3UB7A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with acetamide bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
160
structure length
160
Chain Sequence
QLMEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 56
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub7A00
1XJ2A 1OJGA 3UMDA 1WA9A 4H6JB 2L4RA 1NWZA 5F5YA 1OTBA 4HP4A 4GHIB 4WLAA 3IS2A 4HNBA 1OTIA 2P7JA 4XT2A 4JGQA 1GSVA 1S66L 4I3IA 3MQOA 3LIBA 5G4YA 2PYPA 1DP8A 2ZOHA 2L0WA 4H6JA 1UGUA 3UMEA 2PR5A 2QJ7A 4WL9A 1OTEA 4GHIA 5F69A 3CWFA 1OT9A 4HH2A 3LI9A 2VLGA 2D02A 4HQAA 4K08A 4EEUA 5HWWA 1MZUA 1S1YA 4HH3A 4I38A 5F6AA 3E4QA 2Z6DA 3A0RA 3H82B 3IBRA 1F9IA 3D72A 2OWHA 5I5LA 5HZHA 5J7EA 3ICYA 3K3DA 4EXOA 2V9AA 5HDDA 3H82A 2W0NA 4L9GA 5DKKA 2R78A 3FC7A 5HDCA 4EESA 1BYWA 2D01A 4WF0A 5HDSA 4I3AA 5HWTA 4I5SA 3MFXA 3H7WB 2WKRA 2PD7A 3LUQA 4R3AA 1UWNX 2V1AA 1V9ZA 4HI4A 4F3LB 2J80A 3C2WA 1KOUA 1DP6A 3CLOA 5TBMB 2INWA 4BBUA 5HD3A 1VB6A 1GSWA 4M4XA 2VV8A 3ULFA 1UWPX 4WUJA 3NHQA 3UB8A 2ZOIA 5TBMA 4L9FA 1Y28A 3EWKA 3LIFA 4HP9A 1P0ZA 4BBVA 1XJ4A 5HWVA 4HHDA 4NXEA 4WN5A 4BBTA 2V0WA 4B9OA 3E4OA 3MQQA 4HOIA 4I39A 2B02A 3LIEA 5DJTA 3VE4A 3SW1A 3LIDA 3BY8A 1DRMA 1N9LA 1GSXA 4MN6A 3F1PB 1LT0A 4EEPA 1TS8A 5KIZA 3LI8A 1D7EA 1T19A 4YWZA 2PR6A 3UB9A 2A24B 2L1MA 2YKHA 3VOLA 1N9OA 3T50A 4HJ6A 4LPZA 1S67L 3VE3A 1OTAA 3F1PA 4R38A 2BASA 5J3WA 4NXFA 2YKFA 2A24A 3HJIA 4HIAA 3F1OA 4GW9A 2VV6A 4GCZA 4EETB 3A0SA 3NOPC 3MXQA 3F1NB 3OLOA 1N9NA 3LICA 1T1CA 4L9EA 4HY8A 3LYXA 1ODVA 2PHYA 4MN5A 1F98A 1LSWA 3F1NA 4LRYC 2KX6A 2CMNA 4LRXC 1LSXA 3G6OA 4PKYG 5AVEA 2KDKA 2W27A 4RQ9A 4DJ2A 4HJ4A 4JGRA 5EFWA 4EQ1A 2OWJA 4KUKA 1LSVA 2QKPA 2QHKA 2JHEA 2QWSA 3LIAA 3KX0X 4GS9A 3MR0A 1EW0A 1XJ6A 3PYPA 1TS0A 5DKLA 2OOLA 1TS6A 1XFQA 2V1BA 1OJ5A 2V0UA 3NOTC 4LLOB 3UB6A 1T1BA 4LRZE 3K3CA 3P7NA 4DJ3A 1XFNA 4KQDA 2HV1A 2PYRA 2VV7A 1X0OA 3GDIA 3BY9A 1JNUA 1DP9A 1S4SA 2PD8A 3B33A 5HD5A 1G28A 3UB7A 1D06A 3ZQ5A 3F1OB 2PDRA 3E4PA 4E04A 1S1ZA 3CAXA 4PKYA 2ZBBA 3BWLA 5IS1A 5G4ZA 3C8CA 3GECA 1TS7A 5AVFA 3RH8B 2M1CA 4HJ3A 3A0VA 2VEAA 4JGOA 1T18A 2Z6CA 4R70A 5A8BA 1P97A 1V9YA 3H9WA 3EEHA 5DJUA 3UE6A 4EW7A 1OT6A 4EERA 3PHYA 4I3JA 4NXGA 4NXBA 1S4RA 4JGPA 2K7SA 3NOUC 2H28A 5J4EA 3HJKA 2WKPA 1LL8A 2GJ3A 4R6LA 4GS9B 2JN7A 3H7WA 2QJ5A 5HSQA 1T1AA 3MJQA 5IU1A 4F3LA 2I9VA 3FG8A 2WKQA 3RTYA 3IS2B 3NJAA 2EA9A 1OTDA 4XT2B 1XJ3A 5F68A 4KUOA
chains in the Genus database with same CATH superfamily
1K57A 4H6JB 1ACFA 3DWKA 4Y5FA 4F94A 2J8YA 3IS2A 1FCOA 2PU2A 5GLCA 1GSVA 4GDBA 2P08A 3NDGA 2HDRA 2PRFA 1FCMA 2ZOHA 4FUWA 4H6JA 3CJMA 2V20A 4LV1A 2KOIA 3T1XA 4DE3A 3LI9A 1PI5A 4K0WA 1VHMA 4IUHA 4EEUA 5HWWA 1MZUA 2IWDA 1KGGA 3AGDA 4S2PA 1MWTA 1EROA 2Z6DA 1DJAA 3U4LP 2ZC3B 3IBRA 1F9IA 3IX8A 4EUVA 2J7VA 5M19A 2HJEA 5FASA 3VOZA 4QHCA 3K3DA 3MMHA 4EXOA 4JXVA 4IUKA 3VFHA 2LB5A 2H10A 4FSFA 4L9GA 1JWZA 2JKTI 5HDCA 2XA7S 4MBFA 1MKMA 2ZQ7A 2NUPC 3FPVA 4JBFA 2EFXA 2PD7A 3CPTB 3LUQA 4E3MA 1FOFA 1UWNX 2J3TD 4PHTA 2ZC4B 4HI4A 2BTFP 4D2OA 4FH4A 4E3OA 4KQRA 3CLOA 1K56A 3CPTA 1XA1A 5TBMB 2ZQCA 4QU3A 4Y2FA 2DNSA 3U2AA 1YLJA 4WEJA 2B5RA 1GSWA 1ZG4A 3JPUA 3CUEC 4ZAMA 2VV8A 4X55A 2FFYA 3OPLA 4X1MA 4O8GA 3PBSA 1SKOB 4DF6A 5TBMA 4L9FA 1Y28A 3BYDA 5HAQA 4N1XA 3EGXC 3LIFA 4ETZA 1XJ4A 1PZPA 4QD4A 1FCNA 1XXMA 2XLNA 1WE4A 4FTXA 4IEDA 5IT5A 3IXDA 3MQQA 4HOIA 1SKOA 2ZQ8A 4I39A 3IXGA 4X1LA 2V8FA 2O99A 4E3JA 3HLBA 3MXRA 3LIDA 2XRNA 3BY8A 1TD5A 1DRMA 4MN6A 1LT0A 4EEPA 2ZC5B 3VP1A 4ARZB 4S2IA 1D7EA 1H3QA 3IF6B 4R3BA 4OPZA 2A24B 1H8YA 3G32A 1LL5A 3B47A 4LPZA 1JWVA 1OTAA 3RJUA 2ZC7A 3S7PA 1NRFA 1RCJA 3C30A 5AQ7A 1YSQA 3M2JA 2BASA 3ZGAB 3NI9A 5FQKA 5CHMA 2A24A 1BT5A 3ZFZA 5HFOA 4X53A 1K4EA 3ZNYA 3IHBA 1MWRA 4PAUA 4EQIA 1F2KA 1NRJA 4GCZA 1DJBA 4PMAA 1JTGA 2Y2NA 3MXQA 5FI6A 2IWCA 3F1NB 1CEGA 1N9NA 3CI6A 4OQHA 1SZVA 4L9EA 2WGIA 2ZMAA 1KVLA 4ETXA 3W8KA 1F98A 4GD8A 3F1NA 3HCYA 1BZAA 3S4XA 3GSGA 5L8MA 3V39A 4MCWA 2VKSA 4N1HA 5E2EA 1LSXA 3DAVA 1YMSA 4X56A 2ZM0A 2KDKA 5G18A 4DJ2A 3HLDA 4EQ1A 4Y13A 5CERA 3TOIA 2P9VA 2JKRI 4S2KA 2QKPA 3EQVA 2EXAA 4IBXA 3DW0A 3HLFA 2Y59A 3OCNA 3SZTA 2BLSA 3HLEA 5EUAA 1BLCA 3KX0X 4KG2A 3MR0A 4Y17A 4CJNA 3C38A 3PYPA 1U60A 4C3QA 2HZ5A 3S7QA 2OOLA 2IWBA 2W3HA 3ZG0A 1O7EA 2V0UA 4JF4A 4OPQA 2HPBA 4HBUA 3NDEA 3RFBA 3VP2A 5U47A 5HL1A 4S2MA 2ZC6B 1H5XA 3JVVA 1OPXA 3Q1FA 1HVBA 4ID4A 3VV4A 1TVFA 3VFFA 1ZG6A 3CITA 3TE8A 3JYIA 4HESA 1KE0A 5HD5A 1G28A 2Y4AA 3ZQ5A 5BOHA 1YLWA 3BFEA 1NY0A 2Y2MA 2J9OA 2Y2JA 3T1QB 3O86A 3OOVA 4G3KA 3BWLA 5A91A 4CQHA 1ZTUA 1QMFA 3S7OA 5L10A 2R9XA 2M1CA 1NZUA 3OBFA 3PR6A 4JGOA 1PZOA 2Z6CA 4JF5A 1BULA 2Y55A 2XROA 1ZKJA 3D9YA 5GL9A 3IT9A 3BFFA 4BQMA 2JCHA 1JTDA 3G30A 1WYBA 5DJUA 4DXCA 5MC7A 3PHYA 1W8YA 1LLBA 4I3JA 3UNWA 4DKIA 4NXBA 2QMIA 2C6WB 4Y15A 4JGPA 3O3VA 3BW6A 2RL3A 2WKPA 2EX2A 1SKFA 2WUQA 1NYMA 1KDWA 4R6LA 4E6WA 4C6YA 2ZM8A 2JN7A 3E0YA 3WS4A 4S2NA 3H7WA 3BRMA 4YINA 2XQZA 2QJ5A 3VP0A 4Q0IA 3G35A 4Q0HA 3MJQA 2QPNA 5HL6A 5FEFA 3V3SA 4MDZA 4R4SA 2WKQA 4OPRA 2XK1A 4QY5A 3C5AA 2EA9A 4BL3A 3SS4A 5F68A 3IXBA 