3UB3A

D96n variant of tir domain of mal/tirap
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
125
Chain Sequence
b'SSRWSKDYDVCVCHSEENLVAAQDLVSYLEGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
molecule tags Immune system
source organism Homo sapiens
publication title Structural Insights into TIR Domain Specificity of the Bridging Adaptor Mal in TLR4 Signaling
pubmed doi rcsb
total genus 41
structure length 125
sequence length 143
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3ub3A00
5H3CA 2M1XA 3UB4A 3UB3A 3UB2A 1FYXA 1O77A 4C6TB 4LQDA 3H16A 1T3GA 3OZIA 4W8HA 4DOMA 5KU7A 3JRNA 4LQCA 4W8GA 1FYVA 4EO7A 2JS7A 4C7MA 2J67A 4C6SA 1FYWA 2Z5VA 4LZPA 5FORA 4OM7A 4C6TA 4FZ5A 2Y92A 4C6RA
chains in the Genus database with same CATH superfamily
4OHCA 1XF9A 4WCFC 1QZZA 3T1VA 1RYEA 1U7UA 3WJ7A 2QDKA 4Y2XA 4G0NA 4RS3A 4GS5A 3UJ9A 5HRUA 2LGJA 1OVGA 2J3QA 2HNBA 2IZ7A 3HY4A 4ZXPA 3BXXA 1Z6ZA 3C15C 4BB0A 4W8HA 4Y0VA 5A3SA 3W04A 3RCBA 4TN1A 5ALIA 2FK8A 3PD1A 4TLBA 2Z6QA 3WBJA 1RYHA 3G2NA 2G0NA 4KLNA 4KU4A 3SC2B 2UXBB 3FR7A 2O3SA 4YV1A 2PLAA 2IX9A 3L2OB 1KS2A 3MAJA 2R6R1 3B1KA 4JCCA 1FLVA 2EX1A 1OC2A 3FROA 1ZD2P 3SU8A 3ZHVA 3IP7A 1T1IA 2W43A 2FG6C 5CLIA 3TEFA 2IY9A 1VYVA 5FI0B 4ZU3A 3GARA 3NYQA 4GGOA 3GV0A 2K5UA 1OUMA 1ZCBA 3EZ2A 4UHHA 4F46A 1KTIA 2AOUA 1R6BX 4U3JB 1A7JA 5IULC 4FEYA 1DJOA 2FPIB 3O8NA 4OAQA 2A5LA 3EZYA 3JASA 1Q19A 3CLSD 1FQKA 2FZEA 2I2DA 2LRHA 1GGVA 1IU9A 4ZT6A 5F7XA 3LDGA 4CF6A 3FOWA 3QH4A 4EY5A 4EI7A 1NN0A 5CNMA 1G20A 2P4HX 1U6KA 1FSGA 3HFGA 5GPBA 2VDRB 1B43A 2NV0A 5LA6A 5JLJA 3OZDA 3CUSA 4BWFB 2W42A 3DXZA 2QVCA 4CMEA 2F1RA 5CH8A 4M38A 2UYCA 5E0KB 3THYB 3N86A 2UUCB 1GAXA 3WK9A 1XZ8A 1GL6A 2WJ6A 3B70A 1OT3A 2XPCA 3M3HA 1VL5A 4JMLA 3AFHA 3ETNA 4ZRMA 4Y2PA 5TMBA 3UCEA 4CDNA 2ZJAA 3STYA 2FX2A 3HJUA 3R7NA 4HR7A 3W1WA 2B1JA 4C6TB 2NSYA 2XUPA 4MDYA 4B7XA 1P91A 5HGJA 1UXKA 3KQHA 1C7EA 5H16A 1X7DA 2XWBF 1J2JA 4I9HA 2P2NA 2HM7A 3PC6A 4JBGA 1J2UA 4CHTA 1MB0A 1YQGA 4J9UE 5CPFA 3KDSE 1CJMA 2OWEA 4E5UA 4A0HA 2RGAA 3HLTA 3E70C 1O6GA 1LZLA 1FSZA 1P9RA 1RVV1 2G9UA 3OAAD 5C4GB 3FLEA 2O7NA 1IEVA 1O94C 4Q01A 3UH0A 3IMGA 3IUPA 5FLYA 3LQQA 4C9BA 1XZKA 1B8VA 1LRJA 1C7IA 1Z25A 2GFIA 2NZVG 4DWWA 2QW8A 3S2YA 2AOVA 4MRMA 1VC2A 4RDHA 5KYNA 5KYYB 3DW3X 4M8SA 1CR0A 1VLHA 4BQSA 2XDWA 3Q3VA 1COWD 3OQ1A 3INNA 1N75A 4RGYA 2DJIA 2Z09A 2YHUA 3ONEA 3NXSA 4MCAA 5EMMA 5BYJA 3R8CA 3TW4A 1AMNA 1H9CA 2FW8A 3R0IA 1PTJC 5JNTA 4AXBA 3AERA 4CL0A 4ZOLB 2ZBVA 3DM5A 2UYHA 1ISRA 1N9GB 5DCYA 3UK7A 5GJWC 2JATA 5JZMA 5LQJA 4NCKA 4Y6GB 5EP4A 1QHXA 3DE6X 4U2GA 4X66B 4I5EA 1Y33E 4H7KA 2DP4E 4YS6A 4XTCS 1F7UA 5FWNA 3G9XA 1SELA 1GDDA 3EYAA 2IUSA 3Q6MA 4B17A 4AUMA 4IDAA 1YVUA 1IAQA 2CLCX 1OTYA 2C5SA 1I8TA 3ID6C 3K9QO 1I7SB 5LMUB 3D6HA 1C3OB 2D3TA 3G1TA 2C4HA 4GR9A 3GJYA 2PQ2A 3FNGA 4R01A 5FBVB 2E9SA 2P2YA 3OJEA 2IU4A 4GPIB 2AMVA 4XJSA 4AI6A 3V8VA 2R62A 1MAVA 3ETEA 3C70A 4GXQA 4YJFB 5AXBA 2NTEA 2VHTA 3JYQA 2HQRA 1EUDA 2AEEA 4FHZA 1MB4A 2GCEA 4GW3A 4QPJC 3W7AA 5HX7A 4F6RA 3A6DA 3CZ9A 3H42B 3OQHA 1GNQA 1WSWA 5DW3A 1IBMB 4Q7MB 1LDMA 4FM9A 1F60A 5A0VA 2H4FA 5JYEA 2P9TA 4NQZA 5A0TA 4A27A 2L0XA 1FDVA 3FVRA 1B41A 3LHKA 1ULUA 1RQGA 3RJZA 4DRZA 4F4UA 1Q7EA 2I6UA 3QM1A 1USGA 3I8OA 5I7EA 2B5OA 1L5FA 5E9QA 1L5NA 3RVJA 1XNRB 1N5DA 3B6JA 3KTAA 1RE1A 4HGZA 1J6UA 5C52B 1C4KA 3L4SO 5DN9A 3L84A 1NN1A 4AN4A 2UVQA 4FFSA 2QV0A 3PQ6A 5I45A 1FTNA 4KUEA 3A6LA 4QPDA 4WZ6A 2LIPA 2I6XA 2PX5A 1OFUA 1E1RA 3U61B 5JG7A 2GPTA 1S3GA 3G5AA 1IOWA 1VZ2A 2QLJA 2YHIB 4JCOA 3WIEA 3ZI0A 5BWLA 2DM6A 4LCJA 5C7OO 4OYYA 2C78A 4LYGA 4Q3OA 4RXUA 4F4IA 1BDIA 3N0XA 4B6SA 4OYLA 4E6PA 1CULC 5D1NA 3KHKA 4HWGA 4N18A 2WJ4A 2FZ5A 1SEVA 1EXNA 4G0UA 4L3OA 1U28C 4KRGA 3CZAA 1FCJA 3NIBA 3Q3EA 4JR0A 1WOYA 3LP5A 3PJRA 2B4TO 2GM3A 3I2KA 2G9ZA 1UBKS 4E2XA 5DXJA 5COAA 2TSYB 3W8RA 3N8GA 2O0KA 3B89A 4M7OA 4BASA 1WVIA 2P0YA 4TX1A 5K2MA 2RKOA 3CT4A 3Q6NA 3F0TA 1YGPA 3LPLA 2W2NA 4XX0A 5IBQA 5HJ7A 4EHLA 2BFPA 2J5QA 2ZR9A 2CT8A 3E7DA 3Q5GA 1YL7A 2LKDA 4JXXA 2JGMA 5F76A 1LI7A 1IHOA 2RARA 2EAUA 4K9PA 1DWOA 4KXLA 4F8EA 3G6WA 5F5NA 3SZRA 3QX9A 4RTSA 4JA2A 1MABB 1D1SA 3AKYA 3NBXX 5AKLA 4ZT2A 1B7GO 3L1KA 1UPBA 3HO6A 4A6EA 2VOEA 4UTVA 6GPBA 3RYFB 5K8IA 2V6FA 5FULA 3BIFA 3VYUB 2OQ2A 4E70A 5CCXA 2P68A 1E1RD 1VSVA 3NDPA 3DDUA 5JU6A 4OBEA 3HNOA 1KYWA 1ETHA 3VSBA 1Z6QA 4WXPA 2JLZA 1JLSA 5I7SA 3WYBA 1TO2E 3PUKA 4OB8A 2GTHA 1U3GA 3AV0B 4FLFA 1BJTA 3AVOA 2OY0A 1D9XA 1T9HA 3EDCA 1XGKA 4N6GA 3MSXA 4O4LA 5EINA 2ZQYA 3VZSA 4HNSA 3W2EA 3OQ6A 1JVNA 1TVEA 2CL6X 1M3SA 4PVCA 4RM2A 5GOZA 2X7JA 3UY4A 3CN9A 4RVOA 4LRUA 4M0EA 1DU4A 1PL7A 1RCFA 4REMA 4BVFA 2OB1A 5KKCA 5E95A 3GP5A 1T2CA 3L1HA 3UT0A 1EFTA 5JSUA 1JDVA 4DB2A 5JS8A 3R4VA 1I4TD 1L5ZA 1N6LA 3TFQA 1JB9A 3CCFA 1PVOA 3A6JA 4M88A 4MMZB 3UB3A 4A0QA 3RAFC 3D3WB 1MO5A 3K8OE 4EARA 1T3HA 4F86A 2ZRAA 3STHA 2DLCX 3H17A 4MRPA 3TJMA 4CNQA 1K5GA 2HFJA 4LE2A 1HA3A 2BMJA 4IMPA 1QG4A 4NYMR 1S1CA 1E5TA 3K1JA 3M4XA 4KQKA 1DMSA 3RE1A 1FLDA 4ZICA 3RODA 3E4CA 1HFKA 3B1VA 1LV7A 3U7RA 2BGIA 2DBYA 1X7XB 4JVMA 2OA0A 1OFVA 1DBWA 