ZK8A 1CNMA 3WYFA 3N70A 4FFRA 5B3KA 3WOVA 3C3BA 3LSYA 4IIHA 4JBYA 4NLLA 5TVGA 3EPLA 1P17A 4CM4B 1JEEA 3AZPA 3QZUA 5EJ8A 3CZ4A 5FPKA 1NR5A 3LUDA 4J3FA 1VE1A 4FOTA 3A1CA 2WJHA 1G20B 2XNSA 5I3CA 4KYIB 3IBSA 5JCPA 5A2QA 1M1YE 3D0RA 1DEAA 5FR2A 4CKXA 4QFDA 1FUIA 2OY0A 3HB0A 3W3AA 2X0NA 1S4QA 1D4FA 1CD5A 1R6DA 4M7WA 3JZMA 3GQBA 2C7VA 1N8NA 2XNDA 5HYVA 1AU9A 2W58A 4N1AA 2ACKA 1U2GC 2JFWA 3EGWA 2Q4EA 2A0KA 3SHVA 4F5ZA 4CLOB 2KX7A 1G9TA 2HDNB 5T6BA 4B3CA 4HUJA 1VL8A 2F62A 4KZKA 3LLUA 4RVFA 4ZOAA 4DCGA 1GTRA 1N3BA 2V3CC 3L7MA 2W43A 1ESMA 4LC9A 2VHVA 3ZHYA 4FSXA 3GEPA 2UUCB 4KPFC 5JNVA 4W5OA 2PL9A 4FEAA 1G6OA 2FH5B 5SV2A 1U0GA 4J0CA 1R8YA 4WPGA 3KL2A 5J3JA 3LQ4A 3KU4A 3OQBA 4QDXA 1ZGJA 2RHWA 1P45A 4JIMA 2Z83A 1WSBA 4V0OA 1TJYA 3IP6A 4HN2A 2Z08A 3L82B 2FUKA 4HRVA 1FQWA 2XGSA 4ZU1X 5KQLA 1V71A 3S2ZA 1KI4A 5HUHA 4NDNE 3JQFC 1E7RA 5JI2E 2FMTA 3PRYA 1NI4A 1V47A 5HIAA 2WD7B 3IKJA 1AKVA 1VZ2A 2YWDA 3M9LA 4I3FA 4J2OA 1DKPA 2HT1A 1JKFA 1GRNA 2ZSKA 3IIIA 5B3LA 4P82A 3C7AA 4IS2A 1DADA 1ZJWA 4BVEA 2Z1MA 5AICA 4RQUA 3RANA 2ZT6A 4G4SO 4GMDA 3AG5A 5JAOA 1AF7A 1HMPA 2FUG6 3FNEA 4F1WA 4AMZA 1CIJA 1ZLYA 4TKUA 5A3SA 3MJVA 2NXEA 1QIFA 4LHEA 1OREA 2PGOA 1Q7BA 2W4IA 2ZIXA 3PQ2A 1T34A 4M8NE 3WWYA 4DEVA 1QRDA 2NUPA 1Z3IX 2AJDA 3V55A 1CJUC 1MJGA 2A9RA 2C00A 3UVEA 3PKJA 1T91A 1CIVA 1DRWA 2FG6C 1DRUA 4R81A 3M8KA 4G1CA 2J5XA 1XMPA 4IIYA 3BXXA 3ROXA 1RJEA 1GRVA 2RC5A 2VK1A 3LBYA 3LDFA 3QMPA 4EWLA 1TEVA 3OD1A 4HTFB 5DM1A 5TT1A 3MWDB 2JBWA 3DVAA 4EARA 2XI4A 1F2VA 4ARCA 3VAAA 3WIUA 4D56A 2R5WA 2V6BA 2XYHA 2ZBPA 2F3SA 2QLFA 2P9FA 5ARBA 3O1JC 3L5OA 3N5CA 4PYLA 1J7KA 3HB7A 3L0DA 4IIJB 2NN3C 4RVNA 2NO4A 1LK5A 4QA9A 5L3SB 3U39A 3FOWA 1TL7C 1G59A 1OX4B 1QB8A 4FFVA 1AKUA 4OHRA 4BWFB 5AUPB 4J07A 3B53X 3AU8A 3RSQA 4BKPA 4KSCA 1NP3A 2BMJA 1AUOA 3D7LA 4IDGA 3JYNA 4MKRA 3JYHA 1U2ZA 2AV6A 1BQEA 2D0DA 4JI3B 5JFTA 3CW2A 3LLMA 3RWBA 1S1CA 1C80A 3PGLA 3QENA 1E79D 1EBBA 4YMHA 2YNMA 2TMGA 4ZIRA 1VG1A 3B7WA 4U2BA 3U31A 4PYMA 4O2RA 3WGGA 1A5AB 1WDMA 5FTMA 2AVNA 4W1PA 4P0TA 4Y0VA 2VWHA 5LLSA 5JXJA 2OFWA 2ZJ1A 3OJLA 2VDUE 4BX2A 5ALQA 2M9MA 3WISA 2NZYA 3CPHA 3EUAA 4LYJA 1Y9AA 4KDCA 2GJ4A 5DN6A 3T9AA 4GP6A 4BP3A 2EZ8A 4R9RA 1TZBA 1EWQA 4NAVA 2G9ZA 4ND2A 2EFHB 2EP5A 3TVDA 3O1HB 1LLCA 1Y5MA 5J1TB 1XP8A 1UFVA 2XDQA 1FJ2A 1YCFA 3X1DA 3V4FA 1XMOB 1XN1A 2WJ3A 2Q3HA 3UCXA 5ALZA 5KHLB 3L7AA 4O4LA 1H8ED 1QHHB 2HH9A 3BTUA 3R6WA 4OQPA 4WRRA 1USKA 4S1NA 2WU1A 1BTOA 4MWTA 5BR8B 3VNBA 3P32A 4E5KA 4QAQA 2A9PA 2HEGA 4MS1A 1D04A 3CVJA 