3UBXG

Crystal structure of the mouse cd1d-c20:2-agalcer-l363 mab fab complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVRISCKASGYSFTNYGMHWVKQAPGKGLKWVGWINTYTGEPTYADDFKGRFAFSLETSASTAYLEINNLKNEDMATYLCASAAGIRWAWFAWWGQGTLVTVSAAKTTAPSVYPLAPVCGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural basis for the recognition of C20:2-alpha GalCer by the invariant natural killer T cell receptor-like antibody L363.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 221
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ubxG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ubxG02
1WFOA 4FQQA 2YS4A 1A4JB 3FONA 3GB7B 1P4LB 4ZS6C 2BNRE 5E99H 1FYTA 3ZKQD 3RZCA 4YE4H 3HE7C 4YQXL 1NGXA 5IBLD 3OKLB 5FYJL 4IJ3C 4Z8FH 4DOHB 1S9KC 2AEIT 4JM4L 2VMFA 2Y5TA 2GSIA 4K3GA 1T1ZA 1G0XA 4X6CA 3L6FA 3X3FH 1ADQH 4PJ8B 4J4PD 3T77A 1EUTA 2YUVA 4S1DC 1ETZA 4ERSL 4M62H 3RUGE 5TF0A 5CLWA 2WP3O 4JRWA 1MHCB 4P23A 4DGYH 3IF1B 2FH6A 3BAEL 3QDMA 1OSPL 3U7YL 4XAWL 4AZ8A 3WUWB 3S34L 5C8JB 4EN3D 4R90H 1QFWL 4O5LL 2XKUA 3OKOB 1IT9H 1GGUA 2X7LB 1E4JA 3N1QC 3C60C 3MLUL 5DD0L 4CNIB 1JUFA 1MI5D 3KPNA 1P2CA 4LLMA 4Y5YB 5F9WC 1TVBB 3VXQB 1P5UA 1T0MA 4XWOD 5HHMD 1Z5LB 3PJSA 3OHXB 4J12A 2N7AA 3MGAA 1EBAA 4PTTB 3BKML 4KUCF 4QKXB 1ZSDA 5IHZA 4BZ2L 2LQRA 3K2UL 3ARYA 3VGAB 2J8UB 5IKCB 5C07D 1Q9KA 2EDJA 2JELL 4Y19B 3BP7B 1MFBL 1CCZA 4FFWC 5D2NC 1QRKA 1AIFA 1FVEA 3GMNB 4NIKB 1F6LL 2C1PB 3C5JA 5J89A 2OXHA 1NFDE 4NRYB 2P43B 3UTOA 3MA7B 2PCPA 4S11A 4YNYB 5CP7A 3EOTL 1I7ZA 3BPCB 3VFOA 2PW2B 3HE7D 4HKBB 4ZFFB 1I1FA 3U0TA 1NH6A 1V05A 3JZ7A 3WFZA 1S7XB 1PVHA 3S35L 4LLQA 1UWEL 2R1XA 3FMGL 4YAQB 4Y4KB 1B4JL 4FXGA 5HYSA 1TZHA 3PDGA 4KKLD 4S0TD 4CVZB 1WLHA 3CSYA 3HPJB 4D0DA 1J1PL 4HEME 2H2PD 2IPUK 2X70B 4XB8A 3UTTD 3QISA 3W9EA 4ZYKA 3QUMB 3BQUB 4G6KL 1GZPB 4TTDD 3NPSC 4NKDA 4MMZC 1FIGH 5F7EL 2A83B 1KNOB 4KI5D 4TN9A 12E8L 2IAMB 2W0FA 2C3WA 4KKBD 1XGYH 4D9QE 5DJYB 3O3EA 5A40E 1A14L 4UILH 4LP4A 2R23B 5JR1L 2BY0A 4NJ9H 1OP3K 2J5LB 1II4E 3BN3B 4PJFF 2AEWA 4YHIB 4DGIL 1BFSA 4OLEA 4M6OL 4QHUA 4CAGA 1CYGA 5EZLB 1A7OL 2EDKA 2YA1A 5SWQA 4CN1A 4LASL 2XFXA 2RCSL 1S78D 4OIIL 5DC9B 2F5AL 1JGLH 5AG9A 5JOFB 1YNLH 3ZDZE 1EO7A 4YJZL 3QXDA 2HVKA 3ZTJH 1M71A 5BO1H 2N1KA 2GT9B 1RJZB 2NZ9C 3CVHL 4Y2DD 5FKAA 3CVHA 1HSBA 4RISH 3MROA 3VXTA 4HWNA 3RP1A 1T6VN 1OTTC 1AR2A 3MJ8A 4OZ4B 3RIAK 4YXLH 4FTVE 5HVHB 4GS7B 4Z7UB 4QXTA 5SWZA 3SDDC 3BP5A 4M8QA 1JZ2A 1Q0XH 4KROD 4A2LA 1D5ZA 2FZ3B 5AYQA 1GHFL 1N0LA 3GMPA 2P42B 3MXWH 4AJ0A 1OP9A 4PD4J 4RIRB 5JTWA 5L6YL 1U8MB 2D7PA 2E3VA 3UBXA 1EK3A 3QAZC 1S7VA 1KPUB 2QHLA 4R96B 3TT3H 5M95B 1C8PA 1N8ZA 2AP2A 43CAB 1T04B 1UACL 3TA3A 3UO1H 3TF7C 3V6ZB 1NMAH 3NCFB 4K55A 3EDFA 1YN6A 4LEXL 3M1BB 3TESA 5IW3A 4G3YL 4PLJC 1U8NB 4M7JH 1DN2A 3KHOA 1U8HB 1JHLL 3QUXA 3A6BL 4PRDA 1CLCA 4ORGA 1VACB 2XKNB 1F3JA 1GJIA 5GHWH 1DE4A 1E6OL 4F2MB 3L3JB 5ADPL 1L0QA 3IKCB 1MWAB 5HHQA 4GRLB 1ZANH 3MRHB 4CVXA 2I5YH 1KENH 3P4NA 3WIFB 3WKNA 5FGCB 1NBZB 3T0XA 3LQAH 3GO1L 2D7NA 5SWSB 2FEEL 2X6MA 4PJ9A 4ZO8A 4UBDC 4MDIB 5IVXE 3CGTA 3Q0HA 3JWDH 4TUKL 5IB1B 5B39B 3IJSB 3MNVA 5GS0C 1PX3A 3QO0A 5AYUH 1LP9A 5DUPH 2NZ9D 5DRWA 1XR8B 2ZUXA 2NR6D 3EYUL 5ACZB 4GG6E 5C1MB 2X9XA 5CWSA 1YMMA 1QFUH 3CMGA 5DMKB 1FC1A 4NO2B 3RUGF 1RUKL 1JGVH 3LKOA 4WHTA 3STZA 1WCBA 5HPOA 3MZGB 5FK9B 2AXFB 5TQ2L 1E6JL 3GSXB 3HRPA 4LQFL 1RZJL 3GHBH 4GBXC 4O02H 3V8OA 1CFSB 4FQ2H 3LIZL 4JAMA 4FFZL 4OLXL 1INEH 5GRJH 5DMGC 3ULUH 3BP4B 3QIBC 3RHWK 1VFBB 3LN9A 2QBWA 4H0HB 3O4LE 5IEHB 4AIZA 4PV8B 4JZNA 3VXOB 5GGQL 3OKKB 3DROB 4OZGE 2CO6B 1BFVH 1UH4A 3LEXA 1ONQA 5FAAA 3AS3A 2Q7YA 2JJTA 4M43H 4RGOL 5DQDL 1QLEL 4PLJD 5E5UB 4P5TB 2PO6D 2XACC 4PUBL 5IHLB 5E5MB 2FO4A 2X1PA 4PJ5B 2RQ8A 3MLYH 4N0CC 1VFAB 1A6TA 4KAQL 1MCWM 2DMBA 5DHYB 2MQCA 2B2XH 3DIFA 3BMVA 1JNLH 5HTSA 1MRDH 2XWTA 1MFNA 5TF1L 5SV4A 3M8OL 2AQ3A 4HCRA 5ITBL 1KCVH 9CGTA 3HC0A 4MNGA 4NQDA 4WW2C 3CZJA 1NFDF 4DQOL 3G5VB 3O4OB 3DV6A 4N0UA 4PRPD 4YDKH 2V7NB 4RDQG 1MCWW 3RGVA 1LO2L 1SJEA 2R29L 5JMRA 2WINB 1JWMB 2VISB 5TE4L 4LCYB 4FABL 3DLQR 4DKFH 5CJOH 2WSKA 3QIWC 4NPYB 3AS1A 3CFEB 5D1XB 1AO7D 1N59B 3EZ8A 1I9RL 1U93B 2Q3ZA 1QA9A 4X4YA 3L5XH 4XT1C 4S1SH 1EHNA 1CGSL 4MA8H 2VUOA 3QXAB 4M5ZL 2X4SA 5FO8A 4BK4A 2I9LB 4F7TB 1IEAA 4I5BA 2Y25A 4YEFA 5DURD 3I9GL 4PR5B 4WO4C 1A7BA 1IQWH 3SHSA 4L4VA 5CBAA 5IUSA 1A7PL 2A74A 3A67L 4MGXA 2D7TH 2DLEA 3SPVB 4Y4HD 5DMGD 5LGJA 4K94H 1ZVHA 5D7LD 3W0WE 1NMCB 3DRTB 4WI6A 4XVJL 1SHMA 3ZDXE 3CXHJ 3MCLH 3WS6C 4FP8H 5L0QC 4R0LC 5E8DH 1Q9OB 3LMJH 5E9DE 5HHOA 2I9TB 2NY1C 3ECBB 1KSRA 5F7DB 4L4TA 2FECL 2I26N 1VGEH 2DM7A 5J4MA 1A6WL 1BVKB 4R7NA 2ZOKA 3V4PH 3C5ZD 1OQOA 1YPZB 2JIXA 1L0XA 4U6XA 4X99A 4ZQKB 1FAIH 1BQHA 4M3JA 5JLZA 1GGTA 4PJFA 2NYYD 3ZDZF 1DL7H 3S96B 3ZHKA 2FEDC 4LHUG 3DXAD 3MRJA 2R4RH 4I2XA 4HZLA 1UB6B 2A6KA 1YN7A 1P84J 4MQXC 4G6ML 4JGUA 1OAYH 3SGDI 1K6QH 5E94B 3T0EA 5C92A 5DRNA 1UM6L 5HHVH 5TH2B 1RSFA 1WEJL 4TULL 2NPLX 2XA8H 3Q2CA 2R4SL 4XH2B 2RHEA 4DOHE 1P7QB 4QTIL 1B3JA 1GC1H 2YD4A 2A9ML 3BRFA 1CU4L 1FV1B 2R9HC 2X44D 3N50A 3SGJC 3VXPB 3NGBC 2XY2A 1V8HA 1XF5A 