4BVEA 4UVEA 2QGZA 5IABA 2I71A 5E1BA 3TW8B 821PA 5C1DA 4EYEA 1PGPA 3IKTA 4Z53A 1B8PA 2XE6A 2FLVA 2X77A 3BFKA 3BILA 3KX2A 5JNSA 1X7WB 2ZFUA 3S0JA 2NNLD 4CEHB 4QSMA 1P81A 4QQNA 2CNWA 2JLYA 2H07A 1MJNA 3OCCA 4B7AA 1FMLA 2O7QA 2P3QA 1CQIA 2AI1A 7ABPA 4KLAA 2QIOA 2WF5A 3NHFA 3QZUA 1Q16A 2AI2A 1N34B 2V65A 1A77A 2AKEA 1OWOA 5E7QA 3BMOA 1YZNA 4JS0A 4Z3OA 5HM8A 2XZLA 2CCGA 1PEAA 4MA4A 1JSXA 4EG1A 4Z3DA 3A1UA 3ICOA 1ISJA 3RQSA 2ZUUA 2H1RA 4XLLA 3EXFB 3FNQA 3I6IA 1RAAA 4KN8A 3W2GA 4PC7A 3AR8A 4CLOA 4V0KA 3PC2A 3E3OA 2QXYA 4RFSA 3WY9A 3F7NA 2Q5HA 2F7SA 1UMDB 1GCIA 2VHWA 3NGLA 3LQ2A 3QVKA 4J16A 3DLTA 4GMDA 4J03A 4LJ4A 4RVSA 5JRJA 1N0HA 3L0ZA 2HB6A 2QR5A 4DEXA 3PA6A 3SE0A 4TWJA 2D5CA 2BGRA 2Q4RA 4FD3A 2H4YA 1E0AA 1YR9A 3BMQB 4DWVA 1DWPA 1BWQA 4DLYA 3L6RA 4YASA 5LYJF 2R47A 1XZLA 5IT4A 2WU3A 1ZH6A 1NLZA 1RT9A 3GH3A 3QKRB 1CFZA 2B1IA 2O52A 3N87A 3U3MA 2C9MA 4AJLA 2EP5A 4R0NA 5JSKA 4F6CA 3E3MA 3H19A 4P33A 2C7QA 1QQ6A 4N0EA 3W34A 5C5EA 3UMCA 1B14A 4ZO6A 5KYWA 1WQ3A 5EKUA 3EXHB 4E31A 3BVPA 3FZEA 4FFLA 3EZ9A 2VWHA 4GZLA 4G5FA 3HXOA 1A4XA 1GN9A 3BWXA 2R8PA 3MWGA 4KLZA 1NNEA 1C1HA 1GLNA 1RKXA 1IHYA 3C3MA 5KQGA 2FYTA 4PBSA 5LP1A 2NUTB 2PYIA 3P9NA 1D1QA 3K1ZA 3L8GA 5BV0A 1E1CA 2VRBA 1Q0QA 2GA8A 1SY7A 3KQQA 1NFRA 1OFHA 4UUAA 4KREA 2R1UA 1RPJA 2WOJA 4KO1S 3SOPA 2JB9A 4URWR 5CIYA 3O4FA 4HF7A 4UDXX 5JE8A 2QNBA 3BE4A 1I3MA 1PFQA 1EWVA 2EQ5A 2Y1DA 1D07A 1E92A 2C2WA 2VHEA 3ECCA 1N1EA 4INJA 6REQA 1U1CA 1D2NA 1SKYB 1RNLA 1VE5A 2L82A 3L6UA 4JT9A 2WRZA 3RJMA 1A97A 2V6MA 3JAKB 2G36A 4F3NA 3GPCA 3L7IA 4RQTA 4QC2A 1ZGJA 1P9NA 2P27A 3BC1A 1QRRA 3R77A 5D01A 4P38A 4OQLA 3ZDRA 1QFXA 4R8RA 3ITDA 3LL7A 1MG5A 2IHKA 2V7TA 4HWRA 3RFCA 3W5HA 1FFDA 1WQ1R 3RV3A 3HXLA 1ZD3A 4KB5A 2LCIA 2P9GA 1FMFA 3TCXB 2ZLBA 3UV6A 2IPNA 4TLDA 2VT6A 4UU0A 3J7TA 1PR0A 3ELUA 3O93A 5LP6A 2V5AA 4C1NA 3L5KA 3KTFA 2V3VA 4UC0A 2AN1A 4TYWA 3ZXIA 4HB2A 1CQWA 1IBCA 1V7ZA 3OHPA 4QYXA 1G3IA 1HKUA 3L49A 4BFZA 4BNGA 4DWOA 2D2IA 1EFPB 2BTQB 3FPCA 2A3NA 5IJXA 5IH3A 3TINA 1U0GA 3ZJVA 3DZHA 4PZCA 2FPGA 2MSEB 3THXA 2O19A 1R4MA 1KERA 3KSZO 2W6QA 2PUDA 4B45A 1T5OA 5A9SB 4XWWA 1JI3A 4L9RA 1KFCB 1Z2EA 1RFLA 4HB0A 2R00A 4KPUB 5EP3A 4A0SA 2BOVA 3IOYA 1ND5A 1PV4A 4FMCB 4LOIA 2H00A 4PYNA 5HJEA 3ZD8A 2QMOA 2OG2A 3M70A 4R5MA 5FHQA 3U44A 2XADA 1RKVA 3PYXA 2AG5A 4RGBA 3SSOA 3WNBA 5KSYA 3ZWXA 1ELOA 2JFQA 3PK0A 3I09A 1P2VA 1J0XO 3OOWA 1NXPA 4Z4CA 4HLUA 1B3RA 2WEKA 4R2KA 5JI3E 3TLYA 1EWYA 1KOFA 4YAOA 3IB3A 3T1NA 4MV1A 4HWPA 1TKAA 4HPXB 1C7ZA 3MS7A 3UJBA 4PZZA 4FOSA 2KLBA 1PJCA 2EKLA 4BIIA 5JC8A 3AHFA 1Z5ZA 1UPCA 3DL2A 1SU4A 4D4MA 2BBWA 4GOKA 5KYYA 2AH5A 3JQ7A 1PJRA 3ODPA 1MQAA 1I7PA 2C99A 2J9FA 2VAMA 1Q7BA 2PYZA 2X9NA 2HSDA 2ZI6A 1J5XA 1HV8A 3DO6A 4C5AA 2JW5A 4DJEC 1X86B 1TNDA 1AQ6A 1H6CA 3VOSA 5DYYA 2KS6A 2ZI9A 4J0EA 3DP7A 2RK4A 1LPNA 3N8KA 1TCVA 4FCCA 3WJ1A 5LJLA 3EPJA 1E8DA 3AONB 3I32A 3WB9A 4URXR 5KSPA 2BH2A 4QFCA 4WY5A 3ZIUA 2B0CA 3H8JA 1C29B 3C6QA 2FLKA 1KMQA 1NTOA 2RG7A 1UWKA 2ZB3A 3IBTA 4RPGA 1H8EA 5BR8B 2EKZA 2W2PA 1H2WA 1R4AA 4EJSA 3ESXA 1S3IA 1T36B 3INYA 4RQUA 2WSIA 3SIWA 2GN1A 4CMBA 4ZEMA 1T36A 1SQSA 1E9FA 4J3NA 3VDQA 2JZCA 3EOZA 1N36B 4TT3A 3X1MA 3WWCA 3UC9A 3EVBA 3CEHA 4HTFA 3KQPA 2ERXA 4NP6A 2HJWA 5AW0A 2JKZA 2QT0A 3V00A 1IK6A 4EUKA 2G4VA 4FBMA 4Y1GA 5LLDA 5LYYA 3U4QA 1MDFA 2QRZA 4Q02A 2E82A 4N39A 2C2YA 4TV9F 3NT2A 4HFRA 4TRNA 5A1JA 5ICGA 3NP9A 1S8OA 1T24A 2RIRA 1NGSA 3PQ5A 1PWZA 3IO5A 5EE5B 3RB8A 4OKIA 2AOUB 3IP3A 3FYUA 4RKQA 4X1KB 4N03A 3AEQB 3K1TA 3OEEA 4L9WA 4KPGA 3OJFA 4CLOB 4DMKA 4D82A 2G09A 1CUEA 5EJEA 4IIVA 3VSEA 2QQ0A 3DMHA 4GM1A 2XKBA 1DKLA 4OYRA 4XX1A 1TIKA 4M9RA 4AZSA 1T8SA 3LS2A 3LLSA 4JBNA 1KO5A 2G67A 2C20A 1QVWA 1FXSA 2I7TA 3SSAA 2D0DA 3TRDA 3T5MA 1I51A 3A4LA 2W2KA 5LLSA 3U3ZA 2NAFA 3BFXA 3BCUA 3RSOA 4TTAA 3IL2A 3ABQB 3ZIAD 4CM4A 1V2HE 4DEYA 5B64A 2R1VB 5EPOA 4WD3A 5J4HA 2E85A 5JAHA 2Y99A 3ZXYA 4U5QA 2YZGA 1F0KA 1I7NA 2ZUVA 1YAHA 3UUEA 4B3GA 1DEHA 4F85A 3SHFA 3F5MA 2HMWA 2QZZA 3DE5X 4EY7A 1XLTC 1C30B 4V1CB 1LBIA 4EUSA 4B8WA 2HDNB 1YRLA 1TKBA 1PT6A 1ZGCA 2JHGA 5SY9A 5SYNA 3LBAA 2F2TA 3B1FA 3PUYA 4HLUC 4AX4A 5ITZB 1QP7A 4LWZA 3DBHB 3EMKA 4DJJA 1U5BA 1QM5A 4PPFA 2G9VA 2YVQA 3AR9A 4RC9A 4EFLA 4EG8A 2IU6A 3AU9A 3F5FA 3RTGA 4F3TA 3HVHA 3M1IA 1UBHS 3OPXA 3TQOA 3V34A 5BMVA 2OP1A 1GFSA 5AKXA 2FSVA 5H1YA 1QH8A 3QITA 8GPBA 3L0PA 2JVIA 3SQLA 2VBFA 4EYQA 5JNRA 5KQSA 3SVLA 2YHBA 2JIOA 1M6HA 2H51A 1PNOA 4J1SA 2VJMB 3A1WA 3L7CA 1CNMA 1W49A 2ISSD 3M6FA 1D5WA 2PTHA 4N3BA 4XDHA 1AB5A 2EERA 2EV9A 3Q6IA 4L28A 3REQB 3ZWCA 5CBKA 4Y2HA 4DLZA 1YJ5A 2EDCA 3FZGA 5DBFA 5F35A 4O8CA 2QEQA 4MRNA 1IOVA 1G38A 4Q24A 1QKKA 2DFLA 1OXBB 1LRKA 3OKAA 4WZAA 2BTOA 4KQ2A 1EXDA 4RGQA 1TIBA 2EX4A 2XOXA 4IS3A 2G5GX 1V16A 3ZGYA 3W90A 5GZ3A 2CWWA 1QHSA 3Q0EA 2QSUA 1ZM2A 1KGSA 4Z8YA 3UWDA 3M1LA 5F52A 4ZEOA 1VL2A 2Y0DA 3RUHA 4PO8A 1LJLA 4OQQA 5JJCA 2CDCA 5I4CA 4HAUA 1YXMA 1A5SB 1PEKE 3S44A 1Q0PA 4JD5A 1Q91A 5A5FA 2X0NA 4B4KA 4GWGA 4NFHA 3GD7A 3OQJA 4NESA 3ENWA 3FUWA 1C7FA 5LM3A 1YVPA 4D6YA 2O3JA 1PVVA 5KOYA 3QIVA 2OGSA 3SJ7A 1MO3A 5K3FA 4MWOA 3A26A 