3UBXG

Crystal structure of the mouse cd1d-c20:2-agalcer-l363 mab fab complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVRISCKASGYSFTNYGMHWVKQAPGKGLKWVGWINTYTGEPTYADDFKGRFAFSLETSASTAYLEINNLKNEDMATYLCASAAGIRWAWFAWWGQGTLVTVSAAKTTAPSVYPLAPVCGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural basis for the recognition of C20:2-alpha GalCer by the invariant natural killer T cell receptor-like antibody L363.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 221
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ubxG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ubxG02
4AH2A 1FG9C 4S1DC 4R4FL 4P9HC 2ED8A 4O02H 5F8RC 3T77B 2XKUA 3WKMH 2F53B 5EIIA 4X8JB 3FN0L 4J1UB 4LMQI 1G7LA 2UZXB 3QXAA 4PJIB 3P30L 4M1DL 3FMGL 1JHTA 1VESA 3U7YL 4IRJA 3IGAB 1KUMA 5AYQA 5IG7B 4UB0L 4Z7WA 1NSNL 3BZFA 3O4LA 1AGCB 2XICA 1TNMA 2LQRA 1JZ6A 4L1HA 1QRND 2A73A 4KK8C 1T7WA 5GJSH 3OKMA 5DHVA 1FSKC 2RBLA 3U30B 3LKQB 1D5BA 3QEGH 1SYVB 5C8JA 1MCWW 4FABH 1OAUL 4MXWL 1Z6JT 1KCUH 4R96B 1X4XA 5C07A 4MWFB 1FPTL 1U8QA 4HJGA 1DUZA 1GGBH 1YECL 1R5IB 1E4WL 2GSIB 4NQXB 3S5LG 1J0IA 1FE8L 3HRZA 3IU3B 4W4OA 4DUWA 4FQXD 1FO0L 1J1PH 4UV7L 3F6LA 2PXYB 5FAAA 5E8DH 1I8KB 1DN2A 4D9RE 1T1XA 3A0OA 1GPOH 2HVJB 4Y1AE 3D2UA 2VLMD 4FFZH 2K7PA 3X13A 1R3HA 2VDML 3L5WB 2HMIC 3F7VA 1G6RB 3L1OL 2HAZA 3V7AE 2HRPL 2BY3A 3ZYOA 1YUHA 3UP1A 3RBGA 4YHZH 3CFDA 5F1SA 5ITBL 3SGDI 4YHML 2GJJA 2DF3A 3KPSD 5L6YL 4J12A 2YRZA 1CD8A 2CLRB 3EYFA 1S9YA 4FHBD 4LCYA 4CN6A 2C3VA 4HK3N 3MUGA 1CE1H 3DXAE 2HP4A 5F21B 4LFHD 5E2VL 2J8UA 1D3CA 4PY7B 3RVTC 1G0XA 2IPKB 2V9TA 1MQKH 3MMEA 2R1WB 3PJSB 2D7TL 3UTSE 4LLWA 1WZKA 2OJEB 3O2WH 2ARWA 2WZPD 2A6DA 1YY8A 1VPOL 2E6JA 2P7TB 4U6XA 2ZZUT 1FH5L 1TENA 3MJ9H 4H1LH 5C0DB 3TA3B 3GMPA 5DWUH 1B4JL 5E6IB 4ERSH 3CFJB 3U2SB 2BERA 2NY7H 4UDTA 3RUGA 3EJZC 1R3LA 3U1SH 1S7QA 3K74B 4K2UL 5D7JD 1B6DA 1DQLH 4PJAB 1JGEB 2OK0H 3P0YH 2R1XB 1G7JA 5CZVL 4JGUA 4IMKC 4FS0A 3IAGC 1AH1A 5DHYB 3G5YB 5DMGD 4NUGL 2OP4L 4OTXH 4HS8L 3A6CH 2VLRE 5GGSY 5BRZA 3O3AB 3ZE1F 3QUKB 4KMTL 4C4KT 2WV3A 1WBYB 1W2KT 1WIPA 2B1AH 1MHEB 2MHAA 2GK0B 3QT2A 2VC2H 3VXQB 4JFFD 4JFED 4LMQE 4KJPD 4OJFL 5I1CL 5ADPH 2VMFA 1M1SA 4OLYH 3NN8B 4ZS6D 5FYLL 3WJLC 3MV7B 4MJID 4AIZB 2A2QT 3G08B 5I8EA 1HKLH 1T1ZA 3O81A 3STLA 1FO0A 5ESAB 3WXVL 3O6LL 3FB7A 4RDQF 5FM5M 1J10A 3BEVB 4L3ED 2P1YA 4L1DA 1EZVX 5CMAB 3D85B 1BFVH 1DLHA 4MAUL 2FX8L 2G5RA 5E95B 1PKQB 4JRYA 1RAMA 5E5MB 5DI8B 5D1ZB 4G7YH 5MEQB 1JN6A 3R0MA 1CFQB 1ED3B 3CX5J 1VACA 3LKNB 4IIQB 4F57H 5IOPA 4YIQA 2R0LH 4U6YB 4CU8A 4MZ3A 3F12A 3GBNH 4RFNB 1XIWB 4HULB 5AD0A 1CG9A 1S7XA 2F5AH 5BVPL 2MMXA 4U1IB 5C0CB 2F53D 3LD8C 4E41E 1JZ3A 1MFDL 2FX7L 5GS0D 5CJOH 3MUZ1 4NRXB 5ECJE 5M95B 1UA6H 2OQJB 2EDJA 1PD6A 3VD9A 3AVEA 5HHOA 3SOBL 2ICWJ 4IMKA 3M1BA 4M8QB 1CXEA 1YPZF 2W91A 3HMXH 1EFXB 3QULB 4PRIA 4U1LB 5D93B 5H8DA 1SEBA 4M48H 4XPGL 3GKWH 4M1CC 2XRAH 4DZ8B 1VFMA 2YPKA 5GIRB 1NGZA 3CDCA 5I15H 2AK4A 3HPLB 4NZRL 3RGVB 3KXFE 4KHXH 2E9JA 1MF2H 3WJLA 4D0DA 3AGVA 5D71H 3GMLA 3D25B 3NA4A 1FJ1B 3QQNA 3TN0B 2FCBA 3QUZD 3WLWD 3W39B 2JB5L 3U9UB 3ZL4H 2WMPA 1C16B 1A6AB 3IF1A 4PJ9C 3NAAL 4I5BA 4KHTL 3V5DA 5K9OA 2QSCH 3TZVB 5D72L 4JY4B 4PJIF 4N9GA 3W11C 2ZUTA 2NW2B 3VGDA 4AG4H 4JG1H 5F7LB 5IQ7H 3HI5L 4Z8FL 3ETBF 1YN7A 4X80L 1ZKAA 3B5TA 4JG0H 1YQVL 1YNKL 3IJSA 4XWOC 3INUL 3FB5A 3CPLA 2V7HA 3UTTA 2XY2A 4XPAH 3PWJB 3IFLL 2FJHB 4U3XA 4H1LG 1JRHI 2X1XR 1JPSL 3EYVB 4TVSa 1X4ZA 4ZSOE 1AKJA 2X4SA 2BJML 1S9XA 1A6PA 1W0VB 1U8OB 2VDKL 2A0LC 4MXQC 4UILH 4X6DB 3QRGL 3MRDA 3HNTH 5T3XL 4XRCA 2EIZA 1FGVH 4I13B 1T03L 1OAQL 4Z78B 5GRUL 1A4KA 4JM2B 5CJ5A 5K59F 2OLDA 4OLWL 4WW1A 1IQWL 3EYQD 2OR9H 5B4MC 1X6LA 1L7TH 1YYLH 3VD7A 3VGHA 3WUZA 1NFDE 4JDVB 5ANMB 3S3JA 1IC5H 1JNHB 3B9VA 4Z5RB 3QCUL 1OW0C 1JYVA 2F8XC 2M8XA 2NY3C 1QHOA 2ED7A 4G9FD 4PJ9A 1NANH 4WUUA 3VWJD 4JGJA 3TBSB 5B8CB 1CE6A 1MLBB 3MLUL 1B6UA 1KYOJ 4HGMA 3U4AA 4P2RE 5F71A 3VFSB 1J0KA 1JL8A 4V1DB 3LDBB 1X5YA 1KB9K 1RK0A 4P59L 1A3RH 5EU6B 5I1JL 1BQHB 3RNKB 1F4WH 1QG3A 1G7MA 2DB8A 5DO2D 3V5KB 3VRJA 4GKSB 3RHWK 5IWLC 1RZKL 2ATKB 3ARDD 1KCRL 4RMQA 4LCUA 4AMKL 1KPVB 1PSKH 3T0ED 4LQ1A 2N7BA 4OCRL 3TBTA 3ARBB 4QTHA 3DBXB 3GI9H 1UACH 5BO1L 1QBML 4HK0B 1KJ3L 1ORSB 4NKIH 4KVCL 2AQ2A 4PRBA 3C60D 1IGIH 3CNKA 5C08B 1H0DA 3CMOL 1I85C 4PREA 4B50A 4Y2OA 2G9HA 1IGJA 5IT2H 4AEEA 4XVJL 5D7SH 3VG9B 4PJAF 1NL0H 4UT7L 1INDH 1CCZA 2YN5A 1LGVA 4LSQH 2H9GA 3VXRE 2OTPA 5CINL 1A7QL 2PTTB 2QKIB 4CVUA 1D7FA 4TTDD 1OW0A 2AGJL 4Y2DC 3S35L 4Y5YC 3MV7E 2FJGA 4WHDA 4J6RH 3KDMA 2VQTA 4ZPVA 2DN7A 5ACZA 5FF6A 5C0CD 3QRFM 1G7IB 4G9DA 2ITDB 1N6VA 1P1ZA 1SHMA 4RGOH 1NCBL 5L88H 3I50L 1I1AB 4YWGL 3L7FB 2D0HA 5SWQB 3RA7L 2Z92A 4UDUB 1ZLWK 2R2EB 3GSRB 3PV6B 1NGWB 1HXYB 4DKFL 2ITCB 3ZKXB 4OT1H 1SMAA 2UWEA 5HYSB 3BDXA 1VHPA 3L95A 1X44A 2NXYB 1RHFA 2W0FB 1EXUA 4M7KL 3V2AR 1U91B 1JWMB 4J3OC 1ND0A 3RGVD 3TVMB 4UAOB 5CJQL 3O3BB 5HDBF 5MP6H 4NNPL 3TEUA 1TVHB 3EO1B 4XNYH 5DURD 2L0DA 5EU4B 3LN5B 4QXWA 3S5LA 1OCWL 4NQEA 4X7FC 1T20A 4HPYH 1I85A 3F65A 4K3EL 3DX9A 4TVPL 1G0YR 3H2WA 3DUSB 5CILL 4RWYH 