3UC2A

Crystal structure of a duf4426 family protein (pa0388) from pseudomonas aeruginosa pao1 at 2.09 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
124
structure length
124
Chain Sequence
YFQGEQVQRFGDLDVHYNVFNSSFLQPNVASAVGLVRSKAQGVINVVPMEKGKPVEAAVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQFPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein with immunoglobulin-like fold
publication title Crystal structure of a hypothetical protein with immunoglobulin-like fold (PA0388) from Pseudomonas aeruginosa PAO1 at 2.09 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 20
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14467 DUF4426 Domain of unknown function (DUF4426)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3340 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uc2A00
3UC2A
chains in the Genus database with same CATH superfamily
3UJJH 4D9LH 1VA9A 3F6JA 5EO1B 2WKOA 1KXQE 4A6YB 2MQ0A 3DV4A 1ZTMA 4HIQA 4D0DB 5C92A 3ZKXC 4JFFD 4AENA 4EI5A 5DJCB 3MREA 4RISL 1TQTA 3PABB 4NNYA 4QOKA 3DPBA 2CKNA 4L8SB 4PCSA 3TZVB 1NICA 4Z7WF 2EH7L 4QYOB 3MLZH 4LCWA 2LR4A 3PPEA 3UL4A 1JRHI 2JK5B 3P0YH 3W1ZA 4CSPA 4G8IB 1H19A 1VADB 5B39B 5L0QC 2OMYA 3QEQE 2FATH 1NKRA 2H0JA 4L0YA 2ZOWA 4ABQA 3IPBA 1Q4NX 4FI8A 1BD2E 3IYLW 4RCAA 5L2KB 1RIHH 4QJ3B 5ESVB 4FFVD 5EUOE 3RGVC 1KLGB 1XGYL 1UOVA 4U1KB 2YXVA 3MRBA 1NSNL 5J9PB 2JKJA 1ZLDA 4JFWA 5BZDA 2IBZY 4JHWH 3INOA 5FO9B 2JV6A 5DLLA 4NC1C 1MELA 5GQBA 2DMKA 2WUBH 2XZZA 4KV5F 2IBBA 4JZNA 2PW1B 1SY6H 1T6BX 1SEQL 2ZG3A 4PY8I 1AZUA 4G59C 2XWJA 3BDXA 4WI7A 5I0YA 1CDCA 5F7EL 1NOFA 5CGYD 4FTDA 1AGCA 3UX9B 3WNLA 2E4FA 3EUDA 3NVQA 3O8XA 4F7EA 2X1PA 1I1RA 1QZ1A 1WFOA 3RVWC 4YSEA 4LARH 1SDDA 3VXUE 2V3DA 5IW6B 4R5XA 2F54D 2VLKE 4UILH 4ILDA 35C8H 3J27A 3O45A 1SHXA 4RFEA 4UNUA 3MOAH 3GRGA 1TG8A 3K8KA 4QHMA 5E2TH 5EC2B 3S34H 1Y7VA 3BO8B 1IFHH 4Y2DA 2EIKB 5CGBA 2WKLA 5C0FB 2X1WL 4YFDB 3PWJA 3RTLA 4Q4EA 1QNZL 5F7DA 2VKWA 4X6EA 2B59B 5EV7A 1K4DB 3KYAA 3QBTB 4PSPA 3QC6X 4X5RA 4RWYH 2WXMA 4W4OA 2Y7NA 4FYQA 2QHRL 3BZDA 3E7JA 3U2IA 5D1ZB 4AYGA 4JGNA 3FBKA 1IQWH 4KRPB 4YX2H 2BNQA 2APVA 4APXB 1PKOA 1J05B 4FXLA 2W9EL 3BHBB 4K5OA 2R56H 2LLLA 4ZOCA 1JZ3A 2WQ8A 3QJRB 4MZIA 5LCVL 3RVWD 1XH3B 1Q8MA 4K9EL 3FQUA 4IEFA 5CHNA 1Z7JA 1BZEA 4AOFA 1KCVL 3QDJD 4MLSA 1X5KA 3KVPA 3T08A 1BIIA 2QPEB 4JRWA 1F90L 1QP1A 3CC5B 3OKOB 2I32A 2BRRL 4FS0A 4RMQA 3B9KC 3ECBB 4CW1B 3TT3H 5GSVB 3U0TB 5FUZH 5IJBC 2J1XA 3BIKA 4XO5A 2P3YA 1HHHB 3BPOB 3PWLB 2BHUA 1U4FA 5DO2C 1ETB1 3X3GL 4G8EB 4CU7A 3GXPA 1XF3B 2K7QA 1JGUH 4L3EE 4UQAA 2N7SA 4X9YA 5FM8A 3UPCA 4AJ0A 2A9BA 3UBXB 1XZ0A 3UJTH 4GQ9H 4AQAA 4EAEA 2WCGA 2APSA 3VXQB 2FX7L 1BQHA 1D6VL 1AI1H 1LO0L 2H2SC 3LDBB 3LRHA 2VCOA 2D7MA 3FFCE 1Y6KR 1UT1A 3WIAA 2BHYA 4TSAH 3RWCB 