1ML3A 1EEXB 1NTRA 4RD3A 4RF4A 3OQIA 4U2GA 3PNOA 3U81A 3ZC3A 4BNHA 2J45A 5KYGA 2WILA 3EFOB 3ISVA 1Y63A 2WNIA 1RRFA 1XTZA 1VI5A 1JSRA 1S8AA 3AFOA 1EFLA 4L3VA 5A3JA 3QNUA 2AF3C 3ZXUB 4MR7B 2A84A 3QW2A 3PL1A 1LUAA 3D3WA 2VJAA 2J0UA 2NZWA 1ZLXA 2QTAA 1IY9A 3N2LA 4NWIA 3UV3A 2QM0A 2E18A 3G2PA 2DFLA 2XITA 3M2PA 5FEUA 2PEYA 3ISJA 1JQBA 3HQ4O 3SQXA 3VR6H 3CFYA 3EZYA 4MTCA 4NBTA 1KZGB 3RSCA 3ZD6A 3THOA 3R5FA 2IEYA 4Y2JA 3V97A 3N7TA 4DV7B 2C5EA 3ABSB 3ENVA 2NPIA 3JSAA 5NLLA 1EQ2A 2X4LA 2ZYRA 4WLVA 2G5PA 4L75A 3EGEA 3TLYA 4DC0A 1XRQA 2YOHA 3VOBA 3ZE6A 4KN9S 4DCNA 4EY6A 5J58A 1LC3A 3VU8A 2O2GA 2ZIGA 3PUZA 3KKQA 4YRRA 2LKCA 5HRAA 3U3ZA 3ZWCA 1B0ZA 3HJAA 2A1TS 4EHAA 1W0KA 2AK3A 4HV4A 4WCDA 2Z43A 1ESNA 3RUDA 1E2UA 2AOTB 2QU8A 4TS4A 4DG5A 4PYRA 5EY5B 3U4QA 2BW0A 4KAJA 3RWOA 3OE7D 1O96A 4BB5A 1GA6A 4GVXA 5C81A 1GRQA 3CEPB 3A4LA 3KQYA 4TKVB 5JQGB 4YI5A 2PGJA 5J5AA 1H2AS 2H08A 4EUKA 3WYGA 2G9VA 2WUEA 5EVCA 3TW8B 1Q1AA 4DUGD 4EO7A 3DLBA 4U0KA 2RH8A 4TLLB 4RNDB 3IJRA 3JALA 1EDDA 1M6HA 4HPWA 3DEIA 1R8XA 1JAZA 3C74A 3QPBA 4J6FA 1IY0A 5IEJA 2G5CA 3IDZA 1R0XA 3LLCA 4A2CA 4U02A 3K71B 2O48X 1U4SA 1TA4A 3ICOA 1YF3A 4FZRA 3DOEA 1OT3A 3UJDA 1TFUA 4JXZA 3I1IA 5BN4B 4RQBA 4WASA 1WUHS 5CURA 1C3OB 3S28A 3TTTA 3PA6A 4REQA 2I0FA 4DR7B 3D6HA 3H9CA 4UFPA 5E7MA 5AQEA 4E2FA 1Z2DA 3Q10A 1YJAA 1HTTA 3QWIA 1AZWA 2MHCA 3BQ9A 3MHPA 3QUBA 4TMYA 4ZOLA 5TJHA 3QP9A 1P2DA 3FSRA 4Q48A 5LQKA 5LBIA 4DQVA 1PR4A 1TLLA 4RABA 4ER5A 3W7BA 4CG0A 4CIWA 1E99A 3B6JA 1JEJA 2IOFK 4MYSA 4PGGA 3G89A 4C43A 5I7WA 3IB3A 1PS8A 3EPJA 1YIAA 5KU7A 4DQDA 2HCFA 3CT6A 4XQ0A 1Z15A 1CERA 4M8IA 2NXWA 4J6EA 4Q9NA 3P4XA 4RFSA 4AKEA 1ZD1A 1KAGA 4II2A 3WQHA 4BLPA 4Z9BA 2RGXA 1E8NA 4XCXA 5J5CA 3FXAA 4C89A 2P6NA 1KAMA 4WJLA 2PBFA 3OMXA 4FDUA 4BQIA 5GV7A 1T3SA 2XUHA 5JO0A 1Q7GA 2A92A 1RAGA 1MB0A 4ZQEA 1WSAA 2FSUA 2ARKA 4P7JA 5DF1A 3HWWA 2WG1A 3U80A 3VVBA 3X1XA 4AWBA 2WHPB 4RL4A 3K9NA 1RYEA 1THMA 4XDZA 1FNDA 2YVQA 3DE0X 2FOLA 2WDZA 4JL6A 3LX8A 2D7DA 1O5TA 2B0CA 5CB8A 1GR1A 3AB7A 5BXQC 2CXRA 3OD5A 1Z6ZA 3EQ9A 1KKUA 3TM5A 4I5IA 5KNDD 2UUPA 4BDSA 4BP1A 1XQ6A 3BH6A 1K5PA 3KDSE 4J03A 4O2BB 3RRFA 5H4HA 4LY6A 4QJBA 5ER9A 5AKEA 2D1QA 3FFAA 1PL7A 2FRDA 5CJJA 3R3SA 1WM1A 1U5BA 1H5UA 1PJ3A 1F5SA 3HPQA 4K9MA 1MEEA 3FHOA 4KO3S 1NN0A 1MGPA 2H4YA 2V5AA 4GBMA 4JI0B 3HXTA 4P92A 4Q47A 3ZHUA 3FRJA 3QBTA 3S1AA 3KYIB 2P4HX 1QYRA 1G6Q1 3GG9A 3R5XA 4Q1DA 1Z5WA 3IC5A 4AP9A 1B8PA 2XE6A 2YH2A 4GE3A 4LQLA 3ABOB 5I9LA 1PDWA 5DNYB 2VDLB 3DZIA 2IQ5A 4HHEA 3WL8A 5L3ZA 