1JFQL 2I26N 5D6CB 2ADFH 4L4VB 3TZVD 2A6JA 4X7SL 3V0WH 3WLBB 2ICCA 4MCYB 3NH7H 4ALAH 1IT9L 2L7JA 3PIQB 7CGTA 3QNYB 1X5LA 2YRLA 1ZLVH 4E42B 2MWCA 1IGML 5FO9A 2KH2B 4XNZB 3HG1E 1YC8A 5DMYA 4ODWB 4Y2DA 3UYPA 5CAYB 2D7PA 4KZDL 4Y5YA 5BOPA 1F3RB 4FQQB 4CVWA 5I1IH 4XMPH 4WFGD 4BZYA 4NCDA 4LCWB 1LO2L 2W92A 4QLRA 4CNIA 2GCYA 4NO0B 1NLDL 3GNMH 5KSUA 2BVQA 4CAGA 3VFOA 1IFHH 4S1QL 3PQYD 4HH8A 2XN9D 1BVKB 1L6ZA 5AG9A 1IAKA 4G42A 3CDYA 5E70A 3CXDH 5H35A 3DROB 4R7NA 5CSZB 4DGIH 2NX5A 3BDYH 5SX5K 2FL5A 4KMQA 1I3RA 2JIXA 4NUJB 4F3FB 5ADOL 4JM2D 2YPLB 1U8IA 2BFVL 5TDNA 1FBIL 4WFED 5HHPB 3S34H 5HDQL 3CVHH 2PR4H 2VLKB 4IDJH 3EJYC 5FYJU 4J4PD 1U8PA 1I1RA 1K4DA 2WBJC 2GJ6D 4H25B 3X14A 1OWWA 3V4UH 1OGAB 4Y16A 5D7IA 5F9AC 4JVPA 5F1IB 5DD3H 2VDNL 3OB8A 4U6VL 5JOPE 3BEWB 3NCMA 1YEGH 3TPUA 3PUCA 4RISH 4U2ZA 3BGMB 3KYKL 1TCMA 2PO6B 1RZIA 2BVPB 5EOCH 1ZHLB 4GKNB 3DWTA 3O6KL 2A74A 4V1DD 5HPMB 5EU6D 1K5NB 4KJWD 1MNUH 3M8OH 2DI9A 4X6DF 1E0OB 3S36X 1U2HA 2PKDA 3B9KC 5HY9B 5FYJL 1R3KA 3PGDB 1RZFL 3HZYB 3I6KB 4P2OB 4P2QA 1QBLH 4JM2F 3VXME 3IETB 3MLTA 5F96H 4GXUM 4XBEL 4BQ9A 1VB9A 1Z0NA 1JYXA 3ARBD 4XWGL 3VGBA 4QYOA 4NM8H 5CP3H 3T0BA 1NC4A 5EB9A 1NUNB 5D7LD 5IVXA 5BVJB 5J57B 4WU7A 1RZ7H 5DJDA 4RBPH 3GSUB 1PBYA 3O8XB 4QRUA 4NDMA 4ISVA 3S97C 2DJ4A 3QR2A 4HMDA 3TCLB 4Z7QE 1S78C 1BP3B 4KZEL 3RWJA 4BSWB 2XPGA 2DKUA 3G5VB 2F5BL 1AHWB 1LD9A 4PJFA 3GK8H 2VIRA 3DUUA 4UT9H 3ZE0F 2WBJA 3R4DA 3LMJH 2JK5A 3IDNA 3WFCH 1JBJA 4U1KB 5D1XD 1R24B 3W5NA 4CVZB 4L29A 1G9NH 3MXVH 1YMMA 3ZHLA 1H8SA 3MACH 4QHKI 4GG8A 4XGZA 1P7KB 2CDEB 1R3IH 3NIDE 2DQJL 5C08E 4P9ML 1YECH 2C1OA 2FWOA 2YD4A 3ULUF 5HGAB 3SCMB 5D5ME 4M7LT 4XH2A 1G7HA 4JKPH 3DIFB 2DYPD 2EXWC 4MB5A 4JDTH 3GSNL 4Z0XB 4LSPL 2YBRA 2FO4A 3B9KA 2Z35A 4KVNL 1N6UA 2P5ED 3ZKSD 5ICZB 5BJTA 5CEZD 1XGUB 4HWBH 4CU7A 1NGPL 1MFBL 3BP7A 5C0JA 2YPVL 1UM5H 1FFNA 4L9LC 4RFEB 4XNQB 4Q74A 3ES6B 1FVEA 5TDOA 1BX2A 1JWUB 2HT3C 5DMIH 2J4WH 1DLFL 4ZXBC 5JR1H 2FZ3A 3SDXA 5I73B 3TP4A 1J0HA 1S9VA 1S7UA 3UTQB 1NLBL 2NCMA 4OCLC 1CT8B 2B20A 1KEMH 2YMXH 4LHUD 4ODVL 3OKLB 4JO3L 3WEXA 3BPOC 3C6LC 3OB0H 3VU2A 3EOAB 4K94L 2AEQL 2KZ1B 35C8L 2VE6B 4XXCC 3PNWB 1N6QL 3MRKA 3HR6A 5HI3C 1JPFB 2AJVL 1QA9A 3PWPA 4PGCB 2ZOKA 1A9EA 1Z5LA 4H1LA 1EJOH 1TTFA 4F9PA 4W70A 4TUJB 4UINL 1RJLB 5DC9B 3WUWB 1A14H 4CKVX 2HJFB 1B90A 3KJ4C 4R3SB 3TWCL 4OCSL 2OTWB 4PJBB 4U2YA 1D5ZA 2KUTA 4GW5A 1RUPL 4HIEA 1EX0A 1NANI 1CDUA 4L4VE 3ALPA 1GAFL 5LWYH 3BISA 1UH3A 2CKBH 3MROB 1T7XA 1U92A 4NQDD 3H6JA 4F7CB 1NDGA 3ROLA 3OGCB 4JDZA 5FYKD 2IBBA 1BFOB 1U8HA 1Q9OA 2HTKD 1RUML 2EC8A 2OP4H 4TUOB 2DWDB 3X12B 3FT4A 4DEPB 5FECB 1UVQA 5JPMA 3LIZL 1MWAL 2VLKD 4L9LA 4L8BB 4LCWE 4UNTA 3DURA 2MPAH 4PPTA 3GMRB 4Z9KB 5DJ6A 2HRLA 4WFFD 1UZ6E 5MEOB 2GK2A 5CEXB 4ZXBA 1KLUB 5T3ZE 5FO8A 1J1XL 1TJHH 1T22A 5EFIB 1AGDA 1XH3B 1KELH 3P40A 4HWEH 4GOSA 3WIIL 5IFJA 3V4VH 5EIIB 1UQSB 5GZND 4GQPH 3GSNA 1G7LB 1UZ6F 1CFTA 2CRZA 3C6LA 2AJSH 2YPLE 2EDWA 1C12A 1JVKA 4XP5L 8CGTA 1JHTB 3EGSA 5KG9A 3LH2L 1I1CA 1P4BH 4IRJB 4XXCA 25C8L 4P57A 2D4DA 4U1JA 1BEYL 3OXSA 4Z7WB 3VG0H 2VXTL 2HT2C 4NQVA 4WVRA 2QQQA 3O4LB 1OGAE 5KVGL 2AJYH 4P2OD 1CDIA 2A73B 5DHVB 4JY6A 1G84A 3LQAL 1DQQA 2AJXH 3EYOA 5DJXA 4LSSH 1JI1A 5C8JB 2P46B 1QOKA 2VZSA 4PB0H 3RY6C 4ETYA 4GSDH 5C07B 1Q9WA 3EO0A 1U8QB 4HJGB 1DUZB 1KXTB 3GBLA 4PRHA 2R2CA 2UY7A 3RWIA 3U7WL 3FT2A 4ODHL 3HRZB 4R26L 1MJUH 1WBXB 5I71B 3F7YA 4LVOB 1FGNL 2OZ4H 4IOFC 4MNGB 1KULA 2AEWA 4HQQH 3PHOA 3TJEH 2LTQB 1T1XB 1OOAA 1HWHB 5LXGL 1F4YH 5D7KE 3GBMH 2K3TA 3D2UB 4AL8L 3X13B 4YO0A 5E8PB 3EDEA 4K3HA 3F7VB 5IESH 5C6TL 3QJHB 2W07A 4S1SH 4YHLL 3MBEC 3N85H 5I19H 2ICWI 1NQBA 4MQ7A 1YUHB 4I4WA 5TE7H 2EE6A 3HC0A 4Y8AA 7FABH 3CFDB 5GSRA 4GRLB 4FFYH 3AFLA 4KHTH 2F19H 4JLRA 1D5XA 2XTJC 1MCNA 3EYFB 1S9YB 4LCYB 2EEBA 2C3VB 3MUGB 4DKEL 3MRCA 1YA5A 1CU4L 2IQ9L 2XZQL 1MWAA 1T04B 2VB5A 1YQVH 2J8UB 5IB5B 4MJ5A 4H8WL 3MMEB 2HLFD 1OP3H 4QGTA 3ARFC 1N2RA 4LLWB 1EIBA 1FSKB 4G6AD 5IM7A 1IGTB 1CGXA 1JPST 3AM8C 1RV6X 1P4LA 4LVHC 3MRQA 2A6DB 3RY6A 1YY8B 2HFTA 2BNRB 3G04B 4TNWF 4HIXH 1F4XH 4ZPTA 3OR7A 4PLKC 2VDKH 2X10A 4ORGA 3WFEL 3GMPB 1Q94B 2AQ1A 3BE1H 5ILTH 4UDTB 3RUGB 5C0FA 5IFAH 2I9LB 1R3LB 1S7QB 4PFEA 1SY6L 3BKCL 1A7OL 2ZCHL 4NQSB 1HH6B 1F58L 3U0WH 4ZDHA 4X9BA 4LKCA 4JJ5A 5GXBB 4FXKA 1G7JB 5BZDA 3BJ91 2HT4C 1K6QL 3RVXD 5BRZB 4WHCA 5JIKA 1ZHNA 3JVGC 1X3DA 2X44D 5KOVC 2MHAB 5JHDE 1YEEH 3VWKC 2DL9A 3MBEA 4RAVA 4KGLA 4YDIL 5E1AB 3FQWB 4LEOA 4IS6A 3NMEA 2O26U 3CUPB 4RMSA 3HTLX 4TYUA 2L7UA 1MAKA 5AZ2H 2FDBP 2YA1A 4KJQC 5I8EB 1G9MH 2EDRA 1QR4A 1T1ZB 3STLB 1FO0B 3FB7B 1U8MB 1WVZA 4FQ2H 1MCRA 4OF5A 1ZWIA 4LCIH 5IMLA 4P23A 1DLHB 1DBMH 3ARFA 2DD8L 3T65A 1N0XH 3QDJA 4JRYB 5C92A 2CKNA 2DWEB 2JJWA 1IILE 1FVDB 3O0RH 1JN6B 3AM8A 5B38B 4N0RA 4ZTPL 3VXUE 3P4NA 1GGCH 1VACB 3WS3B 4IHOA 1A7RL 5IOPB 4YIQB 4GRWB 4P4KC 4Y4FC 3F12B 5E4EC 4HBCH 5AD0B 1KJ3H 3QEHA 1JGUL 15C8H 2NY4C 1M6OA 4DN3L 3TYFA 1QBBA 4PJBF 3CFCH 4N68A 5GS2D 1QFWL 2JELL 2ERJB 4OLZL 4MD5A 3HUJA 4Q6IC 5HHOB 1SEQL 5ELIA 4HXBL 3E6FA 4YR6A 1MJ8H 4TRPL 4PRIB 3CH1A 4PUBH 4Q2ZA 1R6VA 5A16A 