3DVGA 1QBML 4UI2A 4WO4D 3SKUD 1AFVH 3VXRB 4RZCB 3SQOL 3RVXD 5BVPL 4K8RL 3JTSA 3QDHA 1JRHH 3CCHB 4FXKA 3AU1A 4OF7A 2Y36H 3TBYB 2ICWB 4FQLL 1PG7W 5F89A 1EMTL 4GRWB 5F1IB 3VFRB 3TJHC 1C08B 1H9VA 5ESQB 3FFDB 3OKNA 3MV8D 2JTDA 4UU9A 3RWGB 3FT3A 4MMXC 1JTOA 1BIIB 1OVZA 1ZVSA 3L3IA 5CHNB 2IWGA 5E1HB 1RMFL 3ARQA 3MUGB 4FZEL 2CKBH 1N64H 1NJ9A 1U95A 2OK0H 4MQTB 2HG5A 4F8QA 2H6PB 2MHAB 2GITA 4XBPA 4HFUH 2DIBA 1VESA 4QRRB 3U36B 2HA1A 5E1AA 3RA7H 3MFFA 4XVTH 3UMTA 1MAMH 2G2RA 4RMSA 5IVXF 4I77L 3EO0B 2J8UE 1OD7A 3OBAA 5CP3A 2IBZX 3VFUB 1UXWB 1T89C 5FHAL 1I1AB 4Y19E 1IAIL 2BNRA 2FIRT 2OL3B 4LLUA 4GG6F 5L8KB 1FDLL 2EEDA 3T3PF 5SX4I 1A5FL 4OGAD 2R15A 2HFFA 5ALBH 1U3HA 5GGSY 1SEBB 4HS8H 4RMRA 3S4SG 4NQVB 5C0RH 1RIVH 5DUMH 5EZOL 3NZ8B 3RUGA 4QRPD 3BIAX 3VW3H 4JY4A 1FFOA 1HHKA 2WWKT 5C0IB 5EBMA 1G0DA 3M17A 3TV3H 5BV7B 3UPAA 1ZHNB 1DVFC 1MRFH 1XZ0A 3IKKA 4LL9A 2GCYA 5DQJB 5DC0A 2O5XL 4L9DA 2MMXA 3IDXH 1YEDB 3MRRA 4OZGF 3DGGA 1UCTA 1W0VB 4Q6IB 1UXSB 3QUYA 1BD2D 1WBZA 4LSVL 4APQC 3T8XA 1A6UL 4OLYH 3RDTC 5IEKA 1S7RB 2P5WD 4MAUL 1IZJA 5IMMA 4HUKB 4GKNB 3GMOB 3JWOL 3PWJA 5CD5C 4BKLA 2QKIA 3U0PB 2D3VA 1C7SA 5DK2A 5DD6B 5HGBB 1A3LL 3EFFA 4M61B 5C0EA 4ZXBB 2NX5B 4CVUA 1ZA6A 3RTQA 3HE6B 4OM1H 4Z95L 3D6GA 4UDUA 3BXNA 4NZUL 2DAVA 3LKSB 4LPYA 1Q0YL 3UTSA 2CDEB 5T1DH 3L7FA 1M05A 4M6MH 4O58L 3HNVL 5AAWA 4JKPL 4LMQI 1VGKB 2QSTA 2VZSA 1NFDA 3QUKA 4JPWH 4YDIH 2AJXL 3F5WA 1JI2A 4V2BA 4UT7L 3V2AR 1IAKA 1VKXA 4HF5L 4OCWL 3BGMA 4XPBL 4DKAA 1NAMB 3U7AA 1ZWIA 2G5RA 2PW1B 4QRSB 4P99A 3L95B 5D1QC 1PEWA 3T4YB 2N7BA 4Z7UE 2D2OA 3HPLB 4JFEB 5LGHH 4EI6A 2OR9H 1RFDH 1SBSL 3CH8A 1CFNB 3GK8H 1PAMA 5T1MA 5L2JB 3WIIL 1H8OA 2HFGL 1RPQA 4OSUL 2FL5A 3ZDXF 4H8WC 4LDOB 3RVTC 1TJGH 1RU9H 3PHSA 2AW2A 4DAGH 2W59A 3F7YB 3ZTJG 2OI9B 2FJHB 3KPRA 3DPBA 1WIPA 2G9HA 4OGXH 2VOTA 4NO5B 1T20B 1DQJB 1F11B 3RDTD 3BWAB 1GPOH 5FM4A 1M7IB 5GRXG 1H0DB 4XXCC 5TPWH 3TBTB 3SE8L 1KN4L 4NRZB 5CD5D 3B9KD 4NN7C 2IPTL 1FNSL 4IHOA 3BVNB 1Q1JH 4P4KB 4AEEA 3KYNB 1L0YA 1Y0LB 4O2CA 4A6YB 3O81A 1H3WM 1F02I 2FX7L 2XXMB 1FVDA 1G7LB 5FGCE 4PLKC 1EFXB 2YN3A 2DICA 4XBEH 4O00A 2NXZB 1K4CA 1S7QA 2M26A 4NRXA 1M7DA 2X89D 1CD1B 3H7BA 2O61B 2PYEA 1CVSC 2ADJA 5C70A 4GSDL 3KPOB 1I8MA 4JO3H 3WSQH 5LKNA 4FTVA 1KG0B 1O7SA 3TVMD 43C9A 1CXIA 3FAWA 2DQDL 4X6FA 3RNKA 4QRQA 4F7PA 3O6LL 3WMSA 4YDJA 3UEZA 2L7JA 1FP5A 2HWZL 1X5LA 3QQ3B 3H3BC 2HT2C 2LFGA 1MHPL 3KDMB 4FQXC 1DN0A 3WL9B 4BH7A 5DRXB 1OF2A 1DCLA 2D9QB 3SCMA 1I4FA 2V5MA 3U9UB 4S1RH 3RVTD 1FORH 4NDMA 1S7TB 3FO1A 1N6QH 1RD6A 4ONHA 4FG6D 3SBWA 2VDKL 4G7YH 2Z31B 2HFTA 3TCXA 2JJWA 1RI8A 4HUXA 2Z35B 3ARSA 4YHZL 2P8PA 4GUPB 5I73B 3LQMA 3WD5H 4G8FA 3FN3A 3TM6A 4NQCD 2H3NA 2NY7H 4POZD 2IG2L 2J8UF 4PJ5E 3WN5A 2Y06H 1W0WB 5GISH 4NO0B 3EJYC 2QL1A 1J0HA 2ESVA 3NPZB 4WVRA 3ARVA 4U33A 1YEGH 3VFSB 4EDXA 1LEGA 5DA4A 3MLZH 5IVXA 1NFIA 2CLVB 4TTGA 1A0QL 3VI4E 4HMEA 5C0FB 1YUHA 5F1NB 1FVCB 1P4IH 2ZKHH 2IANE 4KRPD 3OAUH 2DYPA 1LO4L 5C86A 4IRJA 5HYJD 4BJLA 4X6DB 4GG6A 1PZ5A 3L3DB 4F37K 5EIIB 4BUGA 1RJYB 4DK6A 1ED3B 4HX1A 3AREC 5BRZD 2ZPKL 4LSTH 1EXUA 2B5IC 1WBXA 3G5ZB 2DLFH 2EYSA 1HHJA 2DLIA 2VR9A 1EHLH 4KTDH 4MCZA 1HWGB 2EDLA 3Q48A 4G8IB 3QUZB 3TN0A 4NGHL 2HT2D 3CDGB 4I3GA 1TPXC 4X7CC 4OZFA 1JGUH 3D0LB 5TQ0H 4EN3B 2OTWB 4P2OD 3DX6B 4IRSC 3WKML 5CIPH 4JREB 5D2LB 4G8GD 4OZGA 3K80A 5C0DB 1RIUH 3SKMA 2ED8A 1MF2L 4IOFC 5E2TL 3S5LA 5HDOA 1DBML 4Y88A 1MI5B 5GGTH 4IIQB 4JFOB 2ED9A 4G5ZH 1KIRB 4HWEH 4J3WA 3QO1B 3H7LA 1NCDH 3MR9A 5HHMB 1TTFA 3H2WA 2HVJA 2E27L 2HLAA 1ADQL 4ZTPH 2AABL 1YPZE 4WTZA 1T1XB 3OKMA 3L9RB 4S2SA 2C9AA 1NCBH 2UV3A 1MCEA 1AR1D 2WQRA 1INDH 5IOPB 5ID0B 1KB5B 5C07B 4JHZA 3E2HB 4K7FB 4LSQL 4LCUA 3O41B 2CIKA 2NY0C 2VLRE 1NDGA 5D1ZD 1WQVT 4OGYH 2VH5L 5F9OH 4AG4L 5HSFA 1TJIL 4F9LA 3VRJA 2EIZB 1B0WA 2HTLD 2P7TB 3SE3A 3BGFB 3THMH 5DHVH 3NA9H 4M93B 4LLVA 2V5SA 4PGDB 4UINL 1FBIH 1TXKA 5GPRA 3MUY1 4QTHA 1ZLSL 1OT2A 4KK9D 5FOBA 4NYLB 2BHZA 3D2UA 4LHUB 5E7BA 2BVOA 3OB0K 1M6OB 3GMRA 4D0BB 3VXRE 5DVLA 4ENEC 5C9JA 3ZE1E 1JMXA 4X9FA 4NQXB 3FO0L 4EUPA 3P4MB 4H25B 3NFNB 5BQ7B 2CLZB 5K9QI 4GRWE 3EHBD 3HLAA 1EX0A 5CMAA 1QBLH 3STLB 4LGRB 3FZUD 4WUUB 1WC7A 1R5VB 5IROA 5C08B 3C09B 4PJXB 1IFHH 3GBML 4ODWA 4P2QD 1YY8B 3ET9F 4QRRE 3ULVH 2H41A 5GGVH 3HNSL 5HGAA 2VC2L 5EBLB 4GKOA 3SDCC 1SEQH 2DF3A 2ADFL 2Z8WC 5CSGA 2BRRH 3O6ML 1BPVA 4JJ5B 3ZL4H 3FJTA 1MCIA 2OP4H 2APWA 4Y2DB 2O5ZL 1A4JA 3PDOA 1HEZB 3GB7A 1P4LA 4CJ1A 4HIEB 3F7VA 3VXNB 1A1MB 2P1YA 2V2XB 1E4WL 2HJFB 1FG2A 3JXAA 1UZ6E 1XMWA 5E4EB 3BUYA 4P23C 3CLEH 5DJCB 4KROB 1PKQB 2XNAB 3H9YA 1HIMH 2R2HA 5H94B 3VMPA 4WU7B 5BS0D 1QYGH 4TSAH 1N26A 1MHCA 3GI9H 3QI9D 2UUDH 2VXTH 2M8XA 3MNZB 5BXFB 1ZHKA 1AH1A 3UCRA 3BD5A 5C2BH 3MLVL 1NLDH 1NCCH 1A1OB 3PF2A 1S7UA 2X7LA 4PRNB 5KZCD 1CDHA 1F4XH 1DEDA 2W0PA 1MIMH 3K0WA 1H3XA 2XZCH 3OGCB 5HI4D 5C6TH 1T1YA 5GSVB 2N4IA 2YPLD 4LSPH 3MXVH 4V1DB 3QB7C 5CGTA 4X7SL 3S4SB 3OHXA 5IMLB 2F8OA 4MQ7A 1F4AA 3QNXB 3WFDL 2VDRL 5IESL 5F9JB 5BVJB 4ODXA 3VI4F 2J8UA 3BN9C 5DK3A 2NX5E 2BVPB 2EE6A 2G75B 4PIRF 5FECA 3HC4H 5IKCA 1U36A 3MCG1 2DI7A 1X5YA 3OPZH 