3UBXG

Crystal structure of the mouse cd1d-c20:2-agalcer-l363 mab fab complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVRISCKASGYSFTNYGMHWVKQAPGKGLKWVGWINTYTGEPTYADDFKGRFAFSLETSASTAYLEINNLKNEDMATYLCASAAGIRWAWFAWWGQGTLVTVSAAKTTAPSVYPLAPVCGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural basis for the recognition of C20:2-alpha GalCer by the invariant natural killer T cell receptor-like antibody L363.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 221
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ubxG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ubxG02
1ZA6A 4N90E 5C0AE 1ITCA 2E7HA 3ECBB 4MDJB 3VXMB 2X1WL 4PGEA 5CHNB 2UZIL 2R9HC 3HZKA 1WCBB 2FH8A 4JDZA 4JDVA 1C16B 4M5ZH 5ETUA 4PRBB 3EJZC 4PJ8C 3ZKNC 5DRNB 5ABDE 1S8DA 3B5TA 4ZODA 4ZXBC 4PJFF 1ZVYA 1U8IA 4MYWB 1NFDB 1UZ6F 3EFDL 1U8MB 2PR4L 32C2B 4HIHB 4NKQB 3ZO0A 1A47A 3RY6C 5DDHA 1A6ZA 2VXQH 1X4YA 4N8PA 4P0DA 1OT1A 1C08B 2V17L 3TV3H 1RHHB 4LAJH 1AGCB 2P1YA 1N5YH 2OZ4A 1YYML 3GSUB 3VRIB 3IFPB 1KCUL 1JHKL 3CZJA 4RAUB 4URTB 3CFDB 4TUJB 5HGBB 2NZIA 1DQJA 5IJKC 4OUUA 3ZE2F 3PV7A 2GW5A 2R2EB 1F4AA 5I1DB 1S9KC 5DD5L 3G6JE 2Q8BH 3BVNA 8FABA 5ERWA 3RPKA 3MBED 5EWIH 5HDOA 2J8UF 4NQCB 4JFED 4WUUB 1K4DB 3KYMB 5D9SB 5C7XH 4ZSOB 1G7MB 3SHSA 3NAAL 4KZEH 3CSPA 5KJRH 1L0YA 3W82A 3CGTA 3RU8H 1UWXK 1HILA 1WZLA 2H8PA 4DOHE 4LLDB 4IS6B 5ILTL 1XGRA 3I6GB 4KDVA 4IRJD 1EV2E 3MV9D 3OB8A 4YO0A 5I19H 2XG5A 5HYSA 1MHCA 3O8XA 2E7CA 4GRLA 3WDIA 3QWRD 5KS9B 1CDJA 1OAKH 2W0KA 2D0FA 3BP5B 3PJSA 2R56L 1NLBL 3EYFA 2ERJB 5JHLL 4APQC 5EUOF 4KAQL 1JWSB 1BX2B 1IGTB 4KZDH 5BOPA 1RJYB 1DQLL 2A74B 4PRHD 4C83B 3VGHA 4NKOA 3GRWL 3IFOA 4RISH 4OCRL 5LVEA 3MLUL 1IEBB 2GTZB 3GUTA 2HP4A 1F3RB 3ROOA 1JRHL 5FM8A 1YPZB 5D7LD 3VXNB 1SM3L 2IFFL 4HWBA 2ZKHL 4P2QB 3NIGE 3ARBA 2R69L 1CGUA 1HXMA 2OMNA 5DJCB 1MRDH 1KPVB 2FD6L 5ESAB 4UV7H 3QG6A 2CKBL 4KXZI 4KQ4L 4NUGL 3HI1A 5DA0B 1CD0A 1LP9A 4G6FD 2W60A 4LU5L 2IPKB 4TTDC 1GYAA 1TIUA 4O02H 4FTVB 2Z8VC 5FGBC 1ADQA 4F8QA 4OIIH 3HZMA 2A77L 1HHIB 4HQQH 2VDPH 3TIDA 4I1NB 2RR3A 3T1FA 4RMSA 1KJ3L 3OPZL 1T89C 3QDMD 3QIWD 3RIFK 1JYXA 3BZDA 3KYKL 4MHHG 3WNPA 4NC2B 4G42A 1RZKC 3NABH 3VRLF 1PSKL 5IW3A 3GSOB 5LBSH 3HPJB 3MACH 3R06A 4DGIL 3SQOL 1N6QL 3V0VB 2BSRA 4R4FL 3B9VA 4J3SA 2RQ8A 1R0AH 1P9MA 1OVZA 2VZTA 3HNSL 1MRCH 4CDHA 4I77H 1G9MH 2R29L 2J3SA 2OR7A 4J3WA 3MRCB 4UILL 4PJ7F 4R3SA 1IEHA 5J6GA 1MAKA 3MGTB 5F7KC 5T5NF 3FO0L 3L95B 5DZOA 1K6QL 4TVPE 1CGXA 4QXTB 4D0DB 3ARFD 3SDCA 2HJFA 4YGVA 1W0WB 1MAML 1UYWL 1NPUA 2O61A 4YGAB 4ORGB 2Q3ZA 2WMPA 3ES6B 1KT2B 2EC9T 1HCFX 5AAMA 1Y6MR 3CK0L 3S5LA 3GHEL 2YPLA 3LV3B 4CVWA 4Y5VA 2A83A 4L8DB 3RDTA 1RI8A 2B0SL 4JZNB 4ONHB 3RL2A 3RWCA 2FEDC 3ARTA 4N1CA 2CO6B 3FAXA 2GK2A 2HH0H 1IAMA 4G8IA 1BPVA 2DBLH 3FKUS 4JREB 4JZJA 4NGHH 5L0QC 4N0CC 1OHQA 3PWPD 1MI5E 4PJBF 4LSPH 1GHFL 3P11H 3P9LB 1YUHB 4L29A 5H37G 4XTRC 4WV1A 3V52H 3X3GL 1OGTB 4OB5H 4XPHL 5EA0L 3H9ZA 5FYJU 4K07A 2R2BA 1G7LB 1SJHA 5I1CH 3WKNA 2FRGP 2D31B 4PR5B 1E28B 1KF9B 1FZKB 2WIMA 3SDAA 1R3IH 4PB0L 4LNVA 2IG2L 2QSCH 1AY1H 4MJ4A 5CZKA 3ZE0F 3L5WA 1INQB 4FNLH 5F3HA 2BVOA 4NNYA 3RVXD 3V6ZA 1ETZA 1MH5B 5EO0A 4LQFH 4HS8H 4OM1H 3NZHH 5SV4A 5C71A 3PXJA 5C6PB 4KQ3L 4GRWH 3D87B 5HYJA 2BY2A 5E6IA 5LXGL 4QNPE 3MV11 1F3JA 3ZKXB 4JB9H 2MTPA 4AMKH 4OCLC 1TDQA 4OV5A 4R90L 1F2QA 4XCCH 4KK5C 5GS0C 3MXVL 3DV4B 4RFOL 5IB1A 5D72H 3T0BA 1NCAH 5HYFA 5EU6A 3NIDF 4QF1A 2MSPA 2YD3A 5E8EB 3LIZL 3U83A 1NBVL 3LMJH 5E8OA 3B8YA 4GSDH 1MAJA 1UJ3A 4PD4J 4LVNC 3L3DB 2EC8A 4TUOA 4LSQL 1RUKH 2ZSWA 5E4EB 3SDXF 2OJZH 2XZAL 3WO4B 3ZHDA 4HJGB 5IG7A 4JFEB 5HYJE 3F12A 4UQ3A 5ADPL 4NHUA 4BZ2L 3BWAA 1T66C 3GSXB 4ONFH 4Y0GA 3LY6A 5CGYD 1E4XH 4NZTH 4G6MH 2DKSA 4ZTPL 2B1HH 2EXYC 5F70A 3IDYB 5INDA 2AJUH 1LE9A 4IRJB 4CUCA 2G2RB 3MNZB 2OP4H 4NHCH 2F53A 4K2UL 3PDOB 2D4DA 2DMBA 5CJ8A 1WBXB 5IMMA 2V5MA 3RVWC 5FYJD 2JIXD 2E7BA 1VADB 1AJ7L 2LAAA 1HQ4A 3FB6A 4I2XA 2AQ1A 2ICWA 5DI8B 1XGUA 5ICXA 5JPNA 3T0EC 1G1CA 1RURH 4M1GH 3VFRA 5D2NA 1YEFL 4Y5XA 4BYHA 4OCSH 1N59B 3D69B 4K3GA 5C0CD 1YC7A 3NVQA 3K4ZA 2EECA 2QV2A 4F7CA 2MOVA 3AU1A 5DHYA 1U6AL 5DHVA 3OKOA 3RL1B 5F89B 4N8VB 4XT1C 1CF8L 1J0JA 4O4YH 2F53E 4NC1C 2XZCL 5IB2B 5D7LB 1I7UA 2L0DA 3VFGL 3TJHD 2DD8H 4LRIA 3GKWH 3GSWB 1EBAA 2DLEA 3GMPB 2XV6B 3F8UB 1OP3H 5K9JH 4OZGF 1DE4A 3BN9C 5HGDB 3QIUC 1A0QH 4DN3L 5D2NE 4OQTL 4G6FB 5JQ6H 4M62H 5FV1L 1UB5A 1FV1B 2VDKH 1JV5A 2VUYA 1DBJH 2FHBA 3QHFL 4L3AA 5T3XL 1YMMA 2UWEB 4H25A 1KCSH 1XH3A 4ETQA 4O00A 5C08D 4NN7C 5DFVD 1EBPA 2G9HB 1I1AA 3D25A 4AM0B 4F3FB 5HY9A 1JZ7A 1W8NA 3PIQA 3QIWB 5CKGA 5T1KD 4NQTA 4PS4L 2IPUK 4QYOB 3MFFA 3TYFA 1VACB 2DWDA 4DKEH 3SBWA 3KXFE 5ECJE 3MCLH 1W0VA 5ANMA 1YMME 3KPNB 2KQNA 3NTCL 4P9ML 5I1KH 4JHWL 3VW3H 2VITA 2A9NH 3QNZA 1NBYB 2HTLD 4XPTH 5GISH 3NA9H 4EN3C 4HIXH 3ARFB 4CVZA 4OZ4B 3MLYH 4NWUH 3QZWA 1QFWM 1CFSA 3VE0B 1NBZA 3QUYD 1A6WL 2HFGL 1J86A 1G1YA 1CZ8L 1BHGA 1X9QA 1SYVB 3L3GA 1VCAA 1A6VH 1FFPB 2NX5D 1MJ8L 1JN6A 1FVCB 1S7XA 4X7SL 4YPGA 4K8RC 4L8BA 2WZPD 4D0CB 3JWOC 3O6ML 3FOLB 1P5UA 1QRKA 4XNYH 5SWZA 5DEFA 4P4KA 