1YTUA 4AROA 1PJLA 1QR2A 5KDDA 2I6QA 1C7QA 2JAXA 4NHEA 4H0NA 5HDBB 3CJQA 3SIPA 4FZVA 5DM0A 5AI5A 3FWZA 4D74A 1U2RA 3CLTC 3GT4A 2VYVD 3DZJA 3C7TA 3T7EA 4LF9B 2QD2A 1L4MA 2X0EA 4L4SA 4UBJA 5KNBA 2WWWA 3M5DA 1F48A 4KMRA 2FPRA 4NCNA 3VTAA 1H93A 2XTJA 3LGXA 5HZGA 1DE0A 5TQVA 3BOSA 2Z4RA 2GD2A 4WTOA 1TM2A 2AX4A 1KR5A 4MVJG 4MXDA 3QKWA 4MV0A 2QMYA 3IQDB 2DQZA 3NHKA 5CDFA 3SF0A 2EIXA 2FUG1 2F3TA 4BKQA 1M2EA 4LQCA 1OU4A 1U8ZA 2F1HA 2REBA 4BNJA 1ENYA 4HNUA 4OX9B 5F7ZA 2RB5A 2PT6A 4BNVA 3EAGA 2G1AA 1FOEB 3MD0A 1C8BA 4MV7A 4OD0A 4OGWA 1WV0A 5COQA 3ICCA 1MZPA 3BMOB 3CF6R 1OW3B 3QNWA 1GD1O 2BHTA 5CM9C 1K88A 4XD7D 1I4OA 4WCFB 1CF2O 1GHTA 1QTRA 4L2IA 1JFVA 3C48A 4ZEVA 3CKLA 3CT6A 4CI0B 1DRUA 3OT4A 1D0VA 1DIBA 1WMDA 3G5MA 1RLUA 2J87A 4HQOA 4QNMA 3ZU4A 3HCRA 3PI6A 4S35A 2H1VA 1Y98A 7ADHA 5FPPA 2GD1O 3N2YA 2OFFA 3K15A 4ZQFA 1HG0A 1KIAA 2JFOA 4UHCA 5I9NA 3EX7C 1GRRA 3PHJA 2OHGA 2VHJA 3G7NA 4NH4A 4MW2A 4CPDA 1VCOA 1CUBA 3V3KA 1GVHA 3ZZ0A 1FFXA 3OF2A 4B3HA 2DTEA 4EW2A 5IM4A 1XPOA 4Z7JA 1YBHA 3OQIA 3VNRA 2BFDB 1MOZA 2Y05A 4YJFA 5K3FB 2X0DA 2PZLA 2WBLC 3SDBA 1TX4B 4L15A 3AP3A 1ZH8A 4ZU6X 3GIWA 2P5UA 3OTQA 1FVXA 4IWXA 3ZDZB 3ZDCA 5HQJA 3ZWDA 1QAMA 3N2NA 3NDIA 3S27A 1EGQA 2PUJA 2ZI3A 3DC2A 5HZMA 1UT5A 5L7YA 1T5SA 1YTLA 4XGKA 1HT3A 4QSHA 4BNYA 4DA6A 1PLJA 3LSTA 3UOWA 2PKEA 1C0IA 1GR0A 1YKGA 2GZAA 3W0LB 5IN4A 3ZHQA 1QCYA 3RRJA 4OPMA 3RRBA 1BU5A 2AZTA 4NBLA 1CUFA 1FS4A 5FKJA 1GKYA 5EE3A 4B44A 3EAFA 5I5EA 5AP9A 3QUQA 2JJ1D 4WCVA 3ZV6A 2PUBA 2F90A 4EPYA 3AVUA 2WLSA 1XK6A 3NTQA 5C3UA 4EIWA 5HQ3B 3H5IA 2XHEA 5EHZA 3U31A 2AJCA 3CH6A 1DAFA 1FEZA 4YLEA 2Z9CA 1V3QE 3EFHA 5TIIA 5BV7A 1ZGHA 1AKRA 2OZVA 3HH8A 1O5IA 1TJ3A 4NX2A 5J2TF 2CZGA 3VC1A 2Y93A 1JPJA 3JU3A 5EEHA 4FDMA 4ETIA 4MKIA 1JHDA 3FBTA 3RUIA 2D1QA 1YRAA 3TLEA 3J80A 3FAZA 4TRMA 1N7JA 4KJZA 1EU1A 2I8AA 4PG5A 4ZTUB 4Z2YA 2JJ2A 5KTNA 4KXNA 2P5YA 4X41A 1Z06A 4RNCA 5F2EA 3H4MA 2DUJA 3KS9A 4IQGA 3O0TA 4HTFB 2CXPA 1OLSB 2ZJYA 4FGSA 1DIHA 4MR8B 4AKHA 3SEFA 1TLFA 3DAOA 2CVFA 3IV9A 4M0DA 4XTRA 1L4FA 2PHZA 1ZPDA 4G85A 4OM7A 5CLHA 1HETA 1BX3A 4FKZA 1O94A 4HO1X 3RAPR 1VHJA 5EE9A 5ES3A 1NN3A 3Q0TA 2VCHA 3EC2A 1HMPA 2VBIA 3VH2A 9LDBA 5AW1A 5IAAA 1W29A 1S8FA 5JSFA 3DMPA 3OJWA 1WKBA 1XWIA 4BU0A 2CV2A 2DWCA 2ZAIA 1QYCA 3I01M 2HHJA 1JIJA 1O6FA 4EELA 4AMUA 4OXYA 1S4MA 4H3SA 3UOAB 1IB0A 1PRYA 5AOVA 3UA3A 1GG9A 5KQPA 3CEPB 3UAWA 4ZGBA 3P2IA 1F6DA 4J2OA 1EZ1A 4FYWA 3ZHZA 4EO7A 4JLAA 1WCIA 2A5YB 3W1EA 4CKYA 1ZC4A 1OIWA 3MJRA 1JJVA 2VNIA 2WF9A 1QRAA 3GQVA 4V2IA 1TD1A 4KQFA 3KV3O 2HGZA 2A94A 2FPKA 1BGXT 3QFFA 3IQEA 2DPYA 1PUXA 1RWQA 1U94A 3K6SB 4EJ0A 1IN8A 1WUJS 2C03A 3MWEB 3C1OA 1NDQA 3OD5A 4GKVA 4OMCA 3VYWA 1B42A 2HYDA 5IUKC 2GF2A 5CX1B 4DBLC 2QAGB 4QU8A 2P4UA 4KQIA 2CFRA 4ZZ2A 5DBGA 4MVJE 2QRNA 3CF0A 3HXKA 3NBZC 3AHIA 4LWOA 4INAA 3P2YA 2FEAA 1I2BA 1R8QA 3K9WA 4IJQA 4ZQEA 1QX3A 1X9GA 3U4QB 1VPDA 1T8RA 3WL3A 4JGIA 4OJYA 5DN6D 4N9WA 3QW2A 4M6WA 1KI4A 1HQCA 2AFHB 5HCIA 4B73A 3L1JA 4MTLA 4D41A 3CZPA 1E32A 4D9JA 1HE8B 4YRCA 3DTVA 5CXSA 3CPSA 4ZCPA 2BKXA 2GPNA 2BI7A 3ENVA 2QW0X 2C9ZA 3WBFA 4NYIR 2WD7A 2NNWB 2W98A 4P36A 4RLFA 4EM6A 2Q9CA 5ILOA 4RCYA 1QPBA 5BSTA 3WMRA 1Y7PA 2IYAA 4B7UA 1BCRB 2WAXA 3EJ6A 3TAUA 3JQ9A 3RYHB 5EIAA 4BTEA 1ZK0A 1DZ3A 3WLLA 1TKCA 2QN1A 2Y0CA 1U0EA 1GA1A 2JGLA 2Z2IA 2C3OA 3BFJA 2WKRA 3QU2A 1Z0KA 4Q9LA 3I45A 1PFKA 1E5XA 5BUCA 3C3YA 3A1CA 1ZJWA 1Y3HA 3AL0C 3U26A 4QJBA 4DDWA 4ZYYA 4BIMA 1UMKA 2GAJA 1Z4LA 2KWIA 1U0FA 2Y1OA 2OHOA 4WGGA 1Y3FE 2QD3A 4XSHA 5T4EA 4ZI5A 3DDCA 1JQ5A 3X1KA 3K70B 1JQLB 3KQWA 2W9XA 3E0XA 3NBFA 4YDHB 4YAFA 2R7KA 3KYDA 3ORFA 1QCDA 3DXXA 2FFHA 3T7SA 3H5VA 4JJ6A 1VKZA 2A5DA 2P78A 3BHIA 4WFQA 5B6IA 2JFXA 1QQAA 4PHTA 2YYYA 2PFKA 3FIUA 4R9NA 4EB6A 2ZWAA 2B2XA 4R83A 2C94A 4CIXA 2OAGA 4JFRA 1AKYA 1GRNA 2ZWIA 3S6JA 4EZIA 4NECA 1LDYA 1LVGA 5CVJA 1Y4ZA 3VO8A 4MO9A 4LJSA 1MJHA 1E7SA 1LLUA 3C8DA 4GG1A 2ZGVA 3CLVA 3TFOA 1CQJB 1MLDA 1Y6QA 4LVCA 4LQDA 4ZOLF 1WXFA 2DPXA 2IHTA 5F73A 2AMJA 2XKJE 1PFYA 2VJNA 5JAMA 1UDWA 1W44A 2QVZX 1D6MA 1UCFA 3AEXA 3BF7A 3VRHA 3DE3X 5FWXA 4GR4A 4Z51A 4I0WB 1EFHA 3AR4A 2VSOA 3IPAA 2QTNA 5KNBD 1HNWB 5L4NA 3SHOA 4PQFA 3FCYA 1N33B 1PKEA 1IJFA 2XXBA 4I1SA 4V3BA 2IXDA 1L4KA 3HKBA 2IDKA 5KHAA 3WDMA 5KHLB 5HEKA 5C34B 5BRNA 4NEGA 2C5LA 2R4QA 1CP3A 3N7UA 2NU8B 4EQ6A 3I1YA 3MTDA 1VB3A 5FQNA 3UJHA 1SUSA 4A92A 4RTOA 4E5KA 2H1OA 9LDTA 3NRCA 5INTA 5JAOA 4XWTA 5K05A 1YR8A 2IV3A 2BEWB 3G8CA 4BNHA 1ABBA 4Y9SA 3JAKA 2CXOA 3L0IB 4L07A 4LZJA 4M1OA 1VCHA 3G17A 2H0RA 2R48A 2XYQA 2YYAA 5JBIA 1CQPA 2CL5A 2SHKA 1O94D 1P61B 1SIUA 3TXXA 2WQZA 3GVPA 3DBLA 4PLVA 1MHPA 3P8ZA 3RAJA 1FYEA 1QYIA 2RH4A 4RD4A 2E6UX 4E46A 4MX8A 3K2IA 5BWNA 1G18A 3DVQX 1G5QA 4C2TA 4N5LA 4NCBA 3WQBA 1E64A 1POXA 1XP8A 4LPKA 2YRXA 4MUGA 3JV7A 4O1IA 4R98A 4ZPJA 4EGCB 5TX7A 2AXQA 4JT8A 1DUSA 2A57A 2VXBA 3SZUA 1JEQB 4Y9TA 3I5YA 5JPCA 3EXEB 1BEUB 4RVCA 2CNNA 4RTNA 2W71A 1S1MA 1O5OA 1RJWA 2HCBA 2IZ0A 2Z98A 1QLJA 5DNEA 3VNVA 2FOIA 2Q28A 5EE1A 4JVSB 4EY4A 2FE1A 3L9WA 2HRZA 4URYR 3EEQA 3GEGA 3H0KA 2LXNA 5D87A 3NORA 3ZWOA 4B47A 2J0QA 3HV0A 3HM2A 