3RFZC 3JVGA 4QRRD 4B7IA 3S35H 2CDFB 2Z0BA 3FQUA 4O9HH 2MNUA 1SJEB 3VWKA 3OPZL 1NGZB 4KK9C 3Q5OA 2I27N 2EXYD 4U31A 4KRLB 4D0DB 1FYHB 1DQMH 1CDCA 3WHE0 3GMLB 3PXHA 1FZKB 1B2WL 3MRMA 4FTVA 5E6ZA 5C07D 2GSGA 3S3SA 3DI2B 4LIQE 1SY6A 2VAJA 3EJJX 4QOKA 4BZ2L 5JOFA 3V5DB 4L8DA 3DHMA 5K9OB 4M62H 3O4LE 5T1LD 4WTWA 1CS6A 1KCKA 2DM3A 3T1FA 2X41A 3P4MA 3IJSB 2A9NL 5FA3B 3C2AL 3FB5B 3CPLB 4Z7WF 3UTTB 4P5TC 3FO0L 3C6SA 1FYTE 1YZZA 4P4KA 4Y4FA 3RKDD 3BAEH 5EN2A 5I1EH 1BQUA 3DECA 3NZHH 4C56A 1E27B 1JGVL 2Y7QB 3LD8B 4J3SA 3OHXA 1H8OA 4ZMAT 4WGVB 1S9XB 1BMGA 4PLJD 2JKXA 2B1HH 4H88L 4KPHH 4QRTA 3OQ3B 1HINL 4DKDC 4MNGE 1C5CH 5I0ZA 2BXYA 3MRDB 1YYMH 2ZUQC 4XRCB 2EIZB 4PBWD 4XP4L 4PLOB 4XP9H 3QQ3A 1A4KB 4D9RD 4NKMB 1A6ZA 1WFUA 2AXFA 3VFGH 4WW1B 5DR5L 4KK8D 5CWSB 1MH5A 3ZDYF 2GTZB 2J6EL 2APTA 4Y1AD 5D8JH 5J3HC 3ULSB 1ZGLM 3BIBX 3UO1L 1A6VH 1MIEL 3WNMA 4LHQB 5L8JB 4GAJL 2DBLL 2Y4SA 4PJ9B 1U0QA 1TCRA 4ODSH 2A77L 5C6PB 4PJ5B 1J8HA 4PJEA 1KIRA 1I9IL 1CE6B 3KHQA 4R2GC 3I6LE 4ZO9A 3AAZA 4YUEL 3LKOA 4X4MA 1VGKA 2OR8A 1ZT7B 3X3FL 2DTMH 1M71A 5K9QG 2F74A 1AQDA 4JVUA 3N50A 4ZD3L 3PP4L 3CLEH 3VRJB 1G9NC 1K3ZA 4P5TA 4WU5A 4ZFGH 3Q6FA 2J8UF 2BNRE 2HFFA 5J12C 5C09A 3ALWA 2Q8BL 1MVUA 2HMID 1T0PB 3CXHJ 4LCUB 4FFWD 4N0UB 1GC1L 1FZJB 5IBTH 1WWBX 4UZGA 3IDXH 1VSCA 2VAAA 4NO2A 2CD0A 1WFOA 5C0RH 3KS0J 3TBTB 4OKVB 3CFEA 4G6KH 3BKJL 3RUGE 4F15B 1UENA 2LU7A 2Z31C 4HIJA 1CBVL 4PRBB 4LDLB 1JYNA 4HGWA 4LQFL 1KV3A 2WWMC 4ZOBA 4I9WE 1H0DB 1V7MH 4PREB 4PJHA 3RVTD 2G9HB 1IGJB 1QEWA 1RJCA 3RUGF 5BRZE 3IFOA 3E6HB 4FNLL 2G2RA 4XHJC 1N5AA 4JRYD 1OPGH 2VLRD 4MGXA 5ALBH 1QFUL 2H9GB 4HT1H 5C71A 4BSVA 3U46A 4LARH 5GRVK 2CO7B 2R23A 1B0RA 2Q8AH 3LRGA 1GRWA 3BQUC 2CK0H 2FJGB 3SE9H 3RTQC 4BH7B 2XYCA 3KDMB 1AXIB 4ZPVB 3KYAA 2ZUXA 3QDMA 5IGXL 5ACZB 1LO0L 5FF6B 4G9DB 5EU7E 1P1ZB 5DVMA 3EJZD 3NCEB 3H3BC 5MERA 3G5ZA 1IGCH 1HH9B 1UXSA 2Z92B 5EC1A 1MCKA 3D3VA 5K33A 3VXNA 4E5XA 2VDQH 4H5SA 4HMEA 4JO2L 3EO9L 2J6EA 2UWEB 2XY1A 5FGRA 3DYPA 1U6AH 3K8MA 3GMNA 5JLZA 5BZWA 2IPTH 1RZJL 3AS1A 4GRWE 4XPHH 5HDLA 3QISA 2D7NA 4LLMB 2EH7H 1MCDA 2QJDA 3VFWB 4C55A 2AK4D 3PDGA 1WIOA 4PJGA 1PG7H 3AMKA 2X6MA 2Z31A 2AK1L 1KIQA 4EBQH 4XC1L 2G60H 3THMH 4E41D 2JCCA 4GRWF 2CUIA 1ZA3A 4AEHL 4N1CA 3S5LB 1J18A 5I17B 4G6JH 1MJ7H 4NQEB 5A2IH 2YRPA 1CXFA 4KVNH 1MQ8A 2A6JB 1D5IL 4JPWL 1QKZH 5EZJB 1FFOA 5CUSL 3MV01 5IV2A 1BBJA 1TZHA 2HTLC 4OSUL 1PEZA 3BQUA 4Y5YB 5I1DA 3UTTD 2OSLA 5E6YA 3MNVA 4DTGH 4NZUL 4J3WA 2X4PA 4HBQA 5FYLD 5I30L 4DCQA 2J8HA 1RQ5A 5AWNL 1V3JA 4HUVA 3MLRH 4CNIB 2GCYB 1AKJD 4O5LL 5KSUB 4MJ4A 3ULVH 1UB6B 3WO4C 1TTGA 4EI5A 1T2QL 4TNWK 1Q38A 2RFXA 1IAKB 1KNOA 3NGBC 4BM7A 2UYLA 3CSGA 4M1GL 4LLAA 1EEYA 5CP7A 4R7NB 2NX5B 4F33A 3ZO0A 2FL5B 3FONA 3ARGC 2JIXB 2QQKL 5FO7B 2OJZL 4M1CD 2DQUL 3L5JA 1AFVH 2CH8A 1U9KA 5CHNA 3V52L 2MOVA 4PD4J 3RJQB 4Y19A 2OBGA 1BZ9B 4PGEA 1K4DB 5IHZA 4QRPA 5MENB 1GZQB 1NAMH 1Q0YL 4CDGC 3H42L 3A67H 5T1MB 2V9RA 3PHSA 1NCWL 4XVSH 4Y16B 4WI8A 1MREH 4AZ8A 1RUQH 4N5UA 2VLLB 4PJ9D 3TPUB 4WUUD 3G5XA 2DQTH 4XBGA 3PE9A 2P4AB 5I1HH 1CFBA 3VRIB 3SEPA 1RZIB 1IM3A 1U8NA 2ZUYA 5CGYC 2YKLL 3RL2B 3W11D 1MOEA 4NZDA 2A74B 2Y6SC 3WNOA 4R97C 1Q1JL 4PJ7A 3PG2A 2I60L 4N1HB 3FRUB 3BWAB 4XWOD 1RD6A 1NBZA 3JWOL 3VGEA 1VA9A 1R3KB 4P2QB 4FOMA 3BGFC 3HPJA 5TE6L 3MLTB 2IANB 1MCPL 4LASH 5IMOA 3CZFA 3OZ9L 1BQSA 1PW3A 4PJ5E 1EMTL 3O6ML 3SO3C 5F9OH 1MRCL 1UM6L 4QYOB 1ZT1A 1NC4B 3BP5A 5JNYB 5BS0A 2A0LD 4MXQD 4OM1H 3VFTA 5IVXB 2DJSA 2HKHL 4WU7B 1KTLA 2EYSB 2ZNWA 2GHWB 3FQRA 4XCYA 4LFHG 4ISVB 4NDMB 25C8H 4YBQC 4NKDA 2H41A 1QLEL 2W1NA 3HI6L 2AJUH 5B4MD 3RWJB 5BV7L 4N0UE 1LD9B 3MO1A 5IW1A 2VIRB 3DUUB 4OFPA 43C9A 4BA8A 2VXSL 2JK5B 3IDNB 4K8RH 3CX5K 4KKNA 1A22B 2R9HD 3DARA 2PCPA 4HIHA 1FDLH 2NY3D 4L29B 5E2UH 5I1LA 2LABA 3BFOA 4WCYH 2FH8A 2P8PB 1NC2B 1E28A 3DO7A 4XGZB 3BZDA 3FZUC 4NWUH 1DL7L 5B3JE 3BW9A 1J86A 4I8DA 4RGNB 2C1OB 1FAIH 2FWOB 5GS1C 4DN4H 1G7HB 1MFCL 3HFMH 1ZEAH 4AK1A 2APVA 1PYWA 3GRWH 4RMRA 1U8LA 2AXGA 1LO3H 2AS5M 4QO1A 3S7GA 2YBRB 3WIFA 1ZLSH 3UC0L 2FO4B 2ORBH 2APFA 2X7LB 4EQ2A 1GZPA 4GBXC 5BJTB 4HUXA 4X6CA 2CLZA 1RIHL 3UJJH 5C0JB 3D9AL 1P6FA 3WIHL 1Y0LA 3Q1SH 3PGFH 1U8JA 5DD1L 4Z7NE 1KEGL 4LSRH 1FVEB 5F1OB 1Q9KA 4HZLB 5TDOB 1BX2B 3JXAA 3IRZA 2O5XL 4GUPA 3Q48A 1C5BL 1S9VB 1RMFH 1S7UB 1UZ8A 4K71C 1NFIA 2WQRA 4JRWA 2CR6A 4POZC 4LCCC 2X4TA 4OF7A 2E8YA 4NSKA 2UZIH 1UWEH 3KPRB 3R0NA 5T1DH 4YPGA 3CVIL 1TETL 1P2CB 2F54A 5CIPH 5DVKA 3MRKB 3PWPB 1QA9B 1YEHH 4Y2DD 2ZOKB 2UWEF 1A9EB 1Z5LB 2XQYK 1D6EA 1H9VA 5BQ7A 5GJTL 3BRGC 1CFVL 4BZ1H 2XKNB 1BLNA 1U2CA 1OB1A 2EC9U 12E8H 1MPAL 3QXWA 5FXCH 3F7PC 3EOYG 4NQEE 4PBVC 1GGTA 3R1GH 1D5ZB 4HIEB 1S7RA 1HCFX 5F3HA 3SKNA 3QFJA 2SEBA 1ZV5A 3BP6A 2YD3A 3AS0A 1F58H 1U92B 4NWTH 2VXVH 1NDGB 3ROLB 3MGTA 4KI5F 1RUKL 2QSQA 3CSYA 4JDZB 2NX5D 3UZQA 4GBXA 2IQAA 1WZLA 1I8MA 1Q9OB 2JIXD 1VADA 4XNXL 2XA8L 5C7XL 1UVQB 2ATPB 5JPMB 4L9LB 1QLRA 3KLHD 1KB5A 3DURB 5DDHA 5DJ6B 2W60A 3U9PH 5KSBA 4CN4A 1IAOB 1Z3GL 5SWSE 3O2DL 1T3FA 4KROB 1LEKA 4WWKB 5FO8B 3PABA 4UT6H 5F7FA 5GS3A 5BXFA 5DMKA 5IFJB 3WMSA 3ZTNH 5F6IB 4LCCA 2VXUH 