4D0BB 5CFHA 3JXAA 4TNWF 5IESH 1TITA 3EFFA 1P7KA 4Y16A 3QR2A 1CDCA 3D0VB 4LDOB 1MCWM 2E9JA 5DWUL 4RBPK 5DD0L 4JN2B 1NMAL 1X4ZA 3T77A 2X6MA 3W5NA 5I1IL 4N0YL 4NRZB 4AH2A 2HT4C 4ODUA 1EEQA 1QUNA 1XF3B 4XXDB 3TO4C 5DSCA 1EJOL 1PX4A 4WO4D 5D1ZA 3GI9H 4MX7A 4XH2B 1Q94A 4CJ1A 4X5LA 1PZUB 4HIIB 4EIZC 1K5NA 5F9AC 2AGJL 3DUSB 2X42A 3GMQA 4KPHL 4MCZB 6CGTA 4HV8A 4Y4FA 1VFMA 2EIZB 1J1PH 5DJYA 3P4MB 4AEIH 5JR1H 1JPGA 2Q1EA 5GJSH 4LVHC 4L3ED 4OD2B 3H9YA 5L8JB 5TE4H 4Y4KD 1KLFA 3B8SA 4KJYB 2ENYA 4QCIB 2MHAB 3BKYH 3U36B 4HUVA 1OGAD 3RVUC 1KXQE 5E70A 3GMLB 2B4CH 1Q9WB 2VDOL 3VFUA 2CMRH 4WHDA 3V6OE 1X44A 3UYRL 4HSQA 1T5WB 2GTWB 1V3KA 3LHPL 5D8JH 3QJHB 4E0RB 3PL6A 1F42A 4KKBC 4WRLA 4GG6B 4MJ6A 3DURB 5EG6C 3S96B 5LGJB 5GXBB 5EC1A 5DQDH 2HKFH 4KJPC 2X4NA 12E8L 2X89D 3NCEB 3NZ8B 4DVRL 3WSQL 1U2HA 3QUZA 1T1YB 2QR0B 5IFHH 1VFBB 5CIPB 3V4VL 4EUPH 5FOBB 2QQKH 4K7FB 1Q9KB 3SDDA 1FNFA 3BYYA 4MD4A 1MFBH 3C2SA 4N5EC 3VGGA 1IT9H 1BOYA 5JOPD 4ZS7H 3GNML 3U30C 1HKLL 3R8QA 2CLVB 5I1GH 4QRQA 5GSVB 3RAJL 1HSBA 2VZOA 5DURD 4RDQF 3FRUB 4I3GA 1NAKH 2DIBA 1J5OL 4G5ZH 4UMGA 3RWDB 2JIXB 5IWLA 2KZWA 4DFIA 1G0XA 1T20B 1EHXA 2PUQT 3BPCB 4ODHH 2Y07H 2YZ8A 4HCRH 3TNNB 5FYLE 3FT2B 1QRNE 5D7KE 3OV6A 4CU8A 1BZ9A 4Z7WB 4U1MB 1OAZL 3QQ4B 1CVRA 5C0CB 2AJSH 2PTUA 4V1DD 3U9PH 4O58H 1WVZA 1R24B 4UT9H 1YC8A 5CJQL 1V7NH 4NP4H 5I17A 4HJ0C 3MRHA 5BV7C 1MCJA 4PJEF 3MYZA 2HLAB 3CFCH 4UTBL 5IB4A 1IC7H 1IZJA 4J3TA 3ZMRA 3SGJA 1WICA 5GS1A 5JA9A 4P5TA 3VWJA 1FYTA 1U3YA 4J1UA 4M1CC 1XCTB 2NXZB 3L3OB 1D5IH 5TJWK 3F6IA 2WWMC 4XVTH 5EWIL 2PN5A 4XB8A 5IMKA 5JDSA 3RKDD 4JRYA 4DZBA 5CGMA 1RUAH 5C7XL 1IQWL 4JHBA 1OSPL 4KZEL 4QRPD 5C08B 5KJRL 3A0OA 3I84A 1JGLL 4M9OA 1WZMA 3V95A 1FYTE 5T1KB 1A3RL 1YJDH 3L3JA 3UBXB 1XEDA 1RK1B 4QY8A 3AS0A 1XIWD 3MLRH 3CCHB 3LN5A 4CMMB 3MRNB 4XRCA 4MJID 5DR5H 4WUKH 4JRYE 1TLKA 2ITDA 1EEUA 3OF6A 4A2LA 5ACZA 2F54A 5GRYA 4AT6A 4R0LA 2GCYA 1RZ7L 3OJ2C 2BCKB 2IMNA 2IADA 2X7LA 1WAAE 3TWCH 2VIRB 4RISL 5AG9A 3O6KH 2YOCA 3G08A 4YR6B 4F9LA 1PLGH 4ONGH 4M61B 1LNUA 4NRYA 3B2VL 4H1LB 3AS3A 4KUZH 5EOTA 3QUYB 3G9VA 3RHWF 2FSEA 4CVXA 1NEZA 2CK0L 1I8KB 3O8XC 4PGDA 2WSKA 3CXHK 3PP3K 1LO3L 1MHHB 4NJAH 2ADGB 1NGPL 1QBLH 3FMGL 2NX5B 3HE6A 4NC0B 5T5FL 2F54E 5LAXA 4GQPH 2OK0H 1JPST 2H2SC 5HYQB 3T08A 1O7SA 2W0PA 3UP1A 4AIZB 5HHOD 3W2DH 2UYLB 3BH9B 4EXPX 3MJ9A 4HQQL 5JHDD 3CC5A 5FGCB 2VDPL 3FTGB 1Q9LA 1BF2A 4XPBH 5EU7E 1VFAA 4JZOA 3O3UN 1R5VB 3SCMD 2CLZA 5DYOB 2FGWH 3NPZB 1MOEA 2AJ3A 1UXWB 3QULA 1SY6L 1MQKH 1RZKH 4JVUA 3ARBC 1B2WH 5JZ7C 4K3EH 4BZ1H 5K9KB 4Q58C 1KEMH 3NABL 5CCKH 3MUZ1 4HPYL 1ZLWK 43C9B 3ARED 3MRPA 3MACL 3KG5A 3LSOA 3BZEA 4QTIH 3RWGB 2DYPB 4OGAD 3IYLW 1WWWX 4FQPA 5HI3C 2ZOKA 4IJ3C 2NY4C 1A7BA 1YEKH 1O0VA 2Y36L 3N0PB 2H9GB 4YAQB 2E3VA 2DQTL 1IILE 2ID5A 4LPTA 3NIGF 3KPSE 4KFZC 1U3JA 1WIPA 4PLJD 1OW0C 1U8LA 3GSNA 3FZUD 3G5XB 5IHUH 2NLJB 3AVEA 3TN0D 2HG5B 5IP4A 4WTZA 2NW3B 3BEWA 2OBGA 2QTEA 1OGAB 1CBVH 3OAUL 2NR6C 1Z9LA 1EH9A 2W59A 3DX8B 3T2QA 5A3ID 2FWOB 1P1ZA 1U8KB 2UUDK 1T7WA 1XF1A 2Z4QB 4JR9H 2P8PA 2RCSL 6FABH 3O11A 1TNMA 4GH7B 3SGEH 5TDOB 5CZVH 4P3DB 4DZ8A 2PF6A 2VLJB 4A6YA 1LO5B 1NFKA 5FO7B 1IAKB 4RMWA 4N0RA 5E6YA 4X6BB 1A14L 4ZPTA 2OLDA 2GJZA 1AD9A 3WDJA 5D1QC 4Y8DC 5C0IA 5EU5B 2P24B 2BVQA 3ARVA 1CE1L 4EVNA 4K3HA 2CIIB 2MKLC 4LSPL 4MGXA 4OZIA 4HX1A 1OTUD 2OI9C 4Y5VC 1W72A 2WLZA 4OZFB 4JPKH 3QUMA 1HN1A 4OB5L 1IFHH 5DURB 2YPKA 5EIQA 1JP5A 4P5KB 5CMAA 5AZEL 2X4TB 5E1AA 3QIBD 2GK0A 3FQXB 4HS3B 4WJ5A 4J3VA 4W6XB 4O2CA 5ISZD 1MQ8A 3UTQB 4RAHA 2A6IB 4PJIB 2AEQL 1PZ5A 4JZJC 1Z0NA 2LU4A 3B5HA 4HS8L 4OM1L 1JPTL 5EPMA 2Y5TB 1IC4H 1FC1A 4X7DC 1FL6A 1EERB 4UDUA 4R96A 1MFAH 3BESR 4UT7H 5JLZA 4XBEL 4UQ2A 3JZ7A 3MLTA 1X5AA 2H2PC 3MRMA 3QEQB 4XCCL 3U79A 3QXDB 5D72L 5IVNA 3CSYA 4OF3A 5GGUB 4UOJA 5J9PB 1DL7L 4L8SA 3LMJL 4F80A 1WFTA 1UFUA 4PY7B 3SDAC 4YHIA 4GSDL 4LK4A 3KPLB 4YE4H 4PJXE 4YXHH 4HGWB 1FO0B 3D18B 3DVNA 3FFCE 3IU3B 4YEFA 1U91A 3VMPA 1GSMA 1LO2H 2VLLA 5E6IC 3FHAA 4QRPB 5E8PA 2J88L 2QHLA 2R0ZL 3ZKMC 4DW2H 2WP3T 1MIEH 3EYOB 4DKDC 1F4XL 2X4QB 2OL3B 4M43H 1EGJA 1UA6H 4HKJA 4IOFC 3O3AA 1KTDB 2NXYC 2OP4L 4G8GE 4JFYA 1BVKA 4JPWL 2GT9A 4X5XA 4WFED 5EU4B 5H2BB 1KLUB 4J3UA 1UJ3C 1WGOA 1XIWB 3QRGH 4XPFH 5B38A 3AB0C 3SY0A 2I26N 4IRZL 4MJIB 3CDGA 4IOIA 4UBDD 4QNPF 3FB5A 5FKPA 5D1XA 3I9GH 5F96H 4TSAL 2K7PA 2ZSVA 4FFVC 4HHAA 5HVFB 4H1LG 5IK3B 1OAUL 3DGGA 4HKZB 4EDWL 1DP0A 5J12C 5T1LA 1P7QD 3AXLA 3X17A 1K2DA 1G6RH 5HDLA 3HR6A 3DVGB 4MWFA 4NT6A 1ZV5A 4N9GA 1PY9A 3P9MA 2DD8L 2VKXA 2XTLA 5BZWB 3JV6B 1P7HL 2CRZA 1E4KC 3N1PC 2YZ1A 1G7PA 2VDLL 3IF1B 5TE6H 4BQBA 4QO1A 3FQWB 1LHZA 5EOQL 3T4AB 4LEOA 3G5YA 3ULUF 1JGEB 1EK3A 3VD7A 3N50A 4M62L 5D5MA 5KVGH 4JRXA 3HG1D 1GC1L 2PYFA 3QQ3A 4OI9A 5D2NC 4Y5XC 3HS0A 3S3JA 4GAYB 1ZHNB 2X4PB 5AZ2L 4XMLH 4XNQB 4I18B 2ED8A 3OJDA 3MLSH 2CUIA 2UZXB 2CSPA 4XGZB 3SCMB 4XNXH 3X12A 4LVNB 2W91A 3RWEA 3ZHKA 1ZT4B 4LRIC 3T4YA 4WFHE 5IHLB 5EUKA 4NJ9L 3VFSB 1MWAH 4F2MA 4U1IB 3BEVB 1MJ7H 3HI6H 1RK0B 3GEWB 5D5ME 3H7LA 3AREB 2VLRD 2E27H 3CFEB 5GZOD 1G6VK 3PXHA 5CEZE 4WHYG 1FFNB 3O9WA 5I1KL 