4GXRA 4IEIA 3GGCA 4LDRA 4NVRA 1CUIA 1CR6A 1JDJA 1EDBA 1GSIA 1AKMA 2D1FA 3F6CA 3PD0A 5AJHA 5EY5B 1A9RA 3F74A 1T2VA 3TMYA 2B8WA 3OZVA 4WLOA 1QGAA 3VJRA 1NYQA 1OGYA 1X1RA 2PGIA 3QX7A 2C84A 1I2CA 3QLUA 4WVFA 3SD7A 3ZK9A 4ZO7A 1QGUA 1ZS9A 1WUYA 2GBLC 3IMFA 1L4LA 2VAPA 1JAXA 1ODIA 2O0LA 1XHEA 4YONB 3IJRA 4ZK2A 5DM2A 4KEAA 5DHFA 1SG6A 3IIIA 4D45A 2HXYA 2OORA 1W5EA 4E3ZA 2NVUA 4ZAWA 3AUAA 4KPEC 1L7NA 2EVWX 3EVEA 2IE0A 2X7XA 2DFNA 1L7BA 5LKRA 4AY5A 3D4BA 3KYCB 3A1SA 1TI7A 3MBKA 1T0JB 1H69A 2P2DA 1C8VB 1KZ6A 1RM5A 4MCHA 4O63O 4S12A 1YE8A 3SQWA 3BX1A 4O4LB 1RABA 1JKMA 3X1ZA 2SBTA 1RVDA 3D8NA 1L5VA 1T5LA 4TMTA 4Y3UA 3WLQA 4M83A 4B80A 1ML3A 4QKQA 1L4YA 1ZCFA 3NGXA 4UAVA 3I58A 5DPMA 1UC4B 4IRMA 4J6EA 4E15A 4JP3A 1EQUA 2Q8NA 4GC9A 1BQ4A 1BGWA 3HPRA 3PQEA 4PICA 1AGPA 1DBVO 1R5OA 4QGSA 2C82A 1MENA 4FOTA 4UBLA 1XZDA 1AHHA 1K9SA 3CZCA 2W4QA 5ALFA 1ZVJA 5LMCA 5IZCA 3F7MA 1J20A 2DFPA 3V33A 4PHHA 1MG0A 3I6ZA 3OFSA 1ZUIA 1XT6A 1HZZC 2O2XA 2ZRBA 1Z8NA 2GILA 3EVDA 4KHZA 3UTDA 2YKGA 1BHO1 2EQBA 2OOKA 2H9YA 3DEJA 5KO2A 5CXXA 3PQDA 3TJRA 2Q0SA 2IOQA 3EW9A 3LFUA 3NHWA 4UMEA 4C2BA 2YOFA 3DP9A 1GKIA 1N2CB 2SCUB 2O7VA 2ZWPA 2DC1A 4EFNA 2C04A 3KZ1E 3X3HA 3GMIA 1IXZA 2W2MA 2R84A 3SLGA 2J5KA 4P35A 1ULAA 1NONA 3PFBA 4TWIA 3J7AC 4L2IB 4QICA 4IF4A 2ZWVA 2FU5C 1L7VC 1FXWA 3SNKA 3WHKA 4RZUA 1O57A 2I87A 1OZFA 3CS3A 1YZKA 3GJ4A 4JLJA 4LWQA 4QDKA 4Z0NA 5FUYA 2TS1A 3LZDA 2Q99A 5SY6A 5H9WA 3AM1A 3Q8WA 4J0DA 5EQTA 1Y8QA 3I76A 1FQWA 3SIXA 1JBQA 4L8LA 4LFAB 1I2DA 1RBMA 4EY3A 1RRMA 1E2KA 1GL7A 3CX4A 1UINA 2B0JA 3QENA 4M8NE 4RA6B 1AQJA 5F21A 3KYCA 3T4UA 4F6LA 3HB1A 5ICEA 3AHEA 3CVJA 5DV9A 4DIEA 3BQMB 3K9HA 2JD0A 4EW6A 2J59A 2C96A 3W5IA 3M33A 2WTXA 1OLUA 3SC3A 3MUNA 4TMXA 1YVRA 3T35A 5DX0A 5THXA 1E2HA 3MHPA 1I2MA 4D9EA 2WFLA 3O1LA 3H5WA 3QBJA 4JQCA 1HFEL 3JD2A 2WHPB 3IMEA 2E55A 3M4NA 1H0HA 2BSQA 5ENZA 1WXEA 3RYCA 1W85A 4LWPA 2J45A 3BKWA 3D2LA 2J31A 2ZIZA 3BE5A 5SZJA 1GCGA 1WMBA 5BYKA 4C5BA 1VLLA 3DDNA 4XCVA 4HUTA 3WB2A 2Z2XA 1SBNE 3FUVA 1A9QA 3SYRA 1KWKA 1PCXA 3H7IA 2GN2A 3HMQA 2XUOA 3EODA 1TW3A 4PAQA 4XWKA 3Q9NA 4FOOA 3OD1A 1YUNA 4XYBA 1KU6A 3QF4A 2XB8A 1SQ5A 2F6RA 2XEXA 1TQ4A 2HXGA 1RWVA 1O87A 2WYUA 2ZR8A 1UJCA 2Y77A 1N9GA 4RELA 3R5HA 5C4IA 3VR1A 1G8JA 4W5QA 4XDGA 3RAGA 1KZ7B 3CUYA 1YASA 3IDSA 1JYSA 1G16A 3QRWA 4DLXA 3I5MA 5A4FS 5I7VA 3B2NA 1HNZB 1JQJC 2YVAA 3PC4A 4NG5A 3HTXA 5HW0A 1SVKA 3WLOA 2HSJA 1M7HA 2ANCA 2O2EA 2FUEA 1U4NA 1NR5A 3DBRA 2JGAA 3DOUA 5LQAA 2O5VA 4UXHA 3F78A 3QYPA 3UMYA 1YRWA 2XMBA 4EG4A 1A5AB 2VJMA 3H04A 1K08A 1UXGA 3ANSA 4X7BA 5CAEA 1O89A 3NW9A 3P45A 2QWXA 2RC6A 1YSCA 1Z5GA 3C3EA 3CF4A 2VR1A 4FIDA 1VSTA 4RADA 3TG2A 4XYEA 2OPHA 4AUKA 1JG6A 4YCLA 2GJKA 2A59A 3H2SA 4EA6A 1ZP6A 4QOEA 4EVSA 5AESA 1KK1A 4L8YA 4MWEA 5LN1A 2PBFA 2IHBA 4ZAZA 2JC3A 4X3PA 3QLVC 5SZKB 5EJ9A 4UVHA 1R2QA 2UYGA 3LVQE 4QUBA 4DLLA 1L5SA 2P3LA 5FX2A 1YFZA 4ZT5A 4X92A 2XUFA 3DE0X 1OV6A 3FZQA 5EPUA 2YCBA 2RFLA 2F3UA 4QPPA 4K03A 4L16A 3C6KA 4LI3X 1WD5A 2JCGA 5IAEA 4JBYA 3GF4A 3EMVA 1T9DA 4FN4A 4Z9YA 3MF4A 4QOJA 1CEEA 2AN4A 1DFIA 2W7TA 3KWFA 2Z5LA 2GUGA 4PAWA 3W5SA 4NNOA 2Q7OE 3TO5A 3AYXB 3UGQA 2FW1A 2XMZA 2RD2A 3VBCA 2W2KB 4JLUA 4LV8B 3H1EA 3PQFA 3GFQA 3GGPA 5CHEA 1HE3A 4UE2A 1DT3A 1L5WA 3HJGA 3ZUPA 2G1PA 1AQIA 1IY2A 2XMRA 3CW2A 4LDNA 2GBGA 3VR3D 1XA0A 4TYYA 2C07A 5KSZA 1G60A 1KXJA 2F00A 3IOMA 5AM1A 2FFQA 4EG5A 1NXWA 1UDXA 2UAGA 1P39A 1XIVA 4Q4JA 4UNIA 3V9PA 3WYNA 4BVLA 2WTBA 3OUTA 2XUAA 4J7AA 2IL1A 3WGUA 4MROA 1D3AA 1C1YA 2Z8ZA 3EH2A 2X1VA 2VJDA 1X13A 5K5EA 2C2MA 621PA 1KWGA 4JQYA 4MJXA 4ZHQA 4AXXA 5FLXA 5G1PA 1WY7A 4HBZA 1VDMA 2JIQA 2J6CA 2ZJZA 3HN6A 4NE9A 5ALWA 5M34A 3DMGA 3KE9A 2R7MA 5D3QA 4U7DA 2REXB 3QELB 1N3IA 3JATB 4EJMA 1IN7A 2J46A 3SLRA 5HKKA 3L07A 1N32B 2NXCA 1NVUQ 2CUKA 3MT9A 4JJ8A 4RAOA 1U2PA 2WUEA 1EBBA 2IW3A 3LDAA 3OTIA 1E2FA 1BJKA 4FW8A 4OH1A 3BRCA 3PYLA 3V1KA 4NH0A 1I7DA 2AK3A 3PC3A 2YWDA 2YIMA 2ILTA 2HHCA 3QVGA 5BSHA 2NGRA 1IWBB 1X1BA 2JI6A 2PVPA 3FI0A 3FX2A 1X1QA 2B1RA 5I8WA 5IJ0A 3WLEA 1A7AA 3EGDA 3ICPA 5JVDF 2HSGA 4BATA 3ONWA 2RJOA 1N8TA 1M0WA 1J22A 1AZSC 1K7CA 3OX4A 1QWSA 1HGXA 2HHAA 2F3SA 3TD9A 3UMBA 4B3CA 4CM9A 2VK4A 5CG2A 2PLFA 1M2WA 2Q21A 4I1IA 1M0TA 1U90A 4XM2A 1QANA 4ZVKA 4KLRA 3T3MB 1L5RA 1DKPA 3QVXA 5EXXA 5FBRB 3SXPA 1S2GA 1DKRA 2V8BA 3TS1A 3I2YX 1L6IA 1VJDA 4RL6A 3X43A 5U4QA 2PE5A 1SIBE 1WHSA 2VF7A 1QDUA 2XLBA 1T4DA 2YCLA 2CD9A 3I8SA 1P2TA 3K0BA 1NI4B 4NBVA 4NCXA 4Y2VA 5B37A 3RSZA 1H8HD 3Q85A 1W4CA 2V4UA 4HXGA 3RUEA 3OIGA 3WRXA 4HWSA 3A3OA 1HDIA 2MSNA 1BE1A 4MV9A 3D4LA 3S55A 1I6WA 5FHRA 5SZHB 2G6BA 2AHRA 2VDQB 3KHSA 4JVNA 1YZVA 4MPRA 4N6OA 4DJDC 4PINA 2XGMA 2FWAA 2DG2A 2FZKA 3H11B 3MT8A 3FYHA 5WRFA 1RLOA 2J0EA 3N58A 5DI3A 4MLDA 3DEZA 3FOZA 4FS8A 3QF7A 4LUCA 5BQXA 2Z58A 1N5OX 4MWSA 5L3VA 3S3TA 3ZHCA 2GHIA 4RK7A 1Z17A 1M1NB 3DF9A 4TTPA 1E99A 3LUAA 3AUJB 4G1FA 4IIBA 3EGXB 2CZCA 3KVNA 2BZSA 1H42A 4MNTA 1X94A 3WIUA 2B30A 4LXGA 1RLJA 2NO7A 3E05A 5H3CA 4B7CA 1SVUA 3ZVMA 3H2IA 1UIRA 1WZNA 1PUIA 3LBIA 5BV1A 2A1UB 1D8AA 4WOPA 5SV2A 1OGJA 4ALIA 4F9GA 2NZUG 1RM3A 2FPGB 