3NTCL 1FI8C 3KLHC 5E2JA 4FADA 2OSLB 2AJUH 5ICZB 4G83A 3P0VH 3UC0L 1QHOA 3K74B 4QRPA 3AQDA 4PJEE 3OXSA 1NGWA 4KK6C 2ZWKA 1NCBL 4X98B 3AQYA 1G7PA 3FSWA 4GOSA 4BZYA 3B9EA 3SD5A 1X5HA 4TMPA 5C3LD 3QXTA 4QNPF 1PX8A 4JPQA 5H37A 3BJ91 4P2QA 4XXCC 4Y1AE 4GY4A 3RGBA 1B0RA 4P04A 2IANB 4Q58C 5DA4A 2WN3A 3RVXD 3QIBC 4MNQD 2CBQA 2VN5A 2FR4B 2EDKA 4ZUVB 1JYVA 3TEYA 1FJ1B 5L6YH 3O9WA 4WUUD 3WXVL 4ZDHB 4LSUL 1M71B 5TQ0H 4TVPL 1N59B 2G60L 1CF1A 4PJGF 3RLSA 2QQLH 5BS0A 5EF1A 2FL5A 1I31A 1XEDA 3DGGA 1NCJA 4PJHF 5D9SB 4PJ7B 3BN9D 3MCKA 3RDJA 1IJ9A 4Y4FA 5J8OA 5CZVH 4KI5D 1WZAA 4LCIL 4UQ9A 2E4TA 4PJ8A 3WUWA 1JD7A 1RSFA 2HG0A 1CFVH 3KYKH 1NBVH 1R5IB 2JVUA 1HE7A 4WGWB 2AV7A 4FG4A 1VFAA 3NCEB 2C1OB 1M1XB 2CKBH 2A6JA 3CFIC 1U2HA 3NCXA 4Y9EA 5T3XD 1FZMA 4JDZA 2YD8A 2NYZA 2PCPA 2V6HA 4R7XA 3DVGB 5J06A 1ZPUA 3M8OL 4QRRA 2HX8A 4BDVA 4PP1D 2XZAH 4PRNA 2QELA 1W0VB 4GI9A 3N91A 1VHPA 4DKFL 3DHJA 3F6LA 3WKYA 1XSKA 2YK1H 5EIQA 5DC0A 5HDBF 2CLVA 3NAAL 1UQSA 1ZK5A 4YUEL 5I6KA 3RZCA 25C8H 3DRQA 3LIUA 4G1MB 4OM1L 1EX0A 4HIHA 5KANI 4UOQA 3DX9A 5L4MA 2G3MA 1IGFH 2VDRH 1LJMA 2X1QA 4L1BA 2GUYA 3KYNB 2B5IC 4NI6A 1HK6A 1F3JA 5C6PB 2VUYA 5AZ2H 1Z6JT 3F00A 5E6IB 43CAB 5EO0A 5TPWH 3QA3B 5DU7A 5I1IL 4FQHA 2ODHA 3D4GA 5CD3B 2ORBL 1B3JA 2DQFA 1AANA 2FRGP 2A9NL 5DJDB 4MXQD 4NKIH 4U0RB 4PHXA 1JPGB 2HTLC 3HTLX 2H26B 2NOYA 3FTYA 2Z8RA 4PLJD 2NW2A 3Q3GB 2YD3A 4NLAA 4TSBH 4WU5A 5G55A 1TXKA 3MV9A 4K73A 3EHBC 1F4WH 2WLNA 3JQOB 5IREA 1MFBH 2UWEA 1LO2L 4JZJB 2O4EA 1U3HA 4HETA 4AIEA 4EXKA 4G5AA 2Y07L 4TV3A 3THMH 4L4JA 5EPMB 1O9VA 5IMOA 1W72H 1MAMH 2DDQH 2NY6D 2A73B 4FQ1H 4ZUTB 2VAAA 1T1ZA 2XN1A 1I1AD 1CFMA 2CO4A 5KG9A 3VYNA 1IARB 1YEWA 4CSTA 1HJBC 4POUB 1AJ7H 1NBCA 2ENSA 2W1NA 4F93B 3V4VB 1U58A 3EFFA 1L4IA 2O26U 4XWGH 4UDTB 2D7OA 3MUJA 4TVSa 1DBKH 4NKDA 3N50A 3DXAD 3STZB 4D0BB 3MRIB 2YUXA 4N2DA 4YLBA 1MCLA 4EN3C 4KTGA 3GMMB 4XC3L 1QBLH 1WAPA 1B4TA 3VFRB 3O4OB 2J6EH 3IGAB 4Z3IA 4IGBB 1T03L 5CN2A 2EYSA 2YAMA 4YZFE 3CZNA 1S7RA 3V52H 1RJZA 4UDUB 4OV5A 2VQUA 5CJBA 1M56B 5DEJA 5C08D 1KCKA 2IMNA 2XYBA 1FL5B 1JRHH 1JZHA 3FT4B 3MNVA 3V9EA 3BVXA 1R19A 4GYBA 4NO2A 4OGAC 3CAFA 2NNAA 5BRZE 5A7EA 5AOZA 4CMHB 2OCFD 5KANG 3KH4A 1T7VA 2ISDA 4JUTA 2Q87A 2Y6SD 5C0JB 3BFWA 3CU1A 3HE6A 4PRPA 5E08H 1IILE 5FDWA 2NT0A 4RDQG 2O6PA 3HBPA 3H9SA 4G5ZL 4QWWC 1KLFB 4JO8A 1A22B 4ZTOH 4A7VA 5DVOA 4PJ9A 2R0LL 4PRBB 4AQEB 3SYPA 5F1SA 1DQML 2R4SL 2YD2A 4HBCH 5LN4A 5DRXB 3MTRA 5EU6B 1NKOA 5LBGA 5G4MA 1UA7A 1DSWA 5EBMB 4AYFA 3SDAA 2Q2EB 4OGXH 3CBKB 4P5TC 2KQMA 5EU5B 4N5EC 1HINH 5AW7B 4HDIB 4GRWH 3H4FA 2Y36H 5DD5L 2Q5BA 3QJHA 4DEWA 1OGAE 1HS6A 1ZGLB 3FN9A 3MBED 4LLQB 1FNSL 5E2UH 3QPXL 2IADB 5E99H 4QWWD 4JM2C 2C3VB 4BWWA 1CB4A 3VQMA 2XWTB 3BKYL 2QPSA 1DTUA 3FN0H 3LPFA 3MV8A 5GRUL 3NP3A 3S96B 1V7MH 2X4TB 4PD4J 