3SDCD 1PDKA 1CDGA 3BP7A 1LO0H 1S5HB 3FN9A 3TT3L 3LN5B 2XZAH 2J88H 4MS8C 5C3TA 2BK8A 5DD1L 1JTPA 1XR9B 4X6EB 1WFTA 4R97C 1B0RB 4M1DL 4NRYA 4P2RD 1DQLL 3MA7A 3TZVD 4YNYA 1JNNH 4WEBL 2IF7A 2PW2A 1Z0MA 4XPTL 1ULVA 4YPGA 1S7XA 3HR6A 5IB2B 3PWNB 4GMSL 4PRAB 1JNHA 2NY5H 3SOBL 4KQ4L 1AGDB 3QEGL 5GJSL 4CVZA 4QRUB 3HPJA 4JPIA 1UH3A 4JFEE 2MWCA 3QEQD 2ZJSL 5DMIL 5IVZB 2X70A 1OAQH 3QUML 2CH8A 3QUMA 1LE5A 3VFPB 1R5WA 4XNUH 3P9MA 5F70A 1G7HA 1R3IL 1MJJB 3G6AB 3PXJA 2ZUYA 4UV7H 2IAMA 3MGTB 5AYUL 1AE6H 1QUNA 5K9JL 4HIXH 5DJYA 1X5XA 4X8XA 4XMKH 5ISZD 3O9WD 2DI9A 1SJHB 3DBXA 2C1OB 4LRNH 3EOBA 3T2OA 5HI3C 2PO6B 2QSQA 5F72S 2RGSA 4YHIA 2DLGA 2C3VB 5GSRB 2ORBL 2DMKA 2F53E 5EZLA 4HG4K 3BW9A 2IH3B 1U91B 5I8EA 1F58H 4JG0L 3JV4A 3SDAD 2PXYD 2BJMH 3VI3E 3MODL 1I1YA 4ALAL 1QSFA 2GT9A 4PRPB 2W07A 4JFHE 4KKCD 3DNKA 2YSSA 4GAFB 4OZ4A 1XFPA 1AO7B 4OJFH 5ITFB 2DLHA 3W2DL 1KLFA 1T1WB 2D0FA 2FX8L 4YR6B 3CXDL 2WNGA 4ZUUA 2MQ0A 4IDJL 1ORSB 5BOZG 3KXFD 3B3IB 1C1EH 4Y1AD 3S36X 1KF9B 3RVUD 4JPVL 5MHSE 3GMLA 5DURB 4RIRA 3TA3C 3AAZB 5JQHC 1QPPA 1U8MA 4ODVH 2VAAB 3MBXL 3ZE1F 2GW5A 2MCPH 3WXWH 1L7IL 4QY8B 5J1AB 1KPUA 2HKHL 4Y4HB 1JGDB 5DFVC 3Q1SL 5F3BB 1T04A 5D7LB 5MEQA 3QUXC 5SX5K 3V6ZA 1JNJA 4BELD 3RWCB 1G9NC 5I1HH 1KEMH 3TT1H 3CH1B 1U8HA 4PBVC 3I50H 4NJAH 4J3TA 3U7WH 3C5ZB 3WHE1 2XKNA 2ZUVA 3TP4A 2EH8H 5HBBA 3IKCA 2BNQD 4PJ9C 1IGFL 4PV9B 4N5UA 4G8EB 3MRHA 3QDGB 4EQ2A 1ZTXL 4ZUSB 2NY6C 1DBKL 2AJSL 5F96H 2FSEB 1HK6A 4EI5B 1J87A 5D6CA 1ZLWK 1LWRA 4L5FL 5B39A 5IG7A 3MO1B 4ZODA 1KV3A 1RK0B 1UZ6F 2ENYA 1XR8A 3C08L 5FUCE 2DBLH 1CWVA 4X6DE 4LCIH 4Y5VB 5E8EA 5EOCH 2YWYA 4MXVE 4UUJB 4NO2A 5J56B 1EO5A 3RPKA 2QSCL 4ZG1A 2AXFA 5I1GL 3ABZA 3GSXA 4XXDB 3HG1B 5JW5B 4KJPC 1CFSA 3HI6H 4HT1H 1DUZB 3VXUD 3RWFB 3VE0B 1KTDA 1DQTA 2OMBA 3BP4A 2PETA 4LBEB 2Z91B 1XCTB 5EPMB 1HQRB 1FH5H 1RULH 4PGZA 3WIHL 3WIHA 5JOEA 4QXUL 5HY9A 3MOBL 4YC2B 3ARDD 2SEBA 1OP3H 1RZKH 4KDWA 4H0GA 3QFDB 3VXOA 3K8MA 3OKKA 4LOUD 5T3ZH 5DC4B 1CLZL 1ZEAL 3DROA 2A73B 1U42A 2IFGA 3B8SA 3MV8B 4MVBC 4QCIA 5MERB 2ATPA 4F7EB 1MLBA 1BQLH 4YX2H 1MI5E 1TENA 1WFUA 4P5TA 4KGLA 5E5MA 1F8TL 4PJ5A 1BBDH 2QQNH 2PKDA 1VFAA 2FEEI 4O51A 1FGVH 5HHME 3NCYP 2WM0A 3OXSA 4U1LB 2OCFD 3Q5YA 5IMOB 5C0AA 4KZDH 4OLUL 2BDNL 5GRVL 3NCBB 4JR9L 1P4BL 3RGVC 2W9DH 3QFJD 2IANA 1OARH 2FHFA 2Q8AL 2NY6D 5I1IL 5C07E 1FFPB 3IDNB 1TQCB 2YD8A 4AENB 1KBGL 1JYNA 3OZ9H 1CLOL 3ARBB 1J1OH 2XICA 1DBJL 1JWMA 2VISA 3BE1H 4TNWK 2CMRH 1ITBB 1S9XB 1TETH 1RHFA 5CAYB 5D1XA 1N59A 1U93A 1P69B 1RZGB 4NNXB 4D0CA 2HJKB 2BCKB 3MTRA 4X4XB 1LD9B 3ZYJA 4I3RL 2I9LA 3E8UL 4QRPB 2F8XC 3ULSA 5B8CB 3CFBB 2D7QA 4PR5A 1YMHA 4KJPD 1FL6B 1QLFA 3EJJX 5EN2A 4J3OC 4KKNA 4KVNL 2NNAB 3UTTE 1AHWB 4ONFH 4M4RA 3R0MA 1V5JA 3BZ4B 3QG7L 4AEFA 3DRTA 1BD2B 2QR0A 5FA4A 3P2TA 1Q9OA 2I9TA 2P5WB 1J7VR 3ECBA 4KI5E 4D3CL 2E5EA 2X40A 5EBWB 5J3HC 1KCSH 2A0LC 1BVKA 4NC1C 5CJBA 2F8VA 3NFSH 3ES6B 1RIVL 2FGWL 4JFQB 5DUML 2W0LA 4ZQKA 1YECL 4PJGB 4OLWH 3UYRH 3Q6FB 4Z7WE 3OJMB 1PBYA 1QSEB 3S96A 4JHWL 2QQKL 3U1SL 1T7XA 4PJXE 1G7JA 2BC4B 1XGTA 3MRGB 2VLRA 1YJDL 2GFBA 3T0EC 3V5DB 4NUJB 1U8PA 3PHQB 4O2EB 4OLVH 3P11H 1TIUA 1X7QB 2YWZA 3BDYL 5E94A 3GMMB 2OX5A 1IKNC 5TH2A 3QCTH 4WI4A 3TGXA 2B4CC 3O6KL 2IMMA 4P46D 4XX1G 4EDWL 5I19L 5JORB 2UWEB 3WNNA 4RMTA 3JVGA 2BP3A 4LPUA 1FV1A 1K2DB 1PKQE 1X5FA 4QHNA 5FYLH 1HYSC 1KC5L 4OV5B 3WS3B 1FSKC 3BO8B 1DQQA 5IJKC 3BDBA 3VXRA 3SGKA 5HXMA 1HKLL 4RZCA 5E6ID 3DX7B 1IAOA 1QOKA 2FECI 2OJZL 4TQEL 2ICWA 1SVZA 1MY7A 2IBBA 5F1IA 3VFRA 4JPWL 4OTXH 5ESQA 3FFDA 3O8XD 2WZPD 3RL1A 3F8UB 1A9BB 3BH9B 3RDTB 3QPXH 5EUOB 3GJFB 2P5ED 3O0RL 1CFBA 4K3JH 5CHNA 3GMQB 1U2CA 2AJYH 3MRCA 3HR5B 2WUCL 4M1CC 2H6PA 2MHAA 3B9KB 4V1DE 4QRRA 1EO8L 3DETC 4UNTA 2CKBB 2I07B 3K4ZA 3MRKB 2EIDA 1H5BA 3LD8B 1T21B 1HE7A 2AV7A 1HXYB 1BF2A 4M48H 3GGWB 3VFUA 4GW5B 3GSUB 3DSFL 1I1AA 2WBJC 1BAFL 4K2UL 1G1YA 3S3SA 3W9DB 1IGCH 4O4YH 4X6DF 5AAMA 3GSNL 3VFMB 3GSNA 4MXVF 4NWTH 3ZTNL 1YQVL 3REWB 2PR4L 2EE3A 5DGRA 3TVMB 2WAHA 1YEFH 3VFVB 1UH2A 4AQ1B 2E9IA 3FOMA 4NQVA 2HT3C 4Z7QE 4I0PC 4JDZB 4XPGH 4XGZB 1JP5A 4MNHB 3WLBB 3N1GC 5DMJB 4LLDB 3QIUD 3ME0A 4LSSL 2DMCA 1ZHNA 1WT5A 4QO1A 5LXGL 4JO2L 5HPMB 2XY1A 2ZOLB 1J1XH 5CCKH 2WIIA 4UAOC 1YEDA 4MYWB 5D8JL 4LHQB 2VSCA 1W0VA 2GQHA 3JWOC 4RDQF 3MLRH 3IFNH 4N8CL 3SGEH 1S7RA 4Y4FD 2CUMA 1DSFH 2F19L 2AGJH 3OX8B 3MLTB 1BOGA 1PG7L 1AD9A 3CNKA 3U0PA 2NY2D 2R56H 3DTXB 1PQZB 5F7KC 5DD6A 5HGBA 4KTEL 4WWKD 4HK0B 4ZXBA 2NX5A 3ZT7A 4NO3B 3C9NB 5DJ8A 4L29A 3HE6A 4MA7L 3C6LD 5EG6C 2WV3A 1FNHA 3EAKA 1IAII 4PJHB 5J9PB 4BZ1H 4OFDA 4FFVD 1A22B 4J6RL 4HHAA 2CDEA 3ARUA 4URTB 5JW4Q 4U7KA 1EPFA 5JO5B 1XF3B 5F7NC 4ZUVB 1G7MB 1IGMH 2WBJD 4KRPB 4LIQH 3RWJB 5HVWA 1D9KD 2BFVL 1NUFA 5DVMA 5I9QC 4NHUB 5HYJB 3LV3A 4PRPE 4HFWB 5I75C 4DCQB 1NAML 1NAMA 3UX9B 1DTUA 5CGYD 3L95A 2YC1B 4TSCH 3T0WA 5BRZB 5LWYL 1AO7E 1Q8MA 3EYSH 3V4VH 1Z3GH 3ISWA 4JFEA 1EHAA 4JKWA 4X8JB 1FO0H 2DQIL 4ODHH 4I0PD 2NMSA 5DJAB 5EA0L 5ESAB 3L3GB 1OPGH 1CFNA 1X5ZA 1MNUL 1IM3B 4JFFD 1CGYA 2ZSWB 5IV2A 4KJWD 1MCRA 3E6HA 3SDXF 2DQUH 2Z4QB 3F7YA 3BPLB 4P2OB 4ZOBA 1L9MA 