2YYSA 3GUYA 3JALB 1FFXB 1FVOA 4G5SA 4LHXA 4AYXA 4UVGA 3V97A 2VA8A 1YF3A 3PC8A 4KDRA 4OMUA 4MO2A 3GD5A 4RENA 4AY6A 3DFUA 1HOTA 3C8HA 4JLBA 4K6OA 3O4HA 3ZCPA 3AVVA 1C4WA 2FLWA 1XCLA 5JS6A 5L3QB 5BNWA 3ER9A 2QRKA 1KVQA 4V0MA 1WETA 1EZZA 5DDIP 5DO9A 1G3MA 1MV8A 4MOWA 3OURA 1BGVA 3ZOKA 4DMMA 4I5DA 3O5AA 5T6MA 1EGAA 4C21A 2R7AA 4M0UA 3RIGA 1RYMA 2ZI5A 4G1UC 4IRUB 4AICA 1XZJA 2I6FA 2PKRA 2P2ZA 4PLYA 3HB5X 3AFOA 4C3UA 3GLGE 1BEEA 1RKUA 4L6IA 3KQTA 4TN5A 4E11A 3DEKA 3R3HA 4P9NA 2Q7XA 2QSJA 2R8BA 4GGPA 2VAWA 2XB9A 2YMQA 3C6XA 2AE2A 4GVXA 2C97A 4N3GA 2JVKA 3EDRA 5U1PA 4DLSA 3O3MB 4U2KA 5KJFA 3ISTA 1THGA 3P9YA 1Q1NA 4KRXA 4A8JA 1X0VA 1L9XA 4Z9AA 3DYBA 2NYAA 1XRRA 3TTUA 4XUGB 1Z5WA 2FW7A 3H9EO 1EFDN 4H1HA 1IUKA 2HIMA 1QC5A 2IGBA 5G4LA 1ZAYA 2NUTA 2JCBA 4JJ7A 1T0HB 2I1WA 1G6OA 3FSJX 3VU9B 3ZHOA 4E22A 3U0BA 4JQSA 5E8JA 5IDYA 1YOBA 5DM70 1EM8B 1Y7LA 4FHFA 1I01A 4LXHA 5JQGB 4RH0A 2PU5A 4GSYA 5ALJA 5FWAA 3G59A 2PM8A 1W4RA 3HYTA 4IVQA 3S2GA 1LBHA 4EPVA 4G1EB 4K0RA 5HMLA 1CDEA 4HADA 4P5DA 4DEVA 1HQYE 1HLPA 4OI4A 5TF0A 4BN4A 4MK4A 2X0RA 5FOQA 1TADA 1U1IA 2FFJA 2QAGC 4B6OA 2XQFA 4BZPA 3BERA 3K1YA 2Y1GA 2AOTA 1J4AA 4RJTA 2WIGA 1KK2A 1W87A 2X5JO 4AJ2A 4B82A 2YASA 4AQ7A 3D4NA 2WFZA 2EBFX 2ZROA 1H4TA 1R4NB 4TYNA 2VRNA 2XTNA 5JLAA 1RI5A 4IZ6A 1O77A 1IUPA 3MFYA 1M1XB 3IGFA 3O8RA 4RFSB 4J7XA 2HA6A 5CDYA 3EY9A 3ZY6A 5CVEA 2P62A 4UOQA 4F2GA 5KNBH 1B2LA 3C3WA 1TT5B 2VXCA 1Z6YA 3GBSA 4IIGA 1DAPA 3HKCB 1UADA 4LNHA 3ZCUA 4XUDA 4GMGA 5L3SA 1FZTA 2VLIA 3UFXA 1GTVA 1NRXA 3KLBA 3DFFA 4DA0A 4QG3A 4QE3A 9ABPA 1CUCA 1DIAA 1Y1PA 3OE1A 3P9CA 4HEA6 2PX2A 1YRYE 5EIOA 1G6Q1 1AHNA 3LWBA 1TUGA 2QPLA 4CQMA 3DH0A 3LDFA 1UXIA 3JXEA 1FTWA 1KXZA 3L0SA 4Q5IA 1N4AA 4DY6A 2OG1A 3MWJA 3RPEA 3IEPA 2IYUA 4TTJA 1SC6A 2HCFA 1T3LA 2W11A 3B82A 4F45A 1NF2A 3OT1A 4UATA 4YA6A 1SZCA 1V8FA 2A5JA 3PEFA 3AWIA 3F8SA 4FUTA 1G9XA 4AJJA 3LOPA 3L7BA 5BMVB 4JYAB 5IANA 5JJLA 2FWJA 5BQOA 4NZ9A 5B1SA 4L4YA 4XFDA 1JTFA 2PNFA 4UTNA 2CFOA 1M2OA 2Y71A 5EZYF 3V3TA 3PNLA 5L9AA 2OSBA 4KYUA 5T4HA 4D43A 2P77A 1E2MA 2GTIA 2KJQA 2E21A 3AVPA 3DAFA 2HWUA 4J16C 4JYCA 5JD3A 1EI9A 3CO0S 1RBQA 2V5UA 3DE4X 3N53A 4C6SA 1NXXA 3LRPA 1F1BA 1MTOA 1XDSA 1M6EX 3C2QA 4JFAA 3RKUA 4P3PA 4Q82A 3M4YA 2O57A 3PJDA 5JS2A 1T0BA 3E9CA 4CLRB 2B99A 4P7KA 3NHMA 1TM1E 1IEWA 2P4QA 5KPDA 3WHLA 4CFYA 4B0OA 1FSFA 2B4AA 2GD6A 1PTJA 3UQZA 4HV4A 5B2FA 2GYWA 1ZH2A 3F8TA 1DVRA 2EKDA 3PE6A 1G4UR 2WR8A 3NGMA 3NAZA 1K4KA 3CNNA 4R8MA 3AVTA 1V45E 3HKEB 1U80A 4PR0A 2KM1A 4X94A 3T3EA 3KSAC 1KJ9A 1MORA 2HA5A 4U0JA 1EFRA 3ETJA 5CJ2A 4MS4B 4ZP1A 5ESDA 3IA2A 5ETJA 3RLIA 4PLWA 1N6HA 1S2IA 4E5YA 3F4KA 3CVWA 5F1KA 3O91A 2IZ1A 3SHWA 3S2IA 4YHBA 4JP5A 1ULZA 4HRVA 4S1PA 2P8JA 3LCJA 1QP0A 1BH2A 2HWKA 2UKDA 1HE4A 3OM1A 3KQKA 1MVOA 4I3FA 1U3UA 3PENA 2JEOA 1Q74A 3BAZA 1JV2B 4TTSA 5AW6A 2VHQA 2KE5A 5AIAA 4QWWA 4YX9A 2BBTA 3GRAA 5G1NA 3GFPA 4Q6BA 3GCGA 3ZQJA 4LNAA 4NU8X 3JWPA 1NRWA 1V41E 2BC9A 2EJCA 2OFOA 2ZRQA 3DCNA 1NP3A 1U7TA 2JGEA 3HA7A 3CFYA 3UGJA 2PS9A 1JZTA 4IMRA 4HX2A 1H66A 3H87A 2WQ7A 1T1RA 3HCBA 2WJVA 5LDGA 4OGFA 4B7ZA 4FC7A 3OZUA 1BRMA 3CPEA 1WNTA 3CZMA 3FMFA 4WESB 3M6LA 3GLGB 5CLGA 1X77A 3SKVA 4YYEA 3WWPA 4OHRA 3BWEA 1Z62A 1H6DA 3CGGA 4DC0A 4G1MB 3DO8A 4AG6A 4DIOA 1YBAA 4P7GA 1ZESA 1T9ZA 4M2LA 5DB4A 5ADUS 3MNFA 1Q6ZA 2C8LA 2W2VA 2YBDA 5CURA 1A5TA 4CKBB 4B6PA 4KSYA 1Y8ZA 3E58A 1WDMA 3AINA 5C9ZA 2BEUB 3BKXA 3NHPA 4CCYB 5C0OE 5KJEA 3UJNA 2WG2A 3TTSA 4D4GA 1XQXA 4NBNA 3V1YA 2AG6A 2BF7A 4N7RA 4OQYA 1FRZA 3PFHA 2WAYA 2H1FA 4ZAYA 3U4DA 3QUBA 4F1KA 3NBYC 2I4OA 1GXSA 4MMYB 2H92A 3K0AB 3PHHA 5B2EA 3F73A 1OH5A 4MR9A 2IZ6A 1UFQA 4JP2A 3WR5A 1X7HA 3CLHA 2KYRA 3V8MA 3WIOA 4JLWA 3GI1A 2UDPA 4M0CA 4YAWA 3IEMA 4U1RA 4LTDA 1KAQA 1NURA 3EOAI 3CV3A 1Z2NX 5BSUA 4XM1A 1FVFA 5J2UF 2CXRA 2HWXA 4E07A 2FFAA 1JT9A 1JLKA 2XUQA 2TMGA 3K0FB 4PEVA 4ER6A 4Z49A 3FPFA 3JZFA 2Y1KA 3SJZA 2P6UA 3E22A 2HU5A 3C14C 2JS7A 2NVBA 2IYOA 2P1ZA 3FHLA 3NHYA 4I6JA 4PZLA 3A06A 1VI5A 1ZA2A 2QRMA 4TWRA 4R6XA 3SIRA 3AQ4A 3O9MA 2IOFA 5A9TA 1HYHA 2GK7A 2J5BA 3IPXA 2M6SA 4DILA 3WZ2A 4ENRA 4ZI2A 1NXTA 1MGPA 1PJ8A 3A9RA 3M6MD 4OQEA 3ITNA 1XNHA 1WCYA 2XUGA 4LC9A 4MJ7A 2UVDA 4MKXA 5AKEA 2COUA 3DE2X 1D4AA 3GGOA 3K4PA 3ZCVA 1WWKA 3EQ6A 1CUZA 1NLYA 3IVRA 3OJOA 2JH9A 3U49A 1RHMA 4BX3A 3ACBA 3MJCA 1XJ5A 2IYEA 4BMSA 2GHQA 3TRIA 1JYFA 1LWOA 3R4CA 2OPBA 4I08A 1JKJB 1MPTA 3ED5A 1KRHA 3EK2A 4M8LA 3ZD7A 1COWA 3NKVA 2WYVA 2PN1A 3VV3A 3R7BA 1SUCA 3DPUA 1E1YA 1CQXA 1KY3A 4MRVA 2IODA 4P7BA 3FYTA 2AX3A 3RFXA 4P2GA 2GCIA 2HO5A 4I99A 3WLJA 1MDBA 3H1FA 1CJKC 3OCZA 1CP2A 1M5UA 3MCZA 1EFVA 1ZJYA 4YT2A 2J9FB 3QTLA 3CB2A 1ZM9A 5J63A 4UDOA 1U65A 2WWVD 5IS2A 1C9JA 1X1EA 5HIJA 3B3AA 3FHOA 721PA 2XBMA 4PNPA 3LUGA 4RZ2A 1SVOA 4Y9UA 2CEAA 4HZIA 2R66A 2FSUA 4K8RB 3O3OB 4E5PA 1KBQA 4F12A 3C5VA 1SUIA 2VP0A 4OOEA 2ZDGA 1O7JA 4D98A 1V7QA 2X42A 5IASA 3VVBA 3IV6A 5BW8A 2JIPA 2PZJA 1T3ZA 1UBOS 2KLHA 4JQOA 1T10A 4WLUA 5EJ5A 4AZVA 4YUXA 3PXEA 4Q9DA 2R65A 4YMIA 4YRIA 5EJ2A 4L9SA 4U7WA 1Z2CA 1NAHA 2NN3C 1L7EA 1V4BA 1Y0BA 2FPOA 4Q4CA 4RETA 4GQBA 1XHLA 1C2TA 3MERA 