5M1AA 4R4RA 1XJ2A 3UMDA 1H8MA 1GA9A 2L4RA 5DFYA 1NWZA 5F5YA 4GHIB 4HNBA 2ZL1A 4IJGA 4R3JA 1IYSA 4I3IA 4LV2A 5DTKA 3MQOA 5G4YA 1E25A 2PYPA 1OTEA 4GHIA 4PPRA 5C5KA 4RX2A 3RXXA 4HH2A 2VLGA 3PBNA 4HBTA 3Q81A 1S1YA 1GCEA 4HH3A 5HARA 4N9LA 3E4QA 3H82B 5FQIA 3VOYA 1BTLA 5I94A 2WYXA 2H5SA 3MSHA 5CECA 2V9AA 3MQ0A 2W3EA 3H82A 3V67A 2W0NA 2Y2PA 1ESUA 5EPHA 3FPWA 3W4QA 2WAFA 5TFQA 2EXBA 2R78A 2BG1A 4EESA 2D01A 3BLSA 2XDMA 5HWTA 1AWIA 3OPHA 2FH5A 3MKEA 4EBPA 1LL9A 2W1TA 1K54A 2MJ6A 3QP4A 5DTTA 1HLUP 5JYOA 3HUMA 4F3LB 3W2ZA 3C2WA 4P0MA 1ONGA 1RP5A 1RGYA 5CTNA 1G6AA 4NEED 2XGNA 2M7VA 3FWLA 5LBRA 1FSWA 4X69A 4ZRRA 4WUJA 5CHJA 3P98A 5EVIC 4FH2A 4D60A 3HL9A 4OLDA 1CQAA 4HP9A 3LR0A 4BL2A 4WN5A 1K55C 4B9OA 4MBHA 1PYYA 3KO6A 4KZ5A 3LIEA 4OLGA 5DJTA 4BWIA 3QNBA 3CG5A 5E2FA 3T1SA 3SW1A 3SOIA 3S7NA 3ZHHA 1I2SA 3HREA 3BQAA 2WAEA 1GSXA 3F1PB 2Z2MB 4UA9A 3LI8A 1T19A 2PR6A 3UB9A 3QP8A 5KSCA 2YKHA 3PBTA 3VOLA 4L0LA 3MBZA 1YQSA 1K57C 1MPLA 3F1PA 5CX7A 5D3OA 5E2GA 1O07A 3VP3A 4NXFA 4Z9QA 1SHVA 3V3RA 3BM6A 4B4XA 2W1RA 3Q7ZA 4R0QA 1OMEA 4KENB 5FQ9A 4LV0A 4MEZA 2WK0A 3Q7VB 3F1OA 1GHPA 4EETB 4Y7PA 3QP2A 3TRCA 3OLOA 3LICA 3IH8A 4Z1WA 1YPRA 3WS2A 3Q7VA 2A2LA 3LYXA 1ODVA 3BJNA 1I2WA 2PHYA 3GV9A 5GHYA 4MN5A 3E2LA 4IBRA 4X25A 3O5YA 1K56D 3E98A 4PM9A 1BLPA 2JC7A 1PIOA 2KX6A 2Q9NA 4U0TA 4OOYA 2VZWA 5FDHA 3LO7A 5AVEA 2Y2GA 1K25A 3LR3A 3PBOA 3G2ZA 4HJ4A 2Q9MA 1A0KA 1YLZA 3C4PA 1CF0A 2OWJA 1PFLA 3SS3A 1NLZA 3UPPA 1LI0A 3B3XA 4LCLA 1KE3A 4RVAA 3GQZA 2ZD8A 2DCFA 1MC0A 2EWWA 3TSGA 1DJCA 3EEAA 2QWSA 5FA7A 4Y0UA 1F5MA 3UDIA 1EW0A 1XJ6A 1TS0A 4NETA 2GNXA 2J3TC 1BLSA 1TEMA 2EFUA 3S1YA 3ZVWA 1K38A 3QP6A 1T1BA 4LRZE 1QMEA 4OONA 3PTEA 1P9RA 5AJGA 4KQDA 3LR4A 5F83A 2OAQ1 1FILA 2PYRA 3T1RA 2J9PA 1NLYA 3GDIA 4ZTKA 1ES2A 2W3FA 2XSSA 1S4SA 1MY8A 3MKFA 3B33A 3O87A 3N4IA 1D06A 4KZ8A 5EM1A 3LFVA 3L7HA 1IKGA 4KZ6A 1TDGA 1PI4A 1JWPA 2H0YA 3PAEA 3KSIA 1NYYA 4NG2A 1FIKA 5GHZA 2ZBBA 4C75A 5G4ZA 3DTKA 3GECA 2G2WA 4OP8A 3UB5P 1MWUA 5AVFA 3NC8A 4NKPA 3RH8B 4OPYA 4ME4A 4G3VA 2EX8A 4XXRA 3C4OA 3BQ8A 1T18A 1TF1A 4DDSA 3MF0A 4R70A 1FR6A 1V9YA 2GZAA 2P9VB 1KE4A 3UE6A 3IF6C 2QZ6A 3RXWA 2OLVA 1MXOA 5CXWA 4EBNA 3NOUC 2X01A 1BUEA 3T4LA 3ITBA 1LL8A 1IYPA 4P85A 3UN7A 3IBJA 3BEBA 4QPRA 2ZMVA 3NCKA 1XPBA 4P87A 3IWQA 4LGWA 4MNRA 2Y2HA 4BLMA 1W7FA 1J3WA 3G2YA 3FG8A 3R7WB 5J8XA 3N6IA 3RTYA 1W8QA 1GHIA 1GA0A 1OTDA 3T4SA 4EV4A 4JLFA 1XP4A 3FKVA 4IVKA 5EE8A 3WS0A 3KSFA 1OJGA 3R7WA 4CLCC 2X02A 3EQUA 3A3IA 4HP4A 4WLAA 1OTIA 3M6BA 4KZAA 5M18A 4JGQA 5HAIA 1S66L 2K31A 5KSHA 3DBAA 3SH7A 1LHYA 2L0WA 1UGUA 2QJ7A 4WL9A 1ERMA 1ZHHB 4FCFA 1VEUA 4GD6A 3HLGA 1XKZA 4GOGA 2ZQDA 4GZBA 3D3OA 1Q2QA 2D02A 2Y91A 4HQAA 4K08A 4U0XA 1LI9A 3KSGA 2A49A 4I38A 2Z2LB 5A90A 1IYOA 4RA7A 4RYEA 5L2FA 3D72A 2ZQAA 5I5LA 5HZHA 2WKEA 3UE1A 3JVUA 2ZMFA 3Q07A 3PBRA 3IF5A 1IEMA 4O7DA 1BLHA 5FAPA 1W79A 5DKKA 3FC7A 4JXGA 1PRQA 4WF0A 4X68A 1PW8A 4I3AA 3ZG9B 1VETB 3H7WB 2WKRA 3BECA 4R3AA 3ZG5A 1I5QA 4DE2A 1YMXA 4WZ5C 1D1JA 3BFCA 5F1GA 4KZ9A 2OV5A 4JF6A 2HP5A 3GVBA 2J80A 4GKUA 4GJ4A 1DP6A 2XD1A 1VETA 5EECA 1W63Q 1N9BA 4O01A 4S2OA 3SS5A 5HD3A 2GDNA 2HJ9C 1PWCA 1ES5A 2W3DA 4XUZA 3LCEA 4MMNA 2Q0OA 4B88A 3IX4A 4LV3A 4M4XA 1SDEA 1K6RA 4DE1A 3NHQA 3GMWA 3UB8A 1E3UD 2ZOIA 2NUTC 4EBLA 1HZOA 1P0ZA 2ZL1B 4BBVA 5HWVA 2WZXA 4DMZA 1E3UA 4HHDA 4NXEA 4BBTA 2WKHA 2EWVA 3W4PA 1YLPA 2Y2QA 4S2NC 1PWGA 3VMAA 4MLLA 4RX3A 2O0YA 4GDNA 5K5BA 3VE4A 5HAPA 3DTMA 1S0WA 5CGSA 3WS1A 4PM7A 3HLWA 3DTIA 1N9LA 3P09A 3A3FA 1TS8A 4YWZA 4EU0A 3IQAA 1FR1A 2WGWB 3AGEA 3VE3A 2Y2LA 4R38A 5FATA 3P01A 2JE5A 3IWOA 5TGFA 4LCMA 1VQQA 1BSGA 2I72A 2HDQA 1HTZA 1ALQA 3ISGA 3IXHA 4WMCA 3IX3A 4WZ4A 2WGWA 4U3TA 4S2LA 4UA7A 2ACGA 3HJIA 1XGIA 3GR2A 1STZA 2PT7A 2HGVA 2VV6A 1NJ4A 5CEDA 2W1TB 3A0SA 1YKDA 4Y3IA 3GRJA 4E3LA 3HLCA 2Y79A 5DF9A 1T1CA 2R9WA 4JPMA 3SH9A 2VGKA 4YFMA 3MZEA 4HY8A 3LEQA 5EOEA 2RCXA 3LR5A 1CEFA 1L0EA 3OZHA 4DRTA 3CMZA 1Y4OA 2G2UA 4KZ7A 5GLBA 4LRXC 4ZBEA 3ZYTA 3G6OA 5AQAA 5EVIA 1Q2PA 1E4DA 3MFDA 3IWIA 4KZ3A 5EFWA 2GX5A 4PM5A 5JYPA 3QNCA 3BLMA 4WBGA 2PU4A 2QHKA 3WRTA 2JHEA 5EV0A 1W5DA 3A3EA 3O88A 4E6XA 3MS6A 4AFIA 3IHAA 3NY4A 4OOMA 4GS9A 4II7A 4BENA 1XX2A 1L0FA 2O9CA 4DDYA 1K6SA 3C7VA 2V1BA 4ZDXA 1OJ5A 3A3DA 1TDLA 4LLOB 3UB6A 1J9MA 3WS5A 5DVAA 5IHVA 2XA7M 2JKTM 3P7NA 1XFNA 5FAQA 3LY4A 5FQJA 4BJPA 5EM0A 2KLIA 1X0OA 4E3IA 4CLCE 3N7WA 2XR0A 4OVDA 5CTMA 3NECA 1IKIA 3T4KA 2A3UA 2ZLYA 4XUXA 2PD8A 4QB8A 3HBRA 2XH9A 3F1OB 4UA6A 1KGEA 1ERQA 2HP9A 1CI8A 2PDRA 3E4PA 1CK3A 4A5RA 4E04A 5HPFA 1S1ZA 1PNEA 5HPIA 4PKYA 3V5MA 3ZG7B 5IS1A 4CPKA 1TS7A 4P6ZM 3HUOA 2JBFA 3D4FA 3A0VA 3C7UA 3FV7A 2VEAA 3OC2A 4DE0A 5A8BA 1P97A 3H9WA 5FSRA 3EEHA 3DTEA 1OT6A 3CUEA 3WRZA 1K0KA 3IH9A 4NXGA 2XD5A 3T12B 3T4JA 5EVEA 4GB7A 1YAXA 2H28A 4KQQA 5J4EA 3HJKA 3L9KA 4IVIA 1KVMA 4BD0A 2GJ3A 2ZJ9A 4ESPA 5FEGA 4O0PA 4WEKA 2HP6A 2ZQ9A 4N92A 3N8LA 1CJFA 5HSQA 3R4KA 5FDSA 5FQMA 2XF3A 2FZ0A 2I9VA 2K2NA 2HF6A 5L07A 4P6ZS 2O9AA 4GNUA 2OSUA 5E2HA 4XT2B 5F1FA 2XEPA 3HVFA 1WA9A 2H0TA 5DF8A 2VGJA 1SCWA 2X71A 3MXSA 