2FX9H 4UIMA 3GSNB 4ZUWA 1KYOK 3KLSA 3SGJC 1S7VA 5GISH 1C12B 4K23L 1AXSB 4LHJB 4QGYA 5BOZG 3EGSB 4ZS7L 5KG9B 2IADA 2WLZA 4P57B 2UUDK 4U1JB 2YS4A 5L7XL 3OXSB 5MENE 5E24E 3OR6A 4NQVB 4XCCH 1KCVH 4XPBH 2ZUUA 5HSFA 4ODXA 3NCCB 2HKFL 4JY6B 2VZ1A 1A47A 3W9EA 5MI0C 1EDQA 1JNLH 1FORL 2P48B 1EV2E 5F7EH 3EYOB 3LKSA 5DJXB 4FQCH 1PZ5A 2LFGA 5HHNB 5DQDL 2BMKA 4X99B 3B8SA 5D7IF 1Q9WB 4YFLI 1LVEA 3IDJA 4PRHB 1JTTA 1F8TH 2K7QA 3RWIB 5F7YC 3FT2B 4P5MA 3I75A 4X6BA 4DZBA 4HUUA 3CK0L 3FN3A 3FHAA 4OZGB 3LN9A 5AZEH 3GMQA 3TNMA 1OLZA 2W9LA 5IW6A 3EJYD 3SDDC 2CUHA 2IANE 3NCJL 3PHOB 1IM9A 2WBJD 5DJYB 5HI5C 2Q1EA 5E2TL 1BJ1H 2H45A 2I9TA 3GHBL 5ICXA 3G9VA 4GMTH 4YO0B 4OIBA 1YMMD 4TVPE 1YDPA 4U4BA 5KVEH 1DQDL 1T5XA 5MEPA 5JW4R 4Y5VC 4ZNCD 3BN9C 4MQ7B 4DJMA 1QRKA 3HC0B 4PJXA 4DGVH 5GSRB 1S5HB 4NO3A 4YPJA 1FRGL 1NDMA 5F6HI 2FSEA 1D5XB 5IVXF 3FN9A 5E5RB 4MNQB 5C0BE 1HIML 1INQA 3B2VL 3B9KD 1MWAB 1NAKH 1J1OH 4JHAL 4I3RL 4Y7MA 4MJ5B 3MQIA 2BVOA 1T1YA 4EN3B 4YHPA 5JDSA 4YDJA 5EG6C 3FOLA 1N8ZB 3O2DA 5LGHL 1U3YA 5IM7B 1CICC 2ZPKL 1P4LB 3TBYA 1UXWA 3MRQB 4RGNE 1S3KH 2A38A 4G6ML 2DQDH 1OL0A 1XF3A 1X5HA 4LAQH 4ZPTB 3OR7B 2UVEA 1H3WM 4J3UA 4QXGL 4ORGB 1DR9A 3PWVA 4GQ9H 4FZ8H 3T4AA 5JO5B 5C0FB 3MXWL 1A7NL 3MODH 2HJKA 1S78D 4B41A 3IKKA 4HG4J 3HAEH 3SDDA 4ZDHB 4JJ5B 5DT1L 4FXKB 4QCIA 3JUZA 3ARTA 3KPLB 5T33L 5BZDB 3OAYK 3G6DH 4PR5A 1DFBH 3AUVA 3ZE2E 1QSVA 1MIML 4NQCA 3P2TA 2UY6A 3K2UL 3RWGA 1ZHNB 4MJ6B 5A43C 5T1KA 2EIBA 4Y5VA 4OLUH 3MBEB 4RAVB 4ZFOL 2G75B 1IKFL 3NPZB 5KZCB 5KVFL 4IS6B 3GJFB 1XFPA 4JQXC 4Z7UA 3KPRE 4IJ3C 2EXWD 5CFHA 3P11L 1A1MA 1L0QA 4TSCH 3SDXF 2EZ0C 2Y72A 2P8MA 1QRNA 3B4NA 1LMKA 1ZWIB 3PWPE 5IMLB 1XCQB 4P23B 4Z95H 5DRWA 5FIEA 3T65B 3T2NL 4NHCH 4OQTL 4Z18A 3QDJB 3H9YA 1CICA 3RGHA 3FO9B 1E6JL 5DZLA 3WD5L 3P4NB 1Y6NR 4UTBL 5JXAH 1CGVA 3MBXL 1M05A 4IHOB 2HT3D 1WAAA 4ZXBD 3CU7A 4BFIA 4NJ9L 5IJVB 2W65A 2M2DA 1NJ9A 4NBZB 3QEHB 4ZYKA 2R4SH 2PYEB 1P7QA 3N9GL 4F9LC 4FQXA 5D7JC 1AIFA 4M7JL 1MAJA 4LP4A 5DZNA 1KJVA 3C6LD 1ADQL 5HDOA 2E7LA 2XOTA 3E6FB 4ZNEA 3HB3C 4N0YL 1MI5A 1EEZA 5DQJA 1IL1A 1YJDH 1IGFH 3MCLL 3CH1B 1J0ZA 3NACL 3VI4F 5DK2A 4U1GC 3U4EA 5A16B 1FNFA 3CLFH 1A1OB 5DSCA 4A2LA 3N0PB 3KPPB 1TITA 3G6AA 2QL1A 4K3JH 3ULVC 5IGXH 1SYSA 5BCAA 5L2KB 2CR3A 3EOTL 4QHNA 1T6VN 3ISWA 3L7EA 4JQXA 3FB6B 4FTVB 4XCEA 2OCFD 5KAQG 4WTXA 1LILA 3GSVB 5I6XC 1NEZG 5JMRA 4JO4L 1P6AB 5ESQA 4BK5A 4QOKB 5JOFB 4XP6L 5JORA 4L8DB 1R0AH 4ODBD 2VQUA 4YLQT 4L8SA 1OVZA 1A8JH 3LSOA 3T1FB 1NMBH 3QHZH 2NTSP 3TT1L 4JZOA 2ZCKH 4JZNB 1KTDA 3MV8E 3P4MB 2B0SH 5AYUH 2XZCL 1HHIA 4JO1H 3L3OA 3T4YB 3WFBH 3B6SB 1QSFE 3P77A 1A21A 1H15B 4FZEH 4LLYA 4ZFOA 2Z8RA 3C6SB 4Y4FB 4OCNC 3UJTH 5EN2B 4OM0L 4F9LA 3TO4C 2B2XH 4C56B 3MGOA 3U36A 5CBEB 4HKBA 3OHXB 3NFPB 5D7JA 4UQ2A 5F7DA 5EIVA 1L9MA 3WBDA 4OZGE 1KB9J 2X40A 5FGSA 2C4FU 3B9EA 4OQTA 1A6UL 1A64A 1SJVA 3QQ3B 3KPNA 2DMBA 3IFNL 4NRZA 1A6ZB 5GSVA 3LKRA 2AXFB 2ADGA 3BN3B 3ARYA 4OZGF 5E99H 1WGOA 1MH5B 1MFEH 4LGPB 2DMCA 4JN1H 3VXPA 3C87A 4AYFA 4QHMA 4RFOH 3O2VL 4Y8DC 3MC0A 3EZJB 4ONGL 3UJIH 1OQXA 5HHMB 5DHXB 3DI3B 4ZAKC 1FHGA 3QUZC 1CL7H 1NMAH 1OY3B 3MRBA 3QCVL 4KUZH 3C09C 4G8GD 4CJ1A 3V7MA 3H3PH 1TCRB 3BT2L 1ADQA 4RMVA 4L3EA 4MNQE 1DUYA 1J8HB 4PJEB 1KIRB 5FOBA 3O9WC 4F2MB 2VDLH 1BOYA 4RGMC 1I7TA 5EO9B 2A6KA 1AGBA 4MD4A 1XGPA 4PTTA 3AAZB 4Q9RH 3LKOB 3UPAA 1VGKB 4IOFD 3RQ3A 1M71B 1CF8H 1KN2L 2RHEA 4OF0A 3QDGD 2F74B 1AQDB 4XXDA 5CJBA 4EEEA 5K9JH 4LSTL 3EDKA 1HN1A 4RAHA 1QD0A 3QXUA 1UKTA 5FV2A 4NQUA 2IPUG 3BKMH 3BD5A 4P5TB 1HE7A 3Q6FB 3STBA 2HFFB 3I9GL 1BF2A 5IMKA 1A7PL 1MVUB 2DI8A 2YEZA 3TV3H 1UCBL 3AREC 2XQBL 3VFVA 4Z7VA 3TO4A 1JGLH 4NO2B 1AY1L 3DHJA 3MBED 2LVEA 1CGSL 2H26A 5KZCD 4LLQA 4FQ1L 3OSKA 1YNLH 3CFEB 3NA9L 4OZHA 1IBGL 1WC7A 5FB8A 4NZTH 4EOWH 2XTJD 2YKLH 4HGWB 5JW5A 3VW3L 1GXEA 4Z76A 1TQBC 4R0LC 4QRQA 4YGAB 3L3IB 1QEWB 3JV4A 1WLHA 4KQ4L 4NGHL 3IFOB 1W72L 4QHUB 2G2RB 3ARFD 1N5AB 3QDJD 3R06A 4ZUSA 3UBXI 4HAFA 5IBUB 1PDKA 3SPVA 1J5OL 2GQHA 1PGRB 2CGRH 2LE9A 4JREC 4BSVB 1SMOA 1B0RB 3QUZA 1L7IL 5JUEH 2GTWA 2JB6A 3UCRA 4PLKD 4NJAL 1HDMA 4TOYL 1KCSH 2YXMA 3QDMB 4GW4A 2AKRA 4M6OL 3O9WA 3IDUA 3AXLA 2I5YH 3D69B 4QHLA 1FFPA 2BDNH 3SO5A 3P4OA 5MERB 3G5ZB 4HS3B 1UXSB 5J13B 3SGKC 2B4CH 3RX7A 4DVRH 1FIGH 3D3VB 4Q58C 3VXNB 3L3GA 4ODTH 3KPOA 3AS2A 4M6NH 5DO2C 4H5SB 2HT4D 4H0GA 4OGZA 3MRHA 5SV4A 3GMNB 5JLZB 5BZWB 3VXUD 2DI7A 4D2NA 3U83A 3FJTA 5I76A 5I75C 3EW3B 4YHIA 3RWFA 5HGDA 3VWKD 2PYEE 2GITA 4EZMA 1WEJL 4Y4HC 2Z31B 4MA8H 1KIQB 4YXLH 4YHKL 4JVWA 5CGTA 4KJQD 2JCCB 3B43A 2FD6H 1OM3L 4R0LA 1AGEB 4U1MA 1XGTB 3JTSA 5DEZA 3WFHA 3GUTB 2BXZA 3O3EA 1ZA6A 1MCOL 3F5WA 3HUJF 4HF5H 1U8KA 1YY9C 3PWUA 3F58H 1FFOB 3LV3A 2QQLL 2IGFH 5IV2B 1BBJB 5I9QB 5FUZL 5L2KE 1TZHB 5J11C 2H1PH 4ELME 4G9FA 5I1DB 2OSLB 5IEKA 3W82A 1NUFA 1UGNA 4P4KD 4MQSB 5TF0A 1WITA 2X4PB 2ZSVB 3OX8A 4DCQB 3FRPG 4HUVB 3H0TA 4XTRC 5F89A 2NY4D 4KKCC 2X4UA 3PWNA 1GHFH 2FECI 4EI5B 2EEDA 4S1RH 3MLPA 5D2NB 3SGKA 1AO7A 1KNOB 5CIPA 3UEZA 2UYLB 2E7BA 3OAUH 2D7OA 1W72A 1TETH 4UOW1 4XX1G 1UYWH 5CP7B 5HHXL 4PG9A 1AQKL 2VLJE 3ARDA 4WJ5A 