4KI5F 4U1MA 5FYKD 3CU7A 2E7CA 4E41D 4DTGL 2XWJB 4G8GB 5EZIH 1XAUA 5D7LE 2FJFB 1T20A 5KVDH 1J18A 4BUHA 1DQJA 1F11A 3X12B 5I15L 3D3VA 3V0VB 3GIZH 3BWAA 4P57B 2GEEA 5C0JA 1H0DA 3MUZ1 4Z0XB 2VO5A 2WBWB 4HGKC 1CDJA 3D5OF 3TBTA 5IBTH 4CBPA 3I3BA 4Z7WF 4NRZA 4LKXB 4MJID 2F53A 1BFOB 4PJXF 5HYFA 3CJJA 1FZMB 4P4KA 3KYNA 1MH5B 4ZO6A 1Y0LA 1JWUB 3MV7B 4AQOA 1BQSA 3QDGE 1RZ8B 4ZOAA 3P0VL 5LCVL 1G7LA 4LSRL 1WWWX 4ELKB 4H8WH 5D1ZB 5CILL 1MQKL 2V5YA 1OL0A 5FO7B 1CD1A 3BH8B 3MREA 2O61A 5HGDB 2J12B 5I74B 2R2EB 3TO4B 1TNNA 4LARL 4MD5B 4G5ZL 1X4XA 1R0AL 4R26H 5LBSL 4RFEB 4HWEL 2EYRB 5D6DA 1YEHH 4DFHA 4HWBH 1N5AB 1RK1B 4MD4A 4DJMA 1MJ8L 1O5DT 3NZHH 4N9GA 2NXYD 3BJLA 1Y6KR 4YDLC 3HG1E 5ADOL 5FF6B 5JDSA 2EIBA 3KDMA 3OF6D 3V6FA 3N9GL 3LHPL 4NOBA 3D85D 2DKSA 1A7QH 3FRPG 3SBWC 1UQSB 4KXZH 1NLBH 4OLZL 5D7SL 4LLWA 1KT2B 4NM4L 5L9DH 35C8H 4QRTB 4NP4L 1KYOK 4C56A 1GGCL 3F12A 4YHYB 4M5YL 4N0YH 3FN0H 1MREL 1B6UA 1RZIB 3JWNC 3WN5C 5JXEC 4G6JH 1W0YT 2Z35A 3MV8E 5HDQH 2CXKA 4F15B 4GUPA 4PG9A 4R4ND 3WJLA 5E08L 3V79C 1SM3H 4ZS7L 2OS7A 4NO0A 4P2QB 2V5RA 1QTYT 3GUTB 5E2UL 1R24B 4XVSH 3S37H 1JBJA 2VDNL 4IRJC 4JVPA 3KYKH 3PWUB 5C0FA 1QFWM 1LK3L 5F1NA 2R0LH 2XQYG 3FQXA 4DW2H 1N7ML 5F7UA 4GAJL 8CGTA 4WHDA 3GSWB 5A16A 1WGOA 1RVFL 3BIBX 4X6DA 2DB8A 3K74B 5IJVA 2Y07H 4Z7QF 5D5MB 3IVKA 4ZSOE 1Q72L 3OJDB 3VGDA 3O11B 1K8DB 1RV6X 4NZDA 4XP9H 4J4PA 5T3XD 3G5ZA 4G6AD 3QA3B 2IQ9H 2KZ1B 3G04B 4PJEA 4JQIL 4XTRC 1P5VA 4QRPE 5GRUH 4G8IA 3CIQA 2MKLC 3QI9B 4Q9BA 4FQHB 4HPYL 4XC3H 5KJRH 1I8IA 1Z9SA 4EN3A 4OD3L 2BZDA 2EZ0D 5C0DA 3LZFL 1NBQA 2XI9A 5DT1L 2R0WH 5KZCB 1YYML 1Y6NR 5I6XB 2FD6H 4Z77B 1K8IA 1BD2E 1MI5A 5ALCH 5CJQH 5TDPA 4IIQA 4X80H 5D4QA 2P5WE 1KIRA 2YPLB 3D69B 5J13B 1U92A 1B9ZA 5L7XH 3L3HB 4KC3B 2NTFB 4KJQC 4U1HB 3S6CA 3D25B 1IILE 1QKZH 1T1XA 5BJTA 4KTYA 3RX7A 3U30C 1CT8B 3L9RA 1CFQB 5L2KD 1HQ4B 1DEEB 3WNOA 3DRQB 3O45B 5IOPA 5ID0A 1KB5A 5E4IA 5INDB 2YBRB 1MFEH 2CK0H 3MYZA 4PP1C 4YDVB 4XRCB 4LPTA 3SE3C 3WEXB 4GMTH 2A38A 1U8KA 4P2RB 3MBED 3TZVB 2IH1B 3HFML 2B1HL 1ZV5A 4LNVA 3B8YA 2P7TA 3HE7A 5F1KC 4TUOB 3CFCH 5M7QA 5FXCH 4N0FB 4PGDA 4MLSA 3ARGB 3NAAL 2Y72A 4PJ7B 2WWMD 2VLKD 2UWEE 4J23A 5TFSL 3P0YL 1YNKH 3QEQB 4MB5A 4X7FC 3UTTA 3QHZL 4ZPTB 4BFBD 3BYTA 3DUSB 4AEHL 2GHWB 2VXUH 1VENA 4U1SB 2Z92A 4NQXA 5FDWA 5AZEH 3SDXA 1VPOH 4H25A 3NFNA 4XC1L 5BQ7A 1PX4A 2CLZA 5DSCB 5KVGH 4X4MA 5CEZD 5JQ6L 1PY9A 4U6HA 5EO1A 1C5DA 1YEIL 2BSSB 5ISZB 3O9WB 4M7KH 3Q5TA 4PJAA 1DQDL 5I1KH 5EUOE 1UJ3B 2P45B 4Z7WA 2YMXL 1R5VA 4NQUA 4KJQD 3KHQA 3PP3K 4U4BA 1YY8A 3I3EA 3MPCA 5A3IC 5JHLL 3EO9L 3VH8G 1OT1A 4K9EC 3ZKXB 1WAAE 4GT7A 4N68A 2FIKB 1YDPB 3SDAB 5IFAH 1PYWA 1CXEA 4WW2F 2PXYB 5J0BA 4JPKH 4WIQA 2A6IB 3MJ9H 4M7LH 1A3RH 3ARFD 4Y2DA 3O2DL 3LN4A 2VIRA 1HEZA 3O2DA 3HZVB 4JLRA 4HIEA 3EBAA 4PJ8C 4HXAL 1C16A 1A1MA 4Q0XL 5CEYB 1OAZL 2MSPA 2V2XA 2PN5A 1IMHC 1TDQA 2HJFA 2ARJB 2HKFL 3F6LA 3OAZK 1NL0H 2GJ6A 1VCAA 3FRUB 2ICEB 1GAFL 2YA0A 2B1AL 1F6FB 1PKQA 2A1WH 1JK8A 3QRGH 5DHXB 1SYVA 3KXFB 5H94A 4WU7A 4Z6AT 3JV0A 3BEVA 4Y1AB 1D5XA 1K3ZA 3MNZA 4Z0BH 3X14A 3OKEA 1A6VL 5BXFA 5E9DD 3PWLA 1XGRB 3KPPA 4Y5YC 4YQXH 1A1OA 2NW2B 5FYJH 3PL6D 3SKJL 2BVEA 2CDGA 2P24B 2H32B 1OSZB 4JM4H 4Y0GA 1MVUB 4G7VL 2H2SC 5GSVA 1KTLB 4OCLC 3VGAC 3GSQA 4ERSH 4NKQB 1U8OB 4JFYB 3S4SA 1IBGL 1I8LC 3BAEH 1OSPH 4X6BB 4XNQB 4HV8B 5EBGA 3U7YH 5BVJA 4XCFL 4XAWH 2YXFA 3ZKND 2BNQB 1PG7X 3QNZB 3WLWD 3S34H 2EC8A 2BVPA 4Z7VB 2H26B 2G75A 1QFWH 4MXWL 4O5LH 3HMWL 3TEUA 4X0KB 4OBRA 4PJHE 5JZ7C 1AQKL 3VRIB 3MLUH 5DD0H 5DJ2A 5M94B 3LN5A 4ELMB 1UEMA 4GRMA 3CK0L 3ILQD 3O2VL 2X09A 5DA0B 1BM3L 1XR9A 3GBNL 1IC7L 1CG9B 1YEEL 4BFEA 4MXQC 1B0RA 3ARZA 3OR6B 1DBAL 4Y4KC 5HYJE 2PYFB 2G5BB 3BKMH 2QV2A 3IGAA 4X7TB 3OB0H 2Y6SC 4BZ2H 3KLAB 3K2UH 1H15B 3RL2B 4E5XA 4LVEA 3RWIB 4PRAA 3BQUC 4NM8L 4PRID 4XVUC 3NOIA 1MSPA 5BRZE 3SN6N 1AGDA 2MCG1 4WY7L 2WMPA 2X42A 2JELH 4QRUA 5E8NA 4AT6B 5IVZA 1MFBH 4KK5C 4OGZA 3VXUB 5HJ3A 3UJTL 3EDKA 3VXSA 2IAMC 3IDMB 4G42B 3VFPA 3KJ4B 5D7JD 3V7AG 3H6JA 3LQZA 4HUVA 3EGSB 3ARDB 1MQ8A 4NFDA 3EOTH 2YD9A 1MJJA 1I3UA 2J5LC 3MGTA 1FLRL 4G8GE 1ZXQA 4YGAB 2CGRL 1U3ZA 4FMKA 4NNPL 3S35H 1UWEH 3DMMD 3IXAB 4LCIL 3FMGH 4XMPL 1B4JH 2H2SD 5FUZL 2PO6A 3MRMA 4P4RB 1TVHB 1J1PH 2V9TA 1VSCA 1B6DA 2EDDA 3BZFA 5GSRA 4G6KH 2CIIB 1OB1A 4GKSA 2EXYD 3MZTA 5FA3B 5F7EH 1UWXK 5CINL 3QFJB 3MV7E 12E8H 2LAGB 5J57B 4PRPA 3L5WB 5HVHC 4GS7C 1A14H 2BOBB 1D5BA 5GS0L 2EYTA 5IQ9A 3H0TB 4AM0B 5FV2A 5FCUL 2IGFL 3D18B 4ZOCA 3V0WL 4DGIH 1AO7A 1UM4L 4M6OH 4HS3B 3VXMD 4YR6A 2UWEF 1Q9LB 3L3KB 1A7OH 1F6AA 1ORSA 1OM3L 3TIEA 3KS0H 4LASH 3MNWB 4P59L 2RCSH 4OIIH 3B3IA 3IRZA 4R7DB 3EJZD 5I18L 3VGFA 1NGPL 1PY4A 5K9KA 2VAAA 3ZKSD 4OM0L 3VFTB 4KY1L 4C58B 3CVHH 5LJYH 4LPVA 2J2ZA 3N85L 4Y4HA 4EBQL 1JGDA 3QIBA 5F3BA 5D7LA 4M02A 2BSTA 4YH6A 4NQSB 1FYTD 3RZCD 1W2KT 3DUUA 4PY8J 2AXGA 3RWCA 4JVWA 5EOTB 5FYJD 3HUJB 4JY6B 5EO9A 2H8PB 4GRLC 1GHFH 1WV7T 6FABL 3C5ZA 1AD0B 1HH6A 4CDGC 5L6YH 1JV5A 3SKNB 5D96B 1WAAF 5FIEA 4PV9A 5BOPA 1BJ1H 1FZJA 4EOWL 1KYOJ 3FCTA 1UACH 2KUTA 1CN4A 3DXAA 4P2QE 3V6OE 4ZAKD 4ZUSA 4FFYL 4G80B 