4M3KA 1MBLA 1XGJA 1OTBA 2WKIA 1MKIA 4HEFA 2P7JA 4QY6A 4XT2A 3M6HA 2CC1A 1YM1A 3LIBA 3ITAA 3BFGA 1DP8A 2XFSA 3T4OA 5KMWA 4GN2A 3OPPA 3UMEA 2PR5A 3ZCZA 1IFQA 5CGWA 3TG9A 4QJGA 5F69A 3CWFA 1OT9A 2DMWA 2B95A 4G3WA 4R1GA 4B93A 3W4OA 2JKRM 1H0MA 5F6AA 5FL3A 2M7UA 4PM8A 3A0RA 2WGVA 3WWXA 4ARZA 3KYZA 4NK3A 2OWHA 3IF6A 2V2FF 5J7EA 1CI9A 3ICYA 2Y2IA 2P04A 2VGLM 1XA7A 5HDDA 1FQGA 3OPRA 1GHMA 4R23A 5GHXA 1AXBA 3V50A 3FZCA 1C3BA 3FKWA 2E8IA 3B42A 5FI2A 2FFFB 1K4FA 1BYWA 3UO9A 5CHUA 1DY6A 5HDSA 2Y8HA 1G6OA 4I5SA 3MFXA 3E2KA 4OKPA 1ZC2A 3QP5A 4UQIM 3G34A 3N8SA 4KQOA 4JXWA 1IELA 1Z09A 4EUZA 2V1AA 4H8RA 2J3WA 1ES3A 1V9ZA 5FI7A 4YNRA 4KZ4A 4GLQA 3ZG8B 1KOUA 4CLCB 4OP5A 2JKGA 2INWA 4BBUA 2PBYA 3G4PA 1VB6A 3ZVTA 4CLCD 3I7JA 3ULFA 5F82A 4DXBA 1UWPX 4LFUA 4JKTA 4CLCA 1PW1A 2EX9A 3EWKA 1KGFA 1P9WA 2VGLS 2V0WA 3E4OA 2IA2A 1M40A 3AGFA 2B02A 2G7UA 1VEUB 5DTSA 5FQQA 3UDXA 4UEYA 3K2NA 3PXPA 2O9BA 1N4OA 5CGXA 2DRWA 5GLDA 4WELA 1SDNA 4DN0A 4UQIS 4OQ0A 5DFXA 1ES4A 2V8CA 1YT4A 2V1ZA 4K0XA 5KIZA 1RGZA 5EOOA 3LEZA 2L1MA 5HX9A 1N9OA 3T50A 3ZNTA 4HJ6A 1S67L 3LGOA 4Y0TA 2C5WB 5J3WA 3Q82A 2YKFA 3TJZC 5HW3A 3FYZA 3PBQA 4B4ZA 5L09A 4HIAA 3UPNA 1WYCA 4GW9A 4WZ5A 3NOPC 3ZDJA 4N9KA 2W3GA 3GTCA 4FD8A 2PAVP 4KG5A 5DF7A 4MBKA 5A93A 1LSWA 4PM6A 1G68A 2P74A 3T4TA 1EWZA 4ZJ1A 4LRYC 2OAP1 2CMNA 2EX6A 3LY3A 1KDSA 1EI5A 4LENA 4E3NA 1JVJA 1G5UA 5FAOA 4PKYG 5KZHA 3MZFA 2W27A 1VM1A 4RQ9A 4JGRA 1YLYA 3PAGA 4KUKA 1LSVA 3HUNA 3SH8A 3KSHA 5AQ9A 2E8JA 4OQGA 3NBLA 1MWSA 5A92A 3S22A 1Y54A 1NZOA 2UWXA 3NULA 3T4QA 3LIAA 4P6BA 4ZJ2A 4KG6A 3QP1A 5DKLA 4ZJ3A 3UDFA 5E43A 1TS6A 1XFQA 3UY6A 4BD1A 3NOTC 3EGDC 3M2KA 3UPOA 4QWOA 3VP4A 4FOFA 1ESIA 3K3CA 3OCLA 4DJ3A 3KYQA 5CRFA 3VSKA 4OOLA 2JKFA 3A3JA 3CHWP 2HV1A 3UE3A 1S6RA 2VV7A 1IOUA 3BY9A 4Y0OA 1L2SA 5TJJA 1JNUA 4KZBA 3CZDA 2VA0A 3BFDA 1DP9A 4Q8IA 2VJWA 3N8RA 1Z6FA 3UB7A 1H8ZA 4WMCD 1L0DA 2VK3A 4IHQA 2WADA 2QYBA 3CAXA 3C8CA 4WYYA 2OLUA 4YOFA 3UE0A 1PWDA 1YSPA 3KYEA 4HJ3A 5TR7A 4OH0A 1M6KA 1ONHA 5EVIB 4EWFA 4BMWA 5GLAA 1HD8A 2WZZA 1FSYA 5EVID 4EW7A 3VSLA 1IYQA 4EERA 4X6TA 2HDUA 2HDSA 2VX8A 2Y2KA 1S4RA 3QHYA 2K7SA 3G31A 2LB9A 2AVXA 4MN7A 4E3KA 1K55A 3NIAA 4GS9B 2PBDP 3DWZA 4K91A 5EVLA 2B18A 4UAAA 1K54C 4S2JA 1NXYA 3EOIA 1T1AA 5IU1A 4F3LA 3MZDA 2Y2OA 4UHUA 1L3LA 4JXSA 2ZM2A 1W63M 5AQBA 2UV0E 4OQIA 3IS2B 3NJAA 3TW8A 1XJ3A 4WM9A 5CEBA 4Q0JA 2XFTA 1YLTA 4KUOA 1L0GA
chains in the Genus database with same CATH topology
3KSFA 1XJ2A 1OJGA 3UMDA 1WA9A 4H6JB 3R7WA 1H8MA 2L4RA 4Y5FA 5DFYA 4CLCC 1NWZA 5F5YA 3EQUA 1OTBA 4HP4A 4GHIB 4WLAA 3IS2A 4HNBA 1OTIA 2P7JA 4IJGA 4XT2A 4JGQA 1GSVA 1S66L 2P08A 2K31A 4I3IA 5KSHA 3MQOA 3LIBA 3DBAA 5G4YA 2PYPA 1DP8A 2ZOHA 2L0WA 4H6JA 3T4OA 1UGUA 3UMEA 2PR5A 2QJ7A 4WL9A 1OTEA 1ZHHB 4GHIA 1IFQA 5C5KA 5F69A 3CWFA 2KOIA 1OT9A 4HH2A 3LI9A 2VLGA 1VHMA 3D3OA 2D02A 2DMWA 4G3WA 3PBNA 4HQAA 4IUHA 4K08A 4B93A 4EEUA 5HWWA 1MZUA 2JKRM 3KSGA 1S1YA 4HH3A 4I38A 5F6AA 5FL3A 3E4QA 2M7UA 2Z6DA 3A0RA 3H82B 4ARZA 3KYZA 3IBRA 1F9IA 3D72A 2OWHA 5I5LA 4EUVA 5HZHA 2HJEA 5J7EA 3ICYA 3K3DA 3MMHA 3JVUA 2P04A 2VGLM 4EXOA 4IUKA 2ZMFA 2V9AA 5HDDA 3MQ0A 3PBRA 2W3EA 3H82A 3V67A 2W0NA 2LB5A 3FPWA 4FSFA 4L9GA 3B42A 5DKKA 2R78A 2JKTI 3FC7A 5HDCA 4EESA 1BYWA 2D01A 2XA7S 4WF0A 1MKMA 2NUPC 5HDSA 4I3AA 2Y8HA 3FPVA 5HWTA 1G6OA 4I5SA 3MFXA 2FH5A 3H7WB 2WKRA 2PD7A 3LUQA 4UQIM 4R3AA 4KQOA 2W1TA 2MJ6A 1UWNX 2V1AA 2J3WA 2J3TD 1V9ZA 4PHTA 4YNRA 4HI4A 4F3LB 4GLQA 3W2ZA 2J80A 3C2WA 1KOUA 4GJ4A 1DP6A 3CLOA 4CLCB 1W63Q 4NEED 4O01A 5TBMB 2INWA 4Y2FA 4BBUA 5HD3A 2HJ9C 3U2AA 4WEJA 2M7VA 2W3DA 1VB6A 1GSWA 4MMNA 5LBRA 4CLCD 4M4XA 3CUEC 2VV8A 3ULFA 4ZRRA 1UWPX 4WUJA 3NHQA 4O8GA 3UB8A 3PBSA 4CLCA 2ZOIA 2NUTC 5TBMA 4L9FA 1Y28A 3EWKA 4ETZA 3EGXC 3LIFA 4HP9A 1P0ZA 3LR0A 4BBVA 1XJ4A 5HWVA 4DMZA 4HHDA 1P9WA 4NXEA 4WN5A 4BBTA 2VGLS 2V0WA 4B9OA 2EWVA 3E4OA 2IA2A 5IT5A 3MQQA 3KO6A 4HOIA 4I39A 2B02A 2G7UA 3LIEA 5DJTA 4BWIA 2O0YA 2O99A 5K5BA 3VE4A 3SW1A 3LIDA 2XRNA 4UEYA 3K2NA 3BY8A 3PXPA 2O9BA 3S7NA 4WELA 1TD5A 4DN0A 1DRMA 1N9LA 3BQAA 4UQIS 1GSXA 4MN6A 3F1PB 1LT0A 5DFXA 4EEPA 4ARZB 1TS8A 5KIZA 3LI8A 1D7EA 1T19A 1H3QA 4YWZA 2PR6A 4EU0A 3UB9A 2A24B 2L1MA 2YKHA 3PBTA 3VOLA 1N9OA 4L0LA 3T50A 4HJ6A 3B47A 4LPZA 1S67L 3VE3A 1OTAA 3F1PA 5CX7A 4R38A 3S7PA 3P01A 3C30A 1YSQA 2BASA 5J3WA 4NXFA 2YKFA 3TJZC 2A24A 2W1RA 3PBQA 3HJIA 4HIAA 4PAUA 1STZA 2PT7A 3F1OA 1NRJA 4GW9A 2HGVA 2VV6A 4GCZA 4EETB 2W1TB 3A0SA 1YKDA 3NOPC 3MXQA 4Y3IA 3F1NB 3TRCA 3OLOA 1N9NA 3LICA 3CI6A 4Z1WA 2Y79A 5DF9A 1T1CA 4L9EA 2W3GA 2A2LA 4HY8A 3LYXA 4ETXA 1ODVA 3BJNA 2PHYA 3LR5A 4MN5A 1F98A 1LSWA 3F1NA 3HCYA 3O5YA 3E98A 3T4TA 5L8MA 4LRYC 2KX6A 2CMNA 2OAP1 2VKSA 4LRXC 4MCWA 3ZYTA 1LSXA 3G6OA 2VZWA 4PKYG 5AVEA 3LR3A 3PBOA 2KDKA 2W27A 4RQ9A 4DJ2A 4HJ4A 4JGRA 5EFWA 4EQ1A 2GX5A 2OWJA 4KUKA 1LSVA 2JKRI 1NLZA 2QKPA 3KSHA 3EQVA 2QHKA 2JHEA 1MC0A 3OCNA 2EWWA 3EEAA 2QWSA 4AFIA 3T4QA 4OOMA 1F5MA 3LIAA 3KX0X 4GS9A 4II7A 3MR0A 2O9CA 1EW0A 1XJ6A 3C38A 3PYPA 1TS0A 5DKLA 3S7QA 2GNXA 2J3TC 2OOLA 1TS6A 1XFQA 2V1BA 2W3HA 