1QR4A 4BD4A 5C09B 5DJ6A 2W07A 5HVHC 2I7SA 2OMXB 4HUCA 2J7LA 3G5WA 4LSRH 4S1DD 3FCSA 4LPTA 2ODIA 1MKFA 2GJ6A 4L1SA 4NB7A 4NO5B 1PDKA 1J1OL 2D73A 3CVHH 1R3LB 4N5ED 4PGEB 3SZ6A 1SHWA 2DI8A 3RTQB 1N2RB 1GC1C 1HEZA 4FCAA 1DBAH 5ADPL 4QAMB 4ZO7A 5GRXG 2Y3AA 3QXDA 3MLYL 2FQFA 4N0UA 2GSIA 2WKGA 4JG1H 4TQPA 2DH2A 3H3KA 3TIDA 3VFNA 3V6ZA 4NPYB 2B3RA 2BIOA 1OGPA 2E75C 4KJWD 5AG9A 1T21B 4JHAH 2HJFB 4B60A 2B0SH 2DH3A 2YKKA 3DDGA 4OJCA 2VH5L 4OZHE 5JQIB 3IBOA 1XCWA 3EH2A 5CJOL 2EEAA 3LZFH 5LHDA 5TF1H 3P9MB 4TULL 3VU2A 1JZ8A 3AU1A 5A40E 4JKPH 3CUPB 4UT9L 5JR1L 1IIIA 2YPKB 4LAQH 2Y1YA 5I6NA 1OOAA 4ORGB 5I82A 1P6AB 3ZDYB 3MU3A 4HW6A 2YD5A 4NQCD 4XVTH 5JIHA 3UTTE 1UYWL 4BE6A 3LZQA 4HKZA 5EUKA 3VG0H 1J5OL 2NXYB 3AM8A 3GI8H 3VG9C 5D72L 2F8VA 1ACZA 2IH3A 3D25A 4G8GB 5TK2A 3M1BB 1T4KA 3V4PH 4DKTA 4KJPC 1I8LC 1FVEB 4XCEB 5KJRL 2FUQA 5DI8A 4RFOL 5D4HA 2E6JA 3B7RL 2R8SH 3MRJB 1AACA 4HH9A 1ZJAA 3ZSTA 3MLPA 2A74B 3T4AA 1JHLH 4PBXA 4PJGA 3LD8B 4LCUA 4XB8A 2WIMA 3CFBB 2EIMB 3OPZH 1S9XA 3GBNH 4KHTH 4PJHA 5GHWH 2AK4B 3KPSE 2XBTA 5IOPB 2O5ZH 4M43L 4R4BA 5C8JA 4H26A 4JJ5A 5AYUH 1H3PL 3ZDXB 5FLVA 3GK8H 4BSVB 1HKFA 1KFAH 5MEPA 4U2YA 1H8LA 1MXGA 3FDWA 3IJEB 3QB7C 4GFXA 4D9RE 1QTPA 3N1PC 2Q7YA 1J9CT 2OCCB 3C8KB 3CVIL 2OTUB 3MOBL 5CIPH 5DT1L 3TJHC 1H15B 3HCVB 1PZ5B 1V3JA 3KLSA 1AGFB 3G08B 4HIEA 3RILA 3SBQA 2VM3A 2AJZB 5JZ7D 1A02N 1D5IH 4KX9A 4U1IB 2A6KA 5FHAL 4D0CA 4E41D 1F8TH 1LMKA 2QTEA 4FTVB 4ODHL 3W56A 1S4IA 1TQBB 4PJFE 5TFSH 2CUMA 2YPLA 3T0WA 3UJJL 4D9LL 5JOFB 1D7DA 3ZR6A 2Z92B 4JR9H 1WD8A 2I07A 4WKZB 5JNYA 1CXIA 3NDZE 3P69A 1K8DB 4WZ9A 4E9TA 2CO3A 3MJ8B 4LLWA 2LW3A 1BP3B 5CZKA 1I3RA 5ITBH 3RX5A 4M1CC 4WNQA 4DTGL 2C4FT 2JJSC 2VDNL 5BW7A 2DIJA 1M2VB 2HVBA 1KCSH 3MLZL 4XNUH 3EG9B 3JUZA 3MBXH 4G43A 3RYMA 1JCKA 1LTXA 1UZ8A 2EEFA 3PQYB 4G82A 2O6CA 3P0YL 1I85C 1BZOA 4TQEL 4L0PB 3WKPA 3ET9F 1DO5A 3L5XH 3POCA 1MWOA 2CIIB 2F19H 4YDJB 4OAWB 2EE0A 4TF4A 4YAQB 1WIPA 4AH2B 1MHCB 2FDBP 3CZFB 2PN5A 3PF2A 1TCRA 1M9WA 3W9EB 3O0RH 4I9WD 3KLDA 3VJ6A 5FB8B 1RZIB 1WFMA 2VDNB 4JN2B 4NCC1 4L4VA 4Y7MA 4R7LA 3T0BA 1C16A 4ZXBA 2E8ZA 4JHWL 1ILUA 2AJSH 1E5UI 1O75A 4Q0XH 32C2A 3GXTA 1QX1A 1H6EA 2AITA 3GGWB 3IRCA 2WUBL 4X9BA 2ZUVA 5HGAB 4ETQA 4NUJB 1SY6L 1NH6A 4L3FA 5DUBA 1XF2A 1NEZG 2XU9A 3L2MA 3ZBMA 5BV7B 4XE0A 5F1IA 3BPCA 4V11A 2N7AA 4Q2ZB 3UYPB 3SY0B 2TRHA 2YMTA 4LARL 3DO4A 4UILL 2PPDA 35C8L 4JFFB 3MOAL 4MCZA 4NRYA 1PLCA 1I1FA 4OFDA 5E2TL 3ZIMA 2WK2A 3S34L 1FNHA 1BLNB 1IFHL 1UJ3B 2DLFH 4A2MA 4C54A 5IB1A 2HSIA 3L9RB 4Z7QF 3UROR 3U0PA 1H6FA 2FWSA 1BXUA 1O6VA 2FX9H 4N0CD 1LEKB 2M8XA 1UM6H 3OKYA 4K5MA 4NZ8A 1ECYA 4GO8A 5AALA 1LEIA 2XV6B 3O4LD 4UTCA 4RWYL 2NR6A 2VSKB 3R19A 4NJAH 1S7WB 3MGOA 1IQWL 4YX2L 1RERA 1V5JA 2ADFH 4P5MB 1T7WA 5C6TH 4QJ4B 3L9BA 1FHGA 2BMKA 2G9HB 4PREB 1WBYA 