1BE6A 1QGUA 1R5BA 3B9BA 3F6CA 4ND3A 4QREA 4YIKA 4EB3A 1CUAA 1P0IA 1U11A 2IPAB 1MX9A 4MCAA 4PTLA 4B79A 4CMHA 1LBEA 4AKTA 5KO2A 2F8SA 1J0AA 5HHTA 4MWZA 5LQCA 2HY7A 3NM6B 4D25A 4HXGA 4RM2A 4S1VA 2GD6A 4CG1A 2PUJA 2YHAA 1UR5A 1SHKA 2DBQA 5IJXA 1TYCA 1H69A 1KTVA 1OI3A 2WMNB 3OO1A 5D3QA 4ZI3A 2ZUEA 4OHPA 3RRMA 2GEFA 2MYUA 4IXDA 5C1PA 3U16A 4FGUA 2V0CA 1YCGA 3VH2A 1U9IA 2PG3A 2VPPA 5DCWA 4YRBA 3NOVA 3DO6A 1E4YA 4UVGA 1C0KA 4L2IA 4Z9FA 4PFSA 1PVDA 4K9SA 4AYWA 4YRMA 3Q3EA 4A5SA 1I30A 2OM6A 5EE5B 4L7QA 1O97C 5C8YB 5KC8A 3L7JA 1P9WA 4ZEXA 2PWPA 2GO7A 5HF8A 3WBBA 1NVAA 3GJZA 2CJWB 5JT1A 1DAPA 2SBTA 2CV0A 3W9UA 1ZR4A 3A6GA 3CY6A 1PIWA 1IN7A 2OORA 3K9QO 4PG8A 5IJ0B 1PT5A 2R4TA 3L6EA 5FBQB 3WQRA 4C08A 2FZ5A 1VJ5A 3DC2A 5F76A 4J0QA 4RSRA 5CHEA 3LHKA 3K8QA 3MJRA 2QK4A 3LSTA 1ZMBA 3VO8A 4N6OA 3AJ9A 1EJ0A 3WGNA 3B85A 3BRQA 3EZXA 4WESA 1SCJA 3HCRA 2Q5IA 4ZRNA 3U26A 4BQNA 1GL3A 2EGUA 4I4TF 1H0SA 2QBYA 1A04A 2V7BA 1AKYA 2YWBA 4CIXA 1D9XA 1YIDA 3H5IA 4U0JA 2Z3WA 4ITUA 4Q1FA 1C9YA 1FMJA 3DJFA 1Z8DA 1KRWA 1R8JA 5BQ3A 1PR3A 1XRMA 4EITA 1XTJA 5F52A 3TF5A 3HRHA 1M2GA 1OLXB 3ZWYA 4FHGA 1BXGA 1U5AA 4BNZA 2O0HA 3Q3CA 4IVQA 2ZR9A 3SC2A 5LD2C 2QRKA 4YJ3F 3KWMA 1CQJB 1LPMA 2BFEA 3KXIA 2DBZA 2B5OA 2BKLA 2BEWB 2C54A 3DV0B 3FBTA 4OQFA 3E18A 1VJDA 4FPXA 4Q34A 4Y6GB 1KQNA 2B1JA 1T13A 2BE7A 2O8FA 1VXRA 4MAMA 4TYQA 4ALIA 5KHOC 3QE4A 3OCVA 1UK8A 3DHWC 3MINA 3S2SA 4V24A 6NULA 1H42A 1XZKA 4QOHA 2ZRAA 4M99A 5CD1A 1CS0A 4EQ6A 2YW9A 4DCUA 1E32A 1NZFA 4X45A 4BEWA 2W7TA 3E2PA 3UY4A 1G8MA 3ZY6A 1HM5A 2ZIVB 2PRYA 1GXSB 4MUYA 3K6RA 4EG8A 2Y92A 4QTTB 4YMIA 4LFCB 1BRTA 1EUYA 4Z0HO 1C3JA 1JS1X 3ZCUA 2ZK7A 4B09A 3I37X 3WIBA 4AQYB 3FLBA 1LSSA 5DHPA 5JC8A 3BAFA 1YA6A 2QN7A 2Y1OA 2YINC 3P45A 4KLCA 1N6HA 4X85A 1SVKA 1W87A 3IV7A 3QX8A 1TD9A 2C3MA 4OJMX 4UHJA 1A2QA 4I7EA 5ENVA 1B74A 1CHNA 4NDAA 4O1MA 5EPUA 3TQOA 3UMFA 4BBAA 1QP7A 1JAHA 1N6LA 4DHEA 4GUDA 2CYBA 4AUNA 1EUCA 3ZCQA 2WTUA 3CEMA 1OTYA 3I05A 1VLJA 1HEYA 1B3RA 4UEJA 4KITB 1LBTA 4ZCQA 2VKQA 2SNIE 4CQLB 1ZEMA 3HO6A 1P4RA 3TCXB 5K6RA 1UOPA 3RRZA 2EWWA 2Q41A 1N8KA 3TL3A 1OYWA 3Q8KA 4FWBA 1JQAA 1UMDA 3F47A 1SCKA 5TVKA 4PLPA 2OBMA 3DQQA 4HQFA 3QIAA 2V6MA 2HI0A 5F4ZA 2H31A 1XEAA 3RNLA 2P6MA 2O5RA 3IRVA 4L0CA 4M9SA 4Q9HA 1IOLA 3UAYA 2SICE 2WTNA 3VHXA 1YA8A 1JKMA 1KSHA 3CX6A 3DDZX 1Q3TA 1P18A 1Z7EA 2OKCA 4DNXA 3WLRA 1UDCA 2D5BA 2AW3A 4MKGA 4QOIA 1TAGA 3A36A 4R2IA 3RTGA 2Z1NA 5EMKA 3RU9A 4LRUA 1EXDA 1NOIA 1K8QA 2A58A 2QL6A 4M0EA 1TM2A 2AFHA 1AS0A 4RK4A 3SE7A 5EZYF 