1OJ5A 2V0UA 3NOTC 3EGDC 4LLOB 3UB6A 4FOFA 1T1BA 3RFBA 4LRZE 3K3CA 3OCLA 2XA7M 2JKTM 1P9RA 3P7NA 4DJ3A 1XFNA 5AJGA 4KQDA 3LR4A 3KYQA 2OAQ1 3JVVA 4OOLA 1OPXA 4BJPA 2HV1A 2PYRA 3VV4A 3UE3A 2KLIA 1NLYA 2VV7A 1X0OA 3GDIA 1IOUA 4CLCE 3BY9A 3T4KA 5TJJA 1JNUA 3CITA 2W3FA 2XSSA 3TE8A 2VA0A 1DP9A 1S4SA 2PD8A 3B33A 2VJWA 5HD5A 1G28A 3UB7A 1D06A 3ZQ5A 3LFVA 3F1OB 4IHQA 2PDRA 3E4PA 3OOVA 3KSIA 4E04A 5HPFA 1S1ZA 2QYBA 3CAXA 5HPIA 4PKYA 4G3KA 2ZBBA 3BWLA 5IS1A 5G4ZA 3C8CA 3GECA 1TS7A 4CQHA 1ZTUA 4YOFA 4P6ZM 5AVFA 3S7OA 1YSPA 4NKPA 3RH8B 2M1CA 4HJ3A 4ME4A 4G3VA 3OBFA 3A0VA 3PR6A 2VEAA 4JGOA 3BQ8A 1T18A 2Z6CA 3OC2A 1TF1A 4BMWA 3MF0A 4R70A 2XROA 5A8BA 1P97A 1V9YA 3H9WA 2GZAA 3EEHA 5DJUA 3UE6A 4EW7A 1OT6A 3CUEA 4EERA 5MC7A 3PHYA 4I3JA 4NXGA 2VX8A 4NXBA 3T4JA 1S4RA 2K7SA 4JGPA 3NOUC 1YAXA 2H28A 5J4EA 3HJKA 3BW6A 2WKPA 2LB9A 3T4LA 1LL8A 4MN7A 2GJ3A 4R6LA 4GS9B 2JN7A 3E0YA 3IBJA 3H7WA 4O0PA 4WEKA 2B18A 4QPRA 2QJ5A 2ZMVA 3R4KA 5HSQA 4Q0IA 3EOIA 1T1AA 4Q0HA 2FZ0A 3MJQA 5HL6A 5IU1A 4F3LA 2I9VA 2K2NA 4MDZA 3FG8A 2HF6A 3R7WB 2WKQA 3RTYA 1W63M 4P6ZS 2O9AA 3IS2B 3NJAA 2EA9A 3TW8A 1OTDA 4XT2B 3T4SA 1XJ3A 5F68A 4Q0JA 4KUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ2 A;  1OJG A;  3UMD A;  1WA9 A;  4H6J B;  2L4R A;  1NWZ A;  5F5Y A;  1OTB A;  4HP4 A;  4GHI B;  4WLA A;  3IS2 A;  4HNB A;  1OTI A;  2P7J A;  4XT2 A;  4JGQ A;  1GSV A;  1S66 L;  4I3I A;  3MQO A;  3LIB A;  5G4Y A;  2PYP A;  1DP8 A;  2ZOH A;  2L0W A;  4H6J A;  1UGU A;  3UME A;  2PR5 A;  2QJ7 A;  4WL9 A;  1OTE A;  4GHI A;  5F69 A;  3CWF A;  1OT9 A;  4HH2 A;  3LI9 A;  2VLG A;  2D02 A;  4HQA A;  4K08 A;  4EEU A;  5HWW A;  1MZU A;  1S1Y A;  4HH3 A;  4I38 A;  5F6A A;  3E4Q A;  2Z6D A;  3A0R A;  3H82 B;  3IBR A;  1F9I A;  3D72 A;  2OWH A;  5I5L A;  5HZH A;  5J7E A;  3ICY A;  3K3D A;  4EXO A;  2V9A A;  5HDD A;  3H82 A;  2W0N A;  4L9G A;  5DKK A;  2R78 A;  3FC7 A;  5HDC A;  4EES A;  1BYW A;  2D01 A;  4WF0 A;  5HDS A;  4I3A A;  5HWT A;  4I5S A;  3MFX A;  3H7W B;  2WKR A;  2PD7 A;  3LUQ A;  4R3A A;  1UWN X;  2V1A A;  1V9Z A;  4HI4 A;  4F3L B;  2J80 A;  3C2W A;  1KOU A;  1DP6 A;  3CLO A;  5TBM B;  2INW A;  4BBU A;  5HD3 A;  1VB6 A;  1GSW A;  4M4X A;  2VV8 A;  3ULF A;  1UWP X;  4WUJ A;  3NHQ A;  3UB8 A;  2ZOI A;  5TBM A;  4L9F A;  1Y28 A;  3EWK A;  3LIF A;  4HP9 A;  1P0Z A;  4BBV A;  1XJ4 A;  5HWV A;  4HHD A;  4NXE A;  4WN5 A;  4BBT A;  2V0W A;  4B9O A;  3E4O A;  3MQQ A;  4HOI A;  4I39 A;  2B02 A;  3LIE A;  5DJT A;  3VE4 A;  3SW1 A;  3LID A;  3BY8 A;  1DRM A;  1N9L A;  1GSX A;  4MN6 A;  3F1P B;  1LT0 A;  4EEP A;  1TS8 A;  5KIZ A;  3LI8 A;  1D7E A;  1T19 A;  4YWZ A;  2PR6 A;  3UB9 A;  2A24 B;  2L1M A;  2YKH A;  3VOL A;  1N9O A;  3T50 A;  4HJ6 A;  4LPZ A;  1S67 L;  3VE3 A;  1OTA A;  3F1P A;  4R38 A;  2BAS A;  5J3W A;  4NXF A;  2YKF A;  2A24 A;  3HJI A;  4HIA A;  3F1O A;  4GW9 A;  2VV6 A;  4GCZ A;  4EET B;  3A0S A;  3NOP C;  3MXQ A;  3F1N B;  3OLO A;  1N9N A;  3LIC A;  1T1C A;  4L9E A;  4HY8 A;  3LYX A;  1ODV A;  2PHY A;  4MN5 A;  1F98 A;  1LSW A;  3F1N A;  4LRY C;  2KX6 A;  2CMN A;  4LRX C;  1LSX A;  3G6O A;  4PKY G;  5AVE A;  2KDK A;  2W27 A;  4RQ9 A;  4DJ2 A;  4HJ4 A;  4JGR A;  5EFW A;  4EQ1 A;  2OWJ A;  4KUK A;  1LSV A;  2QKP A;  2QHK A;  2JHE A;  2QWS A;  3LIA A;  3KX0 X;  4GS9 A;  3MR0 A;  1EW0 A;  1XJ6 A;  3PYP A;  1TS0 A;  5DKL A;  2OOL A;  1TS6 A;  1XFQ A;  2V1B A;  1OJ5 A;  2V0U A;  3NOT C;  4LLO B;  3UB6 A;  1T1B A;  4LRZ E;  3K3C A;  3P7N A;  4DJ3 A;  1XFN A;  4KQD A;  2HV1 A;  2PYR A;  2VV7 A;  1X0O A;  3GDI A;  3BY9 A;  1JNU A;  1DP9 A;  1S4S A;  2PD8 A;  3B33 A;  5HD5 A;  1G28 A;  3UB7 A;  1D06 A;  3ZQ5 A;  3F1O B;  2PDR A;  3E4P A;  4E04 A;  1S1Z A;  3CAX A;  4PKY A;  2ZBB A;  3BWL A;  5IS1 A;  5G4Z A;  3C8C A;  3GEC A;  1TS7 A;  5AVF A;  3RH8 B;  2M1C A;  4HJ3 A;  3A0V A;  2VEA A;  4JGO A;  1T18 A;  2Z6C A;  4R70 A;  5A8B A;  1P97 A;  1V9Y A;  3H9W A;  3EEH A;  5DJU A;  3UE6 A;  4EW7 A;  1OT6 A;  4EER A;  3PHY A;  4I3J A;  4NXG A;  4NXB A;  1S4R A;  4JGP A;  2K7S A;  3NOU C;  2H28 A;  5J4E A;  3HJK A;  2WKP A;  1LL8 A;  2GJ3 A;  4R6L A;  4GS9 B;  2JN7 A;  3H7W A;  2QJ5 A;  5HSQ A;  1T1A A;  3MJQ A;  5IU1 A;  4F3L A;  2I9V A;  3FG8 A;  2WKQ A;  3RTY A;  3IS2 B;  3NJA A;  2EA9 A;  1OTD A;  4XT2 B;  1XJ3 A;  5F68 A;  4KUO A; 
#chains in the Genus database with same CATH topology