3G6DL 3C2AL 4LEXH 1XGQA 4YWGL 1DANU 4WW2A 5I1LA 4X83A 2R8SL 1JHLH 3A6BH 1U6AL 3GBLA 5I8CA 2MOVA 2HRPL 2Y4SA 4YLQT 2AQ1A 2JE8A 1WZ1L 1JGEB 3P77B 5C09A 2GAZB 1E6OH 2G60L 5ADPH 4P46B 1CXFA 4LAQL 3CZFB 3DURB 3RWHB 4XXDA 3FQNB 3GO1H 3I6LD 5DFWH 4CU6A 1DUZA 3RWFA 4TUKH 4WO4A 2IPKB 5B21A 3U46A 1XCTA 3PWVB 1T22B 5E6IB 4ZD3L 3I3DA 2C3HA 3LPGA 5DK0A 3HZYB 5D93B 3BKCL 1HH9A 5T5NG 4MX7B 3EYUH 1G6RL 4QT5B 4QWWC 1D6VL 1URLA 1G6RA 4HJ0C 4OZHB 4P5TC 5INCB 5IF0B 3UTQB 3O8XB 2A73A 1RUKH 3OKDA 3WS6A 4OD2B 5TQ2H 4K7PL 1E6JH 4PJIB 2P5EB 4LQFH 3AM8C 1RZJH 1I3GL 1ZT7B 2VSDA 4WV1B 1N0XL 1J11A 3LIZH 2YPLE 4OLXH 1I85C 3BD3A 2VDML 4GFTB 4WENB 4ZFOB 3NACL 3WE6B 4U1LA 3TNMA 4PJHF 2XZQL 2VL5A 4UTBL 2BY3A 5SWSD 2HYMA 3O4OC 5DZNA 4K23L 4Y8DC 4U1NB 2KL6A 3I75B 4NFCA 4KQ3L 5GGQH 1BVLA 4NKOA 1FFPA 3IDNA 4XNYL 5D1XC 4AENA 1EEZB 1LO3L 1NANH 4WDIB 3HS0A 5IK3B 1CF8L 1PFCA 5FO9B 4RGOH 5DQDH 4ZSOA 1QLEH 5KSUB 1QZ1A 4PUBH 2BX5A 5JHDB 2ZG2A 2BVQB 5KOVC 4FQJL 4KAQH 4NNXA 4P2RE 4JO4H 2HJKA 1NCUA 2DDQL 2BCKA 1HSAA 4JDVB 3VCLB 4JZJB 5TF1H 3RJQB 3M8OH 4H20L 4HCRH 2E7MA 4OCRL 4OZIE 5ITBH 3MCKA 1TNMA 3CFBA 5FYJU 5C2UB 3T04D 5SX5H 3TNNB 2XA3A 3K8LA 3QIUB 4PJ7E 3RBSA 3EO1B 2NY4D 2P8LB 4DQOH 2DL2A 1NMCC 4LFHD 1FL6A 1PEZA 2J6EL 2OQJB 2J6EA 4KPHL 3QEQE 2VKWA 1DZBA 4GQPH 4J2XA 1LO2H 4UQ2A 2R29H 5TE4H 4FABH 3G5YB 2AJZA 3BZ4A 1I9IL 4NT6B 1I9RH 4JANB 3PV6A 1U8IB 4MQSB 4Y4FB 2P5WA 4YK4B 1IGTA 3LCYA 1CGSH 1G7QB 1WISA 3P4OB 1AXSA 5EBWA 4M5ZH 4XB7A 4H5SB 2NW3B 3T1FA 5K9QG 2NY2B 3I9GH 2AK1L 5ISZE 3ES6A 1ZK9A 2V2TB 3GDBA 5DRZB 3EYVA 4WWKB 1A7PH 2MPAL 1ZLWH 2JJSA 3A67H 4XX1E 1JRHI 3C6LB 2ZZUT 2KKQA 1XIWB 4H26B 2BC4A 5I2IB 5E8OA 5BZDB 3SO3C 4J8RB 1J10A 2YUWA 3IJHA 2UZXB 1DLHB 3KPQB 4XVJH 4NUJA 1F3DJ 3PHQA 1U9KA 3ULVE 1ZGLP 1X7QA 2DKUA 2LV4A 1FLTX 1A6WH 3HNTL 4BQ9A 1D9KB 1HOCB 1NAKL 2GUOB 5ETUA 3UDWC 4JRYA 5DJ6B 3U6RB 3EFDL 4YGVA 4UQ3B 3UYOD 3T0DA 4PRHD 2Y9RT 1T2QL 1JPSL 3SY0A 1U58B 2UWEA 3SGKC 2RFXB 1XH3B 3QDJD 1K2DA 1JPGB 3KXFE 4OV5A 4Y1AE 1SBBA 3WS3A 2HMIC 4F3FA 4CGTA 4JFFB 3DX7A 4G6MH 5DJDB 3TBSA 1DVFA 2HTKC 3FFCA 4U31A 4YXHL 1UM6H 1SY6L 4HIIB 3U4EB 1SY6A 4E41B 1UFUA 4L8SB 1WEJH 4TULH 3GSOB 3UJIL 2R4SH 3X3GL 1A9BA 1PSKL 4HUNB 1N6VA 3BH9A 3PABB 1GIGL 3RDTA 1S9VA 3MYJA 4QTIH 3GJFA 2A9MH 1QEWB 5A2KH 1CU4H 3EYFA 2W91A 2B4CH 3QCUL 1VADA 3GMQA 4DVRL 5AD0A 1P53A 3VD3A 5FV1L 4MJIB 3B9KA 1QBMH 4JDTL 5IGXL 5D7IF 1MJUL 4HMDA 4KFZC 1I1AC 3QXUA 4L3EB 2I07A 3MRKA 3PIQA 3SQOH 5BVPH 1WAAA 4K8RH 5HHXL 3U79A 2BNQE 3DOSA 1CL7L 1XGPB 4FQLH 1E27B 1HXYA 1EMTH 5KSVB 4PGCB 5C6PB 4OI7A 4Z7VE 3GGWA 1X4YA 4GW5A 3NABL 3V6BR 5F7FA 2K3TA 5AZ2L 1SVCP 4UV4L 3VFMA 2DQFB 1RMFH 4OF5A 4M3KB 2MFNA 2AV1A 3ROLB 3REWA 1P7QD 2ZCHL 3TVMA 3AXLB 1RUML 1ACYL 5BV7C 5ICYB 2VZOA 5F8QC 5IBTL 5JW3L 4LRIC 4QHKI 1HDMB 2XQBH 4I77H 4XGZA 3MRFB 4KUCD 5D1QA 2X2YA 2A6DA 5CP3H 2PTVA 3WLBA 3G9AB 2NXYB 4LLDA 2NZIA 4Q6IC 4UB0L 5FHAH 5C0GA 1OAUL 5IW6A 4F37F 1SYSA 3K7UA 2ZOLA 3D85B 3NMEA 3VXUE 1FDLH 3VWKB 3LPFA 3PHOB 1E4KA 1A5FH 2YPKB 2HTKD 4Y8AA 4Z78A 3WFBL 1IQDB 3RWDB 3QBTB 5GGUA 4DN4L 1I7UA 5KG9B 4R4BA 4ZXBC 2O5YL 5EZOH 3LEVL 1RUQL 3HE6C 1G9ML 3OX8A 3BP6B 3CC5A 3MLTA 4YEEA 5ICZB 1PQZA 1PD6A 2X4PB 4NQCA 1JN6A 3OAYK 4NO3A 4ZMAT 3IDYB 5D9SB 2O5XH 4L4VD 1IJ9A 5J9PA 3RIFF 3BEWB 2EDYA 4RRPA 5H35B 4G9FD 1RZFL 3NFPB 4LSVH 1A6UH 4PD4K 5EFIA 5JO5A 1KB9K 4MAUH 3QFJE 1AGBA 3O3BB 3KGRA 35C8L 4F7CB 1VFUA 5HHOD 3EOAB 3JWOH 3MV9D 4NHUA 1HCFX 3Q3GB 2W65A 4HFWA 3EDEA 4DCQA 4DZBB 2FB4L 5DJ0B 1A3LH 3CFKB 4OZIF 5CZVL 2X4RB 5F1OB 3V7MA 1KXVC 4ISVA 3WNKA 4L8DB 2ATKB 2YC1A 3PQYD 1JF6A 4Z95H 4NZUH 3E6FB 5J1SC 4LGSB 5B4MD 1T80A 1SM3L 3QPQD 4EXKA 1Q0YH 5DJAA 1OGTB 2VXSL 1A9EB 4O58H 2ENSA 3D39B 2OI9C 2EDFA 3HNVH 1IM3A 4JKPH 1N5YL 3WYRA 4FQIL 3QEHB 5EIQA 3B6SB 2EECA 5EU4A 4HKXB 2IFFL 4B5EA 5I30L 4RBPK 2AJXH 4FQXA 4UT7H 2E7BA 4HF5H 4RSVA 3DVNA 4JHAH 4OCWH 5GXBB 4XPBH 3RFZC 4NC2B 4G8GA 4QXGL 3V95A 3QWRA 2CJUL 4AL8L 1FFRA 4P57A 4P4KC 2HLFC 2YKLL 1KCUL 1AGEA 1R3LB 3HUJE 5ESVB 3QULB 4LKXA 4N8VG 1SBSH 5J1TC 3WIIH 3LB6C 2HFGH 1FZMA 4OSUH 3NN8A 1OAXL 2K1MA 2NXZC 5GRUL 5L2KB 4LFHG 1P1ZB 3G08B 2CSPA 4K8RD 3VD4A 1RZ8A 5HGHB 4TVPD 2EIEA 5CLTA 5KJRL 2HN7A 3HRZA 3ZYZA 4N1EA 2ITDA 1E4XL 4XPAL 3BH8A 4TSBH 5T1KD 1I3RB 5HGDA 2Z93B 4L1DA 3BKJL 1YY9C 4HIHB 4PYGA 4OV6F 1NBVH 2R2EA 1KN4H 3BPNB 2VABB 1A8JH 3MBEB 5ALCL 5GGVY 2IPTH 1FNSH 3IFPB 5ICXB 3V0AC 4RFEA 2EYRA 5F93C 2H9GB 4CVWA 3AMLA 1IC5L 4NBXB 1UZ8B 1N5AA 4AMKL 2FX7H 2VLKB 5KVEL 3VMNA 4DEPB 1CFTB 2IALB 5GGRA 4G9DB 1QBBA 4HLZG 3KNBB 4X9IA 1B90A 1IEBB 5DEFB 2YEZA 2Z31C 4GSDH 5DJZB 2DJUA 3T09A 4FMFA 4EEEA 5I73C 3REVB 3HI5L 5KS9B 3VG9B 1Q9WB 2DQDH 4IRSA 4TRPL 3WJLC 4BH8B 1HWHB 3FB8B 4OZHE 5GZOC 3O6LH 4XNMB 1FL5A 1MCJA 1Q38A 4NQEB 3TFKC 4NKIL 5IR1B 2HWZH 3AS0A 4GG8B 4PJIE 2P5EE 5GS1B 1MHPH 1JYXA 1NGWB 1AQDB 4OCSL 5I1DB 4LVOB 1ZS8B 4Z7VF 4P2QA 1BHGA 3V6OA 5D7IA 1JPTL 3AB0B 5HHNB 4ZFZB 5FUCC 4J1UB 1IC4L 3BESR 1AGFB 1QFOA 1VERA 3ZE2E 4ETQB 2VRAA 5IVOA 2CXGA 4N1CA 5IBLC 3ZHDA 3B83A 5F88B 3MRPB 4H88L 2VDKH 2J8HA 4W4NA 3LKRB 2DTSA 3W39B 4YHZH 3ARFB 4UIMB 