2R56L 4TNWK 4D0DA 2YZ8A 3L3DB 4FJZA 3VSUA 3QJZA 3B34A 2V9RA 4UIMB 3N6YA 4M7LT 1IBGH 3TZVA 1SLXA 3GT6A 4QYOA 3QDGD 2AK1H 4K15A 3L3OB 1SMOA 2VL5B 4J3XA 1VADA 2LFGA 4K5LA 1SJHB 2FB4L 4O2FB 3TT3L 5FUZL 3QZBA 3EYVA 4KQ4H 5E24E 1G84A 1HCYA 3GJFB 5D7IB 4PWKA 5DJZA 5KS9B 5L2KA 1NL0H 2XYCA 1CGUA 3HRZB 3II1A 4JQIH 4PWEA 3OGCB 5A1AA 1JGUL 1S7UA 2DWYA 4MDJB 3UJTL 4GQ9L 2Z35B 1IVTA 3LRSB 1QRNE 1OB0A 1JMXA 5IWLC 2EVFA 4YSTA 4DWHA 3WGVB 1SJEB 1AI1L 3D0LB 3WS3A 4X6FB 1A2YA 2PW1A 4PR5B 5CS7A 2PKDA 3ZQWA 2QPUA 4PS7A 5IUSA 4TSAL 2XV2A 2Y7OA 2RCSH 2X89D 5FWQA 3RI5F 3DVIA 1G6RA 4WHTB 4HALA 1SPDA 3AB0C 4XBMA 3FT2B 1WZKA 2BO0A 3V0AC 4CVXB 2BCKA 3MRCA 5EC2A 1RZFL 3GMNB 5DK3A 3TNNB 3BO8A 1PG7H 2IH8A 2Y1ZA 5IFHH 1X5MA 1XD0A 4I7ZC 3K71A 4ZUSB 3QDJB 2YR3A 3OKMA 3BWZA 1QLRB 3LN4A 2BP0A 4NRXB 3NFNA 3GMLB 2A6DB 4HULB 4QHUB 4KZDL 5L6YL 4RZKA 4LASH 4UT6H 1HQ4B 1U21A 1G9HA 5TQ0L 2AXHA 3EGSB 3FQNB 2ZWNA 2IWKA 2QQLL 2ZWYA 3CCHB 3BHBA 2QKIC 3DX7B 3F7KA 2ICWJ 1CPUA 4C55A 1EH9A 1BQHG 3UZVB 5CZVL 1DQTA 1F6AA 4F7KA 4YHPB 1Z0MA 2KDGA 5ETUA 4XWOD 1CFVL 2CXGA 3EYOB 2EAEA 3TM6A 5EU4B 2CM5A 4AW4A 5GGVY 2FECL 2V2XA 4Y7OC 4L4TE 2CKBL 1I1YA 3LEYH 3PFQA 4RX4D 5DHVA 5I8EB 2H2PC 2GG1A 4QO1B 3ECBA 4CW1A 3PPSA 3Q8FA 5GSVA 2NW3B 4LB8A 4Z7IA 1HSAA 1KSRA 4O00A 3PWLA 2IPUG 2WXNA 1A3QA 2ZWSA 3MLXH 4JKKA 4HLJA 1V54B 2XZAL 1XF3A 5ECJE 4NQUA 1XGUB 5CEZE 2B9BA 3K72A 5C1MB 2YFOA 1M4KA 2QADD 3BI9X 1N18A 1A7OH 3JUYA 3R4RA 2YK1L 3VXQA 4JCWA 2EDXA 3N0AA 4PTUB 5J11B 1E6OH 4MNQB 4JNXA 25C8L 3PY9A 4OFIA 4J4PC 1JZFA 4LVNC 1MUJA 4WUUB 3BUTA 1TZGL 2IVFC 3RWCA 1NANI 3UCRA 1IGFL 3GSUB 2VDRL 2AJ3B 2E46A 5I6XB 4JBSA 4RGNC 4RFNC 1M9SA 3SYCA 1GZQB 1ORQA 3KPQB 3WUWG 1XH1A 4GG6F 2AQTA 5AZ2L 5TPWL 3HR5B 1FIGH 1IAIL 3X11B 3VFUA 4DEPC 1EGJA 4ISVB 4P2RA 2GJJA 3TONA 4HPYH 5IROD 4NKIL 4GQZA 4DOHB 5ACLA 3E8UH 4KKZA 2NCEA 5C0BD 3WE6B 5EZJB 1SYVA 4BKSC 1OVZA 1J0YA 1FG9C 3KL5A 4YIQB 4TSBL 2J4WL 3HZMB 5LWYH 5KTEL 3MYZA 4PG9A 3HUJE 3HIZA 3VFMB 2CO2A 4Z0XB 3UPRA 1NWOA 1F4WL 1ANUA 1FFPA 1MFBL 1I8MB 2CQVA 2NZIA 4JW3A 2A6IB 2WZ6A 3QS3A 2R69H 2Z7UA 2OMUB 3UCQA 1E5AA 1PFCA 3THML 1W72L 2GC4C 3LS4H 1MAML 2DDQL 4FQ1L 4NGHL 2EACA 2WTRA 4TUOA 3ZDXF 2W0KA 1R5IA 5B4MC 5C71A 2P8PA 4CU8A 4XXWA 4BHUA 3H9YA 4U1SB 4MDRA 1KUMA 4NDMB 5AOLA 1KEMH 4OJFL 4HKXB 4XWGL 2EXWD 5DJAA 3DLQR 4LQ1A 1DBKL 4AGOA 3BIAX 4CVWA 4PPTA 2FSEB 1ZLWH 1FNGB 1OB1A 4X2UA 4JN1H 3DVGA 1ZY9A 1N0LB 4UM8A 1SDYA 4JFZH 3WIHH 4RBPK 4WO4D 3SE8H 5GJTH 1MAJA 1W0VA 2QSCH 1JNJA 3WJMA 5KYNA 2J6EL 2YZ1A 2Z8VC 5D7JD 2V17H 3OXRB 1IU1A 1RZGB 5B21A 2PYED 4N68A 3V52L 1D5MB 3RIAF 3PWNB 3OB0K 4RBPH 3ZT6A 3DECA 3LHAA 3NSXA 1JRHL 4XOEA 2E9IA 3JBG7 5C0NC 2DD8H 3BLKA 4M62H 4M6OH 1GS8A 3OB0H 3ZHFA 4OI7A 1T0OA 4BUGA 5JW4Q 1E3ZA 2J1ZA 1RUAH 1UWYA 4IIQC 5IJKC 5DUMH 1ZS2A 2X0VA 3Q1EA 