 1K57 A;  4H6J B;  1ACF A;  3DWK A;  4Y5F A;  4F94 A;  2J8Y A;  3IS2 A;  1FCO A;  2PU2 A;  5GLC A;  1GSV A;  4GDB A;  2P08 A;  3NDG A;  2HDR A;  2PRF A;  1FCM A;  2ZOH A;  4FUW A;  4H6J A;  3CJM A;  2V20 A;  4LV1 A;  2KOI A;  3T1X A;  4DE3 A;  3LI9 A;  1PI5 A;  4K0W A;  1VHM A;  4IUH A;  4EEU A;  5HWW A;  1MZU A;  2IWD A;  1KGG A;  3AGD A;  4S2P A;  1MWT A;  1ERO A;  2Z6D A;  1DJA A;  3U4L P;  2ZC3 B;  3IBR A;  1F9I A;  3IX8 A;  4EUV A;  2J7V A;  5M19 A;  2HJE A;  5FAS A;  3VOZ A;  4QHC A;  3K3D A;  3MMH A;  4EXO A;  4JXV A;  4IUK A;  3VFH A;  2LB5 A;  2H10 A;  4FSF A;  4L9G A;  1JWZ A;  2JKT I;  5HDC A;  2XA7 S;  4MBF A;  1MKM A;  2ZQ7 A;  2NUP C;  3FPV A;  4JBF A;  2EFX A;  2PD7 A;  3CPT B;  3LUQ A;  4E3M A;  1FOF A;  1UWN X;  2J3T D;  4PHT A;  2ZC4 B;  4HI4 A;  2BTF P;  4D2O A;  4FH4 A;  4E3O A;  4KQR A;  3CLO A;  1K56 A;  3CPT A;  1XA1 A;  5TBM B;  2ZQC A;  4QU3 A;  4Y2F A;  2DNS A;  3U2A A;  1YLJ A;  4WEJ A;  2B5R A;  1GSW A;  1ZG4 A;  3JPU A;  3CUE C;  4ZAM A;  2VV8 A;  4X55 A;  2FFY A;  3OPL A;  4X1M A;  4O8G A;  3PBS A;  1SKO B;  4DF6 A;  5TBM A;  4L9F A;  1Y28 A;  3BYD A;  5HAQ A;  4N1X A;  3EGX C;  3LIF A;  4ETZ A;  1XJ4 A;  1PZP A;  4QD4 A;  1FCN A;  1XXM A;  2XLN A;  1WE4 A;  4FTX A;  4IED A;  5IT5 A;  3IXD A;  3MQQ A;  4HOI A;  1SKO A;  2ZQ8 A;  4I39 A;  3IXG A;  4X1L A;  2V8F A;  2O99 A;  4E3J A;  3HLB A;  3MXR A;  3LID A;  2XRN A;  3BY8 A;  1TD5 A;  1DRM A;  4MN6 A;  1LT0 A;  4EEP A;  2ZC5 B;  3VP1 A;  4ARZ B;  4S2I A;  1D7E A;  1H3Q A;  3IF6 B;  4R3B A;  4OPZ A;  2A24 B;  1H8Y A;  3G32 A;  1LL5 A;  3B47 A;  4LPZ A;  1JWV A;  1OTA A;  3RJU A;  2ZC7 A;  3S7P A;  1NRF A;  1RCJ A;  3C30 A;  5AQ7 A;  1YSQ A;  3M2J A;  2BAS A;  3ZGA B;  3NI9 A;  5FQK A;  5CHM A;  2A24 A;  1BT5 A;  3ZFZ A;  5HFO A;  4X53 A;  1K4E A;  3ZNY A;  3IHB A;  1MWR A;  4PAU A;  4EQI A;  1F2K A;  1NRJ A;  4GCZ A;  1DJB A;  4PMA A;  1JTG A;  2Y2N A;  3MXQ A;  5FI6 A;  2IWC A;  3F1N B;  1CEG A;  1N9N A;  3CI6 A;  4OQH A;  1SZV A;  4L9E A;  2WGI A;  2ZMA A;  1KVL A;  4ETX A;  3W8K A;  1F98 A;  4GD8 A;  3F1N A;  3HCY A;  1BZA A;  3S4X A;  3GSG A;  5L8M A;  3V39 A;  4MCW A;  2VKS A;  4N1H A;  5E2E A;  1LSX A;  3DAV A;  1YMS A;  4X56 A;  2ZM0 A;  2KDK A;  5G18 A;  4DJ2 A;  3HLD A;  4EQ1 A;  4Y13 A;  5CER A;  3TOI A;  2P9V A;  2JKR I;  4S2K A;  2QKP A;  3EQV A;  2EXA A;  4IBX A;  3DW0 A;  3HLF A;  2Y59 A;  3OCN A;  3SZT A;  2BLS A;  3HLE A;  5EUA A;  1BLC A;  3KX0 X;  4KG2 A;  3MR0 A;  4Y17 A;  4CJN A;  3C38 A;  3PYP A;  1U60 A;  4C3Q A;  2HZ5 A;  3S7Q A;  2OOL A;  2IWB A;  2W3H A;  3ZG0 A;  1O7E A;  2V0U A;  4JF4 A;  4OPQ A;  2HPB A;  4HBU A;  3NDE A;  3RFB A;  3VP2 A;  5U47 A;  5HL1 A;  4S2M A;  2ZC6 B;  1H5X A;  3JVV A;  1OPX A;  3Q1F A;  1HVB A;  4ID4 A;  3VV4 A;  1TVF A;  3VFF A;  1ZG6 A;  3CIT A;  3TE8 A;  3JYI A;  4HES A;  1KE0 A;  5HD5 A;  1G28 A;  2Y4A A;  3ZQ5 A;  5BOH A;  1YLW A;  3BFE A;  1NY0 A;  2Y2M A;  2J9O A;  2Y2J A;  3T1Q B;  3O86 A;  3OOV A;  4G3K A;  3BWL A;  5A91 A;  4CQH A;  1ZTU A;  1QMF A;  3S7O A;  5L10 A;  2R9X A;  2M1C A;  1NZU A;  3OBF A;  3PR6 A;  4JGO A;  1PZO A;  2Z6C A;  4JF5 A;  1BUL A;  2Y55 A;  2XRO A;  1ZKJ A;  3D9Y A;  5GL9 A;  3IT9 A;  3BFF A;  4BQM A;  2JCH A;  1JTD A;  3G30 A;  1WYB A;  5DJU A;  4DXC A;  5MC7 A;  3PHY A;  1W8Y A;  1LLB A;  4I3J A;  3UNW A;  4DKI A;  4NXB A;  2QMI A;  2C6W B;  4Y15 A;  4JGP A;  3O3V A;  3BW6 A;  2RL3 A;  2WKP A;  2EX2 A;  1SKF A;  2WUQ A;  1NYM A;  1KDW A;  4R6L A;  4E6W A;  4C6Y A;  2ZM8 A;  2JN7 A;  3E0Y A;  3WS4 A;  4S2N A;  3H7W A;  3BRM A;  4YIN A;  2XQZ A;  2QJ5 A;  3VP0 A;  4Q0I A;  3G35 A;  4Q0H A;  3MJQ A;  2QPN A;  5HL6 A;  5FEF A;  3V3S A;  4MDZ A;  4R4S A;  2WKQ A;  4OPR A;  2XK1 A;  4QY5 A;  3C5A A;  2EA9 A;  4BL3 A;  3SS4 A;  5F68 A;  3IXB A;  5M1A A;  4R4R A;  1XJ2 A;  3UMD A;  1H8M A;  1GA9 A;  2L4R A;  5DFY A;  1NWZ A;  5F5Y A;  4GHI B;  4HNB A;  2ZL1 A;  4IJG A;  4R3J A;  1IYS A;  4I3I A;  4LV2 A;  5DTK A;  3MQO A;  5G4Y A;  1E25 A;  2PYP A;  1OTE A;  4GHI A;  4PPR A;  5C5K A;  4RX2 A;  3RXX A;  4HH2 A;  2VLG A;  3PBN A;  4HBT A;  3Q81 A;  1S1Y A;  1GCE A;  4HH3 A;  5HAR A;  4N9L A;  3E4Q A;  3H82 B;  5FQI A;  3VOY A;  1BTL A;  5I94 A;  2WYX A;  2H5S A;  3MSH A;  5CEC A;  2V9A A;  3MQ0 A;  2W3E A;  3H82 A;  3V67 A;  2W0N A;  2Y2P A;  1ESU A;  5EPH A;  3FPW A;  3W4Q A;  2WAF A;  5TFQ A;  2EXB A;  2R78 A;  2BG1 A;  4EES A;  2D01 A;  3BLS A;  2XDM A;  5HWT A;  1AWI A;  3OPH A;  2FH5 A;  3MKE A;  4EBP A;  1LL9 A;  2W1T A;  1K54 A;  2MJ6 A;  3QP4 A;  5DTT A;  1HLU P;  5JYO A;  3HUM A;  4F3L B;  3W2Z A;  3C2W A;  4P0M A;  1ONG A;  1RP5 A;  1RGY A;  5CTN A;  1G6A A;  4NEE D;  2XGN A;  2M7V A;  3FWL A;  5LBR A;  1FSW A;  4X69 A;  4ZRR A;  4WUJ A;  5CHJ A;  3P98 A;  5EVI C;  4FH2 A;  4D60 A;  3HL9 A;  4OLD A;  1CQA A;  4HP9 A;  3LR0 A;  4BL2 A;  4WN5 A;  1K55 C;  4B9O A;  4MBH A;  1PYY A;  3KO6 A;  4KZ5 A;  3LIE A;  4OLG A;  5DJT A;  4BWI A;  3QNB A;  3CG5 A;  5E2F A;  3T1S A;  3SW1 A;  3SOI A;  3S7N A;  3ZHH A;  1I2S A;  3HRE A;  3BQA A;  2WAE A;  1GSX A;  3F1P B;  2Z2M B;  4UA9 A;  3LI8 A;  1T19 A;  2PR6 A;  3UB9 A;  3QP8 A;  5KSC A;  2YKH A;  3PBT A;  3VOL A;  4L0L A;  3MBZ A;  1YQS A;  1K57 C;  1MPL A;  3F1P A;  5CX7 A;  5D3O A;  5E2G A;  1O07 A;  3VP3 A;  4NXF A;  4Z9Q A;  1SHV A;  3V3R A;  3BM6 A;  4B4X A;  2W1R A;  3Q7Z A;  4R0Q A;  1OME A;  4KEN B;  5FQ9 A;  4LV0 A;  4MEZ A;  2WK0 A;  3Q7V B;  3F1O A;  1GHP A;  4EET B;  4Y7P A;  3QP2 A;  3TRC A;  3OLO A;  3LIC A;  3IH8 A;  4Z1W A;  1YPR A;  3WS2 A;  3Q7V