1F13A 2IH1A 2DM2A 2CQVA 4MZ2A 3TT3L 2JLLA 2AEIT 1NCTA 1RVFH 5IF0A 2R4RH 2A83A 3T0EA 1IAIH 4KK9D 1DBAH 3GHEL 4LF3A 4PGEB 4EDWL 1II4E 4C56E 2WANA 3BGAA 3WN5C 5IFHH 3LS5L 5IHZB 4Y4HA 3QQ4A 1AD9A 3PDOA 3MX0A 4JN2A 5E08L 5F7MC 1MCHA 3SJVB 4YE4L 5C0AD 1X5KA 3FFCE 2UVFA 3ELAT 1JF5A 3G5XB 3S3PA 1J8HD 1MSPA 4XBGB 5E8NB 1IAIM 1UM4H 5E00A 1B0WA 2WIMA 4APQC 3W2DH 2QV2A 4PGBA 3HC4H 1IM3B 1FLTX 2XZAL 4L4TA 4KXZH 4XI5C 1DEEA 3E8UL 1YEFH 4PJ7B 1FN4A 3OKDA 3JWDL 3MLWL 4X4XA 1GOFA 3LB6C 2AERT 1NBZB 4EQ3A 5HHME 1S5IL 2ZOLA 3OAZK 4P5TD 1HILA 4LEXH 1LP9E 5C09D 2ADIA 3HPJB 2VDOL 2EEAA 2HH0L 1ZVHA 3CZFB 2I25N 4CL7A 1EGJH 3A6OA 3QUMH 2DKSA 2O5YH 3UYRL 3MYZA 3QIUC 3BP5B 2VWEE 3AS3A 3VFTB 1O7SA 4QXTA 4I0PC 1KTLB 5SWZA 1L0YA 2IMMA 4G8FA 4GAYA 4ZS7H 3FQRB 4K3DL 4XCYB 5KS9A 4PJEF 4U6HA 4WUKH 2V5SA 3BX7C 2VH5L 3IDGA 4ZO8A 1ES0A 3S35X 5J3HD 5IW1B 43C9B 1Y18A 1Q72H 4IRZH 1X4YA 3WN5A 1MAML 2FBJL 1BD2A 4K9EL 2R0KL 4U33A 5D96C 1JHLL 4HIHB 3W0WA 5DGQA 5I1LB 3MFFA 1CDBA 2F58H 1E28B 3CDFA 3MUHL 4TUKH 3DO7B 1QVOA 4OGXL 1HZHL 5L8KB 1IRAY 3NPSC 1WJ3A 3S6CA 1FLRH 4R2GD 4APQA 5DUMH 2P42B 4I9WD 1NFKA 1CLZL 1T83C 3CK0H 3BRFA 1PYWB 1U8LB 2FBOJ 1Q8MA 4H26A 4R97B 5EZOL 4ZOEA 4Z0BL 1EHAA 4MQXC 1P53A 1RURH 4J3XA 3CCHB 4JPIA 4JRXE 4HUXB 3UYOD 3BGFB 3GI8H 4X6CB 2CLZB 3QAZC 3MV9E 4K9EC 4MLIA 1U8JB 3QDME 1KC5H 3TC9A 4FQJH 1Q9KB 2XN9A 1KFAH 2IBGA 3QIUA 2Z31D 3T3PF 1OQOA 4GMSL 4EVNA 4GUPB 3JTTA 2VDRL 4I0PA 4AT6A 1NEZA 1N64L 2N4IA 1CLOH 4NP4L 2WWMD 1UZ8B 2XACC 1DSFH 1ZS8B 2EH8H 3WO3B 4HEPG 2A6IA 2X4TB 4NOBA 3RI5F 4YHOH 2DQIH 1KTKE 1HNGA 4XHJD 4AEIH 5CEZL 3I3BA 4YPGB 3W5MA 3T0XA 2GJ6A 3GIVA 2F54B 1FNLA 1RUAL 4HV8A 5D1XC 4V2CB 1LNUA 1AI1L 5KVDL 3H8NA 4YK4C 3PGCA 4X5XB 3BQUD 3CC5A 1D6EB 3HKFA 5IKCA 4G8IA 5BQ7B 3RTQD 1XR8A 1RFDL 1BLNB 2JCCE 1OB1B 4O4YH 1FNEA 5FCUL 5SX5H 1JNNH 1CL7I 3STZA 2CK2A 4PS4H 3P9LA 4PJGF 1T83A 1Z9OA 4HWNA 5F3HB 1CWVA 3SKNB 1D6VH 2SEBB 3QFJB 4OZIA 4Z7OF 2FEDD 2JCCF 4L5FH 4QKXB 1YJDC 3NCFB 4M3KB 4TSAH 3BKYH 1HOCB 5E94B 1IMHC 3GIZL 2QSTA 3EOBA 3MGTB 3IKCA 4UNVA 5BV7B 1I1YB 5ESVA 1XF5A 2ZSWA 4GBXB 2IQAB 4QXUL 4P46C 3D39A 2ZG2A 1VADB 5EUKA 5F1NA 4NYLA 4FQLL 4EUPG 1LO4H 1YEIL 1XMWA 3JV6A 4Y19D 3VMNA 5C86A 1QLRB 1KB5B 3Q6GH 4DUXA 5DDHB 2RB8A 4UU9B 4O2EB 4QRPD 1NCCL 5GZOC 5D7LA 1T3FB 1LEKB 1A6WH 5D2NE 3QQ9D 3PABB 4P3CH 4NC1E 3L3KB 3P9MA 1HXMA 2JJTC 5BXFB 1I7RA 4KDVA 4V2BA 4LCCB 4PYGA 1OD9A 5FYKL 1S7VB 4BKLA 4CJ0A 4OCXH 2FATH 1X6NA 4NOFA 3S4SG 5LGKA 3MYJA 3LS4L 1TLKA 2DKMA 3QCTH 5D1XA 4D9LH 5ICYA 3SDYH 4CADB 4O00A 4MA1B 4MDJA 3GO1H 3LEVH 3FO2A 1WZMA 3OR6B 1OAKL 2Z91A 4Y5XC 3B9DA 2E27L 4P3DB 2GY5A 4RMUA 3SJVE 3CXHK 3D0VA 2NLJA 1A5FH 5DJZA 4JFDE 1F3DJ 5GRJL 5LAXA 1A6TA 1PZ5B 3RNQA 1E4XL 4LDOB 2XZZA 2BMKB 5EOQL 3LQZA 5BS0D 4M03A 2J7LA 1EERB 1ROWA 3OL2A 1V05A 4N90D 1GIGL 4PJ7E 2P5EA 4ZQKB 4GG6E 3MOAL 4P5MB 3DVFA 2RR3A 3I75B 4JR9H 1JMXA 3ARGD 4KDWA 4X6BB 4P46A 2D3VA 4HUUB 2X4NA 5GHWH 4DZBB 1G7PA 1MRFH 2OL3L 2UZYB 4A6YH 4PRAB 1HWGB 3TNMB 3GMQB 5KW9L 4WEMB 5D1QB 1R5WA 2R1YA 1FIEA 4HLJA 4PJ7F 3FT3A 1CLYL 3CH8A 2VZVA 4U1NA 2I9TB 3FKUS 1MCWM 3A6BL 3BPLC 4PRDA 4X6EA 4D3CH 2ZUVA 1LHZA 2X9WA 3V7AG 5ICXB 3EHBC 5K9KA 4P5KA 1QYGL 1U3HC 3ILPB 4CMHC 1YDPB 2JJTA 5GS0H 1T5XB 5MEPB 5KTEL 1JK8A 2J5LB 2FB4L 4OFDA 2Q7YA 4LRNH 4OLXH 3LEYH 4PJXB 4DK3A 2X09A 4H20H 3QPXH 4KV5F 1R5VA 2Y6SD 1NDMB 2FSEB 5I8CA 2NXZC 5DRZA 5J89A 3EDJA 4GW1A 5D2LE 4KY1H 2VKXA 3HZKB 1INQB 4Y5XA 1NBVL 1RK1A 4G3YL 4OI7A 3ME0A 4F7EA 2BVOB 1T1YB 2F8VA 2IFFH 4YDJB 3C5ZC 3FOLB 3V6FA 2MCPL 2R0ZH 4HFUL 1C1EL 5EBLA 4UUJA 3QI9C 1NGXA 2ENSA 1FL5A 5GGTL 3TBYB 2NY5H 3ZKQD 1CXLA 5DUPL 2DQHL 2PYFA 4GAGH 3HLAA 5JMOC 1X7QA 1BBDL 1XF3B 4NQDA 1J88A 4I2XA 4XCNB 2OTUB 1ODAA 3PL6D 3O4OC 3VFUB 4G5ZH 1JZ5A 3PWVB 3LRSA 1LK3L 2YZ1A 3T4AB 1S7TA 1LE9B 4QNPE 4ELKA 1F4HA 3PP3H 4AIOA 2NY0B 2RCSL 2HJKB 4ONFH 2Q87A 2I07A 2GJZB 3LRHA 1ZT4B 3OG4B 4GS7C 4K7PL 1KJMA 3MA9L 4KAQL 5K93A 5EU3A 2GT9A 1HHKA 2VR9A 3MRGA 4DW2H 4PR5B 1KG0A 2BHYA 2E7HA 3QNXA 5AEAA 4M5YH 3VGFA 1IAII 4NQCB 2D31A 5HD8C 1G6RH 1U3HA 1GL4B 3RWGB 3FRPA 4JY5L 4X6CF 4HC1L 2WUCL 3TBVA 4P48A 4Y5VB 1B88A 1OP5H 5DMJB 3UTPD 1DJSA 2H3NA 3FZUD 5HHVH 4MHHI 4WW2C 4P2CG 3CX2A 5L0QC 1AXTH 2FYYA 4XP1H 3S96A 2W0LA 3MLXH 2C4FT 3BZ4A 4Z7UB 4CMMA 3QFJD 3O3DA 4WY7L 1A1MB 4YX2L 4JHWH 1BFTA 4PRPE 3QIWC 4XCFL 4KXZI 3X3GL 4F7MA 3V8OA 3CIQA 4GBXD 4JB9H 1QRNB 1BF8A 5I1KH 5DRWB 3VXTA 3C5ZA 4ZOAA 4MA7L 1CICB 2IAMC 4G7VL 3QI9A 5IIEA 1G0DA 1M05B 3T0AA 2BOCA 3OJDB 5DD6A 3KYOA 3EFDH 3MJ7A 4HKXA 5JW4N 4ZYKB 1C5DA 4PGDA 1P7QB 3J8F7 1JZ7A 5MHSD 3BUTA 5FUCC 2BY2A 4LGRB 4YQXH 1FL6A 4FQXB 4POZD 1P4IL 1CR9L 4PV9A 4DAGL 1KJVB 4QTIL 1VGEH 5JZ7C 4PJCA 3VD5A 2V2XA 4LOUD 3SDCC 2P5WE 2W0KA 3MNWA 1MI5B 1EEZB 4HPOH 1IL1B 4KKLC 3T8XA 5I1GL 2AI0L 3U4EB 2VUYA 1F3JB 5DSCB 2NQCA 5HGBB 1IC4H 4YGVA 3G6AB 5J7CC 3X17A 4WW2A 5FHBL 5J0BA 2VO5A 4S11A 5EORL 5CD3A 5KSBF 4QHNB 2DDQH 1P5VA 3B3IA 1CZ8H 4Q97A 3L7EB 3KPSB 2ESVE 1OWRM 1BREA 3LOWA 3H9SE 4MA3A 3BMWA 5ID0A 3TLRA 5FM4A 3QIWA 4W4NA 5EOTA 3S36L 3TYGH 1EO8H 4N8CL 4XVTL 5GGQH 2EDTA 5GGVL 3SE4C 5KSAC 