5TH2A 3ZMRA 5T1KA 1GJUA 3RWJA 4W4NA 1F4YL 5E08L 4N24A 43CAA 3I6GA 1M7IB 3QA3A 1RLBA 3DO7B 2NY6B 4GINA 4ELME 1KGCD 3P3TA 2P45B 1I1AB 3Q5YA 4ZTOL 1XTLA 3MRHA 4HIXH 3GIVB 2CRIA 4XMPH 3T0EA 1A7BA 1JPGA 1U3ZA 4JY4B 2H26A 4KDVA 1AY1H 1YEJL 1L5GA 5JIKA 5J13B 2VM9A 4HBCL 1R3IH 4R5VA 2JTYA 3EBIA 3EO0A 3MRNB 3HPJA 3TYFB 3DXAB 4QGYA 3ABMB 4YDKL 3IS0X 1Z5LB 2FAUA 1E4HA 4OGXL 1INQB 2QDVA 3MV9E 1F42A 4WFGD 4XNXH 3B6SA 5L4FA 1SOKA 3S5ZA 4XHQA 2H9GA 1HINL 4FXTA 4OLEA 5EPMA 1PIFA 3O11B 3TEXA 4MQSB 3GRWA 3US9A 5J6HB 4HWBH 1ZE3C 4KGLA 1ZHBA 3S5LA 4HSCX 2DQEH 3LRLA 4U6YB 3VRJA 4WJ5A 4QT5A 3ZO9A 3AADB 4NN5C 3V4VA 1RZ7H 5E99L 3WLBB 5FO7B 2CUIA 3D9AH 3LQAC 1VERA 3TNMB 1DLHB 3FN0L 4OF8A 4WHYH 1ESOA 5KSBB 4FOMA 3UP6A 4G7SB 5TDNB 1V7ML 3WXWH 1IBFA 5I8CB 1BG9A 3GMMA 3LIZA 4X50A 5E9DB 4BH7B 1QYGH 4P9MH 1RZPA 4IGBA 4LSRL 3EW3B 4EN3B 5I8KH 5LKNA 2J73A 5C2BH 4OLYH 3S3JA 2RJMA 1PG7X 3MRQB 4MAYD 5DVPA 4F33B 5TE6H 3K8LA 4Z7WE 5GISL 5IEHB 1WG3A 1MF2H 1UHVA 1UOLA 3PWPD 4YXLH 4BIKA 1FL5A 3FT4A 2ZUSA 2AMUA 1FYTD 5C0CD 3ULUH 2OSXA 1AP2B 4GSUA 4GSXA 4LLUB 2YS4A 3CSYA 2W91A 1QNIA 4LHUD 3WAKA 5L8KB 4HHAB 5HJBA 1OD7A 4K55A 1QFWI 2YQGA 4EUPG 5C0JA 4XTRC 2YXMA 4PBDA 2BS8A 4JHAL 5E8NA 2B0SL 2VC2B 2W94A 3UMNA 1A4BA 3ARPA 1HI6A 2VDPB 4N8CH 4KFMA 4QHKJ 1PD1A 2CMRH 3KEHA 5D4QA 5KJ7E 1EZLA 5TF1L 3H9SE 3MBEB 1LO4H 4JKPL 4EI6A 3T2QA 4N8PA 3UEZA 4ZW5A 1KLUB 4KVPA 5IG7B 3ZT5A 1CR9H 4ALAC 1J48A 2E56A 3FTWA 3HI6H 4Y5YC 1UZ6F 1L9TA 3LKSB 2J5LC 1L7TH 3NJGA 4R7NA 3VG0L 3HG1E 4AQZA 3RNQB 2XZCH 3A21A 1CT8B 3GI8L 4XNDA 1H5BC 3T65A 3WFZA 4N2BA 4OZIB 4NOBA 5LQBL 4XTRD 4IOFC 2BOCB 2WLLB 3V4PL 1HCZA 3LEVH 5ANMB 4AYID 1ZGLA 2J8OA 1UCTA 4JPIA 5TE7H 5CD5D 3DBSA 3MRPB 3W2DH 2R8SL 2PW2B 1CICD 2C3VA 5KVGL 1SQ2N 4OZFB 3AREC 5GS3A 3GBLA 1JHLL 3QNFA 4RLDA 3DYPA 1HSBB 3UEQA 4ACTA 4FYSA 2X4TA 5DD3H 2CHWA 1PLAA 3B1UA 2HJLB 4XHJC 3REWB 2BSTB 4B27A 3OPZL 2PR9A 1GC1L 1WBZA 5GHWL 2HWZH 5L2JA 4NQQA 5FYJD 2O5ZL 3N55A 1NCGA 3KPRA 2XG4A 5AYUL 5GS0D 4NO5A 1S7XB 2H3NB 1SJXA 4A38A 1R3LA 5HVHB 1KFAL 4PB0H 4PGEA 8FABA 2Y0SA 3P3RA 4OR1A 1CMOA 5AAMC 5BJTB 2ZXQA 5DJ8B 4K2UH 2I25N 2XZQH 3RTQA 4P3DA 3SCMD 4X4MA 3UGEA 2P5EA 5ALBH 4NQCB 1ZA6A 5F88A 1D5IL 4IU2B 1RJCA 1F8TL 3BE1H 1UD3A 4FLHA 2WP3O 2EEBA 5TFSL 4N0UE 2UYLA 4YN3A 1ULVA 1Q9LB 4W9JC 3NJLA 2NDFA 4JR9L 3W0WD 4Y19E 2AQSA 4ALAH 2DJMA 1EAQA 2C26A 2ED7A 3NSCA 4M6MH 2CD0A 1ZT4B 4P4RB 2X3AA 4BFIB 1GSKA 1BVNP 2RB8A 2NY3C 2XXGA 3GTNA 3D39A 2JWYA 4XNUL 3MBXL 2A7BA 5D6CA 4UTBH 5HHOE 3EDDA 5FYKH 3E1ZA 3L5XL 4S11A 2F19L 1FP5A 3NPSB 3C2AH 1NANH 1MCSA 1U8KB 2Z9TA 3QAQA 4GG6A 1B4RA 5J4MA 4BELD 2WIIA 5EBGA 1JERA 1X5IA 2YUVA 2Z7ZA 3QNYA 1RHHB 4HEPA 4IHOA 1NFDB 4J1UB 5D71H 3F83A 1M53A 4JG5A 4W9KC 2AJSL 4KI5F 4LIQE 4HKBB 4Q0XL 4XCEA 5CSBA 4Z76B 3FQYA 5SWZA 2BJMH 5K9KA 