A;  2A2L A;  3LYX A;  1ODV A;  3BJN A;  1I2W A;  2PHY A;  3GV9 A;  5GHY A;  4MN5 A;  3E2L A;  4IBR A;  4X25 A;  3O5Y A;  1K56 D;  3E98 A;  4PM9 A;  1BLP A;  2JC7 A;  1PIO A;  2KX6 A;  2Q9N A;  4U0T A;  4OOY A;  2VZW A;  5FDH A;  3LO7 A;  5AVE A;  2Y2G A;  1K25 A;  3LR3 A;  3PBO A;  3G2Z A;  4HJ4 A;  2Q9M A;  1A0K A;  1YLZ A;  3C4P A;  1CF0 A;  2OWJ A;  1PFL A;  3SS3 A;  1NLZ A;  3UPP A;  1LI0 A;  3B3X A;  4LCL A;  1KE3 A;  4RVA A;  3GQZ A;  2ZD8 A;  2DCF A;  1MC0 A;  2EWW A;  3TSG A;  1DJC A;  3EEA A;  2QWS A;  5FA7 A;  4Y0U A;  1F5M A;  3UDI A;  1EW0 A;  1XJ6 A;  1TS0 A;  4NET A;  2GNX A;  2J3T C;  1BLS A;  1TEM A;  2EFU A;  3S1Y A;  3ZVW A;  1K38 A;  3QP6 A;  1T1B A;  4LRZ E;  1QME A;  4OON A;  3PTE A;  1P9R A;  5AJG A;  4KQD A;  3LR4 A;  5F83 A;  2OAQ 1;  1FIL A;  2PYR A;  3T1R A;  2J9P A;  1NLY A;  3GDI A;  4ZTK A;  1ES2 A;  2W3F A;  2XSS A;  1S4S A;  1MY8 A;  3MKF A;  3B33 A;  3O87 A;  3N4I A;  1D06 A;  4KZ8 A;  5EM1 A;  3LFV A;  3L7H A;  1IKG A;  4KZ6 A;  1TDG A;  1PI4 A;  1JWP A;  2H0Y A;  3PAE A;  3KSI A;  1NYY A;  4NG2 A;  1FIK A;  5GHZ A;  2ZBB A;  4C75 A;  5G4Z A;  3DTK A;  3GEC A;  2G2W A;  4OP8 A;  3UB5 P;  1MWU A;  5AVF A;  3NC8 A;  4NKP A;  3RH8 B;  4OPY A;  4ME4 A;  4G3V A;  2EX8 A;  4XXR A;  3C4O A;  3BQ8 A;  1T18 A;  1TF1 A;  4DDS A;  3MF0 A;  4R70 A;  1FR6 A;  1V9Y A;  2GZA A;  2P9V B;  1KE4 A;  3UE6 A;  3IF6 C;  2QZ6 A;  3RXW A;  2OLV A;  1MXO A;  5CXW A;  4EBN A;  3NOU C;  2X01 A;  1BUE A;  3T4L A;  3ITB A;  1LL8 A;  1IYP A;  4P85 A;  3UN7 A;  3IBJ A;  3BEB A;  4QPR A;  2ZMV A;  3NCK A;  1XPB A;  4P87 A;  3IWQ A;  4LGW A;  4MNR A;  2Y2H A;  4BLM A;  1W7F A;  1J3W A;  3G2Y A;  3FG8 A;  3R7W B;  5J8X A;  3N6I A;  3RTY A;  1W8Q A;  1GHI A;  1GA0 A;  1OTD A;  3T4S A;  4EV4 A;  4JLF A;  1XP4 A;  3FKV A;  4IVK A;  5EE8 A;  3WS0 A;  3KSF A;  1OJG A;  3R7W A;  4CLC C;  2X02 A;  3EQU A;  3A3I A;  4HP4 A;  4WLA A;  1OTI A;  3M6B A;  4KZA A;  5M18 A;  4JGQ A;  5HAI A;  1S66 L;  2K31 A;  5KSH A;  3DBA A;  3SH7 A;  1LHY A;  2L0W A;  1UGU A;  2QJ7 A;  4WL9 A;  1ERM A;  1ZHH B;  4FCF A;  1VEU A;  4GD6 A;  3HLG A;  1XKZ A;  4GOG A;  2ZQD A;  4GZB A;  3D3O A;  1Q2Q A;  2D02 A;  2Y91 A;  4HQA A;  4K08 A;  4U0X A;  1LI9 A;  3KSG A;  2A49 A;  4I38 A;  2Z2L B;  5A90 A;  1IYO A;  4RA7 A;  4RYE A;  5L2F A;  3D72 A;  2ZQA A;  5I5L A;  5HZH A;  2WKE A;  3UE1 A;  3JVU A;  2ZMF A;  3Q07 A;  3PBR A;  3IF5 A;  1IEM A;  4O7D A;  1BLH A;  5FAP A;  1W79 A;  5DKK A;  3FC7 A;  4JXG A;  1PRQ A;  4WF0 A;  4X68 A;  1PW8 A;  4I3A A;  3ZG9 B;  1VET B;  3H7W B;  2WKR A;  3BEC A;  4R3A A;  3ZG5 A;  1I5Q A;  4DE2 A;  1YMX A;  4WZ5 C;  1D1J A;  3BFC A;  5F1G A;  4KZ9 A;  2OV5 A;  4JF6 A;  2HP5 A;  3GVB A;  2J80 A;  4GKU A;  4GJ4 A;  1DP6 A;  2XD1 A;  1VET A;  5EEC A;  1W63 Q;  1N9B A;  4O01 A;  4S2O A;  3SS5 A;  5HD3 A;  2GDN A;  2HJ9 C;  1PWC A;  1ES5 A;  2W3D A;  4XUZ A;  3LCE A;  4MMN A;  2Q0O A;  4B88 A;  3IX4 A;  4LV3 A;  4M4X A;  1SDE A;  1K6R A;  4DE1 A;  3NHQ A;  3GMW A;  3UB8 A;  1E3U D;  2ZOI A;  2NUT C;  4EBL A;  1HZO A;  1P0Z A;  2ZL1 B;  4BBV A;  5HWV A;  2WZX A;  4DMZ A;  1E3U A;  4HHD A;  4NXE A;  4BBT A;  2WKH A;  2EWV A;  3W4P A;  1YLP A;  2Y2Q A;  4S2N C;  1PWG A;  3VMA A;  4MLL A;  4RX3 A;  2O0Y A;  4GDN A;  5K5B A;  3VE4 A;  5HAP A;  3DTM A;  1S0W A;  5CGS A;  3WS1 A;  4PM7 A;  3HLW A;  3DTI A;  1N9L A;  3P09 A;  3A3F A;  1TS8 A;  4YWZ A;  4EU0 A;  3IQA A;  1FR1 A;  2WGW B;  3AGE A;  3VE3 A;  2Y2L A;  4R38 A;  5FAT A;  3P01 A;  2JE5 A;  3IWO A;  5TGF A;  4LCM A;  1VQQ A;  1BSG A;  2I72 A;  2HDQ A;  1HTZ A;  1ALQ A;  3ISG A;  3IXH A;  4WMC A;  3IX3 A;  4WZ4 A;  2WGW A;  4U3T A;  4S2L A;  4UA7 A;  2ACG A;  3HJI A;  1XGI A;  3GR2 A;  1STZ A;  2PT7 A;  2HGV A;  2VV6 A;  1NJ4 A;  5CED A;  2W1T B;  3A0S A;  1YKD A;  4Y3I A;  3GRJ A;  4E3L A;  3HLC A;  2Y79 A;  5DF9 A;  1T1C A;  2R9W A;  4JPM A;  3SH9 A;  2VGK A;  4YFM A;  3MZE A;  4HY8 A;  3LEQ A;  5EOE A;  2RCX A;  3LR5 A;  1CEF A;  1L0E A;  3OZH A;  4DRT A;  3CMZ A;  1Y4O A;  2G2U A;  4KZ7 A;  5GLB A;  4LRX C;  4ZBE A;  3ZYT A;  3G6O A;  5AQA A;  5EVI A;  1Q2P A;  1E4D A;  3MFD A;  3IWI A;  4KZ3 A;  5EFW A;  2GX5 A;  4PM5 A;  5JYP A;  3QNC A;  3BLM A;  4WBG A;  2PU4 A;  2QHK A;  3WRT A;  2JHE A;  5EV0 A;  1W5D A;  3A3E A;  3O88 A;  4E6X A;  3MS6 A;  4AFI A;  3IHA A;  3NY4 A;  4OOM A;  4GS9 A;  4II7 A;  4BEN A;  1XX2 A;  1L0F A;  2O9C A;  4DDY A;  1K6S A;  3C7V A;  2V1B A;  4ZDX A;  1OJ5 A;  3A3D A;  1TDL A;  4LLO B;  3UB6 A;  1J9M A;  3WS5 A;  5DVA A;  5IHV A;  2XA7 M;  2JKT M;  3P7N A;  1XFN A;  5FAQ A;  3LY4 A;  5FQJ A;  4BJP A;  5EM0 A;  2KLI A;  1X0O A;  4E3I A;  4CLC E;  3N7W A;  2XR0 A;  4OVD A;  5CTM A;  3NEC A;  1IKI A;  3T4K A;  2A3U A;  2ZLY A;  4XUX A;  2PD8 A;  4QB8 A;  3HBR A;  2XH9 A;  3F1O B;  4UA6 A;  1KGE A;  1ERQ A;  2HP9 A;  1CI8 A;  2PDR A;  3E4P A;  1CK3 A;  4A5R A;  4E04 A;  5HPF A;  1S1Z A;  1PNE A;  5HPI A;  4PKY A;  3V5M