1KN4H 1KGCE 3HNVL 2C26A 4I18A 3ZYIA 3PV7A 5JORB 1F5WA 1Q0XH 1P69B 4L8SB 6FABL 1YN6B 4PJDE 3GB7A 4N8PA 3LSOB 2IAMA 5AUMA 4JZOB 1KTDB 4B0MM 1IM9D 1HHIB 3L3OB 1AJ7L 4DUVA 4HC1A 1JHKH 1IQDA 1QSED 3QO0A 3QP3A 4LLYB 4ZFOB 1BECA 4TQEL 4I3SL 3ZT6A 1IEBA 2J88H 4UV4L 1PZUB 3AU1A 2WIIA 3MGOB 2ADJA 4NN6C 2ILLA 5D7JB 4UQ2B 1K3IA 2IG2H 1JE6A 4XMKL 3G6JA 3SE3C 4RBPK 4URTB 3SDCA 1EAJA 1TQCC 5KJRL 2F9BT 5HGGS 1AC0A 3HE7C 3LCYA 5IBLD 2GIYA 3KJ6H 3RI5K 3KPNB 4F58H 4YC2C 4NRZB 5GSVB 4EXPX 3LKRB 2ADGB 3NABH 3WNKA 4FG6C 1ZE3C 4JFFB 3VXPB 3RU8H 5HYJD 4QHMB 1OLLA 4P9HL 1F45A 3WSQL 2Z8VC 3WL9A 5IB2A 4GRMA 1TZGH 5IMMB 1TVBA 4LVNB 5DTFA 4KTDH 3EYUL 1V5JA 4HJ0C 3MRBB 5I6XB 3LEXA 2R69L 3U4BL 3SE4A 4L3EB 5KSAA 5FOBB 4GKZA 3IDYC 1I3GH 3NFSL 3ALXA 4OB5L 2A6KB 1AGBB 4MD4B 4PJXF 5DVLA 3D18B 5C0BD 1XGPB 1MRDH 4PTTB 3SDDD 3FHQA 2AV1A 2EKSA 1TIUA 3DX6A 3CMGA 3TBWA 3MCKA 3D0LB 2BNQD 5F3BA 2AABH 2CMRL 4NQCD 2GYSA 3RKDC 3C5SA 3K7UA 1U93A 3BSZL 5IMKB 3DLQR 5I18H 1F90H 4N0CC 2YEZB 2VR4A 2G5BA 2XG5A 4OCYL 5T1KD 3VFVB 3V6BR 5E9DA 1VKXB 3QEQA 4YEEA 5D70L 5DD0L 3BN9D 2X2YA 4LLQB 4PLJC 2GAZA 3GM8A 3HC3L 3ZYZA 4LL9A 1WC7B 5FB8B 3SE3A 5DFWH 5E03A 3T1WA 5JW5B 2NY6C 2BY1A 3QFDA 4UBDD 5IB1A 4Z76B 2VXQH 1BGXL 1RPQA 4PB9L 4X5WA 1N4XH 4QRQB 1WTLA 4UTAL 2NZIA 4QRRA 3JV4B 2FEEI 1NCDH 1I9RL 3FAWA 4EUPA 4EI6A 4NHUA 3MLSH 1FNHA 1AP2A 4XAWL 3V6OE 3OXRA 3R06B 4TSBL 4ZUSB 1CICD 4GXVH 3QWQB 3CFBA 3SPVB 1CFNB 1K8DA 2ZKHH 3MUY1 3QUZB 4DOHB 5D6DC 2JB6B 4N8VG 5DJAA 4C83B 5TE4L 3EYSL 4Z7UE 3C09B 5F9WC 1EHLH 1BAFL 1HDMB 3C08H 5FFLA 1ZMYA 4Q9BA 1P7QD 4LSUH 1TMCB 2AKRB 4G8EA 4LK4A 4ZUUA 2R56H 3O9WB 3S88H 2RGSA 3AXLB 4RGMB 4M7LL 5T1LA 4QHLB 1FFPB 1QRNE 3P4OB 4TPRH 4OZ4B 3TNNA 4XC3H 3S4SA 1MY7A 2COQA 4Z7UF 3S37L 1VFAA 3L3GB 1I7ZA 2OXGA 4PY8I 3KPOB 1MI5D 2EDEA 3P0VH 2WSKA 3MRHB 5C9JA 2EIEA 3SKJL 4MVBC 1EBPA 1ZHKA 3FAXA 4FFWC 5I76B 3HNSL 4OGYH 1GGYA 4YHIB 3ULUH 3PHQA 2GITB 3LKPA 5L9DH 4PV8B 2QSVA 5KBNC 4X0KA 3WXWL 3JZ7A 4R4ND 4OLVH 3MLVH 1WAAF 3IU4L 2QQNL 1N3NB 3T04D 4JHBA 2CXGA 4M9PA 4R0LB 2EZ0D 2X4QA 4GAFB 1N7MH 4U1MB 4NNYB 2VLME 3HE6C 1N0LA 2YK1L 3JTSB 5HVGB 3WFHB 4YAQA 1FVCA 5CLTA 4Y1AA 4NN7B 3QG7H 1ZA6B 5LBSL 1FNSH 2Y9RT 1U8KB 3PWUB 4O51B 3LV3B 2A1WH 4HJJL 4JREB 4H0HB 1FZOA 1KJ2L 2HFGH 1YEJH 4G9FB 3KPSE 1N5YL 2EE2A 1WZ1L 3VWJB 2BCKA 2VDPH 1AE6L 4HGKC 1IKNC 3H0TB 4JE4B 1OAZL 2IBZY 4NT6B 5IP4A 2BHZA 3SDAC 5EU5A 3PWNB 3ZE1E 1CTOA 3K8KA 4RQQA 4JFZL 4WI3A 3DXAA 3IRPX 4HX1B 1PVHA 2MJWA 5TFSH 4K3GA 5CIPB 2FJFA 3HMWH 3UTSA 4OBSA 4J3TA 3HB3D 1W72B 3AC0A 4PG9B 5CZXC 2YC1A 3ARDB 3DVIA 2FHBA 1BVLA 4WJ5B 4OD1H 2IH1B 2R0WL 3GSQA 1DEDA 5I75B 5HYQA 3WNPA 2A83B 4R90H 3T0EB 1QSFD 3KPTA 3VFMB 4LF3B 4UIKL 1HQRB 3ULVD 1GGIL 2CRIA 1TFHA 2W9EL 3PDOB 2CDGA 3QB7C 3C60B 1ZGLP 4HXAL 2B5IB 2DQEH 2C1PA 3ARVA 4LAJH 1DBBL 2C7UB 1T0MB 4JFXA 3HE6A 3NTCL 5E00B 1CIDA 4Y4KD 3TH3T 3OKNA 3QG6B 4PGBB 3WYRA 1W0YT 4XMLH 3JBG7 2VLRA 4HG4K 4L4TB 5J9PA 1DEEB 4O58H 4HCRH 4JFFE 4JFEE 1HEZB 3SE8L 3CGTA 3OKDB 5DJ8B 1TVDA 4X4XB 4JQIL 4MJIE 1OP3K 4IOIA 4WO4C 4UI2A 1FC2D 4ZFZA 2BVUA 5FHAL 2ADIB 3MREA 4DVBA 1ZANL 1IKNA 1YPZE 4R8WH 5JHLH 3QHFL 3U7AA 3WE6A 3TO4D 1MEXH 5H94B 5I8OL 5T3ZH 4L3EE 3NVQA 3ULVF 4OIIH 5TQ0L 4XPTL 3ECBB 2AXJA 3ILQC 1BQLL 2Z4QA 2OXHA 4QXTB 1P84K 1MCEA 5IJKC 1X5AA 4G8FB 4FP8L 4GAYB 5KS9B 1ZTXH 1KBGH 4JFOA 3VFPA 4Q9QL 3U30C 3P73A 4U6HB 2R29H 3LPFA 4F8QA 2YSSB 2R2BA 1JMZA 2BRRL 4WEBL 1KJ2A 1CLCA 3VA2C 5T5FH 1ES0B 1SBBA 1UKQA 2F53E 4OGAD 4HFWA 1Y18B 4OZFB 2NY5C 2BSRB 3WN5B 4NM4H 5EA0H 3MOBL 1A0QL 2DQGL 4LLVB 4PJIE 1WCBA 2O93L 5I8KH 4ZAKD 4E41A 5DURB 3MNZB 2Y36H 3L5XH 5E2WH 2X70A 3MFFB 4XZUB 1GGUA 5DLML 3SQOL 1TJGL 1RIUL 2PXYC 1UB5A 1F97A 2RAMA 3O9WD 1SBSH 5DXWA 3FO1A 4APQB 5TPWH 2A9ML 3VI3F 3VDBA 4OZHF 1MFAL 4KGJA 3H7BB 4OCWH 1DBJL 4H26B 2Q76A 1IE5A 1BZQK 1XGYL 2Y07L 5DC0A 1LDPH 1I9JL 4ZTOL 2V17H 5DD5L 3WFDH 1VDGA 3KXFA 2HFEA 4WO4A 1EPFA 4DGYH 4X8JA 4DOHE 1XCTA 2N1KA 4J1UA 5JQ6L 1ZVSA 3ARED 1D9KD 1KT2B 2FGWH 3ZKNC 1DBKH 1OAYL 4LSVH 3T3MF 4M5ZL 5K59E 3PQYB 2DBJA 3QSKB 3WNNA 2XN9B 4JPKL 3MLZH 5IG7A 5E1HB 4EVNB 3JTTB 4I0PB 4AT6B 1NEZB 1AGCA 5HYSG 4G6FD 2IF7A 4OUUA 5C70A 2QR0A 5IJKA 4PG2C 2MKWA 3K1DA 2YD8A 1UWGL 3LKQA 1L6XA 1UC6A 4NFCA 5JW3L 4S2SA 3QBTB 4R96A 3IAQA 2GJ6B 1CVRA 2R9HC 4KKBC 1YEKH 1LNUB 5D96B 4ZSOA 3TA3C 4XNUL 3CFKB 4D94A 2H32A 5EWIL 1S9WA 3TIEA 1OSPH 5E6IC 3P3YA 5EO0A 3DGGB 3CC5B 4LLDA 3IU3A 5IKCB 1QBAA 1XR8B 4M6ML 2D03L 1FNEB 2J12B 3OGOE 3NPSB 1FAKT 2W0PA 1LEGA 3STZB 1LK3H 1BFSA 3O45A 3M17B 2QHRH 1Z9LA 5JQHC 1HYRC 1RU9L 1AO7D 2PTUA 1TPXB 4OZIB 2X4OA 2WUBL 3MLYL 1JPTL 1CGYA 1E6OH 1M7DA 5DZOA 1I3VA 3GJEA 4M61B 1NFDA 3IKCB 1I8IA 5ESVB 1XF5B 1JRHL 5ABDE 3U0TB 1JWSB 4JFHD 4G9FE 1UH4A 1OARH 1V7NL 4NYLB 4TULL 4X83A 5BMFH 3WS6C 3JV6B 2KQNA 4NZJA 1MFNA 4Y4HD 3BIAX 5DFVC 2FIKB 4PJAE 5D7LB 3LHPL 1CYGA 3ZZ1A 4P2RA 1O7VA 4PG2A 1O5DT 1PX3A 1HXMB 5TF1L 1GYAA 2M1KA 1I7RB 4MX7A 5D1ZC 3I2CL 1OAXL 4HAGA 4D9QD 1WWCA 4L4TD 2WK2A 1YY9D 3T0EE 1CGUA 3RAJL 3MYJB 2C3WA 3S98A 5C2BL 1INEH 5C0DA 5D1XB 2MQCA 3QXTA 4RFNC 5ICYB 1XIWC 4JM4H 1JZ2A 4MDJB 