5HYIA 1T2JA 3H3PH 4I4WB 3OR6A 4XP4H 1HZHL 1K4CA 4MNQB 3EYQD 3L3KA 3LZFH 5BXFA 4WI4A 3CNKA 4XPTL 1TCMA 4X6CE 3EZJB 3F65A 3I6KB 3NA9L 5A1AA 3A6CH 4HIXL 4JGMA 3M1BB 4C57C 1F11A 1I1AC 3MLYL 1MCDA 1SEBA 3ET9F 1KELL 3FT3A 4DTGL 2ESVE 5ACLA 1I9IL 5GIRA 3WFZA 5E2WL 1DQTA 2K3TA 3ULVL 4IOSD 3QPXL 5E9DA 1MCBA 2F19H 4I3SL 4N0UB 5E08H 1Q9OA 1G7QB 2O5YH 3JWOH 4ZUTA 5DMYA 1I3GH 4IMLB 1S7TB 3DV6A 4LLQA 4X99B 3OXRA 5GRJL 3HMXL 4XNYL 3C9NB 3WFHA 4KI5E 5IESL 1QEWB 3MBXH 4FQHB 5FM4A 1U8QA 5GGSY 1CG9B 1IGCH 2IBZY 4XCNA 3JV0A 4KU1A 3QIUB 1NKOA 3EJYD 4H8WH 5D7SH 2B39A 4I3RH 1UQSA 2R2CA 4RRPG 4AL8H 1YYLH 1HI6A 2YPVL 1WQVT 2JCCE 3JVGA 2IC2A 4GO6B 2NYYC 3H2WA 3DRTA 3HB3C 3BH8B 3HRZB 2AXFB 1NGWA 3GB7A 4LKCB 2E8ZA 3LVEA 3VGDA 3FO1A 3QIBB 3VJ6B 4MXVF 5ISZB 3U0TB 4P4KC 3THMH 1YEJL 4MZ3A 3MUHL 4CADB 3KAAA 4AEIL 4F8TA 4LCWA 1AO7E 2O5XL 4FMKA 3LKSA 1FZJB 2OTPA 2NTSP 3OAYK 5TE4L 3VFWA 1M05A 4FXLA 2DOCA 2R1XB 4YHMH 3WLBB 4HH9A 1GJIA 3BKYL 2PXYA 2W65A 1WZ1H 4XXCA 5I8KL 3IVKB 2P47B 3PWLA 5D1ZC 4ZD3L 4EN3B 4J12A 2CMRL 1KUMA 3IDXL 5CBAB 3VXQA 2FECI 4XVUC 5IQ9B 4LGRB 2GJ6A 3QH3B 1NCTA 5ID0B 4Y4FC 4Z7VF 3D2UA 1MUJB 4HUMB 4LCWE 2ITCB 3CSGA 1XGYL 2EE6A 5DQDL 1UVQB 3X11A 3NH7L 1T3FB 5TH2B 4PRPB 4ISVA 3EGSB 3LDBC 1KC5H 4GRLD 4KV5F 1L7IH 2R1WA 2NY0C 3RWJA 1QHOA 4BUHA 3DO7A 2FJHA 1ZSDB 1EO8H 1KB5L 1T83C 4Q9CA 2E9WA 3U4EB 3LKNB 7FABH 2FJGB 2XACC 3EDKA 4ZS7L 2VC2H 3D85A 4PP2B 1T04B 3VCLA 1IQDA 3SJVB 3JTTA 1PYWB 4XZUB 4V2CB 1JPFA 1CVSC 3WMSA 2V5YA 5B21A 1TETH 3PDGA 4UAOB 1C7SA 2VNCA 2H6PA 1OF2A 3CMOH 4P46D 3W39B 2VE6B 2VWEE 5EBGA 1FCCA 4U49A 5SWSA 3VXOB 4B50A 4OZHA 3QUZC 2W0FA 1RZJH 3QCUL 1A4JA 3VXSA 1XF4A 3FCTA 1T6WA 3SDDC 1U41A 5BV7H 4UT9L 4GKSB 4NP4L 1LO4H 5BVPL 4G9DB 5J0BA 1DBBH 5H8DA 3KPMB 3CFCL 1MELA 5TE7L 4KC3B 1IC7L 3WKML 3VFTA 3QXAA 5F9DC 4LVHB 5CS7A 3AROA 2AV1B 2NCMA 5E56A 1CK0L 3PF2A 3P9WB 4OAWB 2W9EL 1FG2A 4QRUA 1AKJB 1K8IA 3KPPB 5JMRA 5ITFA 4PV8A 5SWSE 1LDPH 3LS5H 1D5IL 1EEZA 1NGZA 4OZHE 2ATPA 5HHPB 1HYSD 3HG1B 4HS6A 3PWNB 4J8RB 2P8MB 3HI5L 5DMKB 3QCVH 4R4BB 4DWHA 1RUAL 3P4NA 1XF2A 3EO0B 2J6EH 2CK2A 3UX9B 1CWVA 1BEYH 2FIRT 1IMHC 3ROLA 3MJ7A 3STLB 3O2DL 5IV2A 2DM2A 4FN0A 4P2RD 4RSVA 1WEJH 3VDCA 5KSBB 4XX1G 3SDCD 1QFUH 5TF1H 4P5TC 4UIMB 4NUJA 4EQ2A 4NN6B 4ODSL 5JIPA 1F97A 3G5ZB 4HC1L 4K9EC 3BAEH 4JM2D 4P4RA 4DCQB 4HKXB 1DQDL 4P9HC 4XBPB 1YQVH 2BMKA 3IXTB 1VPOL 4X9GA 1TJGH 1WC7A 2V7NA 3RDTD 3QEHA 3BPNB 4X4ZA 4GAGH 2MNUA 1MHEB 2HFFA 2P5WA 3QWOA 4XVJH 5E0QA 3TWCL 3IDMB 1VGKB 4QHUB 1ZHLB 4P5MA 2EYRB 1PLGL 3IJYB 4NQDD 3RWFA 4QLRA 3QUXD 5DQ9B 5FYKH 1MFDL 3SPVA 4KKLD 5I2IB 2BOCA 5INCB 5F7HA 3N06B 4NJAL 1MCEA 4Z8FH 1QBLL 3HZKB 4JDZB 5B8CB 4M3KB 2XQYG 3D9AH 2OK0L 1JNHA 4M6NH 4FZ8H 4PJ5A 3S4SA 3UPAA 1LVEA 5EZOH 4Q6IA 3V7AG 1RJLA 2QJDA 4Z7UA 4KRPC 3QDGA 4XPBL 4F9LC 1TFHA 4U1JB 2FGWL 4WI6A 5DDHB 5EU7C 2ICEA 4FQCH 1A6ZB 3IJSA 4X98B 1MQKL 4S1RH 1RZKL 3RKPA 4ZUUA 4K3EL 1CIUA 4BZ1L 2RBLA 4YDVA 1CICA 5CCKL 1T21A 2DJSA 3CLEH 1NGYB 1MJUH 1NLDL 1WAAF 1H3TA 4PJ5E 1YNKL 1YZZA 1DQJB 1MCOL 2VKWA 5FV2A 3O4LA 3QDGE 3VFNA 4D9LL 3CX5K 2I5YL 2Z91A 4TVPH 1RIVL 1GXEA 2DRUA 3QO0B 2GI7A 3K46A 2YMXL 2AQ3A 3L5HA 5ERWB 3HC4H 1CFVH 2DIJA 3UBXI 1F3DH 1ZWIA 2A38A 1INEL 2PW2A 5C0DB 1JFQH 5K59F 1Y0LB 5F1NA 4LPUA 1ZA3A 4LIQL 2VABA 3H42H 3O4LE 1QTYT 5TDNB 3QDAA 3FOMA 1XGRB 4QXUH 4NQEA 5KOMC 2Y23A 1JGVH 3W9DA 2WIIA 4YO0B 4PLKD 2LVCA 4HZLA 5HYSB 4LHUD 4Z7OF 3BP6A 5CHNA 3O4OC 1WCBA 4GRLB 5HD8C 4BKLB 4B7IA 3KDMA 1G84A 4ORZC 1K85A 3PJSB 4CMHC 3T09A 4C56D 5DRNA 3TM6A 5GRUL 5CUSL 4LPWA 4LPVA 1DBMH 3ZL4H 3BD5A 3CFBA 4UB0L 1E6OL 2VQ1A 2Q20A 1NFDA 4ZQKA 1U8MA 4HIHA 1UM6L 3IFOB 2K1MA 4JO2H 3N9GH 3GUTB 2HT3C 4ELMA 4FQJH 3QAZB 3ROOB 3U6RB 3GJEB 1BBDH 2WW8A 3QBTB 3WNLA 1FP5A 1B90A 3X3FH 3VXME 4LFHD 1EDQA 1C08A 1F90H 3HC3L 3BUTA 1EFXD 2YA1A 1AGCA 4MS8D 1OT2A 3BX7C 3IDUA 5HDBE 3GSUA 5GGTA 3VRIA 4YZFF 1FVEA 3HI1B 2NY7H 1FORL 3HMWH 4PRAA 4RAUA 1LP9B 3CFDA 4TUJA 2ENSA 1NFDE 3OSKA 1RZFH 2FIKA 2R2EA 4X5WA 2NY4B 4YHLL 3HZMB 4TN9A 5I1DA 1MFAL 3DETD 5GS0L 3C8KB 3C60C 3TIDB 2VSDA 4QOKA 1S9XB 3T1FB 4JGJA 4Q6YA 3VA6A 1PG7W 1IC5H 5DMGD 3HNTH 5D9SA 4X7EC 3RVVD 1G7MA 3MRKA 3SEPA 4YXHL 4XP6H 1CQKA 3CVHH 2R4SL 1RAMA 4PGCB 1YN6B 1JHLL 2XN9D 4H26A 2BSRB 4LLDA 4F58H 2B5IB 2QL1A 3I6GA 5C9JB 1LO2L 1CD9B 3GMRB 3QI9D 3HE7A 1J18A 4DW2L 1AGBB 1MIEL 4LLVA 1GGIH 3BQUD 2HT2D 3DMMD 4M43L 1NAML 4P2RB 5K9QG 1AQKH 3FT4B 4NQCE 4WUUE 3SDCB 1GOHA 1M7DB 4ZSOE 2PW1A 3RX7A 3C6SA 4L8SC 1BX2A 1IGTA 5F9JA 1TTFA 4L1DA 1J0ZA 1RJYA 4XNZC 5JXAH 2A74A 2BDNL 3QPQD 3QRGL 4C83A 3ZYOA 4JM2B 3S5LB 1YECL 2YPLB 1I85A 4WY7H 1AXTL 4PJAA 3RDTB 3ARPA 3L7FA 4Z7VA 3ZYJA 4I9WE 1YPZA 3NFSH 3VXNA 3RL2B 1WWAX 3CXDL 4HK3J 4DUWA 4S1DC 5DJCA 1FQ9C 1KPVA 2ORBH 5IBTL 5SWZD 5KS9E 4MQXC 2A0LD 5KSUB 3L5JA 4NQDB 4C4KO 1SBSH 2I9LA 4ESKA 3FL7A 4Y16D 3EYVA 3ZDYE 2W9LA 1IEAB 1TPXC 4GLRH 4K7PY 1V3LA 3O3BB 2E9BA 4QRRD 2JJWA 2NY2C 1U8OB 1MHPH 1NKRA 2CH8A 1YPZE 2OJEB 2B1AL 4PJCA 4XWGH 5D1XC 4WV1B 1QPPA 4WW2F 5SX4I 1OY3B 4P2QE 1ODAA 2JK5B 5BOZG 2APFA 4YPJA 4OT1L 2DQIH 5TDPA 1QLEH 2Y6SD 5C0EA 1WIUA 3Q1SH 4NN5B 