5EZJA 1EV2E 2DRUA 4XCYB 4Q97A 3TO2A 2JB6B 3CSBA 3BZDA 3CXHK 5JHDE 1NC4D 4DVBB 1U8LB 2IG2H 3C8KB 1K5NA 3O11A 3QUZC 3FT4B 4JZOB 4KK6D 1JWSB 1K8DA 3FO2B 1MFAL 2Y1VA 4NKMB 4DWHA 3RTQD 3FB6B 3QA3A 1A0QH 1KCRL 3RGHA 5BS0A 4EN3C 5DYOB 4JREC 3OR7B 3UTSD 2X4TB 4FQHA 1DLFL 1LO4H 2HJLB 4GQ9L 2APFA 5DO2D 4TPRL 4IIQC 4HQQL 1K3IA 5LG1A 1NBYA 1UCBL 2Z31D 1INQA 3OGOE 4MA3B 3PL6B 4XP1L 1NGZB 4XWOC 1EZVY 5FB8B 1P84K 2ZPKH 2E9WA 4WGVB 4ZUWB 3D87B 3V52L 5MP6L 3WBDA 1ZGLB 3T4AB 5DEGB 1NC2A 3ETBF 2J3SA 2YPLA 1RJCA 3D69A 4CN6A 3L3HA 1I75A 3CMOL 4U1HA 3DGCR 2JK5A 1G1CA 3ZMRA 2YZ1A 4QHLA 3FT2B 3E2HC 2Y23A 1YC8A 4B41A 3D25A 4OZFH 3VFWB 3P4LA 1RUAL 1UKQA 1CFQA 1HQ4A 2CK2A 2Z8VC 2DTML 2IEPA 2BXYA 5B38G 3O45A 3WKMH 2ARWA 3LH2L 3CLFL 5GIRB 5INDA 2YBRA 3FB7B 1MF2H 3SDCA 5E2TH 1N6UA 2ARJQ 4LNRA 1DBMH 3KPRD 4X7DC 3BGFC 2FDBP 3WEXA 5J8OA 3FQTA 4M93C 4C4KO 3OJVC 4P2RA 2IH1A 2E27H 1D7FA 1FNGB 4KKLC 2CR6A 2AABH 4TUOA 4UTAL 4OZIA 1T66D 4YIQB 2H2PC 5FKPB 1FCGA 4HXBL 4R4FL 1W72L 1BX2B 1N4XL 3QUZD 1W72A 4M9OA 4PRIB 15C8L 2XRAL 4TTDC 2X1XR 3NIDE 4HJJL 4LSQH 1QR4A 3U4BL 1Q94A 1UEYA 3FQWB 4KI5C 4LSUL 4N9OB 4BK5A 3DUSA 2VKXA 2VH5H 3MMEA 2YR3A 4MDJB 4AG4H 4POYA 3X17A 4KKBC 1TJIH 4JFFE 4R3SB 5D7JB 1JHTB 5FYLE 2PYED 4WI9A 5DSCA 5FYKE 3HUJF 4E41E 3BHBB 2AS5M 2VERN 5D72L 3C09C 4UINH 2BSSA 5ISZA 3O9WA 3DMMB 2XTJD 1F4YL 1ZLSH 2P4AB 1S78C 3VWJD 1BQHG 3G5XB 1MCPL 5A2IH 1ZT1B 4MJIE 3WFCL 3HKFA 1JZ8A 4L3EE 3ZLQC 4Y2DC 3PGCB 4EUPH 3TC9A 3FO0H 1S7SB 3NCJL 2FIKA 3QWOA 3SDAA 3CFJB 4HH8A 1DDHB 4XCEB 5CD3B 5E4EC 1ZHBB 1EDQA 1CR9L 2E8ZA 4I9WD 1EAPA 2AKRB 4KROC 4OF0A 4QEGA 5CEYA 1X5AA 1M1SA 2FHCA 2ARJA 4QNPE 4WUKL 4IS6A 4CUCA 2M2DA 4JE4B 3FRUA 2ICEA 3GBMH 3VXMB 2EE9A 1JI1A 2Q7NA 4HPOL 3HNSH 3VD7A 2VC2H 3KXFA 4KMTL 4JN2B 4LHUD 1YC7A 2E6JA 2ADFH 1HILA 2V7HB 4I18C 4TUJB 3O6MH 1RY7B 3KYOB 4PTUA 3BT2L 4LLYB 1MFDL 1ERNA 5LAXA 2O5ZH 1XGRA 2XYCA 2DYPD 1HXMB 3AS2A 1T7ZA 4OZHF 3TWCL 1GH7A 4R2GD 1KIQA 1E4WH 3TBVB 2FNBA 4RMWA 3FONB 3WFHA 1A21A 1FYTB 2DQCL 3RZCB 2H32A 4MSWA 4O9HL 1NGXB 2VR5A 3FTGB 1ZKAA 1MVUA 5JIIA 4PJIF 4WUUD 1KTLA 5C08D 2GSIB 1U8OA 4JFYA 3TH4T 4X6CB 4MWFA 4LMQE 1PLGL 5IWLC 3T77B 1ETZB 4X6BA 1FNEB 5C9KA 3WXVL 2BNQA 3ZE2F 1VEOA 2VXVH 2DWEB 25C8L 4B50A 5LGKA 4K07A 4Z7VA 2H26A 2QTEA 5L88L 3MLVH 1ZA3A 2Q76B 4YZFE 4ZAKB 3VRIA 4KRLB 3TYGL 1I3VA 4X4ZA 2NR6C 3O6FD 1YA5A 2MJWA 1U8QA 5HVFB 2OSLA 3V7AE 1CG9A 1JUFB 1AKJD 1X5KA 4FXLA 3KPNB 2CLRB 1P2CB 3OR6A 5IB5A 4LLMB 4XP6L 3LDBB 4X7SH 1BP3B 1T0MB 5GJTL 3WFDH 2VDRH 3K2MC 5IESH 1OWWA 1P7KA 2R69L 3PJSB 3KLAA 1BQUA 1Z9OA 2AEPL 4YHKL 1H15A 5FUOL 3T2PA 2V17L 3PWPD 2VDOL 5B3JE 5IHZB 1KB9J 1F4WL 2D4FA 1MEXL 1T3FA 1HHHB 4AT6A 5T3XE 4TNWF 1OTUD 2YZ8A 3LKNB 3VXUA 1Q9KB 5E6ZA 3NH7L 5DD1H 3D39E 4KHXL 1L6ZA 3BMWA 1AIFB 1FVEB 4M1DH 1DQLH 3ARDA 3K8KA 4BA8A 3S37X 2EE2A 4WEBH 5DQ9A 2PO6C 3GIVA 4U3HA 4XPTH 4IM8A 4V1DD 3PP3H 3BX7C 1GVIA 3RKDC 4AY0A 4GMSH 2V2WA 3IXAA 1G9NL 3SOBH 3EYQC 4KQ4H 3U0TB 3CFDA 3QEGH 4UT6L 5GJSH 3BDXA 4LLQB 4P4RA 1TVHA 2XG4A 5DMIH 2ZJSH 3F58L 4FXGB 4H1LG 3QUMH 4GKZA 2YRZA 1PGRB 4PREA 3DO7B 4S0SD 5J11B 4E42B 1ND0A 5FA3A 1FPTL 4ZYKB 3BYYA 4DUXA 1QRND 3KYMA 1R3IH 4NKDB 5L2KE 3OAZH 1KXQE 3EKCA 3U83A 1H3UA 3AGVA 4U3XA 4X98A 5CBEB 5K9JH 3K3QA 2EDWA 2GI7A 4KV5E 3MV11 2BOBA 2W0FB 2KQNA 3H0TA 3M07A 2APBA 3O3EB 4AM0A 3D1MC 4HS3A 2ORBH 3NIDF 2APXA 3L3KA 3JV6A 4Q9QL 1MCHA 4FQ1L 4YXKL 3PGDA 1A6PA 3KJ6L 3RX8A 4N8VB 5H37H 5IFJB 4R7DA 3GM8A 5SWQB 4Y4HC 4JG0H 4J3SA 1CTOA 3MODH 2NY4B 2VLKE 3VFTA 4ALAH 4Z9KB 2GK0A 5CSZA 1H8NA 1JFQL 3DVFA 2OJEB 4RGNB 1QO3A 1F5WA 3BSZL 5EULV 5FKAB 1OGAD 4P5KB 3CSGA 3CVHB 1HSBB 3G6JE 5HHPB 4Y16D 3VXTB 3C5ZC 1UT9A 1RJLB 3W2DH 3S88L 2FX8H 3CXDH 2VZTA 4IDJH 5KS9E 2CO7B 3MJ8B 4OAWB 3HUJA 4JY6A 2H8PA 5CEZE 2NYYC 4QXTB 3H3KA 3RKDD 1EUUA 3BP5B 4JO4L 2X4NA 4JPVH 4NQEE 1TCRA 1FJ1A 4XNZB 3EYQD 1B0GB 3LKPA 4HCRL 3IT8D 1GYAA 3MBXH 1KIUA 1LVEA 3AY4A 1L7IH 4NZTL 4EI5C 4RAVA 2HKHH 3LQAC 5E6YA 3Q1SH 3UBXB 1CD8A 1S7VB 1HHGA 3FRPA 3KR3L 3L3OA 5E7FA 1QQDB 3H9HA 4Y5VC 1F90L 3VDAA 1RAMA 1BFTA 4QNPF 1MRCL 1TVDA 1OLZA 1CGWA 1OOAA 3P77A 1JGEA 1F2XK 1ZT4B 2GAZA 4PRDB 4PRHB 1IGFH 3QHFL 4P46A 1F3JB 3TIDB 3RWHA 5HHQB 4P0DA 2JB5L 1KULA 1ZTXH 3PP4L 3RVXC 3QDJB 5IT2L 4YC2C 1DBKH 4CVXB 2YD1A 5DMYA 2AJSH 2R2BA 2R1WB 1JHKL 1HNFA 4M1GL 5EU6D 2IPKA 4L5FH 1NCNA 5E6IA 5B22A 3NCMA 3BJ91 3C08H 3U0WL 3QO0B 4MX7A 3D9AL 4QT5A 4OZHA 3I6KA 2UVEA 4BSJA 1TJHL 4HLJA 4P48A 4U1JB 4L9LB 4JJHA 4D9LL 4PJDB 2EDBA 3MOAL 1CICD 3WDJA 2QSCH 2NQCA 5CWSB 3ALPA 5I1GH 4OD2A 1Y18A 3NCCB 4PJIA 4WJ5A 3LKOB 4WHTB 1M4KA 2J4WL 4UOW1 5E8PA 3STZB 4ZFOL 3QDGD 2F5BL 4ZFOA 2JJUA 1KPRB 3WIHH 4CMHB 2IQAA 4JAMB 3BZEA 4YZFF 1TQCC 4QXUH 3WUZA 3INUL 3MOBH 4EI5D 3ARBC 1AI1L 3I75A 3UTPD 2FRGP 3BD4A 4WEUD 5TE6L 3IJYB 3CU1A 3SO3B 4OGAC 4AIZB 1CLZH 1ZEAH 1JF1B 1H3VA 3MRDB 3RI5F 1NUNB 2W1NA 5FO9A 4KDVA 1J0YA 1HCVA 2A77L 1A7RL 3QDAA 3LEXB 1ONQB 2F74B 1CDBA 4ODTL 1F8TH 5IB4A 5B8CC 3STBA 1IKNA 5B3JF 3HG1D 4WNQB 1FNAA 8FABB 2B4CL 3V5KB 4JDVA 3GJFK 1A6TB 1A2YA 3IRPX 2BDNH 4OLUH 1ZOXA 3DIFB 4JR9H 1P4BH 1AHWC 2AJVL 1RHHA 