7ADHA 5KPDA 1E2IA 5L3RA 4DLYA 1GU7A 3Q3IA 1V8PA 3ORFA 4FW9A 3H2ZA 4IJQA 1E9FA 4PM4A 4Y9TA 1GZUA 1UIRA 2F1IA 4C88A 3DLPX 4DKJA 1PR5A 3QVJA 5BQPA 3U4GA 3L1VA 2B4QA 2R25B 3FVVA 4Y9RA 3KHKA 1FNSA 2HN9A 2WPDA 3GDWA 3AHGA 2WSMA 3D3JA 3KLNA 3MQ2A 1TCUA 3Q98A 2HUNA 4NZPA 5KCMA 3FVQA 1T9HA 5I7HA 5BSRA 5LD2B 3QE9Y 1WCXA 3P2OA 2GBCA 4BEVA 3ZNQA 3OECA 4UHHA 4ZYYA 3OPXA 2W2MA 3MXTA 3L6DA 1I7QB 1JHAA 1LVGA 3EGVA 1CF4A 1V4BA 2TMYA 5CM8B 4Y8VA 4EB6A 1EGQA 4RZ3A 4H08A 5AM0A 4F4HA 3MIZA 5HVNA 1WBDA 1CUGA 4JJGA 2C9CA 1ZMOA 3DUWA 3FYTA 4CN8A 3EGXA 5IX8A 1IK6A 1GADO 1ZN2A 3EIOA 3TOZA 1SVWA 4JI1B 5DXJA 1WU7A 3PXBA 1ZOOA 3LK6A 1QH1A 2CL5A 5FPPA 2L42A 2Q50A 5DE3A 3UMBA 4DNFA 2WM2A 1Q0RA 4WERA 4H59A 3GN2A 5EZ6B 1Y89A 1E1LA 4M60A 1JWLA 4P3YA 1W4RA 2FPIB 3KE8A 2FE1A 3NLLA 3OJ0A 4RMHA 4IV8A 4W7SA 3TNJA 3U1TA 3RT1A 2C3PA 3BMNB 3WLEA 3LLVA 4KHPB 2WKRA 3AP2A 3DBLA 3FPGA 3VO9A 2FLKA 2IDKA 2X0FA 1ZM3A 2JJYA 3L92A 1VKNA 3F67A 4OLJA 3LHSA 3DEAA 1P0FA 1W75A 4O4JB 3NJ4A 1K75A 4D4JA 2RGNA 5FWYA 2OUKA 2IVZA 4RH0A 1CETA 4KODA 1V1RB 3CINA 1IRIA 4ZAGA 4IIXA 1X1TA 3C7KA 2ENWA 2FR8C 1SIBE 3LQKA 2YICA 2ZROA 4U7HA 5TPZA 1OBFO 1M0EA 3KJQA 4N4AA 4UTVA 3TYXA 1NYQA 3R40A 2WLSA 1NKSA 5DXFA 5TMPA 4Q3LA 1TI7A 3DFZA 2ZSIA 3DULA 4TYMA 1G6HA 1T6BY 1R9NA 1QLHA 1UIMA 1O95D 3HG7A 1MB9A 3UYLA 3F6EX 4TSFD 3OOYA 1AHHA 2AOUA 2P3OA 4CHTA 3I2HA 3KVNA 1HUQA 1RZRA 1PEAA 3KKLA 5EE0A 3R3YA 4IDEA 4LWPA 5B37A 3EASA 3U3RA 1YJ8A 4L08A 5IF3A 1DJQA 4PCVA 1L3BA 2MIIA 1H6DA 5ENZA 2BKUA 3NV9A 3KR1A 1Z73A 4JJFA 3V4RA 1JFRA 2OQRA 3HNOA 4RTSA 2C7PA 2HV8A 3NC0C 2NUTA 4E94A 1M2FA 5B3JC 4I1PA 2X1HA 1J70A 2YJTD 1V7ZA 3FWYA 3L1HA 2DULA 2VTBB 2YXLA 3BGDA 3O75A 3D4OA 1S2OA 2ZUSA 3CU5A 4IMJB 2VPXA 1CUZA 4FYJA 5EPOA 4FT4A 2AEEA 1MFPA 4P2GA 4OHUA 3AOEC 1NN5A 4PTYA 4LY0A 3ZU6A 3DDUA 2A3NA 4RVGA 1WTCA 5G41A 5BNFA 1GPNA 3C8DA 3TLMA 3GDFA 2ZGVA 3VR4D 2OD2A 1ISSA 3O95A 8OHMA 3HXQA 5FIUA 1SVSA 3QKRB 3EZGA 5SY4A 4UXIA 3DF9A 1QM5A 4WSOA 1V39A 3GLGB 2H1RA 4LHXA 1SG0A 3AKCA 3EVEA 4RZQA 2OV4A 2IELA 4JJ8A 3EQZA 4KMRA 4E5SA 4AAYA 3C4VA 3LY5A 4DE5A 4ZCMA 2POQX 2NU8B 4OYHA 1V1MB 3LXMA 1ULBA 4HZUB 1GPUA 4I66A 5K8TA 5H4GA 3ZWBA 2PS9A 4DTIA 1O9GA 2CEAA 3DYIA 3H65A 3KKOA 4KKVA 1GLGA 3VYRB 2DF8A 2JIZD 1T1GA 3EVBA 1TYAE 4BX3A 3PE4A 1JR6A 1ISMA 2I9PA 5BOSB 1IM5A 4Q39A 3O2SB 5I7AA 4CJXA 1K2VN 1PJAA 4YXFA 1WDWB 1RC0A 2NYRA 3B5JA 3I01M 4OATA 3RVRA 4ARIA 2RHRA 4I4LA 1HZZC 1E77A 2APJA 3X44A 4UE3S 2AH5A 1PV2A 4RHCA 2AEJA 1SUIA 1QQ5A 1Z4JA 5CW1A 3UGKA 2ETXA 2NV6A 4I9NA 