4JVWA 2VN4A 4FTVE 3GSOA 4UOW1 4XAKE 3D39A 1DFBH 3HPJA 3IAPA 2R0LH 4U1HB 3L5WB 3MV8A 5F3HB 2BVOB 4NNYB 5EO0B 2CD0A 4TQEH 4EI5D 3CMGA 1D9KD 4MZ2A 3MRCA 3Q5YA 1UACL 3MJ8A 3TVMD 1E27B 1T2XA 2FDBP 5E6IB 1FVDA 3VI4E 3MGTA 5KSAA 1F3JB 3IDIA 4QXTA 4JFZH 3OKNB 4MAUH 3KVQA 4OV5B 1UM5H 3H3PL 5FCSH 5GGRY 5EZJB 5IB1B 1DVFD 1OOAA 3LZFL 3Q5TA 4L5FL 4YK4B 5EU6B 1YA5A 4ELKB 3FN0L 4YBQD 4BM7A 5MHSD 3PL6D 5F3BA 5EO1A 5GRVK 4JO3H 1X5GA 3HAEH 3AB0B 5J13C 2A6KA 1MJJB 4U2ZA 2V9QA 2EYTB 1BJ8A 2ZSWB 5CP7A 3V4UH 4FS0A 4Y5YA 4XPGL 3OKDB 4TVSa 1IGMH 4OF6A 1QBBA 3RZCA 2VJXA 4PY8I 5E00A 1IGIH 2J2ZA 5ALBH 3MROB 5E08L 4K8RL 3O3DA 5IBLC 5HYSG 1BAFH 3BKCL 3JWOL 3O9WC 1OP5H 2Q6WB 4M48H 5CBEA 1DEDA 3QFJA 1BD2D 4ALAH 1NCCH 2H1PL 4HJJH 3VU2A 3ZYIA 5C0GB 2VISB 4LHUB 3SE3A 1NCDH 5IMMB 2ZUQC 1S9VB 1V5JA 4KI5C 1KIQB 3U7WL 2AJXH 2COQA 3P9LA 1RQ5A 1IGFL 5KN5A 1T7ZA 1HQ4B 3FB6B 4LSVL 4C56B 4HWEH 4I2XB 1U42A 4XHJC 4ZAKC 5AEAA 3VFRB 2HJKA 1HOCB 4I3RL 4Y5XB 4P49A 1ZK9A 1BWWA 2WQRA 2D31A 4YDLC 1E28A 4W81A 4AL8L 3U46A 1FZKA 2IWGA 3AU1B 1FAIH 1UWGL 1NCNA 2QKIA 4X6CF 1KBGH 5D7JA 1MH5A 3RPIA 3KS0J 3P40A 5KSVA 4YBHA 2JKXA 5HDQH 4GMTL 4S0TD 4F9PA 1KLGA 5FF6B 1CGSH 1JV5B 5DC0A 3MNVB 2DLFH 4H25B 1XH3B 4MJ5A 2BVUA 3L3DA 1N7ML 3ARGA 3QSKB 3MBEA 4YHPA 4JFFD 2J4WH 3D25B 4R9HA 3W81A 4OJFL 3S97C 5EFIB 4JFEA 3MLZH 3OKMA 5HY9B 4NM4H 3HFMH 3A67L 2G5RA 3GSXA 3MPCA 3MFFB 2DWDB 3FRPA 2LV4A 2XN9B 2JCCF 4Z76B 1W0VB 5ANMB 3OQ3B 3OGCB 1EO8L 4IRJA 3MV9A 2PXYC 3QI9B 3PDOA 2VITB 3QNZB 3MRGB 4XXCC 5TFSL 3DMMB 2VC2L 4FQIH 1CDGA 3Q0HA 3QWRA 4JFHD 1XF5A 5F7MC 3WNKA 2QHRH 4BUGA 1FG9C 2J8UB 4JFEE 3S5LG 4XTRD 5DI8A 1DUZB 1CCZA 3QZWB 4X9BA 1NC2D 2D3VA 1KEGL 1N59A 4LDEB 3D69A 1U92A 4PRHA 5JO5B 4P3CH 3ZTJG 2MKWA 3GBLA 4HFUH 3G6AB 3SGKA 1KJVB 5F89A 4N8VA 5F9OL 2VWEC 3HE6D 2YA2A 1S7XB 5D7LA 2XWTA 2GY7B 2Q86B 3GSWA 8CGTA 4G8FA 5BV7L 5SWZB 1KIPB 2IQ9H 4JFQB 5D4QA 1DBBL 3UC0L 3EFFB 5EUOB 3NCFB 1P7KB 4YXLH 1SQ2N 1D5BA 5HPOA 4FQ1H 5SX5K 1VERA 4Y16B 1FV1A 3EDFA 1AGEA 3QWQB 5JORB 4JG0H 4KTEH 1G9NH 4QRRB 4AH2B 1J8HD 1MCSA 2FEEI 2YWZA 4ODUB 4RMQA 4W6YB 4HBCH 5D7LE 2A73A 4MX7B 5CZXD 3QCVL 2YS4A 2P4AB 3QDMA 3MOBH 4HDIB 2OZ4L 2DQHL 2AEIT 3QIWA 4HZAA 4MXWL 5F6IB 3U1SL 4QRTB 1C5DB 1D7FA 2H32H 3WFBH 5KVEH 5GRZA 4GAJH 3ZT7A 5LGHH 1MFCH 4OFVA 2UWEE 1QFUL 3KPNA 2HVKB 4UUJA 1D9KB 4K9EH 1P2CA 5BO1L 3TVMB 4DGVH 1RFDH 4YHKL 3W11D 3GFUA 4LSRL 2AK4A 1I9RL 3EHBC 3T8XA 3ZLQC 2ZJSH 4GMSH 4M7LH 2VDNH 4OZ4A 3E1F1 3WD5H 1DVFB 5FKAA 4G6AD 2BY1A 1BZ7A 3PL6B 4ODBD 2VL5A 4MJ6B 3LB6D 5EC1B 3TBYB 4YDKL 25C8H 2RHEA 4DQOH 1UCBH 2X4NB 1VESA 2DQCL 1FVCA 2HMID 4RMRA 1RUMH 5I16A 3E6FB 3QUZB 1VGEH 1EHAA 1NDGB 1GGCH 5HHVH 1H8NA 3PABA 4M6AA 4Z8FL 2CPCA 1FNLA 1DQQB 2XTJD 3WUWA 4LLUA 3CPLA 2ICWJ 4QRQB 1G9EA 5J11C 3D0VA 3JSSA 3CAFA 3SO3C 4JN2A 3Q48A 3PWPA 3CDFA 3ALXA 5FM5O 1RSFA 4QHNB 5FUOH 4PG2A 4HXAL 1S7VA 4KKCC 3VGFA 1QSFD 1XF3A 1I4FA 4JQXA 1I1FA 5CINH 3LQZA 4H88L 4NKIH 1T4KB 5IT2H 2N4IA 4U31A 4LOUD 4S1RL 1CDYA 4HUWA 3U0PB 1BZ9B 2VXVL 4MCZA 3CD4A 4XHQA 3CLEL 1EXUB 3P4MA 1MJUL 4OGXH 5I17B 1ADQL 1S7WA 5JUEH 4OD2A 5F9WB 1RULH 4M6OH 5GS1B 2BRQA 4Q6IC 1B4RA 3U36A 3TNMA 3VWJB 5HGHB 1CL7H 4J1UB 4TVPL 1I3UA 4RBPH 4XPAH 3TJEH 4OFPA 1Q9WA 3G04A 1E0OB 5DRZA 4TUKH 1CFVL 1ROWA 2KKQA 5IMKB 1JE6A 5K9QI 3RVTD 3VG0L 4ZMAT 2EH7H 3DTXA 3QJHA 4XVSH 5GZNC 1CICC 4GG6A 3S96A 3DURA 1JFQL 4K3DH 1ITBB 1EHLH 5AD0A 4OD3L 3CIQA 2V9TA 3C5JB 4JFFB 3OX8A 2AAVA 5HI5C 3WJLA 5BMFL 4Z77A 5JPMA 2YD1A 5HXMA 2J5LC 1JGVL 2QR0A 4FFYH 1VFBA 5CIPA 4ZUVA 3L3JB 3WXVL 3KGRA 5FOBA 3C5ZD 4LSUH 1Q9KA 1B9ZA 3MGAA 5DD1L 5IFAH 4Z5RA 1H8OA 4LAQH 5GSVA 3TGXA 4BZYA 2ITDB 4KMTH 3WHE1 1JPSH 4GG6E 3FRUA 4LLAA 3QZWG 4AT6B 4R0LB 1IGYB 4R4ND 1PG7X 1OQXA 3RWDA 2JIXA 2IADB 2X7LB 1YEEL 4YBLB 4GFTB 2E8YA 1T20A 1DANU 2NY3C 3SDXB 4IRSD 3G08B 1RUQH 4FQJL 2ADFH 4GQ9H 3AGVA 1LNUB 3OL2A 1NC2B 4EOWL 4OLXH 2XY2A 5ESQB 2QQLL 3M17B 4Z7WA 4CVXB 4U1MA 1PG7H 1F90L 2A2QT 5C0CA 4I0PA 2HJLA 2MQCA 1R24A 4Q9BA 3SOBL 1FE8L 3F7VB 2NY7L 3HE6B 3HMWL 3B9AA 5LAXB 4FA8A 4JRXD 1OPGL 5FYJE 4S1QL 1A3LL 1NFIB 2AS5M 5DO2C 1F6FB 1WTLA 1QACA 1KJ2H 3WN5A 3NFPB 4AG4L 4P2YA 3HZYA 4OLWL 1VFAB 5IM7B 1CDUA 2CLZB 2YRPA 4HLZG 3G5VB 4Z7WE 3UTOA 5C0CE 3RX5A 2AJ3B 1IC5L 4XP6L 1IL1B 1F8TH 1J8HB 3HRPA 3CVHL 3PNWB 2GYSA 3E2HB 2D7PA 2W9DH 3QG7H 1MEXL 1RMFL 1NMCB 1JWUB 2BJML 2ZOKB 4ENEC 4OZGB 4GXVH 1BIHA 3UBXA 5C0JB 4I0CC 2CDFB 2AW2A 5C0AD 1WCQA 3GIZL 3CCHA 4X6DF 1A7RH 1C5CH 4CMMA 3MRNA 1JF1A 1U8LB 3RIAK 2BSED 3GSNB 5HVHB 5HDBF 1N64H 4XCYA 4NQVA 5C08E 2ZCHH 4NM8H 5K33A 4PGBB 4D94A 4LDLB 2FX9L 3U0WL 4OF8A 2VIRA 4WY7L 3T1WA 3E8UH 3ARYA 5EOCH 2C3XA 1P1ZB 1Q0YL 2EXWD 4RWYL 1N6UA 2P8PB 4HMCA 3O11B 3TZVA 5DZNA 3NN8B 4PUBH 4TULL 3UYPA 4DZ8B 2XRAL 1D6VL 3ZTNL 2CRIA 4BH8A 1MHHA 5CAYB 1SBSL 2ADGA 2XT1B 2UZIH 1I1YA 1RIHL 3MLWL 4BFBD 2NX5A 1JI1A 2ERJC 5FYKU 2EDDA 1G6RB 1ZAGA 2GJZB 1AD9B 2YC1B 1RHFA 2BVQB 4AIZA 4EVNB 1FPTL 2UYLA 3BH9A 4M1CD 4OZIB 4HIEA 1PKOA 1I85C 3OZ9L 4XBGB 4ZOAA 1W72B 2C3VB 1I3RB 3EFDH 1OTTD 2PR4H 3O3EB 5MENA 1I1CA 2VLKD 1R5VA 4PG9A 4XWGL 1NC4A 2WWMD 4Y4HD 3AM8A 