4Y2NA 4UNTA 3L7EB 2VLME 5T1LD 3X1NA 1ZXQA 2NYKA 2A74A 1GMIA 4E41B 3NDYE 5F8RC 1YEIH 2ZT9C 2WLHA 3IJHB 1SOXA 1GOFA 2YC1B 5I17B 4XO8A 5C6WH 3CFBA 2HYMA 3OKDB 4IOIA 4W9EC 3VWJC 2FYVA 4M5YH 1BPVA 1S9WB 3LB6D 3BKJL 3QW9A 2E6QA 1WC7B 1CFTA 1NKGA 2AXWA 4XCYB 1NUFA 4QUOA 2Z4TA 3B37A 4HK3J 2WINB 3IJEA 4AYBA 2FX9L 4U49A 1RHFA 3RY5A 2DQUL 2Q10A 3HCVA 1AGFA 4Z9KB 5B1JC 2BNUA 4HKJB 1KACB 2KI6A 4NJAL 1IZKA 4K8RD 1OCRB 5DZPA 2QQQA 3TA4D 4XN1A 4IBSA 1S9YA 2F08A 1IE4A 3MHZA 2ADFL 5CNHA 2OW6A 2UZIH 3FO2B 1JMZA 3MGTB 4WKZA 3OAWA 4R2GD 1THCA 3HZVA 2X6CA 4PJCE 1K8DA 4N8VA 1F02I 3FYEB 2PABA 2DM7A 4LKCB 5DS8A 4N2LA 1Q38A 5DUPH 3HMWH 5HGGS 4PJIB 4IKJA 1D5BB 3I75B 4ICWA 5B38A 3HJEA 1LNUA 2RGSA 5DZAA 1Z2KA 1J8HA 2CIIA 4OAWA 4AH2A 5KSAA 2DMBA 1MHCA 4ZQKB 1KNOB 3CZFA 3QCVH 2R39A 4KQ4L 4DPBX 1BGXH 3NIDB 3RDTA 4JFEE 3QH3B 3WNPA 4EUPH 1PAMA 3US1A 4P4KC 1J87A 2NNFA 1NL0L 3L45A 5FGBA 3IGUA 4GIAA 3WDJA 2DIAA 2OYKA 1OLZA 5D2NB 1CLOH 2UY6B 2OL3B 4N86A 5B8CC 2F53D 2JJVA 3IDMA 2GTQA 5GXBB 3BZEB 2QLVB 5HGAA 5JPMA 1MJ7H 4DGIH 4MHHI 4QKXB 3KEDA 4ELKA 1G5GA 3TXAA 3O4LB 1RKRA 4AZ8B 2RCSL 3AUVA 3BUYB 3SY0A 2LT9A 2W0FA 2XVGA 1G9MC 5INCB 1MCPH 4UI2A 5C86A 3DUSB 3ARBC 5ID1B 1UJ3A 1PG7L 5CFAA 1NAMA 4HQQL 5IFHL 1Z1WA 4BSWA 3QDGB 1P1ZA 2YUWA 2FBRA 5HYSB 2ZKYA 4YHYB 5ID0A 4Z5RA 5IR1B 4LVHC 3MODH 1E8WA 3Q6GH 3BVWA 5CILH 5T5FA 2E59A 5CBEB 4FMFA 2AW2A 3MUZ1 4UT6L 4LASL 4QCIB 2BSEA 1S7WA 2C9VA 1Q9WB 2Y5TB 4NRZB 4DK3A 2BVQB 3FB6B 4LGRB 4NZTH 1ZLVK 5JMOC 4MJ6A 2DF3A 4JDTL 5KYYB 2YA1A 4N1HB 4FHKA 4AEIL 1OEZW 2IQAB 3UTSA 2APBA 1KG0B 3ARRA 3F12B 4H5SA 1ZLVH 1WA2X 3CN4A 3UADA 4E9LA 1U8HB 2VL5A 5FYKU 1CXLA 1OZUA 2DIBA 4L18A 4YHKH 4Z3FA 1SJHA 3HBQA 4LL4A 2H0EA 4HIJB 5CP7B 2DQJH 3LEYL 1WO2A 3EJSA 1ADQA 3OMNB 3WJLA 3KH3A 1JZIA 1O5PA 4O2FA 3EDFA 5HYIA 4Y5XC 4PLNC 1ASOA 3UAJD 3NGBC 4RMUA 2F54A 3ZW3A 3MLXL 1MCBA 3HRZA 4LDOB 1HH6B 2B77A 1QFWH 3U1PA 3ZZQA 1UD2A 5L2KE 1JGEA 3IF1A 1SUJA 3S97C 1PX4A 2ZX6A 4CKVX 5EBLA 5I74C 4D8PA 1E6OL 1QVOB 1NEPA 1OTUD 1D7BA 1JJUA 4FX5A 3RX8A 1AS8A 3HNSH 4AQ1A 3CX5K 2WOBA 1KJMB 3SDDD 1RCYA 2WQVA 4L8BB 4ZMPA 1NGXB 3V5HB 2VLJE 3FT2A 3VXOA 3D4CA 3FTUA 3KG5A 4GKSB 4CVXA 2KT6A 1E3FA 4BSJA 2XQBL 3AB0B 3UAFA 4DP1X 2F1AA 5HGHB 3O3EB 1KPVB 3L3IA 4FD0A 1FIGL 1K72A 1O7VA 1P4BL 1MNNA 1U8LA 4HPYL 2KHAA 3IPFA 2A6DA 1BFOA 4QHUA 3OHXB 2H8PA 1D5XA 1S3KL 5MERA 4G8FB 3ZMNA 3T1FA 5A6LA 2VRAA 3FQNA 3ESNA 3IE4A 3RVUC 4M1DH 3QQ4B 2VW7A 4LEEA 2BK8A 5EWIL 4R3SB 4MQXC 1S5HA 3GM0A 3FPXA 1VFBA 3H56A 4HMCA 4RAVA 3BDBA 4JFDA 5MEQA 3VI3B 4X5WB 2QADB 3WN6A 1AG0A 2HKHH 3LS4L 1NIBA 2QKIB 1KWKA 1BREA 3EYOA 1XQ4A 4P9HC 3OR7A 5EU4A 4KITB 3M1OA 1RK0B 4Z3JA 4N20A 4X8CA 1AE6H 3GI9H 4KDTC 1KEML 1T0NA 1I9JH 3B9VA 2NY5C 1QBMH 1E7UA 1XL6A 5K1VA 4JN1L 1A7RL 2UY7A 5I1GH 4Q7DA 4L9LB 4JFZL 3WIHL 2O72A 