A;  3ZG7 B;  5IS1 A;  4CPK A;  1TS7 A;  4P6Z M;  3HUO A;  2JBF A;  3D4F A;  3A0V A;  3C7U A;  3FV7 A;  2VEA A;  3OC2 A;  4DE0 A;  5A8B A;  1P97 A;  3H9W A;  5FSR A;  3EEH A;  3DTE A;  1OT6 A;  3CUE A;  3WRZ A;  1K0K A;  3IH9 A;  4NXG A;  2XD5 A;  3T12 B;  3T4J A;  5EVE A;  4GB7 A;  1YAX A;  2H28 A;  4KQQ A;  5J4E A;  3HJK A;  3L9K A;  4IVI A;  1KVM A;  4BD0 A;  2GJ3 A;  2ZJ9 A;  4ESP A;  5FEG A;  4O0P A;  4WEK A;  2HP6 A;  2ZQ9 A;  4N92 A;  3N8L A;  1CJF A;  5HSQ A;  3R4K A;  5FDS A;  5FQM A;  2XF3 A;  2FZ0 A;  2I9V A;  2K2N A;  2HF6 A;  5L07 A;  4P6Z S;  2O9A A;  4GNU A;  2OSU A;  5E2H A;  4XT2 B;  5F1F A;  2XEP A;  3HVF A;  1WA9 A;  2H0T A;  5DF8 A;  2VGJ A;  1SCW A;  2X71 A;  3MXS A;  4M3K A;  1MBL A;  1XGJ A;  1OTB A;  2WKI A;  1MKI A;  4HEF A;  2P7J A;  4QY6 A;  4XT2 A;  3M6H A;  2CC1 A;  1YM1 A;  3LIB A;  3ITA A;  3BFG A;  1DP8 A;  2XFS A;  3T4O A;  5KMW A;  4GN2 A;  3OPP A;  3UME A;  2PR5 A;  3ZCZ A;  1IFQ A;  5CGW A;  3TG9 A;  4QJG A;  5F69 A;  3CWF A;  1OT9 A;  2DMW A;  2B95 A;  4G3W A;  4R1G A;  4B93 A;  3W4O A;  2JKR M;  1H0M A;  5F6A A;  5FL3 A;  2M7U A;  4PM8 A;  3A0R A;  2WGV A;  3WWX A;  4ARZ A;  3KYZ A;  4NK3 A;  2OWH A;  3IF6 A;  2V2F F;  5J7E A;  1CI9 A;  3ICY A;  2Y2I A;  2P04 A;  2VGL M;  1XA7 A;  5HDD A;  1FQG A;  3OPR A;  1GHM A;  4R23 A;  5GHX A;  1AXB A;  3V50 A;  3FZC A;  1C3B A;  3FKW A;  2E8I A;  3B42 A;  5FI2 A;  2FFF B;  1K4F A;  1BYW A;  3UO9 A;  5CHU A;  1DY6 A;  5HDS A;  2Y8H A;  1G6O A;  4I5S A;  3MFX A;  3E2K A;  4OKP A;  1ZC2 A;  3QP5 A;  4UQI M;  3G34 A;  3N8S A;  4KQO A;  4JXW A;  1IEL A;  1Z09 A;  4EUZ A;  2V1A A;  4H8R A;  2J3W A;  1ES3 A;  1V9Z A;  5FI7 A;  4YNR A;  4KZ4 A;  4GLQ A;  3ZG8 B;  1KOU A;  4CLC B;  4OP5 A;  2JKG A;  2INW A;  4BBU A;  2PBY A;  3G4P A;  1VB6 A;  3ZVT A;  4CLC D;  3I7J A;  3ULF A;  5F82 A;  4DXB A;  1UWP X;  4LFU A;  4JKT A;  4CLC A;  1PW1 A;  2EX9 A;  3EWK A;  1KGF A;  1P9W A;  2VGL S;  2V0W A;  3E4O A;  2IA2 A;  1M40 A;  3AGF A;  2B02 A;  2G7U A;  1VEU B;  5DTS A;  5FQQ A;  3UDX A;  4UEY A;  3K2N A;  3PXP A;  2O9B A;  1N4O A;  5CGX A;  2DRW A;  5GLD A;  4WEL A;  1SDN A;  4DN0 A;  4UQI S;  4OQ0 A;  5DFX A;  1ES4 A;  2V8C A;  1YT4 A;  2V1Z A;  4K0X A;  5KIZ A;  1RGZ A;  5EOO A;  3LEZ A;  2L1M A;  5HX9 A;  1N9O A;  3T50 A;  3ZNT A;  4HJ6 A;  1S67 L;  3LGO A;  4Y0T A;  2C5W B;  5J3W A;  3Q82 A;  2YKF A;  3TJZ C;  5HW3 A;  3FYZ A;  3PBQ A;  4B4Z A;  5L09 A;  4HIA A;  3UPN A;  1WYC A;  4GW9 A;  4WZ5 A;  3NOP C;  3ZDJ A;  4N9K A;  2W3G A;  3GTC A;  4FD8 A;  2PAV P;  4KG5 A;  5DF7 A;  4MBK A;  5A93 A;  1LSW A;  4PM6 A;  1G68 A;  2P74 A;  3T4T A;  1EWZ A;  4ZJ1 A;  4LRY C;  2OAP 1;  2CMN A;  2EX6 A;  3LY3 A;  1KDS A;  1EI5 A;  4LEN A;  4E3N A;  1JVJ A;  1G5U A;  5FAO A;  4PKY G;  5KZH A;  3MZF A;  2W27 A;  1VM1 A;  4RQ9 A;  4JGR A;  1YLY A;  3PAG A;  4KUK A;  1LSV A;  3HUN A;  3SH8 A;  3KSH A;  5AQ9 A;  2E8J A;  4OQG A;  3NBL A;  1MWS A;  5A92 A;  3S22 A;  1Y54 A;  1NZO A;  2UWX A;  3NUL A;  3T4Q A;  3LIA A;  4P6B A;  4ZJ2 A;  4KG6 A;  3QP1 A;  5DKL A;  4ZJ3 A;  3UDF A;  5E43 A;  1TS6 A;  1XFQ A;  3UY6 A;  4BD1 A;  3NOT C;  3EGD C;  3M2K A;  3UPO A;  4QWO A;  3VP4 A;  4FOF A;  1ESI A;  3K3C A;  3OCL A;  4DJ3 A;  3KYQ A;  5CRF A;  3VSK A;  4OOL A;  2JKF A;  3A3J A;  3CHW P;  2HV1 A;  3UE3 A;  1S6R A;  2VV7 A;  1IOU A;  3BY9 A;  4Y0O A;  1L2S A;  5TJJ A;  1JNU A;  4KZB A;  3CZD A;  2VA0 A;  3BFD A;  1DP9 A;  4Q8I A;  2VJW A;  3N8R A;  1Z6F A;  3UB7 A;  1H8Z A;  4WMC D;  1L0D A;  2VK3 A;  4IHQ A;  2WAD A;  2QYB A;  3CAX A;  3C8C A;  4WYY A;  2OLU A;  4YOF A;  3UE0 A;  1PWD A;  1YSP A;  3KYE A;  4HJ3 A;  5TR7 A;  4OH0 A;  1M6K A;  1ONH A;  5EVI B;  4EWF A;  4BMW A;  5GLA A;  1HD8 A;  2WZZ A;  1FSY A;  5EVI D;  4EW7 A;  3VSL A;  1IYQ A;  4EER A;  4X6T A;  2HDU A;  2HDS A;  2VX8 A;  2Y2K A;  1S4R A;  3QHY A;  2K7S A;  3G31 A;  2LB9 A;  2AVX A;  4MN7 A;  4E3K A;  1K55 A;  3NIA A;  4GS9 B;  2PBD P;  3DWZ A;  4K91 A;  5EVL A;  2B18 A;  4UAA A;  1K54 C;  4S2J A;  1NXY A;  3EOI A;  1T1A A;  5IU1 A;  4F3L A;  3MZD A;  2Y2O A;  4UHU A;  1L3L A;  4JXS A;  2ZM2 A;  1W63 M;  5AQB A;  2UV0 E;  4OQI A;  3IS2 B;  3NJA A;  3TW8 A;  1XJ3 A;  4WM9 A;  5CEB A;  4Q0J A;  2XFT A;  1YLT A;  4KUO A;  1L0G A; 
#chains in the Genus database with same CATH homology