4Y2OA 2YPKB 4NNXB 3U4AA 4Z7NF 5CMAB 4WGVB 1CR9H 2GK0B 4KJWC 1IAIL 2MMXA 1QSFB 4O2CB 4M03A 2NX5E 4Y8AA 4WO4A 1YEDA 5D6DA 4Z7QF 43C9A 4TPRL 3IKKA 2F74B 1PZ5B 3MO1B 3PP3H 1KCUH 4TQEL 3TT1L 1I8IA 1AI1L 5FGCE 5JW5A 4ERSH 3KJ4C 2H9GA 1SBBA 1MWAB 4U0RB 3BI9X 4UDUB 5DD5H 4PP1D 4EQ3A 2VDQL 5JLZB 1F13A 3TFKD 4MAUL 4YXKL 4L3EA 5KS9F 4CGTA 3RX8A 4F7EA 4Y4KA 2HG5A 2BXZA 1OGAA 3FB8A 5T33L 4HAGA 3OAZK 1E4XI 4TSBL 1SYSB 1SMOA 4ZFZA 1U8KA 3WS3B 2Z4QA 1OTSD 3C2AL 3DARA 1V8HA 5ILTH 1ZLWH 1SJEA 1H3PH 2JJTA 2L7JA 1HINL 3C87A 4OQ1A 5FYKD 4P3DA 2VLLB 3KYOA 4ZNEA 1LO5A 1CI5A 1IGIL 5KSAC 5EO9A 2IPUG 2DF3A 5F88B 3WUZA 5ALBL 1L4IA 2GQHA 1BAFL 2X89A 4P2OD 3OKYA 2GHWB 5CEYB 2NY1B 4HKJB 4NFDA 1R5WA 2R56H 4Y2DA 1NLBH 3O3AB 3SKOB 1BGXL 1OGAE 4JFYB 2NY6C 1BVKB 4XI5D 4X5XB 5CP3H 4G9FA 2E9IA 2X1OA 1HSAA 1DQLH 2DQUL 5B38B 3ZHLA 1A1OB 1L0QA 3GRWH 4HUXB 1UKSA 3SY0B 4OZFA 3PGCB 1JTPA 3CDGB 4HWEL 1EUTA 3MLUH 3G9AB 1X5HA 3F58L 4IOIB 3FHQA 3FB5B 2VLJE 3QJFB 1U9KA 5E2TL 5FKPB 1JRHH 2UV3A 4KK9C 2X4TA 1AC6A 4HHAB 3FQXA 4LRNL 4HS3A 1TCRA 2UUDH 3VXSD 1SM3H 5H94A 2R69H 3BSZL 1P53A 4YHOH 3AXLB 1MCFA 4IRSB 1NEZG 2XI9A 5SV3A 1ZHBA 1QFWH 2A6IA 2CKBH 4PJIA 4U7MA 4NUGH 4JREC 4ZTOL 4NT6B 5IIEB 4N9GB 4LU5H 3P9MB 3VDAA 3S88L 1FSKC 5HI3D 4BSJA 1XZ0A 3UCRA 2H3NB 2JJUA 4V1DA 1YN7A 4X83A 3SE3C 5JOPE 2EH8L 1G7PB 3S34L 3EOBA 5HDQL 4IIQA 2VXTL 2YK1H 4LEOB 1OWWA 1ZVHA 4G3YH 4JRXB 3QQ3B 2PYFB 5D71H 3HS0B 1KJ3H 3OPZH 4ODXB 4D9RD 5J9PA 1HDMB 2DLFL 5DLMH 4PY7A 1D5XB 1ND0B 4PJIE 2NR6D 3KYKH 5DT1L 1FO0A 4RZCB 3IDGB 1EFQA 4WEMB 1ZE3C 4DKFH 2J4WL 3D18A 1PSKH 5EBMB 4DGIH 1N6QH 3D3VD 3PWVA 3RWEB 3MLZL 1KN4L 2BRRH 3K7UA 2HFTA 3T4YB 5EUKB 3HFML 4ZOCA 2EC9U 4QRPA 4F2MB 3CU7A 4WHTA 4PJEB 3QEQE 3ZKXC 3EYOA 1NQBA 3S9DB 2X4QA 2OL3A 3FO0H 1HEZA 1AIFA 1P4BH 1RZIA 3DPBA 5I76A 1MAMH 5I8OL 1UYWH 5H2BA 5EU4A 2DQJL 1LWRA 3FONA 1LEIA 1GH7A 1MI5D 1XIWA 5C0AB 4WTZG 1C1EL 1EO7A 4J4PD 3GHEH 1F11B 4MJIA 2ZZUT 2J12B 3WO4C 2G75A 1SEBB 4QRPE 1JMZA 3FT3B 5GPRA 2B0SH 4WDIA 1KB9K 5IK3A 4HKZA 5GIRB 5HTSA 2ZCLL 3TYGH 1A7PL 2X05A 5E9DB 2J7LA 5FYLL 4TRPL 1F58L 1W2KT 5AYUH 3IDYC 1Q9OB 2MQ0A 4OFKA 4IRJC 4ZFOL 3KYAA 2HLFC 4ZUTB 5L2KD 3DV6B 2NZ9D 3JV6A 4LLQB 3SDYL 4HG4K 1CFTB 4MLSA 2AERT 4PJDF 5A2IH 3DXAD 1QP1A 2ATKB 4MJIE 4PGZA 3FQWA 3VXPB 2GIYA 4O5LH 3HUJA 4YXLL 2DICA 4MNGA 4AYFA 4FQ1L 3W0WD 5C0ND 4RNRB 1I8MB 2X4PA 5EA0H 3INUH 5J06A 1UQSB 5HHOA 5L6YH 2X09A 5JHDA 4KJQD 3SGKC 1HI6B 4WU5A 1CXFA 3MRQA 4PB0H 4DAGH 4HBCL 2VLKB 3SCMA 4Y4HB 5C09D 3TH3T 1T7YA 1NCWL 3MOBL 4WIQA 1NGWB 3GB7B 1ZT4A 1WLHA 4JY5L 2Y5EA 4NCC2 3FO1B 2JLLA 4JKMA 3VFSA 3T0DA 4U1IA 1CU4H 3ULUD 3WFBL 4JQVC 1RK0A 4KQ3H 1J8KA 5LXGH 3CFEA 3UJJL 1Z5LB 3DX7A 1A4KB 2LE9A 3Q6GH 5LGHL 4TTGA 3LKSB 4H0GA 3VFWB 1OAXL 3IRZA 4R90H 4K9EL 4HH9B 3O6FA 3MXVH 2I25N 1F6AA 4RFOH 5E1HB 4DGVL 4Z78A 4P9HL 2F8OA 1GGYA 2W65B 5I30L 1NBVH 3ZE1E 1KXVC 4IEFB 3V5KB 3BKJH 3M1BA 3UO1L 3PWLB 1QZ1A 1BP3B 4M6ML 3ZZ1A 1MCHA 3VXTB 2ZJSL 4M7LL 1BJ1J 2VDNL 5E2UL 3VXQB 2PCPA 3VFMB 1H8SA 3M07A 3QIWC 5I75B 1M7IB 3TN0A 4U1NA 1IRAY 2GJ6B 2VDML 1XR9B 4NQED 4MCYA 5ADPH 3CVIH 3VH8A 2QADD 1UCBL 3I75A 4N0UA 1RVFL 4ZTPH 5LWYL 3OB0K 1BQHB 4MNQE 3RWJB 1RUML 2FJHB 4IMLA 1G7IA 2IAMD 5ITBL 3FQUA 3C9NA 4K2UH 2VL4A 4TYUA 1J0IA 1N4XH 2CLRB 4FQHA 1MLCB 3ARFC 1HHKB 1CG9A 4OBSA 3B3IA 3D1MC 1AHWA 2FATH 5B38G 3Q6FA 4U3XA 3JTTB 1PKQA 1QO3A 1DQMH 5FK9B 2UWEF 4L9LB 5BQ7B 4N0UE 4RQQB 1TJHL 5BJTA 2WP3O 2Z8WC 1UB6A 5JNYB 1AR2A 1U6AH 1UKTA 1UM4H 3TT3L 5AG8A 1ED3A 1CF8H 3QXWA 2K9UA 5IT2L 2AXFA 5F7DB 3FB7B 2W0FB 1QG3A 2CDGA 2XZCH 3QIBA 3VXSB 3VFGH 2W38A 3VJ6A 1XF4B 4OLZL 3MRLB 3CXHJ 4CADA 4NSKB 3JWDC 3ZDZF 4OGXL 1K3ZA 1QPXA 3MRRB 3D5OF 3GM8A 3VI3E 1FZJA 3B4NA 4EXKA 4DN3H 4OQTH 4QOKD 3QXAB 3U7YL 2KZ1B 5JMOC 2R1XA 2Z31A 1LK3H 2FH6A 2BY3A 5DFWH 1J9CT 1FG2B 5T3XH 4QRUB 2DTSA 4JQXC 2NY5C 5EBLB 4PV8B 2Y06L 3GBNH 4HEPG 1M6OA 1FBIL 1NGZB 2ATPB 2M8XA 1LE5A 2AV7B 5CBAA 2YA0A 1E4JA 5IQ9A 5ISZE 1EAJA 1J0HA 1FJ1A 3QH3A 4RGNB 3RUGA 5ID0A 1XF2B 4XVSL 4P59L 1HNFA 4K3DL 4P57B 3HE7D 3KLAB 1EHLL 3ROLB 3MJ7B 3V5HB 5TH2A 1T3FA 4G6KH 5IV2B 4KK6D 2BHZA 3RVXC 3GDBA 3D3VB 4ZUWB 1G0YR 3BW9A 1ZSDA 4FFYL 1UADC 4CBPA 3I50L 3WIFB 2FJGA 3GSNL 4X80H 4FMFA 5KVFH 1NL0H 5DJ0A 2HKHL 2PTTA 2PKDA 4R7DA 3ILQD 4IMKC 3GO1H 2BMKB 4WFFD 3DWTA 2FR4B 1WF5A 4XMPH 1PYWA 3SO3B 2P5WB 2VO5A 5T1DH 1DR9A 3UZEA 2HFGH 4PRPE 2WK2A 3W39A 1R5IA 1TXKA 4JO1H 1CZ8H 4HF5L 4A6YL 3EZ8A 3RWFB 1RPQA 2WUCL 1WT5A 3V2AR 3NMEA 3SKNA 2RJMA 3SPVB 1MJ8H 4MB3A 4BQ6A 4Q9RH 1R6VA 2BOCB 4J3XA 5J6HB 4MVBC 4X9FA 1JWMA 5IGXL 5CGYC 3JV5A 1P7QA 1WWBX 4F7PA 3QNXA 5HHMD 3JV4B 2PNDA 4PRID 4PJGA 4DKAA 3SJVE 3KLHD 4QT5B 5TF0A 4LCUA 4WFEE 3DX6B 3STZA 3HN3A 1JNHB 5L2KB 4RGMB 2YXFA 5H37H 4OAWA 5DD0H 3DXAB 3S4SB 1OLLA 1NMAH 3V79C 3QUML 3KPPA 4Q6IB 5I1IH 1KJ2L 2Y1VA 3V6BR 1NUGA 2F5BL 2MFNA 4M4RA 1EJOH 3D0LB 3W0WB 1TMCB 4BH7A 3GBMH 3HG1A 4OCYL 5F7LB 4J8RA 2ICEB 2P8MA 5DMKA 4R4BA 1KFAL 5F1KC 4ZUUB 5KW9H 4X7TB 3L1OL 4YDVB 4NO5A 2CUHA 1T21B 5J1AA 1WIOA 4DN4H 4PGJA 3H0TB 3STLA 5ADOL 4JKKA 5C09B 4AENB 4WNQA 5T1MA 3UJIL 4WI2A 3TJHC 5EH1A 