3FO2B 2Z91B 5E6IA 1CK0L 2DLIA 2EDLA 1RI8A 3QIBD 4Q0XH 2CSPA 3VDCA 3D0VB 2NLJB 1A3LL 3DV4A 4XTRD 5DJZB 4KKCD 2VERN 1TJIL 4LU5L 4PGZA 3CZJA 5LAXB 1A6TB 1XF4A 3RNQB 2DYPB 1SM3L 1PKQE 1NCAL 5SWZD 5HDBE 4ETQA 2VUOA 5EUOA 5IHUH 2P5EB 4DQOH 1K4CB 2GK0A 5IWLA 3VXRA 4OV6F 1O0VA 4WI5A 2X4NB 2KZWA 1G7PB 4FQIL 4TNVF 4OFYD 4YXKH 4HK3J 3WS6A 5C0CE 3KLHC 4WTZG 5IW3A 4O02L 3TN0C 3G08A 3QA3A 3QEUA 2R1YB 3WKML 3QUYC 2PUQT 2APWA 1BD2D 4U1NB 4D0BB 3KR3H 3BHBA 4PRDB 4N8VA 4X6EB 5J1AB 3W0WD 5K9KB 1QQDB 2ZJSH 3E2HC 3K8LA 2OX5A 3D85A 1XGQA 3IVKB 3UROR 1JK8B 3MJ6A 3FQXA 4LHUB 4J8RA 5D1ZA 2Q7YB 4APQD 3O41B 4LIQH 3LKNA 4PLNC 4XI5D 4U6YA 5GJSL 1KLGA 5I8CB 4PTUB 5DRZB 1XIWA 4GW1B 3LB6D 3QEGL 3V4PH 2DM4A 4Y5XB 1RK1B 2ICES 1H3VA 5KS9F 1QNZH 5DHVH 4FABL 4F7EB 1KCUL 2OQJA 3V6FB 4I77H 2VZOA 1GGBL 1NGQH 5EBLB 1CQKA 2MSPA 1U3ZA 1ZLUH 1NGXB 2P24A 4F7TA 4MAYC 3QIUD 1IZJA 1T21A 4U1LA 3HLAB 4KTEH 5CKAA 1X7QB 1J1PL 3RIFF 4NQDB 2ZCLH 3BD4A 1VEMA 4I0PD 1ORQA 2WBKA 4I2XB 5ALCH 3TJHC 5E8DL 3VRLE 5GIRA 3LRSB 1KENH 1S7TB 1GPOL 4ELKB 5J6HA 4S0TD 3HG1A 2V2WB 3ARZA 4XBPA 2I07B 5H37H 1ITBB 4GLRI 1KJMB 5EU3B 2WP3O 2YD2A 1HHKB 4JRXD 3MRGB 3BI9X 3C8HA 5F72S 3QUYA 3VRLF 1KG0B 3QNXB 1V3MA 3PQYE 1A3QA 1WBZA 2CJUH 4YHZL 4HW6A 4CGTA 1U3HB 5B8CC 4CMHB 1B3JA 2O5ZH 1J05A 4JY4A 4X6DE 5EZIH 3FCTA 1RULH 2H3NB 1DP0A 1CE1L 4HLZH 3I6GA 3S96B 1MQKL 3JV0A 3BZ4B 4HUWB 4CMMB 1DVFC 5KAQF 4FFVD 3O3DB 2LAGB 1H3PH 3PWJA 5E2JA 5ANME 2FJHA 2AV7A 3O2WL 1ACYH 2GJ6E 2OL3B 4MQXD 5EPMA 4YXHH 5HPOA 1RIVH 3EYVA 4F7MB 4AM0A 3D39D 2QHLA 3VXTB 2R15A 3C5ZB 2R39A 1W0VA 3MJ9L 4R4FH 3QI9B 5DWUL 4ERSL 2DS4A 2NY7L 4C54A 4MAYA 5IIEB 1G7QA 3FN0H 5DD0H 3U1SL 3P30H 1DQLL 4V1DE 5DD6B 4M1DH 3KYOB 5I74B 2OK0L 3P0YL 3ZE0E 5EU6E 1KTRL 4RZCB 3FMGH 5DJCA 4OZIE 4HKXB 4LPTA 3O4OB 1C5DB 4PGDB 3U7YH 3VG9C 1A2YB 4UB0H 1FL6B 4HH9A 4OTXL 1NSNH 3A6CL 1JNHA 4XB8A 3TFKC 2JE8A 3RIAF 4PJCB 4BK4A 3VXSD 4YHYC 1YMHB 2B1AL 2C9AA 3SKOB 4OZIF 3VXMA 2VC2L 4M02A 3MNWB 1OSZA 3ULUE 5E4IA 3FFDA 3L3DB 3T8XB 5ADPL 4OLYL 3RY5A 5B8CA 5D7LE 3ARQA 1OAUH 5J56B 4MXWH 4OD3L 3JUYA 3MRPB 1FPTH 5C0EA 1HKLL 4YGVB 4AY0A 1E4WH 1LK2A 4NNXA 1OTSC 1FE8H 1JZ8A 3ZKXC 3B3IB 4KK5D 1FNAA 1BFVL 1I4FA 1Z9MA 1DVFA 1FO0H 4EDXB 4UV7H 1V3KA 4MA3B 5ID0B 4OD2B 4POUB 4R7DA 1MHPL 4G7YL 5EOTB 1D5MA 2NXYC 3V5HA 4WEUD 4X4YA 4I18B 4F57L 1F42A 4P46D 3TVMC 2D7QA 2R0LL 3GB7B 1H8NA 2VDMH 3GBNL 1A1NA 3SY0A 2IAMB 5AUMB 2F5AL 3L1OH 2HRPH 5HGHA 4GRWH 3Q5TA 5GZOD 5CJOL 3VH8G 1IQDB 3QO0B 1UA6L 5CSBA 5JXED 3LPGA 5ITBH 4YHMH 1IEBB 5D5MA 5L6YH 5KVMC 4JANA 1WK0A 2IBZX 2QTEA 3AU1B 5TDPA 3U48A 2VTFA 3KWWA 2WIIB 2OMBA 3Q3GA 2P5EE 3HZMA 2ADJB 3HMXL 5CEZE 2DLHA 2HLAB 4WFHD 2MTPA 5E2VH 4M48L 3GKWL 3RVVD 5H37G 4XNZC 2D7TH 1F6FB 2XRAL 3G6JB 3SDCB 3V9FA 5J6GA 5I15L 1BIHA 4KHXL 5ITFA 1T5WA 1SJHB 1AD0A 3MJ9A 1F6AB 3OKOA 4X9GA 1G7IA 1CD1B 5D71L 2ITDA 1VPOH 2ARJA 1FH5H 5SWQA 3ZL4L 1DZBA 3GSRA 3NIGF 1OTTD 4MNHA 1B4JH 3FOMA 4HLZG 3DYOA 3WL9B 5IB2B 2ITCA 4GRMB 3DJ9A 3UX9B 1TVBB 2QSCL 3E3QE 5DTFB 4K2UH 3MOQA 5HYSA 3P9WB 2D0GA 5D9SA 1NMCC 4FQHB 3LEXB 4LPYA 1MLCB 4AG4L 1PKOA 4JG1L 5IQ7L 1C08A 2P44B 3QXDB 5CZVH 4JG0L 3J7HA 4GKZB 4NUGH 4NKQB 4HS8H 3K3QA 1J7VR 4MS8C 4XPAL 4KMTH 3FB8B 3H9HA 4MD0A 2AV1B 3SQBA 3DX6B 3TBWB 1HCVA 1PY9A 3LN5A 4W6YB 5F3BB 1TNNA 4OJFH 5I1CH 5FYLH 2BVTA 2DIBA 3C5SB 3EHBD 2W59A 1U93B 4AH2B 4OI8A 1U3HD 4NQDE 1UG9A 4L4VA 2G5BB 2PO6C 4I2XE 2C4XA 4IRSC 4UILL 4MCYA 5E9DB 3HNTL 1J87A 4PP1C 3QEQB 3O6LH 5FYKE 3WXVH 1FGVL 3QXAB 1WT5C 4KRMB 2GAZB 3OKEA 4LPVA 4HCRA 3RKPA 5F44A 1T7YA 2VLKE 4MAUH 2FX8H 2OR9L 5ISZD 1MHHA 1L7TL 1YYLL 2NXZD 4HWUA 3K46A 1U3JA 3QFDB 4WFFE 5IB1B 4OLEA 1EUUA 1IC5L 4LCWA 3MRRA 3BZFB 4YC2B 4NO0A 4QRRB 2W9DL 3QPQD 4EUPB 4EI6B 4NHUB 3OKMB 5I66A 3C5ZD 2IEPA 2E9BA 3OXRB 5BVPH 1D5BB 4LNRA 2YD9A 3CFBB 4X4ZA 3K81A 3QI9D 1KF9B 1A9BA 1K8DB 1MFDH 2FX7H 3DROA 1WWWX 3O8XC 2EDNA 5DJAB 3HMXA 1T1WA 2YPLA 2CRYA 3SOBH 1A3RL 3VDAA 5E8OA 1UH2A 1C7SA 2Y1VA 4X7DC 1F4WL 3IXTA 4ZUUB 4G8EB 1AHWC 5T1LB 4XPGH 5B38G 1GCFA 4CBPA 3TNNB 5B39G 5DS8A 1VFAB 3DETD 4NCC2 4NZRH 1PSKL 1I7ZB 2BNUA 5F1IA 1EA9C 2EDKA 3GI9L 1UACL 5HD8D 2AEPL 1R3HB 4TNVK 1ZHKB 4NKIL 2BVPA 2BX5A 4IRSA 2BSTA 2JB5H 1MELA 3SCMC 1IGIL 3PHQB 1WT5A 4L3CA 3NAAH 5ACLA 2XFXA 4X0KB 5IT2L 5D72H 5D7SL 5ACMA 4X9IA 5HY9A 3AB0C 1NL0L 3ZDXF 1INDL 1VEOA 3QIWD 3HI5H 4LSQL 4BFEA 4Z8FH 3DX8A 4X80H 1HKFA 2X4QB 3W9DA 1YNKH 3INUH 2P5WD 1FVCB 3IFLH 4WTZA 4J6RL 4Y1AB 1BPVA 4PJCF 2NY1C 2IAMD 3KYNA 3ZDZF 1JPSH 2BJMH 5I73C 3DV6A 4RGOL 1FZOB 3GSUA 1F00I 3O8XA 4U6XB 5L88L 1H5BC 4G8GA 2R8SL 2ENYA 3TCLA 2BCKB 1I9EA 1H3GA 4BSWA 2ESVD 3QRGH 5T3XH 3G5VA 3H9SD 5EU5B 2H6PA 4OT1L 4YNYA 4WW2F 1T03H 2AP2A 1UEYA 1OAQH 4RQQB 5GRUH 3DXAB 3UAJC 4U1KA 3RIFK 1R24A 3QDGA 5JZ7D 4OLWH 2X4RA 2GUOA 1IQWH 4CVZA 2FJFB 3SDCD 5TGBA 3UTSB 1HYSC 1L9NA 2GKIA 4KKLD 3V6ZA 2YC1B 5MP6L 1BVLB 3Q2CA 1ZAGA 5EC2A 3QCUH 1ULVA 5DK3A 2YA2A 4XNYL 5HYQB 1F4AA 5HGAA 3SCMA 4O2CA 3ARWA 4HZAA 4HPYL 4NKOA 4Z0XA 4YJZL 3MLUH 3RL1A 4RWYL 1U95A 4BSJA 2ADFL 3B5GA 5DVNA 3V0WL 5ICZA 3G6JE 3NH7L 4ALAL 1OHQA 2BVEA 4P59H 4U7MA 1FC1A 5I1JH 