3RVDA 3E0QA 1Z0KA 1K0UA 1JH8A 3AUXA 4AMVA 1L7XA 3DNPA 3FETA 3JVEA 4RGBA 4HVTA 1LF0A 3RHSA 1BE1A 4JYPA 2FRXA 3AVPA 1KZ4A 3PI6A 3C5HA 4AXXA 3M9WA 3ND5A 4Q16A 2ZRMA 4EB0A 3D81A 5JDCA 1T8TA 2EX1A 1XL1A 4C6SA 2JS7A 1DBQA 1A8PA 2PH3A 2PRIA 4LCJA 5DP2A 2GBPA 3VR2D 2BEKA 5ICFA 1X8XA 3I9KA 3UW1A 3MS7A 4GO1A 3T4EA 1GIAA 2O1SA 1VIMA 3SYNA 4QG3A 1CUEA 1Z47A 3G88A 3ILVA 2LV8A 3D5QA 2AE2A 3INRA 1CJSA 1QHGA 1WMAA 1T9GR 5JAQA 3WAGA 2ZIUB 4C0SA 1WPRA 2H2FA 4XKJA 4N3NA 1E1QA 3PLRA 1ULZA 2WMOB 2Z2XA 1E6WA 1T3TA 3QVWA 2YYYA 2VT3A 3ZN2A 1YB6A 3HB4X 2VRWA 3CRW1 1RYZA 3IVGA 3LHFA 3Q7TA 5AOBA 3DKKA 3FR8A 4ZN6A 4CM7A 3AH8A 5FPQA 2JEOA 3VZDA 2B2XA 3MMSA 3H9QA 4KO2S 3S1LA 5KQMA 2PMEA 4Z4EA 2EQBA 2EFCB 4QIHA 2DUUA 3C15C 2P90A 1ZU5A 2BYTA 1G38A 3UMSA 4Z0TA 1DBPA 1O6CA 1YSCA 2IP2A 3CPSA 1TJ5A 1EVKA 3ZHCA 4RD0A 3J81k 2YIVX 4C0AC 2OHXA 1QYXA 1DBWA 4Q3DA 4F6LA 1VSUA 2CV2A 3STXA 4YRGA 1VHDA 1JDNA 3BFKA 1W1UA 2DKOA 3I3OA 4DLVA 1M1YB 3I9OA 2ZTLA 3IOBA 5ALJA 5FOSA 2B4RO 1NRWA 2PT9A 5EJ2A 3X43A 1PK7A 2Y2UA 2Z58A 1Z2PX 2HOQA 1X8KA 2JJ1A 2Q6TA 4QDZA 5JQWA 5IABA 1Q0UA 4CN9A 1GOTA 1JVSA 5I3ZA 3U61B 4KR7A 1Q1QA 2B1QA 4JN6B 3FCYA 1VGVA 3QWBA 4XZ3A 1KMIY 4LSGA 3NBFA 1ZJYA 2JD0A 3DE4X 2FU5C 2NVOA 1IEXA 3WO1A 2YCBA 2HPHA 2OPBA 2QRZA 3T54A 5ICEA 4DR5B 1UQRA 2GCOB 4R8VA 2HRZA 1TD1A 4JVMA 1Z82A 4NCNA 4DN6A 3K6SB 3L7IA 3JQGB 5TY0A 3NKLA 3RS5A 4GMXA 1TW2A 4S2EA 3IAFA 3Q3GE 1OFUX 3HCNA 1ZAYA 1HKHA 4PR3A 4NFHA 5JSYA 3WDKA 1WS6A 1I2BA 4DCPA 1VYUA 1LBQA 2DFTA 3VOTA 2BPOA 4LDJA 1NRXA 1FRZA 3R5JA 1XSEA 1VB3A 5ETJA 1FSSA 1UJMA 3AETB 3AGQA 1R9GA 4XSHA 2UZ1A 4QUIA 3A9RA 5DVZA 2QRHA 4Z51A 4EKEA 1NJ1A 1UBLS 3HN6A 1FTSA 2G1UA 1HZJA 1U2EA 1YD7A 2Q3LA 3GLHE 1RLOA 2VDKB 4FGJA 3WWOA 3M7IA 4NY1A 3WRVA 1FY2A 2F9MA 3L7NA 3LM8A 4I3HA 4FYMA 3HCAA 4C0KA 5KNBH 1EUZA 1CTQA 5JXHA 2BP7A 3BKXA 3JARB 3NIBA 2BDUA 4HNVA 3JWJA 1F38A 2IYXA 4R2WA 2VCEA 1C4XA 4CMIB 1J22A 1EDBA 3I52A 3ZLTA 1DAMA 2AG8A 5IYZB 1XVIA 3ER9A 4B40A 3P0FA 4U8HA 1DO0A 1MPXA 4JJ7A 2NGRA 1OYOA 1EFTA 4QAJA 4OHBA 5JTTA 4UHKA 5BPFA 3ELWA 1MU0A 4RTLA 5FTLA 4F91B 4YRKA 4CCAA 2QP9X 2QRQA 1I3LA 3EQ6A 1FP2A 2CVPA 4UBJA 5CT9A 1HO3A 4PPQA 4Q0MA 2JLBA 2AB0A 4AB1A 2FEKA 1EM8B 2ZE8A 3CE9A 3B2NA 3LNTA 4MLDA 3OTGA 4C29A 2VJNA 3REFA 2BSAA 4K40A 4E3WA 2OKGA 5EZ5A 3WGUA 3UT5A 5BMVF 5K0GA 1B6TA 3C5VA 3FD8A 2WIJA 4XX0A 1JJBA 1P2VA 4KZPA 4XIGS 3SIPA 2ZZKA 1EGMB 3GEBA 1O94A 3HWX1 3UGTA 2VK8A 5SY6A 1RQPA 3KZXA 4OQYA 5G3YA 4FS3A 2GZSA 4DG8A 1O1YA 4JJZA 5BSTA 1VRVA 1YCHA 4HDSB 5EWJA 4YV2A 5DN6D 