2DB3A 3OBBA 5FPKA 4Y2GA 1T3SA 2H2WA 3MJTA 4MUAA 3EEOA 1AN9A 2DECA 4WL0A 3ZWQA 1XAIA 1SHKA 1LFAA 2ISQA 2XE4A 1J33A 2QL7A 1BTOA 1V8BA 2Y0BA 5E6SB 1NVMB 3TX2A 4DSZA 4RQAA 4PNEA 1A9SA 2GDJA 1JTEA 4CR6A 1ID1A 1ZBQA 2FWPA 3X1WA 2FEWB 2IS1A 1KOJA 2JGNA 2RGBA 4G63A 4YTEA 3LLVA 1COZA 2OXCA 4CKWB 5A2QA 1CYEA 3NWEA 4DCSA 3UPUA 4RMNA 4CG2A 2G9QA 4HAVA 2L17A 1GDHA 1Q12A 1X8XA 1GTRA 2A3RA 1U3VA 3HEBA 4WBSA 2NU7A 3IBGA 4PY2A 1XJQA 3A04A 3DTYA 5DW0A 3E9NA 3V1LA 1U4SA 1Z6TA 4TL8A 3GOHA 4TQUS 3RVOA 5CA0B 3TGPA 5E6RA 1DKQA 5GIOE 4YAUA 5HKLA 5MN6A 3ZK8A 3DHWC 5CX4A 5LP6B 2OGZA 3BIXA 3AF6A 3DR3A 2REQB 2HDHA 3IKVA 3BXFA 3AX6A 5DBEX 3OETA 4YUYA 1Z0SA 4HDMB 3LLUA 1A82A 1NOJA 3QOFA 1ZD5A 5FTNA 2B92A 3IDFA 3ZE0B 1WPQA 3K9CA 1FE8A 3CE9A 1DG9A 1XEXA 4EFKA 3KELA 1C3EA 1YC5A 4IHJF 3E81A 5CH3A 5CYPA 3JRNA 5FXMA 4WLFA 2QRJA 3T5TA 1PR5A 1TMGE 1YVDA 5CEJA 2YIJA 3RIYA 3FGNA 3KHUA 1CB7A 2GJAA 5G1OA 8LDHA 3WA7A 1TA0A 4BQNA 1Q1QA 1JE1A 1PJBA 2CBXA 4GRAA 4UEOA 1GZHB 1RRPA 1JL3A 1WU7A 5CVVA 2OHHA 2PIDA 1AZWA 3CNQS 1HL7A 3P0RA 3QXXA 3R7DA 4AO7A 4BCCA 1V9SA 2E6KA 4B5KA 4D3DA 4OQMA 1NNUA 2FEXA 3BTSA 4RHUA 4MP6A 5HBRA 3KKEA 2WSMA 3OCVA 5HE8A 1IZ8A 3ENNA 3JQBC 5FP0A 1IHDA 5TARA 1XQ6A 1QHHB 3NASA 3OCUA 1KSGA 4AF7A 1C9NA 1P0IA 4YP7A 2E3JA 2GPJA 1RBYA 2YVLA 3HACA 4NICA 1Q0LA 5FUQA 2KBEA 3HR4A 3QMVA 4F5WA 1C1XB 4ND4A 3CNOA 2CD7A 1A2KC 2JASA 2QZSA 4L8VA 1ZJ5A 4KIGA 1P73A 1Y82A 2G72A 2P6NA 2R1TB 1MB2A 3H2HA 4IIUA 4YPFA 1WSDA 4DBZA 5I6DA 2Q41A 1TEHA 2C2OA 2V58A 3A2NA 3KZCA 5TJHA 1PR4A 1E9DA 3WGJA 3SMVA 4BFXA 1PN3A 2FW9A 5JECA 3VDXA 2YZMA 4EFMA 4UCWA 1DQNA 4ZJUA 3MLEA 3ZY2A 2BMEA 3R9XA 2FWBA 4BNDB 4ZIRB 4R0VA 1SEPA 2GXSA 2XVMA 3I9OA 4L6CA 3F90A 1CY2A 2BZ0A 2C5FA 1BS1A 1L5MA 2H31A 4TPKA 2IX3A 2CC2A 3LCRA 3TLGB 1VCNA 2GZHA 5CH5A 5ISMA 2OBLA 1F9EA 2ZITA 4ZVVA 4Q93A 4AYWA 5F9MA 2DMRA 1T6ZA 5K2OA 3WRYA 4BBPA 3O6VA 1Q3KA 3VNSA 2OCXA 2X86A 4O4LF 3ZDEA 3HXTA 5HP4A 3O1HB 4IIHA 5LNK1 1E2LA 2EARA 2ZYRA 4O8ZA 2V0GA 4P08A 4R81A 1E1QA 5L53A 1VKOA 1THZA 1H1TA 1XELA 2W8BB 4IOJA 4ZYXA 4BNZA 2F43A 2VJYA 5HGXA 2I2AA 2A5GA 4TYMA 5G4KB 3TQIA 2NAPA 4V0OA 3HZOA 1UM9B 1XMIA 4WKNA 3SF8B 2RHBA 3FD8A 3G1UA 3JSXA 5T4FA 4TZ6A 2EJVA 4KOEC 1QK4A 2Q5FA 3U48A 1JVBA 4IDQA 1I36A 2C1EA 2OBXA 3PRYA 5KTMA 1DV2A 4P80A 5GADl 4YCCA 1P7PA 5AICA 1D6SA 2JJYA 4RHTA 1YK1A 5AIBA 2QBYB 4NDZA 1P1IA 2OYRA 1RSZA 3R2JA 1IQRA 1PT7A 1ACLA 1LA2A 3QUAA 1I7QB 2F3RA 2XUDA 2JKYA 4AJIA 4NV3A 1L7PA 1X7XA 2HQBA 3A37A 4FSDA 1EX6A 5J5VA 1JR2A 2GCNA 4I2VA 3UYKA 2YQ5A 2WM2A 2HA3A 1YMQA 3OTWA 4D0SA 2QG6A 2VF8A 4BP8A 2B9EA 1B6SA 3N6XA 5FR2A 3EE6A 2Q4OA 4YCAA 4LDQA 1QYDA 5FOSA 4QM6A 4I4LA 5FOVA 2BM9A 1TYBE 1L5KA 3DHVA 5K0BA 5LMNB 1XN1A 1KYYA 3LIPA 2FQQA 2K2WA 3ZI4A 4MQFA 1HM5A 1BWRA 2J9ZB 3AEUA 3IUBA 1L7OA 4L57A 2XITA 2J6HA 3B48A 4KZPA 4RV9A 5AI4A 4F11A 1D9ZA 3PZRA 5C8XA 4Q12A 3RW9A 4OFXA 4XFJA 4TKVB 5EG5A 2Z2KA 4LDPA 2FX3A 5BVGB 2H7VA 2FR1A 3PC7A 1GTMA 1VMDA 4AZ0A 3VMFA 2P91A 1GKUB 4JBXA 1G63A 2RGCA 5DEOA 2FZGA 4M0FA 3T61A 1CT9A 1DC7A 1QMGA 1L4HA 1SURA 4MW9A 1CUDA 4XE5A 3ZN2A 4B3MB 4C20A 3TTWA 4CJXA 4BKOA 2QX4A 3HJRA 3PFNA 3EIXA 2IVZA 3ZH9B 1I30A 4D9BA 4K9RA 4X8MA 4O2BF 3ZKAA 4D02A 1EFUA 2V6BA 1GARA 1ZI9A 4Q34A 4RSGA 1QGYA 4KR7A 3DOJA 4L75A 4DNQA 2PD3A 5DYWA 1H85A 5FNVA 4ZARA 5TEVA 5KOIA 2MSDB 3QKSB 1ABFA 3A70A 6ADHA 3TOSA 4C05A 1ZUNB 2YNMD 4N8SA 2C8KA 3WAGA 4O59O 2GPBA 1M75A 4QBKA 4LSZA 2C92A 2D8MA 1HL3A 3L0OA 2EOAA 2H1WA 4NFSA 3RYFA 1OCEA 3RT9A 4AMYA 1RPAA 2X8WA 4B48A 3O1IC 4IJWA 4G0XA 1P5FA 2W22A 4WQMA 2IXFA 3QEKA 3G1WA 5DZSA 2FCAA 2WVGA 2GK6A 4ICIA 3SBXA 3W8FA 3PD7A 3JQGB 4CRWB 2VZ0A 5I3ZA 3LCVB 1JNXX 3TZKA 4TXHA 3GJQA 4UDYX 1V9CA 2GCOA 2ZYAA 3GVIA 5H8WA 4BCBA 4WKBA 3VU9A 3H2YA 3KBBA 3PQCA 3PI7A 4Y2TA 2ZE8A 3W9SA 3W8EA 4ITUA 4YRBA 1UK8A 4FEGA 2JF0A 3IKMB 4AY3A 2BP7A 3GN2A 4B3JA 3R8FA 1A4UA 4P82A 3PR1A 4YUZA 2IWRA 4O5AA 3AB3A 2VG8A 4ZOLA 4IJKA 3QI2A 3FYSA 3HN2A 3L8YA 5F5XA 5J1SB 3ZK7A 1XZGA 2VQEB 4PSAA 1CC1S 1ADFA 4YEDA 3DSRA 1SOMA 1UP7A 2UVPA 4AMZA 2BKVA 2J4CA 2WJYA 4MS1B 4AIRA 3ZGVA 5K0TA 1UOPA 3DUFB 1RLIA 2PUGA 2OHIA 2YN0A 4RIEA 3SC4A 4AKSA 1MO4A 2HT1A 2C7PA 5HCNA 4HAXA 5IX8A 2VUUA 3QE2A 1FDOA 3P0IA 4JX9A 4EY8A 3RIHA 1JRLA 1GRCA 3BGVA 4D3SA 3SEZA 2IYTA 4JUDX 2QY6A 5F1PA 3EWAA 2PG3A 3N74A 3SX2A 1O95C 5JZSA 3HDVA 3M34A 2G7MC 1X9HA 1ZI6A 4PS1A 2JCVA 2R8OA 4PLFA 2R3SA 1XE3A 4WZBE 1UJNA 4IM7A 3UAOA 4DCJA 4ZT4A 4BQEA 5JJIA 2EXXA 4F38A 3CUUA 3MIIA 4GOOD 1PGNA 1G0OA 4HH3C 5EJFA 2DUWA 3DLBA 1JKFA 2JJ1A 1G8MA 5C8YF 1RHUA 2F3PA 5HR5A 3AP2A 2ZIXB 1SQFA 5DHRA 2JBWA 1PJQA 3WWZA 2BF4A 4QTUB 2O7RA 5HMMA 1PR9A 1G7SA 1BO6A 2PS3A 1DEOA 4QREA 3K9LA 1E7MA 4WHMA 3MMSA 3CLKA 4BRSA 5FOUA 5TPZA 4KIUA 4FNOA 1U6JA 4PYRA 3WTCA 1F6BA 3NQ41 1J99A 2BUBA 4FOLA 3I9JA 5GAJA 1RI4A 2PLNA 1K6MA 2VVTA 4CN8A 2RBEA 4KWHA 4ENSA 1FRVA 2BVNA 1ISFA 4JJIA 4S2EA 1NQVA 1KTVA 3I3OA 3QVUA 2C9CA 2FPIA 2YWBA 4KQ6A 5FA6A 3THRA 4FD2A 4IKOA 2V0CA 3NFYA 3FRIA 2IK8A 3L0DA 5IK2D 5DI9A 1VPTA 2WTUA 1EVLA 1U2DC 4G26A 1SXJA 3P2KA 2IYZA 5C7LO 3AF0A 3W8DA 3CLTD 2L18A 3AFNA 3UAGA 4MIEA 1JP7A 4XLZA 1ZINA 