4TOYH 4YWGH 1IZKA 4UIMA 3ULVF 5IVXF 3O0RL 5IF0A 4L4TD 3VFNB 3G5ZA 5I73C 2VLRA 3HG1E 1C5CL 3RZWA 4PBXA 1BVLA 5SWQB 4XBPA 3IXTA 3OKEB 3SGEI 2NQCA 2ZCHL 4NM8L 4CJ0A 3PGFL 1MHEA 1ZWIB 2X4RB 1OAQL 3LHPH 2PW2B 5DFVC 3QYCA 4PTUA 1VGKA 5DVKA 3LRHA 2V2TB 5DK3A 1ZHLA 5ALCL 1HNGA 5EOCL 4OKDA 5KSBE 2P5ED 5D2LF 5DS8A 3IJYA 5FCUH 1RU9L 5I8CB 4DVRH 2AVGA 4KVCH 4PUBL 3QFJD 3P0GB 4NQEB 3ZT5A 5INCA 3W9DB 4NOFA 2WIIB 5DK0A 4HZLB 4JDTL 1RD6A 2WNGA 1B0WA 3BP6B 5B8CA 3GNMH 3KDMB 1HKLH 1S7RA 3C08L 1KPUB 2BVEA 3RAJH 1UC6A 2IAMB 1E4WL 2HTLC 3CFBB 2R2HB 1J5OH 2VQ1B 1QFOA 1PD6A 4ZQKB 4U3HA 1YMHA 2EDFA 1IM9D 2F8XC 3UYOD 4HMEA 4U1JA 2ADJB 5HHQB 4ELMB 3QUYC 4BFIB 3HZVA 4X98A 5D7JD 1J05A 5KOVC 4PJHF 1CR9L 5B3JE 1W0YT 2DL9A 1OAZH 1RY7B 1REIA 5MERA 2OTWA 3HLAB 5CJQH 1NGYA 4GUPA 1FVEB 4H5SB 4PRAB 1QR1A 4UTBH 4PLOB 4LCCA 3AAZA 2FIKB 4ERSL 2F58L 4X5WB 1J12A 1R3JB 2HN7A 2DQDH 1FZOA 5CEZL 3FQNA 3RTQD 4LSSH 3QO0A 3PHQA 4MA1B 5CJ5A 4QOKB 3ARGD 3AM8C 4X7CC 3VFVA 3DO3A 5KBNC 3MRKB 5C0DA 1A6UL 1IQWH 1OSPH 4WO4C 5BW7A 3VXRD 4PJ9D 1Y0LA 4MA7L 4B0MM 4EDXA 1JGLH 4NFCA 3SN6N 5I74B 5JOFA 4H26B 1QVOB 5TDNA 1H3PL 2F15A 2JJVA 5HGAB 1A3RH 3HE7B 1ZLUH 4LLYB 4LLVB 1A6TA 1FNHA 3JTSA 4RCAA 4LPCA 4BKLA 1BM3L 4WI5A 4Y4KC 4KTDL 2PW1B 3C6SB 5DUBA 5EN2A 4M02A 4UZGA 5F9JB 1A7QL 3HKFA 5GS3A 1RZ7H 5KANI 4KRPD 1U8HB 2P48B 2G60L 1HHJA 1BLNA 2CRMA 4PJAB 3LEYL 3U6RA 3L7FB 4Z7VB 3GJEA 3F7YA 4M93B 2OSLB 1GL4B 3S98A 3B2VH 5C0BD 1J87A 4BFEA 2R0KL 2CK0H 4YHOL 4P46A 1B0GB 1LO3H 1QFWL 3B9DA 2DBJA 3LKOB 1FNSL 4GBXA 2I9LB 1NGPH 3HTLX 1LGVA 3FMGH 1Z2KA 5T5FH 3CLFH 3EYVB 4NQUA 4WWKA 1Y18A 2E6QA 2IFGA 2CIKA 2Z9TA 5CJOL 5C8JA 1YEGL 5HHMB 1A9EB 2YK1L 4PRIB 3S4SG 3KJ4B 4PRNA 3C8KA 2ZUXA 2LQRA 3KPSD 3NFNA 1H3XA 4G3YL 4ZO6A 1S9XA 5D71L 1H5BA 4PJCB 4HH8A 3VA2C 5DLML 1SY6H 4U4BA 3EUUA 5TDPB 5F6HI 4YHZL 5C0EB 4PGCA 1LP9E 1YN6A 4LLMA 4DKFL 4HPYH 1JGDA 3D39B 2I07A 1FL5B 3CH1B 3MV8B 2BRRL 3QDHA 3FO9B 5C9JA 3GMRA 2C1OA 1AGBA 3MJ8B 4IIQC 4MA3A 3MUGA 1U3HA 2Y36H 1FVDB 2OYPA 3B9KD 5EZIL 5KSAB 2Z8SA 4HUUB 2DQTH 3IDIB 4P2RA 5L8KB 1P4BL 3FT4A 2DQFA 4NBXB 1IAOA 2PTVA 2AK4D 4XP9L 1M7DA 2ZUYA 3EO1B 2VMFA 4L4TB 3UAJD 2NY6B 5IR1A 4JM2A 2JTDA 5F3BB 3OAUH 5EO1B 3RKDC 2ILLA 4YFEA 5E7FA 2A6KB 3T2OA 2RB8A 3T3MF 5CP7B 2RCSH 4Y5YB 1IJ9A 2E7LA 4W6WB 3TYGL 1J0YA 4P2RE 3RZCB 4BSVB 5E00B 5KSUA 2P5EB 4NQDA 5AYUL 2YRLA 1NUFA 3O3DB 5I18L 3QUXA 4X0KA 4N8CL 3EYUH 5CWSB 5DMJB 1A14H 2FB4L 3P0VL 5CBEB 3QFJB 2C9AA 5E94A 1IEAA 3QHTC 1FSKB 3O3BA 4FQ2H 2YPLE 4FQXA 4MDIB 1XIWC 4Z95L 4O5LL 1CE1H 1D5MA 4M1DH 1E6JL 3QCTL 2APTA 4CW1B 5CEXA 5KN5B 1U8OA 2VQUA 2OJEA 3NBNA 3NGBC 4F15B 2JK5A 2D9QB 1RIUH 3INUL 2HJKB 5L6YL 5DGRA 2X1XR 3I3DA 3N1QC 5AZEH 2L7UA 4NPYB 2V9RA 4NQDE 4CN1A 4MXQD 1KYOK 4HK0A 3U46B 5E99H 4DAGL 2C26A 5I1EH 1IM9B 2APXA 1I9EA 4JAMA 1DTUA 5T3ZL 2QKIB 3OG4B 5FXCH 3P3YA 4FXKA 4U1HA 2AEQH 5D7JB 3FFCD 3RPIB 4CRPA 5DD3H 1CU4L 1JPTH 5I15L 2IAND 2C4FT 2IPTH 5KSVB 1E27A 2AKRA 3AS2A 1JF5A 3Q6GL 2BNRD 3B2UD 3VRJA 1MFEH 3OKNA 1KLGB 4NYLB 4XBEH 1OB1B 3IT8D 5E5RB 4XC3L 3O2WL 5EZJA 4I18C 1KNOA 4G8GD 3PP4L 1DL7H 1TZIA 4ELKA 1PX3A 3BKJL 4MB5A 4MJ5B 4QHKI 3SCMC 1NMBL 3FFDA 4YJZL 1KG0B 2D7MA 3ARGB 3MBEB 1MJJA 4YHPB 1AD0A 2EYTA 3V0AC 4AIOA 5DMIL 3OKDA 4DVBB 3OKMB 1HE7A 3WLWD 3GK8L 3CVIL 4S1DD 2DWEA 4JN1H 4MA8H 2J88H 2R0ZH 4PJ9B 3AREC 3T3PE 3VXRB 1FCGA 3MROA 2EDKA 4F57L 1F4XH 4JGUA 3EDJA 2ZOLA 4BQ8A 1CLZL 3DYOA 4OGAC 2Q6WA 5IVXA 1L6ZA 1TQBC 2IGFL 3BP4B 5EU6E 4QRSB 2VH5H 1H3UA 4KHXH 4OSUL 3MV9B 3GIVB 5C1MB 2FO4B 1BQUA 1KTLB 4JPWH 2VISA 5C0GA 1N4XL 4LHUA 1S9VA 2R23A 1KIQA 1F5WA 3FZUC 1XF5B 2FATL 1LILA 4IRZH 2XXCB 3BPOB 4C56A 2ZCKL 4POZC 3HNVH 1QSED 1G7JB 3TN0C 5IW1A 3UXFA 1DQML 4ZOBA 1HOCA 4POUB 1T03H 4TSAH 3QQNA 1U92B 4PRHB 1OAUH 2I60L 4EDWH 4I0PD 4B53A 4Z0BL 1UM4L 3UTSD 5D7IA 1WISA 3S36X 4PBWD 1I7RA 4JHAH 5C0BB 2XWTB 5DEZA 1A7NH 3GSQA 3MV7D 4S0SD 3WIHH 4G8FB 1EFXA 1QSVA 2VDLH 3DBXB 5IB3B 2RFXA 5F97E 5IHZA 4C56E 2IALB 4I2XE 3CFIC 5EOQH 1CFQB 1AHWC 2DN7A 5BRZD 1GCFA 5F21B 2Z35A 1D5BB 3QEUB 5FF6A 1GGBH 2ADIA 4YDIL 1KCRH 1GC1H 3L7EA 4PJFA 1AGEB 3MNVA 1LK3L 2C3GA 4JKLA 1OTUC 5EC2B 5AZ2H 1KN2H 3GBNL 4CNIB 4DK3A 4K23L 5GJTH 4PJHA 3BT2L 2A73B 3ORJA 5EFIA 3QIBC 3QDMB 2I9TA 1ONQB 2ESVD 4NJ9H 2VAJA 4G6KL 2PETA 5IBLD 2XN9A 3RWIA 1JTTA 2X44D 2FX7L 5FUZL 3C09B 4Z76A 3MQIA 3C8HA 1UZ6E 3OGCA 2SEBB 4UUJB 4DUXA 2ARJA 4XCEA 1S5IL 1UH3A 3QI9A 1O5DT 1P2CB 1X5JA 1HZHH 1QNZL 4X80L 5DEGB 1ORQA 2ZPKH 5KVFL 1NL0L 3CX5J 3MRGA 3IXAA 3BQUA 3DMMA 4EUPA 1EUUA 1XMWA 4D8PB 3GO1L 2J8UA 2AK4B 4PJ8A 3T8XB 4LP4A 1DUZA 3LQAC 3BPLB 4ZAKD 3WE6B 4XMPL 1Z3GL 4HUKB 1JCKA 1KELH 4YX2H 5T1DL 4DTGH 3DJ9A 5FKAB 4UU9B 3TZVD 3VI3F 1S78C 1I9IH 1GIGL 5JO5A 1BZ7B 2XN9E 5I6XB 2IQAA 2VL5B 3L3IA 5E2WH 3G6AA 4JO1L 1KJVA 3ULVH 4HMDA 4EZMA 3QPXH 5ANME 5DUML 4XAWH 5B4MD 4I3SH 1BBJA 1A6AB 2DB8A 2KPNA 1U93A 4Q9RL 5I16B 4HCRA 1ZLSL 2Q86A 5GRJH 3HMXH 1KTKE 1P5VA 3SKJL 1KIPA 3LD8B 4JFQA 3GJFH 2J8UE 3PABB 4OLEA 2CO7B 3EJJX 5EUOA 2HWZH 3V5DA 4LLUB 3CPLB 3WUWB 1AO7D 5MEND 1NC4D 2NMSA 3C6LD 3MLPA 2F8VA 2WBJD 4LKXB 3VFOA 3PWPB 5JORA 