2FTKE 3QE0A 1R74A 4JV5B 3G9QA 4ZP1A 3LBIA 2EP8A 1LC0A 1JPJA 3PF8A 3EEYA 1LRKA 3A37A 1T24A 1NDQA 3W5AA 2O23A 2NTYC 5I8PA 4Q3OA 2QDKA 1IB0A 2XF2A 4L16A 2EYQA 2QENA 3U37A 1U0OC 4BIIA 4RJTA 4RO0A 3TIFA 3GZTB 4OHWA 2YXEA 4FDLA 1DX9A 1P9RA 1UBMS 3AHIA 5AVJA 1GP2A 2YBEA 4Z49A 1BXRB 3DOUA 2OAEA 2D0PB 1B23P 3VPFA 2IA5A 4RELA 4N7MA 4EW1A 5F7ZA 5KYNA 1DAIA 3KSDO 2QHXA 2IBTA 2JIPA 3QG5A 4KGVA 4ZJYA 3ZXIA 3THWA 1BDMA 3WZMA 4RC9A 3E53A 1B76A 1Q2XA 3ETJA 3QUCA 4HBZA 4R01A 1TJPB 4K9KA 1TJNA 5HKLA 4AF8A 1KVUA 2HWXA 4P3XA 5TV2A 4GUAA 1XLWA 4CF6A 1ADJA 1KYYA 1QV9A 4B3SB 1RWVA 3WRXC 4MDHA 4A10A 3BWYA 4JT4A 2XT9A 2O8CA 3EY4A 1CKEA 2JLQA 2KBEA 2VDMB 1MG5A 3IHKA 2A2ZA 4IHKA 5CM2Z 3RFCA 3MT9A 5CIQA 3L1JA 3WDLA 1ECCA 3AEXA 4CF5A 2ZBGA 1RYNA 2FP4A 2JCVA 4G07A 1QWOA 2M6RA 2PLRA 4M3NA 4AN0A 4Z1OA 4TZ6A 5AUQA 3R3VA 3OKFA 4G5RA 4TUYB 3SQMA 3L9XA 5E6RA 1UC9A 5ESDA 3TZHA 3AR3A 5HPYB 2HHLA 2VVTA 4LWZA 3DZGA 5C8VA 4PLZA 4LTDA 4KQWA 2ATEA 3SVLA 3K0CC 1AXEA 1U31A 4I08A 1U0EA 3LO5A 3P9RA 1ACJA 4QRIA 4M1QA 4J29A 3RTAA 1QTRA 1ZA2A 2Y0DA 3PUIA 5DMXA 1XTTA 4QG7A 3CMCO 2X1LA 4GW3A 5H80A 4C0WA 2ZJ6A 4CM8B 3C7CB 4Y2YA 3QLVC 3MRSA 4QOEA 1RSZA 2FPLA 1F8XA 4GM1A 5B1YA 4LQDA 1J1UA 2O2JA 4NS4A 2BMVA 5KNCH 2WIKA 3DEJA 1IN5A 3EGOA 5LQJA 3RYHA 5K3BA 3GPIA 1U0TA 1XPRA 4U7DA 4GR5A 3M1IA 3RJ9A 2KSQA 3Q7EA 4BFSA 3B78A 6CHYA 3SQWA 4I2VA 2AZDA 1J4AA 3HU5A 4JGIA 2LDXA 3GFFA 2PMFA 3KEGA 1UKCA 1KYWA 4PS0A 2IYLD 5JISA 2Q5JA 2O50A 1VMIA 2Y1WA 2G9NA 4PXSA 1QS0B 2X9GA 2BLNA 3QE2A 4WXMA 4YDRA 2OAGA 3WLKX 5LDDC 4HR7A 4A9AA 3SF8A 3DMPA 5LZ7A 3FI9A 2BEVA 4HNAB 1NW7A 4E46A 5AI6A 2PRKA 5CXQA 5GONF 4D9IA 3M5PA 3GRYA 1OA1A 4NJMA 1N7IA 1QYVA 1TO1E 4KFUA 5DYYA 4AY3A 4QKQA 5AW0A 5TPWA 5LZ2A 3MWYW 3RAPR 1U1CA 3NXSA 4IJ5A 4ER6A 2JJQA 4K1XA 2A30A 1Y6RA 1G8AA 5HZHA 1WB6A 3HUDA 4OSOA 3AVWA 2CXOA 4PZ0A 5JBNA 1GCIA 1MIOB 3JTEA 1NLFA 3R8CA 3BC1A 2P2YA 4Z7NB 1S01A 2NVUA 4TZKA 3T3MB 4EHBA 5LIRA 3ZD8A 5DHQA 4JCCA 2VNSA 3CNEA 1NVGA 4HLNA 2IIPA 4TXMA 3K05A 3IV9A 4NHOA 4CDMA 2OMEA 4A8JA 2OV1A 5B5SA 3GLKA 2YRWA 1F0YA 3I0NA 2XMBA 3NYQA 3TMYA 3BCHA 5JH7A 4ZRMA 1OGIA 2HK8A 1FMCA 5CTAA 2JH9A 1TZKA 3RROA 3S8MA 1GAWA 2ST1A 3L79A 3EFEA 3MWGA 1IDN1 4O1HA 3DOCA 5DPMA 3CJQA 4MUNA 3RYFA 4YJ2A 2WM9B 2XGMA 4FM9A 4FB4A 1Z13A 2IPNA 1KYXA 2WWGA 3ZY4A 3ZHSA 1H5NA 1ZEJA 2IE8A 2GSDA 4PLCA 4LNUB 2PKXA 2HNBA 3IEUA 1L4EA 4JLDA 2AQKA 3C3EA 4HQLA 4TXLA 4CIYA 1GGVA 2FHPA 4LZZA 4XWAA 3U09A 3AEQB 2AJLI 1WCV1 2GTHA 1NNI1 3R7AA 2P75A 4MV5A 3EODA 1JHUA 5TC4A 4NS1A 1LKZA 