1UOOA 2IPMA 4NENA 1CZHA 4QBGB 3JX9A 3TAXA 4DMFA 4MR9B 3KR0A 3W79A 2WYOA 2BMDA 3VVCA 4H1VA 3ZV7A 1NQUA 5DT9A 3T4EA 4BN0A 2AVNA 2ZRKA 3OIDA 5DTJA 2Q1WA 1R5NA 2C83A 3O8QB 1NC1A 3GPBA 4NYJR 2PQ6A 1NJ6A 5KJ6A 4CCYA 3BYZA 1I1OA 5CFMA 5IHXA 3D6TB 2HDOA 10MHA 2VK8A 2NSDA 2VDKB 1GIAA 2HHLA 3FFBA 4CKBA 1HK7A 1XL0A 3GLSA 3H9BA 4R2XA 4KV9A 3B7WA 1DCTA 1PLLA 2VCYA 5EXTA 3VZPA 4RAQA 2OXEA 2X4DA 3DDOA 3TZEA 2C9OA 1OYYA 5C1BA 3M4ZA 2FPPB 4D56A 3NHBA 3GH1A 1KVTA 5PGMA 4JJZA 3RFUA 2XCIA 2WINI 4LX0A 4TSFD 1GPH1 4HRYA 3E8XA 1RZ3A 2ZJ3A 5EIBD 4WXYB 1JIXA 3WKBA 2JLVA 2NXNA 4JGBA 4DNPA 3HJHA 1LH0A 4OHFA 3TUJC 1MGOA 1P4AA 2OENG 4QT0A 1ECLA 4R0MA 2QF7A 1WP4A 2ZREA 4ZHQF 4KN5A 1J0BA 3HUFA 1BMQA 5K8TA 1LW6E 3G2IA 1ODLA 1W34A 2RBKA 1KJZA 4M0LA 4M54A 5BSGA 2QRLA 3WX0A 1X80A 1QB7A 1D7OA 3FKJA 3I9V1 1XZCA 3BICA 1G55A 1M10A 3SXUA 4C3ZA 4N5IX 2GF9A 1UK7A 4XH9B 3GROA 4DV0B 4DHWA 1E8NA 2HUNA 5AJVB 1GKLA 1FB5A 1MX9A 3KOZA 1E9SA 3HKDA 1U11A 5DM4A 4RYDA 4DV6B 4WNAB 1GL3A 4ND3A 2MWMA 1CS4C 2QD4A 1Y37A 2CNOA 2VT7A 1KYQA 2JBHA 4S0ZA 1EH5A 1NQAO 2A78A 3ND7A 3M6AA 1PSDA 1CERA 1R64A 3GIDA 3Q98A 4TZKA 3GLQA 5FL3A 2ZANA 4H6PA 3SVTA 1XDDA 5HF6A 1YS2X 3VO1A 1UBSB 3U7QB 2OCYC 2IYRA 4FGJA 1NQTA 1VXOA 2QI9F 3C8ZA 1GPAA 4RCZA 3VYSB 4DCOA 4M99A 4YRPA 5JD5A 5EZYA 4IYJA 5BVHA 3FDIA 4YJHB 4E08A 2R8EA 5JNUA 3FVVA 3RYCB 1LSJA 1NNI1 4XFKA 4YB8A 4UU8A 1EHYA 1E0SA 1FYXA 1XVIA 1PJZA 2C9DA 2FTKE 2GHTA 2QRUA 2VTEA 2ZE5A 1G5TA 3GRVA 4FEAA 4JWKA 4ESEA 5ICSA 1RP1A 2GERA 2QYOA 4J29A 4NOLA 1BQ3A 2YJ5A 4FE7A 1B0AA 3MK31 2AG8A 1XL1A 4JYPA 4P4NA 1PO7A 1WB4A 1OLXA 2VNAA 3KZKA 3COWA 5ENVA 2W58A 4ALLA 2J32A 1CK4A 5FWYA 3CH5A 2I4RA 1KJQA 3EZFA 1T8YA 2HLPA 3IKJA 4IIJA 3CQ9A 4M21A 2RONA 3IR7A 3D4IA 4C7OB 4ZCQA 5IU6A 1EUCB 2ZI7A 3MQ4A 4AN1A 4B85A 3H5RA 1Z4NA 1ZOSA 3PDUA 1PYDA 3T5AA 4IVRA 1FJGB 2PUTA 1G2PA 4JSTA 4X1YB 1JDTA 4PPQA 3T41A 1ENOA 3TUZC 4FGKA 4NAVA 2XWSA 3ENZA 3TTTA 2Q4DA 4PSDA 2BN4A 3SHVA 1YI0A 4U8GA 2R6FA 3EA0A 4UPVA 5FA8A 5K7SA 3O3CA 4EB0A 1XU7A 5DSXA 1DG1G 3M1AA 2H63A 4KX5A 4CIAA 1I24A 3BWMA 2PKXA 4MULA 1MH1A 1SUBA 4CV2A 5FI5A 4W99A 4Z1MD 5JCZA 2Q3HA 1Y8RB 3AGQA 3VUFA 4EVQA 4UD2A 2QHXA 4XB6B 2VXOA 3AIMA 2Z5FA 4JIMA 3ZZUA 4F84A 5TB5A 4KO2S 5IYZB 2WK1A 3ZGLA 5IKMA 4CF5A 1YRHA 3D3KA 4ZZ0A 2J09A 1KPIA 1LJUA 2DQSA 1SIWA 2QM3A 1IQPA 2XXAA 1EP3B 4JJ4A 3JQQA 1UBTS 1RQXA 1DS6A 1PGQA 3O4RA 4D0NA 4M98A 1WY5A 1CY7A 1JDNA 4LZNA 5LB4A 3TDMA 3E15A 1I4LD 1NMSA 4QRIA 1UL1X 1DRKA 2I80A 1DAMA 3FUTA 2D1RA 4Y2YA 3LC1O 2PCLA 1W88A 5KYWB 5KVAA 3VV2A 2AWOA 1ZRMA 2I6TA 3A1FA 3HUEA 3ICVA 4JKYA 1K5DA 2DH6A 4RDIA 4B87A 3REGA 2MSLA 1UBNA 5LBTA 4J7UA 1XMVA 2OCDA 3QLJA 4JDPA 1W52X 2XNDA 1UANA 3R5XA 4U2CA 1EIZA 1BKDR 1QRUA 3H13A 2K7FA 2WHPA 3RBXA 1VI2A 4EO4A 1DSSG 1TYCA 3AFGA 1RHJA 2DWUA 4FMCF 4EHDA 3DLAA 5LU8A 3DB1A 3UWMA 5A7FA 1E6KA 5DEIA 1GAEO 3IEIA 3RUDA 3PU6A 3ORRA 1TYEB 2I6GA 3IQXA 4M3NA 3VTFA 5A5VA 3L82B 3JWGA 4I3GA 3BREA 4OUDB 4F4HA 3AJ8A 4C88A 3RRYA 4A8JB 3DFMA 1PG2A 2Q3CA 3GDFA 4DXDA 3E5HA 2CLKB 3VPGA 4U7FA 2C5EA 4RSMA 3PUXA 1FP4B 1YJ8A 4GX2A 5FEMA 5HA5A 5BR1A 4CU5A 3QJYA 3UFBA 1KI8A 1F12A 5H02A 5BOSA 1VRCA 2ETVA 1ZK2A 1CX9B 1PNTA 2FFRA 2PR2A 5JROA 1NW5A 4TS9A 2O5CA 3M8KA 1ATIA 3LSYA 4H2DA 4J1QA 4DANA 4FDUA 1M8GA 2OV1A 4KFTA 5A3VA 1LPOA 4NZZA 1DRJA 3D7SA 3GAMA 1MEOA 1OXVA 4GWKA 5KAPA 3WMWA 3HXQA 4CEHA 3JQDA 1EM6A 3HDQA 5DHTA 3HJBA 7GPBA 5DHAA 3MM4A 2ISCA 4J7CA 1ZWKA 5AW8A 4FYIA 4C7OA 1CY8A 3RK4A 3HDGA 5HIIA 5F23A 4QAJA 4O4HF 4TKUB 1DDGA 3SCZA 3WNDA 2R5WA 4PYQA 3O74A 3IOEA 3U9SA 4CR8A 4UTRA 1F4VA 3RDPA 1J97A 2HA0A 2JH3A 2M1ZA 2ZSFA 4FDLA 4NDAA 3WLHA 3BSSA 4WY8A 4AJ9A 2FDXA 1FYDA 1MAWA 3CPJB 2BFBA 4CFSA 4FILA 1GU1A 2G7ZA 5ALQA 5M04A 3EARA 4RTKA 4W5TA 5E0OA 1U7DA 3H1PA 3U39A 2C59A 2VUTA 2XYHA 3ME5A 2WABA 1JSCA 1FW6A 2P9CA 3IUQA 4NS4A 1ZOIA 2DUNA 4JR2A 4TV8B 1SD5A 3AI2A 5D5HA 3WXMA 1YS4A 1FFSA 3TCNA 3U7QA 2FHPA 1YZYA 4ER5A 1VPVA 2RSLA 1E7QA 3H0CA 1R74A 1OI2A 1TF7A 3G5LA 4HUJA 2WSBA 3NG1A 3ERCA 5LZ5A 3A58B 3TWOA 1GNTA 3O2JA 4RMHA 5HF8A 5H68A 2FI1A 3QJ5A 5LYJA 1CZRA 1TEVA 1WKVA 3OF3A 4IUCS 4MJLA 4V0SA 4AYTA 1FSSA 1L7QA 3DHYA 3DWGA 5G41A 2HWWA 4NWIA 3TDKA 3I05A 3DWFA 5JDCC 4L5AA 4QYMA 5BW5A 1GOTA 4KXVA 3WL7A 4NBWA 2FQWA 2VEOA 1RQLA 4UU7A 3B38A 3C74A 3KR9A 5DIZA 3NAQA 3RUPA 3BTUA 1QOPB 2G07A 2WT9A 3UK2A 1NQOA 2QY9A 3CR7A 2PSJA 5K6RA 1H23A 3CC8A 6AT1A 1FFAA 4S2UA 2RHMA 1Z0ZA 4BWYA 1GYPA 4QD3A 4KIWA 2V0NA 1VLMA 2O2DA 3A2LA 4FSHA 4O2BA 1U8AA 3FLMA 4OGLA 4HZGA 1A95A 2BGLA 3NH6A 2WPNA 4MQLA 4OLHA 2ZJFA 1VHLA 1JG7A 3ZZMA 3L04A 5KX5F 2YV3A 1L5HA 1KEKA 4ZQIA 3RNLA 2YFKA 5CLQA 3CY6A 2QTFA 4I55F 3ZCTA 1N0WA 3EXEA 1J8QA 521PA 5ILQA 2PMFA 2O06A 1SVNA 4CCSA 4MP3A 2PGNA 4D6PA 1Q3TA 3AI3A 4KAFA 4O29A 3RTAA 2VFAA 3MBOA 4QYSA 1V5EA 5AI0A 3HEAA 2VRCA 3LLCA 4MR7B 1A7UA 3MTIA 1B4DA 1GZ5A 3GVXA 4NLLA 4UPDA 2C5BA 3E27A 5DISB 3ZNQA 4BFSA 2VAXA 4EHIA 1OGIA 1BVUA 5FJIA 4YYZA 4ZO4A 2ODQA 2J07A 4O0MA 4YRFA 3K6JA 1JAYA 4ARZB 4L74A 3UXHA 1GDTA 2NPOA 3ABOB 2X15A 4B2LA 3CKYA 2JLRA 1TQ8A 1TOAA 4FJ1A 4Q05A 5IBCA 5JJKA 5K0EA 5DHQA 4K9DA 1CIPA 1YA4A 