1U8NB 5DF0A 1S7VB 4UAOC 4QRRA 4X8JA 5F44A 1I4FB 2YBRA 4MAYD 2YPVH 1I1FB 5AWNH 4UBDC 3GBML 1YDPB 3LQZB 1T0NB 1WT5C 1H9VA 4NCC1 1HQRB 5IMLB 4HDIA 5SWZE 2ED7A 5GGTL 4HUWB 5KW9L 4FABH 3B43A 3X14B 5I1JL 1HWGB 2I24N 4QRTA 5EUOE 1C5DA 4DN4L 1YEJH 3H8NA 1EJ6A 4RMTA 2CGRL 4YQXL 1K8DB 2O5XH 4FFWC 1S7WB 4TOYL 4FP8L 5CLTA 4GKNB 3L5XL 4YWGL 2HVKA 4EI5A 5DJAB 4JANA 1D9KA 4QRRE 2IANB 3MREA 3TVMA 1A64A 1ZT7A 3TNMB 3LKQB 3RI5F 5I8KH 4FFZL 4WW2B 2BNRB 1BQLL 4IHOA 3G04B 5DRZB 4ZD3H 3FQTB 4QEGA 3IDXH 1NANH 1DVFA 5L88H 3DTXB 4KUCF 1XGYH 3RGHA 1MCRA 3TBYA 5AD0B 3AUVA 2EDNA 5FCUL 3NH7H 2VTFA 3OX8B 4I8DA 1LD9A 4Z77B 3FRPG 4KVCL 5JPMB 4PJ7A 3TEUA 4OUOA 4Y2DD 3E6FA 1KB5H 1S5HB 4NN6C 3PGDB 2A6DA 4ZUVB 3KPRA 1NDGA 5DTFA 4EBQH 4G9FD 5GZOC 1NDMB 4HIJB 1DQQA 2OQJA 4Z5RB 4M7LT 1CQYA 4J3OC 3BPNC 1BD2A 3NIFF 5MHSE 3VRLE 5LGKA 4JPIA 5FIEA 1Q0XH 5AYQA 2YD5A 2X4UA 4QHNA 4UINL 4NIKB 3DUHA 1PJ9A 2BXYA 3B5GA 4H1LH 5J3HD 2FHCA 5K9OA 5C92A 3ME0A 2A1WL 1QSEB 2AK1L 1T4KA 1T89A 5CJXC 1A5FH 4N8VG 3U0PA 4QGYA 3QCUH 2D7TL 4TNWK 4DEPB 4JG1L 4I0PB 4U6VH 2HJLB 5E6ZA 1EXUA 5B8CC 3F7PC 4HPOH 5BVPH 3BDYL 3UTSB 3B9EA 2CJUL 4PB9H 5TE7H 3WKMH 5KSBF 1AQDA 4PJBA 3MV7B 1XGTA 2DTML 2WUBL 1CK0H 2CXGA 2RAMA 1M1SA 2W9EH 1OAYL 1ACYL 2DL2A 2DQDL 5HGHA 4ACPA 3OMZA 5AUMB 4LSSL 4O9HH 4WFGE 1I7TA 3WN5B 4YDJA 5BRZB 5I73B 2KBGA 3F5WB 3EJYC 3HZYB 3VG9B 3E3QE 3CJJA 3TBVA 3HI5H 4KROD 1QYGL 4RWHA 4HLJA 4NQSA 1IE5A 1MREL 2P8LB 4X6CB 3QHZL 2A9ML 3QA3A 5BVJA 4OLYH 5GGSA 5GGVL 3C5JA 1T0MB 1YY9D 4JFFA 3O2DH 2C7UA 3ARSA 2UY7A 4X4YA 4LCCC 3WL9A 4TNVF 1HYRC 4B7LA 4WHYH 3LPGA 1MCNA 2BSSB 2ESVB 3AMKA 3ARDD 3BE1L 3MOAL 2XG4A 1G9MC 4I48A 3QXUA 2P7TA 3WS6A 4OCXH 4ODSH 4YHYB 4HC1H 3QNYB 2D03L 1DQDH 4ZUSB 1JF1B 4X4MA 1VPOH 1V05A 1YNTB 3MA9H 3LS4L 4XCYB 4NQVB 4CL7A 3IB4A 1IGYA 4WU7A 5BW7C 4JFFE 3GMNA 5TQ2L 3BHBA 3SDXA 1VFOA 3G6JF 2EZ0D 4JKPL 4R6UA 4EEEA 1NC2A 4H0HB 1MFDH 3TZVB 4GLRI 5JW3H 5ESQA 3M17A 2O5ZL 3H9HB 2IH1A 1LEGA 4UV4L 2FBJH 2YWYA 4F7MA 2DM4A 5DVMA 1CS6A 4BH8B 4GRLC 4RIRB 3NIDE 3F7VA 1I1YB 1GAFH 5BS0D 3CLFL 2CKBB 3JBG7 2YEZA 3WUWG 3P0YL 1IVLA 4JFHE 3SDXE 1NFIA 5CSZB 5C07D 5I1HL 5JXED 5IJVB 4HIEB 4L3CB 3NFPA 4QXWA 5T3XD 3PHSA 5IM7A 4OF5A 5MENB 4PG9B 3QAZC 3GHBH 1NC4B 3C6LB 3G5VA 4S1SH 3UJTL 2HRLA 2WBJB 1B4JH 1EIBA 2DAVA 3I02B 4QGTA 1IL1A 2F9BT 1J8HA 2XWJA 4MAYB 3PNWA 4WO4B 1YEDB 3BKMH 2YRZA 1FIGL 4LNRB 5EDXA 4N0FA 4CN4A 1NLDH 1U95A 2BC4B 1JWUA 1YNKH 2FGZA 4U1LB 1I8IB 2EDLA 1MCOH 3O6FD 3S35L 4OZGA 5JW5B 5CD5D 1GGUA 2YSSA 1H3WM 4D9LH 3SE9L 5C0JA 2CDFA 3DI2B 2BNQD 2I5YH 1RIVH 3RWHA 5F1OB 1H5BC 2ZNXA 5IVZB 4L3EB 2YMXH 5B39A 4F7EB 4Y4KB 3WNMA 1J8HE 4PGBA 1JGUL 1INEH 1FN4B 3FB8B 2VAAA 1TZHB 1X5ZA 3R8BB 1HYSC 5K93A 1L9MA 3CFJA 4U1SA 4HFWB 4ZFZB 4KMQA 4LIQH 4QWWD 3MLVL 2B5IC 1P9MC 1CLYL 4LF3B 5HPMA 4OZGE 2BERA 3ESUF 3NN8A 1SJEB 2N1KA 4NRXA 4FQQB 3KYOB 3VXMD 4XNUH 3VFPA 5A43C 1HHHA 3ARUA 5EO9B 3S7GA 3TESA 3C5SA 3JUYA 3SDCC 3EYUL 2C3WA 1G6RA 4FZEL 1LP9F 1R5WB 4Y2DB 5EIVA 3VDBA 5CSGA 3ZDXE 5GRUH 2YC1A 3LH2L 1P84J 5CUSH 4FXGB 4FQ2L 4G9FB 4M1DL 4HWUA 3WXWL 4JM2C 1ZEAH 1J1XH 4UB0H 1E6OH 4HWZA 1HSAB 4NWTL 4XBGA 5I8EA 2C3VA 1I3RA 2GEEA 4F7TB 1UM6H 3O3EA 3RDTC 4OLUL 1FH5H 5CILL 1KCVL 1KULA 1RIUL 1T1XA 2JE8A 4NNXA 5GRWA 5HVGB 4OFDA 1TCRB 1QSFA 5E99L 2V5SA 5I1EL 5FGSA 5H94B 5MEQB 3AC0A 5FM5M 2MPAL 3HC3H 4V2BA 3B6SA 1S9WA 5GHWL 3QUXC 1HIML 4P23D 1ZHBB 3UTTD 4KKLC 2F74A 3MRIB 5DJDA 2WWKT 2QSQA 3MO1A 4M7JL 1FORH 3DGCR 2BHUA 3EW3B 5DD3L 4D2NA 2Z31D 4OZIE 1XZ0B 3F7RA 4ENED 2IPTL 2DM3A 15C8H 1YN7B 4V1DB 1K9TA 1U0QA 1TVBA 2GKIA 4YHLH 1MWAA 3EOBB 4IIQB 4W68A 1EA9C 1MFEL 5GS0H 5ENWA 4KDWA 1ZT1B 4WV1C 2YKLL 4NQCD 5HVWA 1EEYB 1CD1A 5LCVL 1FC2D 2XYCA 1LEKA 2M2DA 4PREA 4IM8A 4NN5C 5I1LB 1SYSA 3GMMA 4GW5A 4E9LA 2R4SH 3BGAA 4GKOA 3RBGA 4YUEH 1JHLH 1AR1D 3WS3A 3PWVB 2V5RA 4BSWA 4KROB 5DJ6B 3PG2A 4JY6B 4JN1L 4MA8L 5DJZA 3SO5A 3MOQA 4PTTB 5E7BA 1JNLL 3QXVA 5F88A 4WHTB 3GSRA 4DJMA 3UBXG 3VGBA 1KIRA 2FECL 1HEZB 2FO1A 1NAMH 1AIFB 3G6DH 5CEYA 1RZIB 4G7YL 3O2VL 2VH5L 4KHXL 3SKOA 4ZO8A 5I76B 4YK4C 4YFDB 4F37K 4OLVH 1T5XA 3LEVL 4O2FB 3VXUD 2X2YA 3C5ZA 1F4WL 3FONB 1LEIB 3DROA 2BDNH 4L8CB 3U2SB 4OD1H 1YECH 1A1OA 4KRMB 4HUXA 4OCMC 3PGCA 5C2BL 1AXTH 1OD7A 3HNVL 1CFNA 3MV01 5IQ7L 3QJFA 1X5FA 2G75B 4YFLF 5FDYA 5GRVL 3VGAB 1T03L 4P2QD 3NGBB 4WDIB 5MEOB 1A22B 3CXDH 2EDTA 1NGQL 1J11A 1S7QB 5IBTH 2XNAB 4IRSA 3E6HB 2XPGB 3HR5A 2N7BA 4XAKD 5CD3A 1P6AB 5C6TH 4JHAL 3JWDL 5IIEA 3ULSA 1A7NL 3SE8L 2D0HA 2H3NA 3WIIH 3WIHL 3QQ9D 1VKXA 3EOAB 4LARL 2BVTA 4UT6L 3PQYA 3HUJB 4MJ2A 2N7AA 2BSTA 5BS0B 4KHTL 4XNMB 4MNGB 3RNQB 3IDNA 3S36L 1GGBL 3T3PF 3BFOA 1KCRL 1UCTA 4Q7DA 2B1AH 1MVUB 3UZQA 4JPVL 2DKUA 4PFEA 4ODXA 2NY5L 1JZ8A 5JOEA 1HDMA 2D9CA 3LOWA 5TQ0L 1KN2L 5C07B 4OGYL 5HHOB 5KTEL 1D5XA 4OT1H 5EB9A 1PGRB 5IUSA 5JHDB 1ND0A 1WTGT 4HUNB 4RZCA 4WU5B 3IDGA 3MRQB 5GJTL 1CE6B 3VWKD 5EBMA 1ZGLA 4WTWA 5E2VL 3K2MC 1WK0A 4MS8C 1ERNA 1UACH 4R26L 1WJ3A 1FGVL 4PJEA 4JRXE 4L4VD 3DX7B 1YEIH 2VR5A 4Z6AT 4WWID 1DDHA 5HI4C 5ESVB 1TQBB 3O6FB 4Z78B 1F6AB 2X70A 2ZPKL 5JW4N 3DETC 4L5FH 2UZYB 2XXMB 4C4KT 