1U0QA 2FH8A 2Z9TA 4BSVA 3FOLA 4PRIE 2P8LA 2OLDA 2Q8AH 4K71B 5I1IH 3UYPA 4OZFG 1KBGH 3IAQA 3ULUD 1A6AB 2OQJA 5B38B 3HC0B 4MA1B 1CLOH 1DBJH 4RFNB 5IJKA 1QSFD 3DV6B 4RNRA 3LKQB 4RFOL 1KJMA 1S7WA 1FZKB 3S5LG 5KSAD 1AC0A 3I2CL 4Y4FA 4JY5L 1LQSR 2JJSC 4CADB 3MLPA 4I3RH 4X4YB 1A7NL 3E8UH 5KTEL 2AJUL 2NW3A 3T3ME 5I1EL 4HDIA 2WUBL 2X4SB 5FO8B 4D2NA 5JOPE 4WTZG 5DRZA 2XQBL 1BMGA 3QHTC 3C6LA 4KVNH 4I1NB 4L4VB 2VL4A 4BM7A 5CBAB 2A74B 1MHEA 5BZDA 3QG7H 1DLHA 4KV5F 5GRYA 3ARBD 4G9FB 5MEND 1KLUA 3JBG7 1OCWL 2ZCLL 3QH3A 1NEUA 5EUKB 5IQ7L 1CDUA 5F9DC 5IMKA 3O3AA 4D3CH 2ZSVB 2WBJA 3BIKB 1G7IA 5HHOB 3RVVD 3MV9B 2E9JA 2GK2A 4UNVA 4E9LA 4L4TB 3U6RA 2CKNA 2FGWH 4UQ3A 3W11D 4M6AA 1KTKE 1YECH 2ZOKB 4HGWA 1QNZL 3ZHLA 4RX4A 3PQYB 1NUGA 1S9WB 1U58A 1V7ML 1OWRM 2VQTA 4JHWH 2QQKH 4U6XB 4X99B 3U1SH 1GRWA 1BQHB 1ORQB 5JLZB 1MVFA 3VXME 4X5LA 3S35X 4BQBA 4U49A 4I0PA 1YJDH 1JPGA 1CBVL 1MAJA 3MACL 4ZUTB 5AUMA 3C6SB 3VH8A 4WHYH 3MRJB 1X4ZA 4I2XB 1UENA 4JFFA 3BDYH 3G6JF 4U0QB 1IM9D 3JUYA 4OQTL 2DQHL 4OQTA 2H1PL 3IETA 5JW4M 5FYKL 5F7MC 1X5IA 1DFBL 4HIIA 1LEKA 4E41A 3O6KH 5TGBA 3GSOA 5DRNB 3B9KC 3BOVA 3PABA 3VGEA 4EDWH 1FYTE 2OTUA 5I19H 5GZND 4NN5B 5FYJE 1U41A 1SQ2N 2GY7B 3LD8C 4P2YA 1QSED 4MJIA 1KC5H 2VZUA 2DQJL 2BY1A 1OP5K 4X6CE 1KUMA 2JLLA 3K4AA 3LS4L 4KZEL 1HKLH 4OFPA 4BQCA 5EO0B 3RAJL 4DFIA 3H42L 2OJZH 4TQEH 4XPHL 1XGPA 2VDLL 5KSVA 1E27A 3WHE0 2BVTA 4LVHB 3SGEI 4M00A 3JTSB 3AU1B 5T5NF 3MUJA 5I1CL 5HYIA 3TVMC 4JHAL 5T1LA 3DI3B 1YQ2A 4RAUB 1A6ZA 4D8PB 2DQFA 3O0RH 5T1KB 3L1OL 1N3NB 1ZMYA 2WUCH 2UZIH 2LAAA 3WV0A 1BZ7B 3L3IB 3AXLA 2FR4A 1EO8H 5ICYA 1U95B 2HG5B 5JDJA 3B43A 4QF1A 3RY5A 1EA9C 3IAGC 1J0JA 5CUSL 5C0AD 3MRFA 3MFFB 4LF3B 1GGBL 1CZ8L 5MEPB 1E4KC 4WFFD 2VE6B 4RWYL 3DSFH 1BAFH 4K2UH 3ZKMD 2DKMA 3I6LE 1YNTB 2X4QA 5GRZA 3GSNH 1FGNL 4OI9A 4FG6C 2DJSA 3PHOA 5DLML 4MJ5A 2YPKA 2DWDA 3C5SA 4XP5L 1YQVH 3ZTNH 2PR4H 1G9MC 1IQDA 4HBCL 4JFZL 2CR3A 5BZWB 4TSBL 5KG9A 1MHHA 2GYSA 2ADIB 2HFFB 2QQLL 1NBVL 4POZC 1U3HB 4HZAA 1XF2B 5CFHA 2UZYB 1I7RA 5I66B 2ADGB 2ZUQB 3CPLA 4LSSH 4GW4B 1A1NA 2X4PA 5A2JH 5LXGH 4JO2H 1OQXA 3O2WL 3VFGL 1NFKA 5C3LD 2FX9L 1UG9A 3A0OA 3M17B 4OCYL 3AC0A 1WWBX 5A1AA 1QR1B 4KRPC 4DN3L 2Q20A 4ODUB 5D8JH 1BECA 3DI2B 5DF0A 5SWSE 1FCCA 1X9QA 2QADD 3NFPA 3LOWA 1WK0A 4N8CH 2O93L 2CDFB 5I17A 1ZHLB 2ERJB 3QUYB 1D5IL 4IRZL 1WBZB 2F19H 3T8XB 4F7CA 5IEKB 1CDYA 1PG7H 4X9GA 2VNCA 4UNUA 5IMMB 4DZBA 4MJ6B 4C54A 2LU4A 2BMKB 4XCCL 4KTEH 2Q8BL 3CFKA 3KLDA 4BKLB 1U8JB 1NC4B 4L8DA 4MA7H 3UJJL 3MJ6A 2OBGA 2PF6A 1E28B 4OT1L 3H3PL 3E6FA 5T3XL 2RJMA 1WF5A 1ZA6B 3RTQB 4J6RH 3KAAA 4H1LB 1OGTA 3BXNB 1MOEA 5ENWB 1A9EA 4BFIB 3BPLC 4P2OC 2LTQB 3UTSB 3QEHA 3B6SA 3IXTB 4HKXA 3QT2A 2BFVH 1EEYB 3MRLB 2VQ1B 5EIVA 1I1CA 1NAMH 3QUKB 4LCWD 1VKXB 3X11A 3T3MF 3X13B 1KJVB 4HGMA 1WVZA 2EC9U 5LWYH 5FEBA 3GFUA 2VAJA 3ZYIA 2Q6WB 2DQIH 4I4WA 2P47B 1BZQK 5JXEA 2WW8A 5EA0H 3DYPA 1AR1C 4FHBD 3GJEA 1MNUH 3MOQA 4EI6B 4KXZI 4YHOL 2J1KA 3ROOB 4KHTL 5D1ZC 5FM5O 5T1MB 5L2KA 2NY3D 3F7QA 5FGRA 1MUJA 5GGSA 2FL5B 5I74C 4DTGH 1I1RA 4I48B 5HGHA 4OKVA 3TO4C 2YD7A 3DV4A 5JW4N 1CDCA 3R8QA 4XCNA 1F97A 5I15H 3V4UL 2HTLC 3KPRB 3PG2A 3P9LA 1HYRC 4U6VL 2GTWB 5ABDE 1CXHA 5EOQL 1J05A 3GSRB 4JHBA 4KK9C 1R3KA 2PTUA 1L7TL 2H9GA 2DD8L 4WW1B 1MLCB 1UZ8A 4WCYL 1FZOA 4IHOB 4PRHE 3HI1A 4KDTA 3N06B 3O4LA 1VFOA 3P0VH 4O2CB 5LCVH 1CE6B 4LSRH 4LGPB 3LEYL 3QDJE 1I9JL 4P49A 4ZO9A 5CILH 1MQKH 1FRGL 3QG6B 4JFDD 4YHYC 1IEBA 4HUWB 3EHBC 5E00A 3G6JA 5DJZA 4NRXB 3T2NL 1S8DA 3H7BB 3RIFK 4F15C 1G7PB 2PYEB 3REVA 4LARH 4LHJB 2ADJB 3FZUC 5CEZL 1I8MB 1R0AH 5LBSH 3WNPA 2UY6A 3F6IA 4U1KB 4DGVL 3IDGB 4WU5B 43C9B 1WIUA 1IVLA 1MJ8H 5DZOA 4PJDE 5IVNA 4F7PB 3RNKB 4QRQB 1B4RA 3V6OC 2C7UA 2XTJB 4YDJB 4GG8A 4EJ1C 1DANT 1IL1B 3VWJB 5ADOH 2RR3A 1NGWA 5IB3B 2VDQL 3N9GH 3LHPH 3MV7D 2W60A 1ZS8A 4NUGL 4F57L 3FQUA 4OLZH 5D7SH 1DN0B 5HHNA 4ZFZA 4BH7B 3OXRB 4TVSa 4OF3A 4NM4H 4U3CA 5I71B 3SCMB 1ZAGA 4NP4H 4ETQA 4GW1A 4CMMB 5J7CC 1GGCH 2UVFA 4CU7A 3HAEA 4M5YH 3T2QA 3IS1X 3TO4D 3B2UC 5DVKA 2HFEB 1MREH 2ZNXA 4LVNB 1OTSC 5FHBL 3W39A 4Z7UF 4ONHB 4UIMA 5I1AB 2XWBA 4U7MA 4XCYA 1T03L 4HUXB 5E08H 3L5HA 1H3TA 2P8PB 2VZVA 1U8LA 1ZLUH 4ZS7H 1KJ2B 3U2SA 3FT4A 4JZOA 4G8FB 4RBPH 1JWSA 3TH2T 3QI9C 3FO2A 5E2UH 2EDNA 3FB6A 2E7HA 1UADC 2VDNH 5FGSA 2ESVB 2X4OA 2VB5A 1T0PB 1AXTL 5C0CD 4EDXB 1LK3H 3W0WA 3PGFL 4U05A 3OR7A 2WP3T 1NFIB 1N7MH 2X4TA 3SE9L 1IGIL 4GAJH 3MGOB 1DBBH 5E9DA 1LE9A 3BI9X 5I6XC 4HULB 2C3XA 1RVFH 5KANI 1MCNA 2IBZY 2XIDA 1G6VK 2DYPB 5HI4C 4YFLI 1Q72H 4R2GB 4M7LT 3PL6A 4P3DA 5J13C 1NGZA 3UC0L 4HC1L 5FB8A 4HC1A 4HWZB 4ZUWA 3P40A 4UIKL 1ZGLA 3T4AA 5DEGA 3BUTA 1BLNB 1I7TB 1YEKL 4JQIH 4YBLB 1MJ7L 3IFOA 1TZIB 2EYSB 2AI0L 3AVEA 4OCXL 3U9PL 3FT2A 4JM2D 4MCZB 4ODSL 2F58L 1KJ3L 4HPYH 3VFWA 4K3DH 2KDGA 3QEUB 3LS5L 4LP5A 4L4VE 4KU1A 4K9EL 4OZFB 4OD3H 5GIRA 1NCAL 3LZFH 5DT1H 3SQBA 3QQ9C 3TZVC 1YYMH 2GJJA 3MRQB 3O6FB 1P9MC 4Q58C 1KN2L 4G9FE 3FL7A 3OKLA 5C0ND 3B2UD 3RY6A 1F00I 4N5ED 3S5LB 1AKJB 4B53A 1OTSD 3ARGC 4WFGD 5HHOE 3MV9E 1FNGA 3ARTA 4CN4A 4PJ8A 4XMLL 1UJTA 4L4TE 2HVJB 4HIJB 1KTRL 3JTTB 