 3KSF A;  1XJ2 A;  1OJG A;  3UMD A;  1WA9 A;  4H6J B;  3R7W A;  1H8M A;  2L4R A;  4Y5F A;  5DFY A;  4CLC C;  1NWZ A;  5F5Y A;  3EQU A;  1OTB A;  4HP4 A;  4GHI B;  4WLA A;  3IS2 A;  4HNB A;  1OTI A;  2P7J A;  4IJG A;  4XT2 A;  4JGQ A;  1GSV A;  1S66 L;  2P08 A;  2K31 A;  4I3I A;  5KSH A;  3MQO A;  3LIB A;  3DBA A;  5G4Y A;  2PYP A;  1DP8 A;  2ZOH A;  2L0W A;  4H6J A;  3T4O A;  1UGU A;  3UME A;  2PR5 A;  2QJ7 A;  4WL9 A;  1OTE A;  1ZHH B;  4GHI A;  1IFQ A;  5C5K A;  5F69 A;  3CWF A;  2KOI A;  1OT9 A;  4HH2 A;  3LI9 A;  2VLG A;  1VHM A;  3D3O A;  2D02 A;  2DMW A;  4G3W A;  3PBN A;  4HQA A;  4IUH A;  4K08 A;  4B93 A;  4EEU A;  5HWW A;  1MZU A;  2JKR M;  3KSG A;  1S1Y A;  4HH3 A;  4I38 A;  5F6A A;  5FL3 A;  3E4Q A;  2M7U A;  2Z6D A;  3A0R A;  3H82 B;  4ARZ A;  3KYZ A;  3IBR A;  1F9I A;  3D72 A;  2OWH A;  5I5L A;  4EUV A;  5HZH A;  2HJE A;  5J7E A;  3ICY A;  3K3D A;  3MMH A;  3JVU A;  2P04 A;  2VGL M;  4EXO A;  4IUK A;  2ZMF A;  2V9A A;  5HDD A;  3MQ0 A;  3PBR A;  2W3E A;  3H82 A;  3V67 A;  2W0N A;  2LB5 A;  3FPW A;  4FSF A;  4L9G A;  3B42 A;  5DKK A;  2R78 A;  2JKT I;  3FC7 A;  5HDC A;  4EES A;  1BYW A;  2D01 A;  2XA7 S;  4WF0 A;  1MKM A;  2NUP C;  5HDS A;  4I3A A;  2Y8H A;  3FPV A;  5HWT A;  1G6O A;  4I5S A;  3MFX A;  2FH5 A;  3H7W B;  2WKR A;  2PD7 A;  3LUQ A;  4UQI M;  4R3A A;  4KQO A;  2W1T A;  2MJ6 A;  1UWN X;  2V1A A;  2J3W A;  2J3T D;  1V9Z A;  4PHT A;  4YNR A;  4HI4 A;  4F3L B;  4GLQ A;  3W2Z A;  2J80 A;  3C2W A;  1KOU A;  4GJ4 A;  1DP6 A;  3CLO A;  4CLC B;  1W63 Q;  4NEE D;  4O01 A;  5TBM B;  2INW A;  4Y2F A;  4BBU A;  5HD3 A;  2HJ9 C;  3U2A A;  4WEJ A;  2M7V A;  2W3D A;  1VB6 A;  1GSW A;  4MMN A;  5LBR A;  4CLC D;  4M4X A;  3CUE C;  2VV8 A;  3ULF A;  4ZRR A;  1UWP X;  4WUJ A;  3NHQ A;  4O8G A;  3UB8 A;  3PBS A;  4CLC A;  2ZOI A;  2NUT C;  5TBM A;  4L9F A;  1Y28 A;  3EWK A;  4ETZ A;  3EGX C;  3LIF A;  4HP9 A;  1P0Z A;  3LR0 A;  4BBV A;  1XJ4 A;  5HWV A;  4DMZ A;  4HHD A;  1P9W A;  4NXE A;  4WN5 A;  4BBT A;  2VGL S;  2V0W A;  4B9O A;  2EWV A;  3E4O A;  2IA2 A;  5IT5 A;  3MQQ A;  3KO6 A;  4HOI A;  4I39 A;  2B02 A;  2G7U A;  3LIE A;  5DJT A;  4BWI A;  2O0Y A;  2O99 A;  5K5B A;  3VE4 A;  3SW1 A;  3LID A;  2XRN A;  4UEY A;  3K2N A;  3BY8 A;  3PXP A;  2O9B A;  3S7N A;  4WEL A;  1TD5 A;  4DN0 A;  1DRM A;  1N9L A;  3BQA A;  4UQI S;  1GSX A;  4MN6 A;  3F1P B;  1LT0 A;  5DFX A;  4EEP A;  4ARZ B;  1TS8 A;  5KIZ A;  3LI8 A;  1D7E A;  1T19 A;  1H3Q A;  4YWZ A;  2PR6 A;  4EU0 A;  3UB9 A;  2A24 B;  2L1M A;  2YKH A;  3PBT A;  3VOL A;  1N9O A;  4L0L A;  3T50 A;  4HJ6 A;  3B47 A;  4LPZ A;  1S67 L;  3VE3 A;  1OTA A;  3F1P A;  5CX7 A;  4R38 A;  3S7P A;  3P01 A;  3C30 A;  1YSQ A;  2BAS A;  5J3W A;  4NXF A;  2YKF A;  3TJZ C;  2A24 A;  2W1R A;  3PBQ A;  3HJI A;  4HIA A;  4PAU A;  1STZ A;  2PT7 A;  3F1O A;  1NRJ A;  4GW9 A;  2HGV A;  2VV6 A;  4GCZ A;  4EET B;  2W1T B;  3A0S A;  1YKD A;  3NOP C;  3MXQ A;  4Y3I A;  3F1N B;  3TRC A;  3OLO A;  1N9N A;  3LIC A;  3CI6 A;  4Z1W A;  2Y79 A;  5DF9 A;  1T1C A;  4L9E A;  2W3G A;  2A2L A;  4HY8 A;  3LYX A;  4ETX A;  1ODV A;  3BJN A;  2PHY A;  3LR5 A;  4MN5 A;  1F98 A;  1LSW A;  3F1N A;  3HCY A;  3O5Y A;  3E98 A;  3T4T A;  5L8M A;  4LRY C;  2KX6 A;  2CMN A;  2OAP 1;  2VKS A;  4LRX C;  4MCW A;  3ZYT A;  1LSX A;  3G6O A;  2VZW A;  4PKY G;  5AVE A;  3LR3 A;  3PBO A;  2KDK A;  2W27 A;  4RQ9 A;  4DJ2 A;  4HJ4 A;  4JGR A;  5EFW A;  4EQ1 A;  2GX5 A;  2OWJ A;  4KUK A;  1LSV A;  2JKR I;  1NLZ A;  2QKP A;  3KSH A;  3EQV A;  2QHK A;  2JHE A;  1MC0 A;  3OCN A;  2EWW A;  3EEA A;  2QWS A;  4AFI A;  3T4Q A;  4OOM A;  1F5M A;  3LIA A;  3KX0 X;  4GS9 A;  4II7 A;  3MR0 A;  2O9C A;  1EW0 A;  1XJ6 A;  3C38 A;  3PYP A;  1TS0 A;  5DKL A;  3S7Q A;  2GNX A;  2J3T C;  2OOL A;  1TS6 A;  1XFQ A;  2V1B A;  2W3H A;  1OJ5 A;  2V0U A;  3NOT C;  3EGD C;  4LLO B;  3UB6 A;  4FOF A;  1T1B A;  3RFB A;  4LRZ E;  3K3C A;  3OCL A;  2XA7 M;  2JKT M;  1P9R A;  3P7N A;  4DJ3 A;  1XFN A;  5AJG A;  4KQD A;  3LR4 A;  3KYQ A;  2OAQ 1;  3JVV A;  4OOL A;  1OPX A;  4BJP A;  2HV1 A;  2PYR A;  3VV4 A;  3UE3 A;  2KLI A;  1NLY A;  2VV7 A;  1X0O A;  3GDI A;  1IOU A;  4CLC E;  3BY9 A;  3T4K A;  5TJJ A;  1JNU A;  3CIT A;  2W3F A;  2XSS A;  3TE8 A;  2VA0 A;  1DP9 A;  1S4S A;  2PD8 A;  3B33 A;  2VJW A;  5HD5 A;  1G28 A;  3UB7 A;  1D06 A;  3ZQ5 A;  3LFV A;  3F1O B;  4IHQ A;  2PDR A;  3E4P A;  3OOV A;  3KSI A;  4E04 A;  5HPF A;  1S1Z A;  2QYB A;  3CAX A;  5HPI A;  4PKY A;  4G3K A;  2ZBB A;  3BWL A;  5IS1 A;  5G4Z A;  3C8C A;  3GEC A;  1TS7 A;  4CQH A;  1ZTU A;  4YOF A;  4P6Z M;  5AVF A;  3S7O A;  1YSP A;  4NKP A;  3RH8 B;  2M1C A;  4HJ3 A;  4ME4 A;  4G3V A;  3OBF A;  3A0V A;  3PR6 A;  2VEA A;  4JGO A;  3BQ8 A;  1T18 A;  2Z6C A;  3OC2 A;  1TF1 A;  4BMW A;  3MF0 A;  4R70 A;  2XRO A;  5A8B A;  1P97 A;  1V9Y A;  3H9W A;  2GZA A;  3EEH A;  5DJU A;  3UE6 A;  4EW7 A;  1OT6 A;  3CUE A;  4EER A;  5MC7 A;  3PHY A;  4I3J A;  4NXG A;  2VX8 A;  4NXB A;  3T4J A;  1S4R A;  2K7S A;  4JGP A;  3NOU C;  1YAX A;  2H28 A;  5J4E A;  3HJK A;  3BW6 A;  2WKP A;  2LB9 A;  3T4L A;  1LL8 A;  4MN7 A;  2GJ3 A;  4R6L A;  4GS9 B;  2JN7 A;  3E0Y A;  3IBJ A;  3H7W A;  4O0P A;  4WEK A;  2B18 A;  4QPR A;  2QJ5 A;  2ZMV A;  3R4K A;  5HSQ A;  4Q0I A;  3EOI A;  1T1A A;  4Q0H A;  2FZ0 A;  3MJQ A;  5HL6 A;  5IU1 A;  4F3L A;  2I9V A;  2K2N A;  4MDZ A;  3FG8 A;  2HF6 A;  3R7W B;  2WKQ A;  3RTY A;  1W63 M;  4P6Z S;  2O9A A;  3IS2 B;  3NJA A;  2EA9 A;  3TW8 A;  1OTD A;  4XT2 B;  3T4S A;  1XJ3 A;  5F68 A;  4Q0J A;  4KUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...