4OLAA 5I4KA 1BXZA 4UHEA 2A4MA 1U04A 4LDAA 4YUVA 2ZRHA 4HQ0A 1U8YA 2BIFA 2RJ3A 2XZOA 3PZBA 4RZHA 3WQQA 3EG5A 2P4EA 4O3FA 4QGBA 1WDTA 1TZMA 1SXJB 2HA7A 5HUHA 1NWHA 1VG1A 4KYTA 1GQQA 1ISPA 1H2AS 2A1IA 2FF5A 3ND9A 4JKOA 3SVZA 2P9QA 3UW3A 4AECA 5AT1A 4A9AA 1Q84A 3WFZA 5CDSA 3B85A 2XIQA 1KFKB 2PANA 4YQFA 5BW4A 1G66A 2FXIA 1T8PA 3D4OA 1MP0A 5H3HA 2H8GA 3VOTA 1R8YA 5FUMA 1F17A 3NXKA 1XR3A 1A9YA 1KZYC 5DMXA 1EVIA 1NVTA 3IODA 2D62A 3EPPA 4NZOA 3MT0A 1PAUA 2IE8A 1BH6A 4YRDA 3ZTWA 1NVVQ 4CQLA 2AN5A 4FKBA 3FGOA 1DTEA 1KI7A 4P32A 4PYKA 5E7IA 1Q1AA 2ZAMA 4UHJA 4E4RA 1D2GA 4BQRA 1DO8A 2I33A 2HIHA 4PQRA 1N8KA 4UREA 3VVMA 1I32A 3KPUA 3ANTA 1DAHA 3CX8A 1RMYA 3AJ9A 4HDRB 1C4OA 4HNTA 4KQEA 5EWMA 2C8JA 3ASUA 4PWYA 3AM4A 1NYLA 2R87A 3KQUA 5EWJB 5H3LA 1XMSA 4EA8A 3E8MA 5FFFA 3R9WA 4LGVA 2HRDA 5B7NA 1RC0A 1BU8A 4IX9A 4PG6A 1Z88A 3L0CA 2CXQA 4OFZA 4DJ5X 1BD4A 2HV8A 4OJQA 5JH7F 2PT9A 3KUDA 1VG0B 4FC6A 2HNAA 3REOA 3VR6H 2GZRA 2GPAA 2WTAA 3DMFA 3S1AA 2FOLA 3EZNA 1XP5A 5GOTA 4ZRDA 3HO1A 3BAFA 3ZU6A 4DM4A 3GLIE 1CU1A 3BWVA 3LT1A 4U9HS 1CFJA 5E7JA 2D5IA 4YMLA 1TAUA 1NBME 3I2FA 2MINB 4EATA 1DJMA 3OIVA 4IVNA 5JZVA 1A4RA 1V11B 2VK2A 2VP2A 2G5TA 2J30A 5JVDB 3T5GA 3TEMA 2F1OA 2NZXA 2EWMA 1PZGA 1P6XA 2FP4B 3DLPX 1UC9A 1QVVA 4BGEA 1MXHA 1HXHA 4K5QA 4C4AA 4Y1RA 4ZJZA 5B7PA 2CN1A 5F77A 2O1XA 4UFNA 3WRXC 2GKSA 3BF8A 2PJUA 2CKDA 4OHUA 4LI0A 4L0QA 5T3UA 2EJBA 1EDOA 2BL4A 1IM8A 1SVWA 4HS4A 1NXQA 1A2OA 1JN0A 1NMYA 2R2AA 2XGOA 3O94A 4NL4H 4QPCA 4LDJA 1TK2A 3LPAA 4B4OA 5LQCA 1JGTA 3JVUA 3UJ7A 1JYEA 2V6IA 4HDNA 4QULA 1U99A 3PFKA 1L5YA 5KNCH 3MTQA 5LC1A 5DHSA 3CISA 4UTZA 4BUJA 4II3A 2FVXA 3V1NA 1MIHA 3VQTA 2I7XA 3Q15C 5F51A 4DJTA 2GARA 3C6BA 1DX6A 3U3XA 1M9NA 1QIEA 4N82A 5EKTA 5B6JA 1LLQA 2ZSIA 3OFJA 5IC5A 1NE7A 1W85B 4S1VA 1YUMA 1S01A 2GD0A 5EMJA 5HILA 3D8HA 5TQ0A 3GRRA 4DQUA 3Q3CA 1TFRA 1N25A 3BJEA 5E38A 1XKXA 3UJ8A 3WI7A 4ND8A 1Q83A 5J43A 4UHKA 3C5WP 3UNXA 4OXQA 3OEED 1LGYA 3S5JA 1NRIA 3OHMA 2PWYA 3FPSA 3LPDA 4M1KA 1O4WA 4KE9A 3H5AA 2IUUA 4CETA 2AF3C 5CBPB 5LWHA 1AY0A 3PCTA 4LA4A 1OPXA 1VMKA 5AJZA 1QQ5A 2OECA 3T9BA 2PO5A 2UYYA 4IDCA 3DV0B 3LK7A 4HNRA 5F3RA 4EKIA 5JRDS 4CGZA 2FMXA 1RXWA 2OHVA 4A82A 3EXIB 4G1BA 5DXFA 3NYRA 4O4JF 3BB4A 3TUIC 4W9NC 1W30A 1UAAA 4KOAA 1T9AA 1XXHB 3B6IA 2I91A 3HBLA 3TPFA 4BLQA 3ROFA 4OEHA 5C46F 1J23A 1T2DA 3KK0A 4BP3A 3R9KA 1G8FA 3NEYA 4IFBA 4HYEA 1XTBA 2AG0A 4G5OA 3HCFA 4MAAA 4UBNA 3PFFA 3M2TA 4FZ5A 3R9IA 1N1DA 1JJFA 3P9ZA 2R4UA 2GEBA 2ZM5A 1V26A 5JSQA 1GZVA 2ONZA 4HZUB 3EQ7A 4CV3A 4ZQBA 5C51B 4LXUA 1O0CA 4MLCA 4R16A 5EEGA 1JX6A 2JK0A 2YR0A 4M9CA 4BLUA 2O8DA 3PV0A 1SKYE 4OHZA 1W35A 3NI2A 1AKWA 4KX3A 1DB3A 1V7PC 2VPIA 2C3YA 2ASEA 1D2EA 1VKJA 4TLMB 1M6VA 1SCJA 2EW1A 2OD9A 4OXRA 3EQ2A 3ZVRA 4YMGA 3TIGA 2AWNA 9GPBA 1Y5MA 2JA2A 4YCNA 1QGDA 3TDNA 2Y0EA 3CX3A 3DMTC 2FMKA 4UBIA 3Q5DA 3TE6A 2G40A 2HGSA 4W82A 4EBBA 2V1UA 3RADC 2J0UA 3ZDXB 3L4BA 3C85A 4JL6A 3RRMA 1TCCA 5KJCA 1YI8A 1LY1A 3HZZA 3LBNA 3SZGA 4BFTA 1E96A 3NC0C 3VU3A 1GEGA 3VAZA 3H9QA 4IJ5A 3NS7A 1KYIA 4CM1A 1KEVA 4JEIA 4N7JA 2DQKA 1Q7CA 2X8BA 3E48A 3ZOZA 5EJMA 4JU9A 4ZZ3A 5BN4A 4IO1A 3SQNA 1JALA 1YRBA 2OC4A 4Y0NA 3KOWA 3CVVA 1ONPA 5K4HA 3V4RA 1LW7A 3IAM1 4UHDA 3JYPA 1U7HA 2OC9A 1Q11A 2CMFA 2JFGA 2IYFA 3RWOA 3FCXA 1P7CA 4X65B 1HDCA 2PSFA 4TV8A 1YHYA 5ARDA 1KQOA 4BLVA 4DMHA 3IFSA 1QQ7A 1T9GR 2R96A 2VNKA 3TOXA 1CF4A 4HNQA 2YV1A 3K7EA 1VLVA 1LC0A 3V7FA 1TQHA 1UZMA 1SJ9A 3EFBA 2JAQA 5KDOA 1E20A 4DB4A 4O4IF 4Q9HA 1H8HA 3A28A 1KU0A 3KDPA 4QYIA 4NMHA 2YMLA 2X0KA 4FFBB 2OYSA 4DQVA 1ZWLA 4WW0A 2IXTA 2ZULA 4WX2B 3N28A 4AKGA 4X91A 3VPSA 4IIXA 3MRSA 4GKAA 5B1HA 2ZBQA 3KHTA 2II6A 3DBOB 1B6TA 2FZLA 4F93B 5JDIC 1I3NA 1UEIA 4DUGA 2Y1FA 4WK6A 1Z9BA 2OKCA 3WZLA 5K09A 4PHGA 1WUTA 2RI1A 5CM2Z 2EZUA 1QYRA 5I01A 1NA5A 1PQPA 3RS7A 5EL0A 5JAUA 5AOCA 5KCMA 3ZZ1A 1XQ1A 1MAHA 2MSCB 3EHDA 2ORVA 5IJAA 4ZYVA 4YMWA 3P27A 2JGIA 1WRBA 4A7PA 1XOIA 3I53A 4UJ3A 1KZHA 2ATVA 3DOEA 4AUNA 4D9IA 2ET6A 3OI7A 1P1FA 1ODJA 1XDGA 3R5FA 3CNLA 2FNAA 3SFVA 1YIDA 4REQA 1ZZGA 2QLFA 3IPCA 3DKKA 2ZXFA 3DV0A 3AVQA 3LUCA 3MS4A 5DYNA 4HY3A 3CZRA 3FZNA 3NAMA 5JISA 2CF6A 3NALA 2YS7A 3C97A 3LK6A 1TYDE 1E9BA 4H7IA 1XROA 1GGEA 2RGNA 3T12A 2CLEB 2P5SA 4GP9A 4H27A 1EINA 1JFFB 5B2ZA 2AEFA 1Z5VA 3WL8A 4XW2A 1VJGA 1XJ0A 4GSLA 3Q8KA 3DDWA 3I5AA 4D99A 4L02A 1T6XA 3PRHA 3NRBA 1YZLA 3URKA 1R8JA 3IOBA 1M34B 3JS5A 5KTRA 1QFZA 2A0YA 2ZJ1A 3BL8A 4OHOA 1N4DA 1RLMA 5FF9A 1ZMOA 1SOVA 3AU8A 3KZMA 4MEAA 4R41A 4ZT7A 3VR3A 3MWFA 2Q1TA 4NG4A 2VZ9A 4MVJF 5AVYA 1MU0A 2Q5EA 4KSCA 1V47A 2NACA 2AJ8A 2IWHA 2PX0A 4KVZA 5FYQA 5A3JA 1XTSA 5T5QA 4I1RA 4M1ZA 1G9SA 4BTLA 4K8OA 3MAAC 4F3KA 3V42A 4ES6A 1IIRA 3F46A 1ZW1A 2ECPA 5FUBA 2ZT5A 1L0BA 2X6QA 4Y2JA 3ASVA 2ADOA 1NU8A 3PNMA 1FDSA 1NUUA 1V48A 4GVPA 3C98A 3IIEA 5FPYA 3SYLA 5IBPA 5TQ2B 2RAVA 4URZR 2IW1A 2XDQA 3ETGA 2FRVA 4GICA 2AUTA 1QNFA 5GMOA 3FPLA 3MRXA 2WDPA 4Q03A 4DLAA 3LBYA 1Q15A 4M76B 5BR7A 2CNWD 4X60A 4YQZA 2PQ0A 1TA9A 5DLPA 1GTZA 4G5YA 3UGTA 4A26A 3SXUB 4D9CA 5JHGB 1NYTA 4CR7A 1JI0A 1SO8A 3DXFA 3PEUA 4WNCA 3LZ6A 5K51A 2N1MA 3D1VA