2HLAB 3B9AA 4JVUA 1BX2A 3IF1A 3PWPB 3RKPA 2EDEA 3PQYE 4PRIA 5F6HI 1KB5H 1BF8A 2VXVL 3WUWA 2OTPA 5C8JA 4I18B 3FQWA 3OKOA 1NGQL 4LCUB 1BVZA 4MDJA 4XNXL 4M9PA 5D7JA 4CNIA 2YA2A 3O9WC 3HFMH 2B1HH 2P48B 4PYHA 1GSMA 4Y5YA 1TVBA 1UJ3C 3VXQA 3VRJB 1KCKA 1C5CL 2OMNA 1Z5LA 1KFAL 3NAAH 3DMMA 4PTTA 1LDPL 4AEIL 3ZKXC 3G5XA 5TFSH 3P0YH 2D0HA 3FO9B 3QR2A 4QTHB 1UA6L 3QHZH 3ULVC 3SDAC 2YUXA 3CFIC 4NBZB 1I8LA 3OG6B 4AEHH 5FOBB 2PXYC 1PW3A 5TE7L 4Y19A 5CKAA 2BVOB 1OW0A 4QHKJ 3PGCA 1FYHB 3KLHD 3GMNA 1QRNB 2C1PA 4XC1H 3ARWA 1T5WB 5JQ6H 5C9JB 2IJ0C 4KKCC 5IFHL 2UY7A 4XCEA 3QQ9D 5CD3A 1ZHBA 4JQVC 4C56D 1YEIH 4TVPE 3BPCA 5A2FA 1DQDH 2AKRA 1GGIL 3HLAB 4HKBA 5CMAB 4ZFFA 5I1JL 2YMXH 4HAFA 1NCWL 3ARGD 3RVUC 4YAQA 4Y4KA 5JHLH 1EBPA 2DI8A 1WC7B 3EO9H 3HC3L 1QFWI 2AEQL 7FABL 4JN2A 4RCAA 3TJEL 1Z9MA 4ODWB 1LHZA 2V7HA 3BQUA 3ZT6A 4TUJA 1AXIB 1GZPA 5HGAB 1HKFA 3ESVF 4LLYA 4OKDA 3O2DH 2A83A 3G9VA 4XPFL 1KNOA 1MY5A 4Z18A 1HZHL 4KGJA 1HXMA 4HXAH 3U4AA 4Q9RL 4Q0XH 1OAZH 4LU5L 4MAYD 3TBVA 1OGAB 2HKFH 3QSKB 3PDOB 5KVFL 4PJDF 1CS6A 3F7VB 4Y16B 2EDTA 2R23A 3FTGA 3DX8B 1YPZF 1FG2B 1GAFH 2B1AH 3BUYB 3KPMB 3CUPB 1TITA 5DR5L 5AWNL 3BGAA 5E03A 1KEGL 5HD8D 3P73B 2R2HB 4LPCA 1FNEA 4GLRH 5D70L 5JOFA 1A6VH 4P9HL 3ULVD 2DWEA 4XAKD 3SDYL 4UDTB 4H0IA 5EC2B 2EH7L 1ZHKB 2Q76A 4MLIA 4ZAKA 1RJZA 3SKJH 1IC1A 4PS4L 1MCDA 4G7VH 1DUYB 1S7UB 1JJUA 2WLYA 5I76B 2CLRA 2HH0L 4Z7UA 1T1YB 2HT4D 1IBGH 4G43B 1JZ6A 1MIEL 1C5BL 3QNYB 2FZ3A 4XCFH 3GSVB 3UAJD 2NY5C 4MQ7B 2QSVA 3O3DB 4JO1H 4ODXB 4MXWH 3HMWH 3KJ4C 1AQKH 5ILTL 1HHHA 3ARDC 4BZYA 3LKNA 5FECB 4R96A 4GRWF 5EU3B 43CAA 1J9CT 3CK0H 5EU6B 4A2MA 4CU8A 3O2VH 4LOUC 1BM3H 3MRNB 3GBNH 1ES0B 1IC7H 4PRBB 3UTSE 2FO1A 1YEEH 4MD0B 2W38A 1DBAH 3M1BA 3SJVD 4GXVL 3T65B 1A3QA 3UROR 1U8NA 2R0KL 5T33L 4ZS6D 4PB9H 5E2WL 1CICB 1RUPL 1VACA 4NM8H 4F2MA 1MWAL 3L3JA 3IU4L 3S98A 1FG9C 1MWAA 1KLGB 4WY7H 2RBLA 4YPGB 1JNHB 4GRLA 4ONOA 3WIFA 3UJTH 4S1DD 4JPIB 1NBZA 2FJGB 3DO7A 1Z9LA 5SWSA 4E42A 3ALWA 4XI5C 4MDIA 3EW3B 4NWUL 3MX0A 1LE5B 3VGBA 5IB1A 3IJSA 1AY1L 1R5WB 3P9MB 3QJFB 4GAGL 1G7HB 1FLRH 1V7NL 4I8DA 5DI8B 5CBEA 2CGRH 4NNPH 5ACZA 4XMPH 3R1GL 3KPRE 3C60D 5FUZH 3OB8A 5DMKA 2XQYK 2CPCA 3UBXI 5FK9A 2VYRE 3DBXB 3EOBB 3BKYL 3P30L 4N8VA 5IFJA 1XT5A 1FE8L 3BW9B 5CINH 5I0DA 3NIGE 1VFBA 5I8EB 2C4FU 4W68A 5IEHA 4PV8A 3JV4B 4U1IB 4PB0L 5GS0H 1AJ7L 1I1YB 2OJEA 2L7UA 3RU8L 1QSFB 4FFWD 5D2LE 4P5KA 3SE4A 5FCUH 2IGFH 5HHPA 3V0WH 4ACPA 1UM4H 5KSAB 1RJLA 4FZ8L 1T2XA 2PYEE 2YSSB 1K4DB 4ONGL 1OM3H 3S7GA 5D96C 4OAWA 2DQEL 2GJ6D 4P59H 3AY4C 2ZCKL 2EEAA 5DHYA 4ZUUB 2VN7A 5I18H 3NBNA 3B9DA 4DKEL 1B0GA 1NGPH 3AM8A 1GL4B 4WEMB 2XTJE 1LO5B 4OM0H 3GMLB 4KY1H 1I85A 3N85H 4EBQH 5EWIL 1MCOL 3G5VA 4XI5D 1JE6A 2V7NA 5MENB 1QQDA 2WINA 2F9BT 4LCYA 5MEQB 2XN9D 4NPYA 3CFEA 4DZ8B 4P46C 5ID1B 3BPOB 6FABH 1CGXA 4OIAA 1ZT4A 3QXAA 3QWQB 4I9WE 5DTFB 4F7TA 4PRHA 2KBGA 4WI3A 4EOWH 3TIDA 1R5IB 2BNUB 5E6IC 3QDJA 5D93C 2DQGL 5KW9L 3SPVA 4FFYH 4ZPVB 5IIEB 3G6DH 2R1WA 1IKFL 1NANI 4EIGB 2ESVE 3TPKA 3C2AH 4YWGH 2HAZA 2W92A 3RRQA 2R8SH 5EORL 3O8XC 1CLYL 1RZKC 4HAGA 2N56A 1IM9B 2ZP0T 3KPSD 4FS0A 4NCDA 5D6CB 1U6AH 5IG7B 4Y7MA 2HRPH 1J86A 1TQBB 5F7DA 4WGWB 5KAQG 1WZ1H 1GZQB 2G60H 4WV1C 1A4KB 4YUEL 4U1JA 2P46B 4ZFGL 4L9LA 4PJDA 3NTCL 5E8EB 4LAQH 3KG5A 2OZ4L 1YPZA 2OZ4A 3IAPA 3T3PE 1OTTD 2VLJD 5DD5L 2AERT 4WUUE 3SDDD 2B8OT 2DQTL 3DYMA 1H3PL 5C08E 5JA8B 3VI3F 3N0PB 5EU5B 1KPRA 4ZD3H 1CIUA 1UB6A 3MJGX 1KTDB 3BKCH 1GOFA 3VXSD 3EIFA 1G6RH 1D6VH 4JKKA 3IJYA 2AAVA 4HD9A 1KGCD 5HY9B 4QYOB 1GXEA 5K33A 2SEBB 4D9RD 1CXKA 5E2VL 4KUZH 1JF1A 3MRDA 1P7HL 4UT9L 4K3EL 4K7PH 1HINL 3MLSL 4F7MB 4JZJC 4QCIB 1I3GH 2F74A 4U6YB 1UM5L 1N0XH 4LAJH 4XH2A 4ZDHB 1P7QA 2ATPB 2VDMH 1MLBB 3HMXL 3UDWA 3HMXA 3NACH 1WFNA 1FAKT 4M6NL 4WNQA 3QIUC 8FABA 2XZQH 4UTBH 3V5KA 3VXPA 1CQKA 4O51B 4K23H 3OXSB 5C0AB 5CJ8A 3P0GB 4KQ3H 2DM4A 3PWPE 5BMFL 3CCHA 4NCC2 4XNYH 1LO3H 3TBYA 2IANB 1A6AA 5B38A 1CF8H 4Y4FC 4YK4C 5FCSH 5KOMC 1C08A 1MFCL 4UBDD 3KYAA 3LKQA 1A64A 3RWGA 5DD3L 3WFEL 4F58L 5GS0D 1FZKA 4FQJH 1BIIA 2NY2C 4NFBA 5T3ZD 2DDQH 2FYYB 3MUGA 4C59B 4ZNEE 4WWKC 3PNWB 2K9UA 2Z8RA 4CADA 2UZIL 4H20H 4D0CB 4OCRH 4RQQB 5I8KL 3C6LC 3K1KC 1XIWC 3U36A 4EVNB 3OMZA 1OAKL 1CE1L 2LABA 4FFVC 3S97C 1OD9A 4RGMB 4JB9L 3ULSB 1CFVL 2J6EH 3EO0A 3MRIB 4KPHH 1YMHB 4GBXD 4IOSD 2X4UB 1QLFB 1UXWA 3DX9B 4FQCL 1D9KC 5EN2B 2OL3L 2AK4D 1I9IH 2OL3A 2QADB 4G9FA 1WTGT 3QIBD 2GJZB 5EUKA 1QRNE 3CVIL 5JHDD 4OF6A 2E7LA 5CGYC 4JCMA 2QR0B 2ZSVA 3BIKA 3WJJA 4ESKA 5FA4B 3MV9A 1SJVA 3ARRA 4U1GB 1WCQA 1SEBA 5I0ZA 2AK1H 2WQ8A 3IFLL 3NZ8A 2MPAH 4JN1L 4KMQA 1UYWH 3QXWA 3NIGF 3PQYA 1S9WA 5BV7L 5C0IA 3H9SD 2YK1L 1ORQA 2I60L 2UYLB 4N0CD 3EDDA 4LRIA 5GQBA 4KJWC 5DQJA 4ZUTA 1G7JB 1XGTB 3C6SA 1RURH 2VLRB 5D2LF 2GFBB 4L8SC 4Q6IA 4J3XA 1UXSA 3HNTH 1U8PB 1NAKH 2FATL 3VDCA 4XBGB 5DUBB 1F45A 3EFDH 4W70A 1T83C 1C12B 4LCWB 4GKNA 3GMOA 3VD5A 1T2QH 1OGAE 1JPSH 5C09D 5T5FL 3QCVL 3QIWD 1KACB 1NGYB 3RI5K 5FOJA 4M61A 2Y7QB 3QJHB 2WLZA 1XIWD 3LKSA 4OFYD 1EJOL 2XXCB 4QHNB 5EO0A 1GOGA 1DQQB 3DYOA 1WZKA 2NY3B 4YXHH 1L4IA 5BW7A 1IAOB