4UBLA 3ZDEA 2RGEA 2ZB4A 3QV2A 2QD3A 1ECPA 3SKYA 4DB4A 1ZICA 1H93A 2FSPA 3ZWMA 4HDMB 1XXLA 1UPAA 3MFQA 3A2LA 3CS3A 3U2QA 2C95A 1JDUA 2OZVA 2YJGA 2YYZA 1CZKA 1F2TB 2Y6VA 3E03A 3L07A 4S1TA 3V34A 1T8PA 1KGDA 2JK1A 1T2FA 2J48A 1CY7A 3ESXA 2R00C 3KAJA 4ETNA 4KR0A 4OX9B 5EJIA 1C1YA 2PUAA 4I46A 2VXYA 1ZFNA 4BUZA 1QE0A 4WUVA 2PTHA 4AFNA 2XBUA 2AWOA 3EEIA 3GLSA 5L3VA 2AFVA 3D8TA 3GH3A 1UJ2A 4RF3A 5FHQA 1BN7A 1SBIA 1Y3DE 3HADA 3HCBA 1XCBA 4FLFA 3MNFA 1ODTC 4FONA 2BGKA 2CXPA 3MK31 3WNCA 4OA5A 2FZCA 2W2XA 3FGZA 1QUFA 2D0IA 2QVBA 4JJIA 1RQGA 1IG3A 4HXEB 1KJZA 1H9BA 1T8RA 2ZQ5A 1Z0SA 3KPUA 2P9JA 4JC4A 4BNTA 4C5BA 1SBNE 2AYXA 4M9RA 3ZW8A 1AKNA 4DUZB 2CNOA 3BWCA 3PEUA 1SKAA 1WUYA 3NV7A 2QN1A 3L01A 1NC1A 4R1QA 3WGMA 3GF4A 3LUAA 4RF2A 4ZGWA 4RQAA 5H0IA 2XUGA 2HQOA 3QXXA 3BT7A 4GYWA 5TQJA 1O77A 1MRSA 2PX5A 2YY7A 4Y1RB 4J0KA 1ZC3A 4L15A 1NW9B 1SGWA 1S96A 1T43A 1XCOA 2B7BA 2OB1A 1CU1A 1NZDA 3MPUA 3P8ZA 4QYIA 3D59A 1II8B 1MA0A 3HKCA 1NVUQ 3C3PA 1RI5A 4F3CA 1J07A 1UINA 1YHZA 2H9AA 3A3PA 3PUXA 1FOEB 3F46A 1B16A 2O1WA 3IQWA 4JR0A 2XKKA 3VPXA 2FSIA 4I9HA 4PO1A 4ZEWA 1UXOA 3HP7A 2CHUA 3OJEA 5DO9A 1S2GA 1VPEA 5DM0A 1QLWA 3O9ZA 5K3CA 5FH9A 4LGYA 2ZUDA 4MEAA 1Z56C 3AUTA 2PQ2A 5DBFA 2Q8QA 4Z4HA 1NWCA 3HCEA 3JYQA 3NOQA 4IDPA 1KY2A 2XF8A 4L1KA 5JYDA 4F5WA 1O4WA 2J3JA 1PJBA 1VJCA 2AJCA 4RW0A 3TBHA 3IIMA 4BNVA 1JFFB 4MCHA 5EKXA 5LJIA 4YCDA 5AHOA 1FRFS 2AVDA 3AEZA 4B7UA 4N3GA 3QI7A 1X1BA 3SC3A 5CB0A 1PR1A 3HKEB 5L6LB 1GTMA 4F92B 5JQGF 2BCGY 1CR0A 5T3UA 3E6AA 2LVBA 3UV6A 4H1HA 2HU8A 2YN0A 2PLFA 3NI2A 5A7HA 4E4YA 1VPVA 4GYKA 1HG1A 1UOQA 1VJTA 2OO5C 3ASVA 3FPJA 5F7JA 4B74A 3BULA 3TD2A 5KOIA 1G8HA 1I14A 1JEQB 1N7GA 4PZLA 2QS9A 3CZCA 3THYB 3I4FA 1UP4A 2H16A 3O8OA 1GNQA 1LZLA 3FSEA 1IPFA 5BSEA 4FHFA 5TGZA 3IUEA 1T4MA 4K05A 2WAMA 1CXZA 3EBPA 3G5MA 3RF7A 1SG9A 1UPXA 1FLAA 2BFBA 4W1SA 2XCIA 4AURA 2ECFA 1FS5A 3DB1A 1GRCA 4MRMB 3LKBA 1XDBA 3OCCA 3PDHA 1JHVA 3ZLVA 1WQ3A 4F11A 3JQRA 4IKOA 2QMOA 4YREA 1P9NA 3NXKA 4FOSA 1BVHA 3JAKB 4QC2A 421PA 3WGJA 3S5UA 1EWTA 4A2WA 1ZK4A 3SM9A 2IS1A 2O06A 4URZR 4AYTA 2GAAA 4YP5A 2QUIA 1PJZA 4FILA 4R69A 4B5KA 2GAIA 1Z63A 2JA1A 1CRQA 5KTTA 2O5VA 1RAHA 4AS1A 1MBZA 2QVXX 4HAXA 1TC2A 3SZLA 1VSBA 1JXOA 3GWGA 2AKEA 2WTAA 3T3PB 1LLFA 4OBEA 3B1WA 3FHJA 1PEKE 1CQIB 1I2MA 1B14A 2E85A 3SXUB 3TIXB 2ZU0C 3X2EA 1YL7A 3MAAC 1MENA 5A9RA 1SD1A 3Q5GA 4NQZA 1K4MA 3G2QA 1TTTA 3DO5A 4MVJH 4NJOA 5BQOA 2X8WA 1VPDA 1LWOA 1O95C 3VR5H 3GJ7A 3ZBPA 1UPCA 1YZLA 4F12A 2FPMA 5JLJA 4O2AB 3TECE 4BNDB 