2BNQB 1RUPL 3FN0H 5C0AA 1GZPA 2XFXA 3LQAH 4HT1L 4X4XB 3MXWL 3FO2A 3DRQA 2B4CC 3V0WL 1X5IA 2HFEA 2PCPB 5DMGC 5HHXL 4YX2L 3TN0B 3RVVC 4KK9D 4U1NB 4XPGH 1UH2A 4M5YL 4PJEE 2BVPA 4AK1A 4MCYB 5ID1B 1KGCD 2ZUTA 3VH8B 4YLQT 3SBWC 2YUVA 1MFNA 4XAWL 3I75B 1BFVL 4K8RH 5IKCA 3BKCH 1C7TA 4E41D 3LN4A 4KH2A 5JIHA 3QI9C 4E42A 1CFTA 4NO0D 1G7IB 3FQUB 4X6DB 2H1PH 2ATKA 3BQUC 2HT2C 3DMMC 3K8MA 2M26A 3S3PA 3VXPA 3EAKA 3U7WH 2HWZL 1QLRA 4R97B 1IGFH 3B3IB 2OR8A 1AHWB 5FYJL 2FLBT 2ZG2A 4LSVH 1JZ6A 3Q6FB 5A40E 4OZFG 4RNRA 4RGOL 1I8MA 1PKQB 1QO3B 5GQBA 3QPQC 5E9DE 1BOGB 4J6RH 3BZFA 3G6JA 5BJTB 5AWNL 4K71C 4NCDA 4U6XA 1UB6B 2VLKA 3EBAA 4Y4HA 1UWGH 3QFDA 1ED3B 5D96B 3SGDH 5KAQG 2CDGB 4FABL 3FN9A 3EDDA 2CR6A 3RIFF 4D9QD 1CL7I 2A0LC 4M4PA 2J6EA 2Z0BA 1IGJA 2G5BA 5GGQL 4P23B 1Z5LA 3UTTB 1A4KA 1B6UA 4GMTH 2AI0L 4Y16C 4ZO7A 1T1WA 2R15A 4PYHA 2Z31B 2X5PA 5DC9B 1ZVSB 5C86A 4Y88A 1ZTXH 1HXYB 2V2WA 2VLKE 4U3CA 3V5KA 4LPYA 2BX5A 5CKAA 1M6OB 3VXTA 3UTPD 1LE5B 1OCWL 5E03A 1N7MH 4AQOA 4BQ9A 2LTQB 2X4SB 3VFMA 5F6IC 1M7IA 4OJFH 5MI0C 1AXSB 1DEEA 1FJ1B 5L88L 3MA7A 2Y6SC 3RUGB 1XR9A 4JEGB 3LEXA 3A67H 4WEUD 3VD5A 4UI2A 3V7MA 4OFYD 4FQLL 2V2XB 4JCMA 4OCWL 1BQHA 4EI5C 4YEEA 2HLFD 3LKRA 1D9KC 3BW9B 3ISWA 3TVMC 1D3CA 3EKCA 4EBQL 1YJDC 2VLMD 4D3CH 2CLRA 5L2JB 1MLCA 5DVOA 5DJ0B 1MF2L 4P2OA 1HHKA 4PPTA 5TFSH 2PTTB 5C0RL 3JUZA 4R7DB 4M7KH 4PY8J 3IKCB 3M8OL 2GJ6E 1DVFC 5JDJA 1UENA 1Q0XL 1Q72H 3VXUB 4YBQC 1WFNA 5FK9A 2YD9A 3DX9B 3PL6C 1KEGH 4L9LA 5BQ7A 4CU6A 2AXGB 4RQQA 3ABZA 1X6NA 1VFUA 5JNYA 1R5IB 4HW6A 4GBXD 5FYKE 5F9OH 2DQEL 1A5FL 5F7DA 3FB7A 5GGRA 3SKNB 5DJ2B 3BO8A 4KKAD 3MUJA 4U1GB 2HTKD 2XY1A 3QEGL 3OB0H 3MRLA 4U6VL 2GSIB 4WWKD 1JWMB 4NSKA 3TC9A 1P7QB 4F7PB 1TTUA 4X6FB 2PO6D 3QNXB 1ORSB 1G7HA 1INDL 1Q8MA 2VRAA 2VXUL 2ICCA 4HPOL 2EDXA 1PBYA 3MRRA 4PJGB 3ARQA 4NKDA 3UC0H 4PB9L 4LCUB 3MGOA 1Q1JL 3KYNA 3V4PL 3STZB 1EVTC 3PWUA 1HKFA 5DJ8B 5M95B 5IWLC 4LSTL 2I27N 5EULV 2EEDA 4O9HL 4OTXL 5EBLA 4EKXA 1OW0A 4BH7B 2AV7A 3VXSE 2CXKA 5T3ZE 3E3QC 1NEUA 4YIQB 4MXWH 2OZ4H 2DQHH 1LDSA 3DSFL 3BZ4A 4P57A 3KLAA 4NO5B 3U1SH 5J1AB 4OLYL 1U3HD 3V5HA 5DJXB 1ZXQA 3VWKB 4WNQB 4N68A 1JZ3A 4XWOD 5T1MB 3D3VA 4ZUWA 5F9WC 2BVYA 3PHOA 4NZRL 1FNGA 3SGJC 5GS1C 2NPLX 2EDJA 3KR3H 1OP5K 5DQJA 3WIFA 3VWJC 3IETA 5IF0B 5BO1H 4OCXL 3WFDL 4L4VB 2VLRB 4YHKH 5F72S 5TPWH 1BVLB 4D9RE 5F8RC 2B8OT 4LSRH 4RGNE 1I9RH 1CT8A 1GPOL 3MA9L 4NQXA 5D1QA 2EEAA 2FR4A 2NNAB 3LPWA 3UZVB 3BN3B 1MI5A 4PTUB 4U0QB 3UTZB 4LCYA 3OJVC 5A2KH 4J4PA 3D3VE 1VENA 2EDBA 1I7ZB 3VH8G 5DS8B 4YDKH 4GW4B 3D48R 2DQCH 4KGLA 5JW3L 3LKPA 1B0RA 4HKBB 5HHNA 4Y1AD 4BELD 5IFJB 5J6HA 2Y9RT 3WS6C 2CR3A 4KY1L 2FBJL 5DK0B 4FQXD 5H35A 3MYJA 4ZFGH 1DJSA 3JV4A 5E8DL 1GAFL 5IROA 2AABL 4QT5A 4GW1A 5MP6H 3DX6A 4E41B 2P5WE 1S7RB 1AFVL 5L2KA 4KRNA 4NO0B 3BMVA 4R0LC 3DXAA 1UXSA 5LQBL 1FLTX 4YBLC 1RJZA 2DJ4A 4HXAH 4YNYB 1IKNA 1YMHB 2W1NA 3D0LA 3W0WA 3GHBL 2EKSB 1R3KA 2KH2B 4HWBH 4S1SL 5IEHA 4H88H 1B4JL 2LAGB 5BZDA 3HZVB 4WI3A 1J05B 4X7TA 3L9RB 2VXVH 3R1GL 3IGAA 3BKML 5MERB 3H0TA 3P73B 2OTWB 3HE6C 2JF1A 4ZS6D 5C09A 3CVHA 4AENA 3KS0H 4GUPB 5L2KE 3SKMB 1ADQH 1J0KA 1QR1B 3DXAE 4PJDB 4BK4A 1U8JB 4M7ZB 3OTTA 4LCCB 1T1ZB 2GAZB 4Z7UE 4W4OA 1CGVA 3AAZB 3TO2B 3W0WE 2HN7B 1LQSR 1FZOB 1V7ML 2AJZA 3FQNB 4RMVA 4MQTB 3NCYS 3PHQB 5SWQA 3RQ3A 5C2UB 1O7VA 2X1QA 3OKEA 4ONOA 4KVNL 2EIDA 3TA3D 1FO0L 4G8EB 3VG0H 3VFVB 2X4RA 3X13A 1N0XL 3BP7B 5C09E 3BWUC 1FDLL 3KPOA 3E2HC 2V2TA 4ODTH 4ZFFB 4OD3H 5CZXC 4EDXB 3BJ91 1NMCC 1HK6A 3WEXB 5I8CA 5JOFB 3ULVD 3ULUE 5BMFH 2OL3L 3K8KA 4GKZA 1WBYA 3P30L 4MVBD 4XNUL 3WXVH 5A2FA 1A6TB 5DD1H 3JTSB 3FJTA 4JFDD 3CUPA 5HVHC 1X5KA 1YNLL 4Z9KB 1KPUA 1JRHI 1UJTA 5D6CB 4K3JL 1FFRA 1E4KA 2IAMA 5DUBB 5EN2B 3I6LD 4NBYB 3W11C 1ZEAL 1J1XL 2R2HA 1QFWI 1YEEH 3ZTJH 3WFEL 1HHJB 3RNKA 1FH5L 1BLNB 1QQDB 2ADJA 4NQEE 5HHQA 4G6AC 1DLFH 4BFIA 3F7YB 3T2PA 1KB9J 4EOWH 1S7UA 4G80A 2QQLH 4Y19D 3LB6C 4JFOA 1EMTL 4C59B 2IF7A 3IU4L 4P46B 3BJLA 3NACH 3REWB 2AJVL 4UNUA 4ZDHB 3SOBH 1FGNH 1TQCB 3HLAA 5DD6A 4HGKC 4GBXB 1FE8H 2HMIC 3RGVD 1MCKA 4H5SA 3EO9H 3AFLA 3TH2T 4HG4J 2QQQA 2EICA 1OPGH 4S1QH 15C8L 1H0DA 4WWKB 1A3LH 1HHGA 1Y18B 3EIFA 1R3JA 1XR8B 2CIKB 2PO6B 1UEYA 5C8JB 2XTJC 2NXZD 1CXHA 4GRWB 4PRNB 4ELME 3KXFA 5ELIA 1YEHH 2GSGA 4JVPA 4R2GD 4AG4H 4OLWH 4QHLB 3LQMA 3NFNB 3NPSB 1H5BB 2Q7YB 4LCIH 4KK8D 5TGBA 2DM7A 4AEHL 3ARXA 3QXTA 4FG6D 2VOTA 3ZDXF 2X9WA 4LLMB 4YUEL 1JGDB 4LOUC 3BIKB 2DLIA 1Y6NR 2I07B 1QVOA 1MEXH 3HAEA 4NO3A 1RMFH 2BJMH 4POYA 4MLIA 2C1OB 5HGAA 3ILPA 4U0RC 4MA3B 3WHXA 3MUGB 1U3HB 4LLYA 4QOKE 4MQ7B 3PV6A 2R9HD 4JFXA 3GIZH 4JY4A 3OBAA 5C70A 1SMAA 2DQFB 3G6DL 4KRLB 1IAOB 3TBWB 1RZGB 3EJZD 4PJ8D 3ZKND 4G7VL 3F7QA 5DVNA 2FX8H 4OLVL 3BISA 2R0WH 4LEXH 4ZXBD 1DN0A 1LO0L 3T0WA 5IR1B 1DUYA 4OZIF 4OD1L 5I71B 1U8HA 4IBLT 3CZFA 2FX9H 1F4YL 4MXVE 3U0WH 5C0FA 1NUDA 4IDJL 3RVTC 1Q0YH 4RWYH 2OSLA 4XC1L 1S9YA 2DQGL 2ZG3A 3GSVB 1UWXH 4TULH 3DYPA 1B0GA 2XRAH 4OKVB 1D6VH 3ZTNH 3LKOA 3WO3B 3UPRA 3U82B 2NY1C 3QUXB 1RIHH 3MLWH 4PJXF 4X0KB 5C6TL 4A2MA 1N2RA 4HEME 3WIIL 4Y1AB 5E94B 3C5ZC 3A6BL 4FQXB 5E5MA