5H4YA 4PJXB 3SE8L 5GJTL 1XGUA 2QSCL 2GCYB 4P46D 2ICEB 2N7BA 1V05A 3HI5L 3NJXA 2V17L 3DO3A 3PV6B 3FL7A 4IKIA 5AB9A 1RL1A 1YN6A 2HFGH 2L7UA 2O93L 4GBXC 4MQXD 4J2QA 4PTUA 3CHXA 4MNQA 4AV5A 5C0BB 3QO0A 3AG3B 3Q9PA 1FFTB 2DD8L 4M62L 4X99A 3I6LE 4M6OL 1UWGH 4ZPVB 2X41A 1IM3D 3GSUA 2BP3A 4JHVA 5EMYA 1RUMH 1PZ3A 1RUAL 4F37K 2UUDH 5DUML 1HL4A 3B2UD 4XX5A 3KPQA 2QGBA 4HAKA 1EDYA 4KK8C 4G6FB 5DRNB 5B1AB 1EEYA 1CLYH 4RGNB 2W65B 3EGXA 4RFNB 3WG7B 3HR5A 3UIZA 1FZOB 1NFDF 3AT9A 3BEWB 3BT2H 3VYPA 3X11A 4HIXL 4ISVA 3FTGB 1GCFA 1AO7A 1FN4A 1UD4A 2IANE 4XMPL 4RGMC 5EULV 3WFHB 5KSVB 2ZD0A 1YAZA 4ZFGH 1ZWIA 3ULVC 2XT1B 3D7PA 3FB7B 3WENA 1EHXA 3P11H 1R3IL 2EECA 2X0WA 3CN3A 2YJQA 3HZMA 3L5WB 1JPTH 1VSCA 1VEOA 4Z0XA 2PUQT 1I8MA 1YEKH 2YAHA 4WO4B 2NY4C 4XNXL 2FO8A 4FQXD 2VXQL 4OGQC 3MLRH 1TETH 5E8DH 5D7JB 1SF5A 2OMUA 3SBPA 1KBBA 1RZQA 5DMJB 1YCSA 2NY5H 2PYEB 3AQXA 4PJ7E 5E1IA 4QHPA 2P8MA 2EXYD 5HHME 4C56D 1V55B 3RUGB 5F9WB 1QEWA 3UBHA 1RZ7L 3HRPA 3D9AL 4H8VA 1JVOA 3Q5TA 4A2EA 1Z3GH 4P8QA 2AF2A 4TVPE 5FKPA 3PGCB 2FSEA 3QJTB 4L3CA 5E4EB 3WXWL 3QWNA 3ZDZF 4DKAA 1D5RA 2B20A 4WU7B 4P9ML 4ZTPH 4EDXA 1YJDC 2VLRE 5I8KL 3UFIA 3OXRA 5C2BL 1D5MA 4OLYL 5JUEH 5F7BA 3EYUH 5TE6L 4DUWA 2X2YA 3SJVB 2XFGB 1MF2L 2A5UA 4PJIF 5T3ZL 4YXLL 2VMJA 3SEPA 5EEXA 1JZ6A 3I3EA 5HJGA 3IMBA 4Y4KC 3OZ9H 4JANB 2EXTA 3JVGC 3N0PB 5I1CH 2WLYA 4DJMA 2E0PA 4EIUA 4ZW7A 2HLFC 4HV8B 3CHRA 5EN2A 3HHRB 3RIFF 4ES9A 1YMHB 1UKSA 3DO7A 3FUMA 1I4FB 1OPGL 1RUQH 1E27B 5D8JH 3QUXA 3VI4F 4N8CL 1IC1A 1WTLA 2CMRL 2LU4A 4FNTA 1P9MC 2W59A 3FQTB 1GTNA 2V33A 4W9LC 4I0CC 4LZKA 1LO4L 4DNLA 3KPPA 2H3KA 1N6UA 1JK9B 1ZHLB 3HPLB 5AW3B 3WHE1 3WGUB 1CR9L 1F0LA 3KPOB 2M83A 3ZL1A 3DXAA 3R06B 4FG0A 1II4E 4JFQB 3BEVB 4B95C 4NAQA 1A7NL 1L7TL 2PYFA 1KIRB 3GNMH 2XRAH 3VRLE 1INQA 1MH5B 1ZCRA 1NDGA 4RMSA 4WV1B 3LQAL 2DN7A 4PP2A 4GSDL 3TBSB 5DHMC 2C1PA 1U95A 1QKZH 4G6JH 4CA4A 4MAYB 5E95B 3Q01A 4P23C 4CC4A 3S3SA 2FK9A 2CE6A 3AMLA 5FYLD 3LEVL 3ZT7A 5C08A 1YSOA 3PWPB 5TE7L 4MMXA 2N4IA 1PCXA 2F6AA 3W2DL 1FYTB 1YJDH 5C0CB 2IGTA 2K4AA 5H35A 2JKRM 2HJKB 1AYOA 1DLHA 5CEYB 1AXSB 3BYTA 2FH6A 2DEXX 5F1NB 1CG9A 4LHUB 5DD3L 3RY4A 2AZUA 5I8CA 2EC9T 3W81A 1PZBA 4YDVA 2BCMA 4BH7A 1LK3L 2HWZL 5LBSL 1EVUA 3BAIA 5IFJB 1KIQA 4HSAC 1MLBB 1VACA 2EDMA 3MLVL 3MNWB 1RUPH 2LV4A 4F33A 1MHEB 4PRIA 2IMMA 2EIZB 2IG2H 4BQ9A 2NSMA 1U2YA 3KGRA 5DZ9A 4K2UL 4P23D 2XZQL 4OZGB 4HFWA 1T1YA 4NXSA 4K3DH 1JDAA 2AQRA 3T8VA 2OZNA 3P02A 1NWPA 1ASPA 2YUZA 4NCC2 1SXNA 1PY9A 3D2TA 4WTXA 1X5YA 5IVXB 1CK0H 3MA7A 4ZFZB 4ALAL 5CU5A 1A7PH 1NMAH 5EOTA 4M6ML 2I9LB 3NN8B 4XO4A 1G94A 2Z3FA 3C60C 3KPMB 3MBEA 4GKOA 4PYHA 5E6SB 4UTBL 1KLUA 2N0KA 5IG7A 3TH4T 1CICB 1P7KB 4N90D 4KNSA 2EADA 4MZ3A 1AHWB 3C2AL 2YKLH 3ETBJ 3MOQA 5PCYA 1AHKA 4E68A 2YQ3A 5EU6E 1E3XA 1UH2A 5HGDB 