3C87A 2Q4DA 3T3GA 1LX6A 1ZSVA 3D7SA 5M2QA 4Q9LA 4OHMA 1W88A 4J4BA 3PJRA 2P2SA 3ZIUA 1X87A 3C3XA 1PQPA 1E1RA 2X0KA 2K2QB 1JJAA 2I4LA 1L8QA 1VMDA 4I14A 2QX4A 1R3UA 1TGYA 2VJKA 4YCAA 2FUEA 3BMCA 3WB1A 2XB4A 1N0HA 3L1UA 4WK0B 4XLZA 2XXAA 4EZBA 2B98A 2I66A 1XR3A 3ORSA 4D45A 4LF5B 3DVSX 2YC2C 1TE2A 2AMJA 4Y30A 4RLFA 1G5IA 1GUYA 3T0IA 4R8LA 2QM7A 5CYGA 2BJWA 3GY0A 3RC3A 4BCBA 3EXG2 2NG1A 2XUJA 3ZCXA 5I01A 1K3TA 2PIAA 4G5OA 1EHCA 2W6JA 3ZE1B 2ECQA 5BSMA 3ZZUA 2VHQA 3K9FC 3AHHA 4AJNA 7MHTA 2N1MA 2ZCVA 5IM4F 2YIMA 5TS2A 2GX6A 1PFWA 1Z6XA 3K0EA 2GH1A 4MIOA 5T3YA 4WY8A 4UVHA 1ESZA 2PYDA 3OC6A 1T5LA 3BKWA 3F5SA 2ZYAA 1UXIA 4GX0A 1RR6A 4YMGA 1ZQ9A 3GBVA 5T67A 1I32A 3M5DA 3SDSA 4QUDA 1WEHA 3RPEA 3W5CA 2KPOA 2QPTA 2QRVB 2OPHA 1XD2A 1WR8A 1OGYA 3ZLUA 2A9VA 1RC1A 3EC2A 3H86A 5DTMA 5A6SA 2FMFA 2P3SA 3OF2A 4IILA 2UXBB 1P1RA 1SB8A 2X8JB 2Q3JA 3LT2A 2VF4X 1WLSA 2GYUA 1LY1A 2UYCA 5KJ1A 3IVAA 2VUSA 1O0SA 1VL2A 5FCDA 2AT1A 2I3AA 3THXB 2D7CA 3G13A 2J9RA 4B7CA 4ROTA 1C9NA 3T1NA 1OH8A 1LS1A 4IOMA 1B6GA 4X84A 5K51A 1H2RS 4ME6A 3IVCA 5E4FA 3BA1A 4GM4A 4AMBA 1J8FA 1NJ5A 1VBNA 3OF5A 4KWCA 4UCWA 5UKDA 4KR2A 3RFTA 4FR2A 3ZCRA 1KXZA 4YAFA 2ZS9A 3K2QA 1RKXA 1SCBA 4E30A 5GTDA 1HDCA 2O2EA 2IYPA 3CKKA 2J9FA 5I8ZA 4E13A 3ZK7A 1JH9A 3GR6A 3D8RA 3DC7A 2HBYA 2J31A 2H7YA 2X9NA 3OU7A 1ZKMA 1OXMA 4Z7JA 4ATNA 1JIKA 4H6XA 1QQ6A 5C8YF 1JIXA 1NTOA 5KSYA 3BRWA 4IX1A 4OB7A 2HLDA 3VSAA 2QAGC 1MN6A 2GGSA 1FP6A 2HIHA 2ZDGA 3NWEA 3UA4A 1Z75A 1PGJA 5GIPE 2FLWA 4U5QA 1L5KA 2RIRA 3B60A 1GVHA 1HORA 3CH7A 3VR3A 5FLEX 4TT8A 2B37A 1Q84A 1Y8QA 2EERA 2VHTA 2BEUA 3F96A 4XGKA 3U6BA 4CDRA 3W4KA 1SIOA 5JSUA 1GZ4A 1N5JA 5B1IA 2ANBA 2W0MA 3SVZA 1E5XA 3QSGA 2C4KA 1CJMA 1HDZA 3C5WP 3EXIB 4NOKA 4EMUA 1IAQA 5TNXA 5CBPA 5LYJB 4A0RA 1K3UB 3TB6A 3QUTA 4I8IA 4JROA 4F6RB 3HYSA 2DFNA 2WWVD 3AHEA 3TLJA 3KJXA 1OKKA 3A70A 3JZFA 1XVLA 4PBSA 1O2DA 2HDHA 4WBXC 1ZBQA 2QP4A 3O3NB 2C8LA 1GPYA 4DBZA 2PEZA 5JNTA 3WP1B 1QNFA 4HK4A 1V16B 1BOOA 3MBKA 4XWYA 3VC3A 3QX3A 4LAFA 4TTVA 1QOQB 4L3OA 3HU1A 3GGPA 1Q15A 3K8YA 4IUCS 5FHRA 1KR2A 2H2AA 4Q00A 5BUSA 5A4AA 3AESA 1TEZA 2IDMA 3OQHA 3RK4A 1FQOA 5JD4A 2DCMA 2GSWA 1P2TA 3M4ZA 3V8PA 1GQQA 4LHSA 3OM0A 3UWMA 4OI4A 4RFLA 4DT1B 5CEEA 5EJ4A 5A5EA 1TT5B 3DQZA 4E4RA 3C1OA 4GVLA 2BHTA 1TCCA 1A1SA 2P8JA 2VTKA 3GXBA 3P26A 4ILKA 4PIVA 4KAXA 3TWOA 2FY8A 4M9ZA 5F78A 3KHSA 4ZQFA 1TIKA 2XODA 3BD6A 3U7GA 1ZM4A 2DLCX 3FAZA 1GCUA 4CIVA 3U4HA 5DT9A 3IIKA 1L5WA 3VH1A 3WVNA 4N01A 3RFXA 3WGOA 1R9MA 5CH8A 2M98A 4RENA 3UENA