3FQTA 4DEPC 3IJHA 4CRPA 5KSAD 4JFXB 4K7PY 3BZEA 1I75A 3OKNB 1RZKH 4X98A 1KCRH 2VLRB 5I1IL 5J9PB 3GZKA 4XMPL 3G6JF 4AMKH 1I8LC 1EH9A 3OBAA 4PJBE 5JHDA 4OCRH 3GNML 3RWHA 5F9DC 1H5BA 2NY2C 1IFHL 1QBMH 5BO1H 4ENEC 4IOIB 1CT8A 5HVFB 3S9DB 4ZFZB 1G9EA 1CG9B 1S7XB 1MY5A 4KVCH 4DVBB 4LP5A 3CXDL 1FNGA 1FP5A 1U36A 5E9DD 3QEQD 3CMOH 2EDOA 4DGIL 3BDYL 2VE6A 4IRJC 1FL3A 4XVJH 4MJ2A 4PGCA 3S34L 3M1BB 3CVHL 2PR4L 4UT7H 4IDJL 3JWNC 5B3NA 2APBA 1T0NA 1CXKA 3HE7D 1SEBB 4QEGA 5CINH 4HUNB 1A7QH 4R3SA 3VXUA 4QF1A 4JFOB 3VFPB 4JKKA 2OTWA 2AGJH 3V4UL 3P73B 4JFQA 2XA3A 2YPKB 3ARRA 3RIAK 1GH7A 1UKSA 4FG6D 4X9HA 1AR1C 2R2BB 2AK4B 5DD3L 1KJ2B 1EVTC 4AENA 1C7TA 3RPIA 4RISL 1WCBB 1NCBH 3I50H 4C57C 4YWGH 4E41B 5EOCL 3RJDA 1WF5A 2X70B 4HJ0D 3RA7H 4BJLA 4OI9A 3IF1B 4LVOC 5J06A 3GSOA 5FECA 1MNUL 1OTUD 3M8OL 4DKFH 4I5BB 4Z7WE 1UB5B 4UMGA 3MFGB 4L8BA 2AJZA 3FO1B 4N9GB 5FKPA 2LTQC 4QRRE 5MEOA 1QBLL 3V0VA 4BUHA 4DKAA 4M7KH 1YN7B 5F96L 1I8LA 1LE5A 1VCAA 4MSWA 5EFIA 5HTSA 1XH3A 2ICWA 3DUHA 4L8CA 2V7HB 5CJQH 1C8PA 4NNPH 1B0GA 2HFEB 3KXFB 4WO4B 1UQSA 5C07E 4NM8L 1XCTB 4N0CD 1ZVSB 4QHKJ 4GRLC 1AKJB 1RZ7L 2WQ8A 2X4SB 1Q9LA 1S7SA 1OCWH 4DWHA 4K3EH 2IPUK 3OKKA 4XB7A 4TVPH 5L8LB 5CILH 3BO8A 3REWA 1JFQH 2E3VA 4Q6IA 3ZDYE 4JKWA 1DN0A 5GGVY 5HYFA 4X7SH 4NQTA 1IT9H 4OUUB 2NY6D 2QR0B 3IDMA 2YD1A 3GK8L 4UT9L 1IGMH 3VXOA 3LMJL 3WFCL 3IB4A 3QO1A 4QWWC 4I48A 4KZDH 2EDDA 1G9NL 3MXVL 4U7SA 2R2HA 4S2SB 1FYTA 3MACL 3N06B 1LO2H 1R3IL 4EIZC 3VH8A 1NLDH 4ZSOB 2H32B 3TIEB 1S9WB 4HKJA 3UZVB 4S1QH 5C0AA 5EO0B 4LLDB 1WBXA 4JKPL 4WUUB 1JTOA 4QT5A 4JDTL 3WJJC 4MNGA 2HG5A 4KK6D 2WLYA 1LEGB 2J8UE 4M9OA 3CVHA 3O45B 5ADOH 3DXAD 1JP5A 4HWBL 3I85A 2BFVH 1RK0B 2MFNA 4M4RA 1FBIH 5HDQH 3IJYA 2X4OB 5E8PA 3UTSD 1UM5L 1G7MB 1M7DB 3GJEB 1NFDB 3QJHA 2BZDA 1I8IB 4P4RA 4U1SA 5DMIL 2J4WL 4MVBD 5JR1L 2E9IA 1XF2A 4WV1C 4GRLA 2NR6C 2VDNH 4U6VH 3L5HA 2OR7A 2FLBT 4QTHB 4HDIA 4YDKL 2ICEA 2NNAA 5CGMA 3KYKH 2V9QA 1KEML 2YMXL 3WDHA 2PN5A 5EU7C 5M94B 2X9XA 1T04A 2ID5A 5IB5A 4P2RB 3O6KH 2D9QB 3ORJA 1OP9A 1BWMA 3OAZH 4O2FA 4MX7B 1RJYA 1IGTA 3HE6D 5CD5C 4WIQA 5FEBA 1EJOL 5FYJH 1RZFH 4YBHA 2BNRA 3G04A 4X7TA 3UMTA 4XBEH 1A14L 5CP3A 1ZVYA 4RCAA 1S8DA 2NY3B 4HUKB 1Q94A 43CAA 4XWGH 2I9LA 1ACZA 2IMNA 5LWYL 2CKBL 2FHFA 1UCTA 3WJJA 4NQSA 1HH6A 3DV4B 2ERJC 3SDAD 5AG8A 3HCVA 3EUUA 1XF4B 3MRLA 4JRYE 4KZEH 2FEDC 2XWTA 2F5BH 1T7ZA 4ETQB 2MPAL 5EUOB 5CZXD 5JPNA 2VN7A 5DEFA 3L95B 3VXRB 1AR2A 3BIKA 4MCZA 5E1AA 3FQWA 2XG4A 1EXUB 1UWXH 4WV1A 3CUPA 1TJHL 1ND0B 5C2UB 3CFIC 2PNDA 1KELL 4OD3H 4RNRA 3QZWG 4HWEL 3QA3B 3QEUB 5KN5A 2DQJH 4P9MH 3V4VL 3BPNC 5EIQA 4WI9A 5AAMA 3BHBB 1PEWA 2RJMA 4N8VB 1U8MA 1JUFA 3N1QC 3QQ9C 2AJSL 1DDHA 5HHOE 4HUMB 1X5IA 2BOBA 1XGQB 1T20B 2DAVA 4BQBA 3GSNH 3VMOA 4HWBA 3DX9B 1P4BL 4PRIE 3FQXB 4LSPH 1NBQA 2DWEA 4J8RB 1FVDA 1MHPH 5B38A 3VG0L 1HHGA 2P49B 2WW8A 5B39A 4W6XB 3WS3A 2AJYL 1NGPH 1MFBH 2AK4E 2YPVH 1CTNA 5FO9B 1KLGB 4WI6A 3MR9A 2HWZL 2AJXL 3CD4A 4Y2DB 4LSSL 2YXFA 3KXFD 3RTQA 4WO4D 1HI6A 4PB0L 4ZUVA 2JJVA 5DFTA 1DLFH 4GSDL 4PP2A 2VITA 4LPCA 4BH8A 2BVQB 3ZSTA 1NLBH 3VFOB 2P24B 4F7TB 5FA4A 3RY4A 2BSED 1MJUL 2GI7A 4ODVH 1EFQA 1T21B 4G42B 4JO3H 3ILQD 3EDFA 3UDWC 3TESA 4K94H 2OZ4L 1ORQB 2AEQH 5H35B 2BVYA 3B2UC 4HQQL 2WWKO 35C8H 2CDFA 3TJEL 5HXMA 1SJEA 1I3RB 1N6QH 5J6HB 1U8IB 1F4YL 3UTTE 3GBML 2AJVH 3HG1B 5TDNB 2VKWA 3DVGA 2W38A 3GFUA 5FYLE 4XBPB 1FZKA 1QR1A 1U8PB 4UINH 4Q6YA 4YDVA 5IESL 4AQ1B 4S1SL 3TWCH 3QUYB 1PFCA 3N85L 5I19L 4OCSH 3X14B 3UPRA 2CKBA 5ID1A 5D7IB 5TE7L 4ZG1A 1WBZB 7FABL 5KSVA 1RUPH 4FFYL 3IAPA 3E2HB 1WUNT 4FMFA 2F19L 1GAFH 4Y89A 1J05B 3FCTB 4NPYA 2Y5TA 2PXYD 2YUZA 3I6GB 4NO5A 5FA3A 1RUMH 2YOCA 4WI2A 3EKCA 3LIZH 1MWAH 2AV7B 1REIA 5EPMB 5DA4A 3TCXA 2FNBA 4KRPC 1E27A 2Y7QA 4AM0B 1BVZA 1J1XH 4YDLC 2E9WA 3L3JA 4HIXL 1F4XL 4F15C 3ZKND 4WUUE 3WIIH 3BE1L 5F7KC 5ILTL 4FA8A 3VE0A 4MAYB 1G7QB 2PW2A 5IFAL 4U6TA 2XXMB 3C8DA 5F7WC 3UDWA 2ARJQ 4X9FA 5DJDB 4P2RD 3EAKA 3U0WL 4NKMA 5DJCB 3PL6C 4XP5H 5JA9A 2Q7NA 3LH2H 5EOCJ 5CWSA 4QRUB 2MQ3A 3WHXA 2GTZA 3ARGA 3B83A 1BEYH 4HH9B 3ULSA 2VXTH 3VCLA 1CIUA 1FCGA 3QWOA 2XPGB 5KVGH 4GO6B 2W9DH 4PJFB 3KS0H 4M3JA 2WBJB 2VRAA 1YEEL 5DRNA 3VXMB 2JJUA 3LQAH 4FXGA 1OSZB 2DLGA 4KKBD 3TA3D 3FFDB 5DJ2A 1NFDF 1KB5L 4PJ5A 5E6ID 1YMMB 3HHRB 1TDQA 3LPWA 5AZ2L 2V5TA 4GG8B 1WFNA 3ARSA 1G9ML 5C0EB 1VEPA 4LDEB 1ZT7A 3GJFH 3KNBA 4NNXB 1LK2B 3U7WH 2OZ4A 4KJYA 5DK0A 4ODHH 4FQ2L 4R26H 4XH2B 4LCIL 1I4FB 1DBML 1DVFB 4RX4D 1N0XL 32C2A 1FGNH 4U1HA 4R7DB 3MCG1 2PTVA 3ESUF 3KLAA 3O0RL 1D5MB 1EAPA 3V5HB 3B9KB 4RMWA 2Z35B 4X4YB 4N0UA 1FZJA 1GGCL 3VXRD 5LXGH 1T6WA 4UOW0 1XR9A 2V5YA 3BP7B 4AIXA 4OKVA 4AL8H 2AEPH 1FFNB 2VSCA 1A1NB 3SY0B 3MV7D 4HBCL 5C6TH 5AAWA 15C8L 3K0WA 1X5XA 4YHLH 5HGHB 3MPCA 5DFVD 5T3XE 4KI5C 1G9MC 2FZ3B 3CFCL 3L6FA 3SDXB 3PL6A 4AJ0A 3E6HA 3D85D 5D5MB 5E8EA 4JANB 2Y06L 5TDPB 3KWWB 1MJ8L 2N7AA 3Q3GB 5EUOE 2UWEE 3HZMB 5D1ZD 4DKEH 1CU4H 2IQ9H 1RZKC 3WEXB 2XZQH 4PUBL 5FGBC 3I02A 4H8WH 3AY4C 5JDJA 4LOUC 2WBWB 4YHYB 4O9HL 5J6GB 4BH7A 2Q3AA 1XIWD 5ITFB 5EUOF 1T5WB 1AD0B 4H1LB 1DQML 3OKOB 2OM5A 5DUBA