3KJ4B 1GS7A 2KBGA 3RNQA 4Y5YB 2BVTA 4WFHD 4D7PA 1TQCC 2J5LB 5FF6B 3O3DB 1BFSA 4JFHD 2J57A 1L0XA 1P84J 4JDVB 4OVUA 4BFEA 2JNZA 3A23A 1H5BB 1W6LA 4JKLA 5ANMA 1EV2E 2CGZA 1DJGA 2BJML 1FH2A 4XPAH 2WLIB 2Q9OA 1I75A 5IOKA 3OWRA 4GP8B 1NLBH 5AW5B 3SCMB 3TPUA 4HCIA 2ED9A 4OZFA 1AD9A 3CZKA 3HC0B 2AJVH 3DX1A 1GS6X 4HEMA 1XWVA 3MJGX 6PCYA 4QXVA 2BSTA 4W6WB 2NSXA 3TCLB 1DQDH 4M5YL 3BQUC 5MEND 3E8VA 1Q1JH 5C09E 4ZO8A 2ESVE 4WI9A 4HD9A 2H3NA 2ITFA 3F7PC 4MCNA 3VI3F 1XF5B 2BSDA 1UM4H 1XF1A 4L48A 5BJTA 3N40P 3OSVA 2Z93B 1K2DA 2JB5L 3WEXB 2GUOA 4JY6A 4P0DA 2XG5B 4P2OC 3NYKA 4YDIH 2AJXL 3K8MA 2CDGA 1SQMA 4I5BB 5IGXH 4L8CB 1EJOH 4LCCB 2OXHA 2UZIL 1Q9LA 4IRJC 2KLSA 2OFQA 3KHOA 1RSYA 4FQ2H 2R15A 4P3WA 4QTIH 4IDJH 3F8UB 4X7FC 3RHWF 5KOMC 3QIWC 4NZUL 4WTZG 4M61A 1ZT4A 4P4RA 4WWKC 2WBXA 1YMMA 1MCNA 2KPNA 3L7FA 5DUPL 2R0WH 3HMWL 4Y1SA 5T1LB 4ZMWA 3QO1B 4AQOA 2FE0A 2V5MA 4BH8B 4PJBF 3ZKMD 1LWHA 5FWRA 4S1QH 2QSTA 3ZDYE 3QCVL 3WEBA 1U8KA 2HT2C 1BMWA 3K81A 4NSKA 4ZOBA 5EC1B 1BGXL 1VIWA 2E47A 4M8QA 4YWGH 1UA3A 5GRZA 1MG2C 3ZYOA 3JYBA 1OHZA 1HHKA 4IS6B 1L9QA 3KBHE 2W5PA 4J1UA 1NFDA 2VZ1A 4CVZA 1DVFC 2X9ZA 1X6NA 3I9IA 1O6SA 3OLDA 2YA2A 1CLOL 2CCLA 3L95A 4G8GE 4PTTB 4J6IA 4M3HA 4K23H 4WWKD 2N56A 1MJ7L 2NNCA 2R1WB 4FQLL 4MQ7A 3PNRB 4DGIL 4GKNA 4TUJA 3SPGA 4KY2A 2VZUA 4E41A 1QFUH 4HD5A 1KULA 3A3YB 3IGFA 1G7HB 3CZGA 1E28B 2P5WD 3M07A 3EFDL 1DN2A 3RKDC 4N8VG 3ABGA 2WUCH 2WPGA 2C9XA 4KMTH 4R2GB 1KJ2B 1MCPL 2HT2D 3S7GA 3WI9A 2AK4E 5IMLB 1CXKA 1MW2A 2HXAA 1IGIH 1ZTXL 5EU3B 4I3GA 3ZYIA 4AL8H 5D96C 3ZDXE 2J88H 4YSSA 2Z31D 3AWEA 4GUPB 1G6VK 2OMWB 1W80A 4I13B 2WQAA 3MODL 3DX0A 1UGKA 4YO0B 3Q6GL 5KBDA 3IU3B 5CILL 3F2LA 4E5XB 3OG6B 1S78C 5KSUA 4ZX6A 4YH6A 3CZLA 7CGTA 4JHBA 5F3HA 3B9DA 3GLAA 3UZQB 3SO5A 4Y16C 3RI5K 4R9HA 1F58H 1K9TA 4B96A 4NZTL 7FABL 2VDOB 1MVFA 4FTVE 4J3UA 3WSQL 4GW5B 1BFVH 4JVWA 5ALCH 4O02B 2NYYD 1E67A 1T6WA 3E1F1 5DEFA 4P57B 2ZXEB 1P2CB 4F91B 1ZD6A 5J89A 1KN2L 2F53B 4PM1A 4PJIA 2FYYB 3I75A 2X10A 1HU8A 5CKGA 1N68A 4ONHB 2BERA 2VJ0A 3G6DH 3UTPE 5L9DH 4LQFL 3PQYE 3MRMA 2DQJL 1YPZF 4ZQKA 4QLRA 1KNOA 2AXGA 4G6AC 3VYOA 3CX5J 4HOXA 1QUNA 3BH9A 4J28A 4ZMNA 3KS0H 1CGVA 5BRPA 3BWUF 5D2LB 1FWXA 1B2YA 3MRLB 1QLEB 3KMDA 3VI4A 3FH5A 4OCNC 2YBGA 4AKOA 2WQUA 2WWMD 2ZKWA 5FV2A 1HL8A 2OL3A 4JRXE 2Z0BA 4YGAB 2CNYA 4LGSB 4LNRB 3QFDA 3K5RA 5E8EA 4XXDB 4W6XB 4M1GH 5AYQA 3SKMA 1TZAA 3O4LA 1KIUB 1YQ2A 4N0RA 5EB9A 3HNSL 4AZ8A 1SUHA 4HLZG 3BUYA 4KRNA 1AR1C 1GOGA 3ZXAC 4GEJA 4HUVA 1MJ8H 2FSDA 3LXBA 4S2SB 2B8OT 3UJIH 3V0DA 2E7MA 4Z77B 3GTVA 1L9MA 3FFDA 3DUSA 4ZD3L 2ATKB 2XC8A 4JFFE 1YDPA 2JIXD 5D5ME 2HT3D 3B5HA 5E8PB 3C09B 1O7DE 4R90H 1A14H 3ARBB 3BKCH 5J0BA 4NN7B 1JZGA 5HPOA 5DDHA 4F8TA 2P9RA 3U4EB 4KFZC 3U4BH 2LVEA 3WO4B 1I82A 4JG0L 2ATAA 1N3NA 4LVHB 1TR7A 2QZQA 1I7UB 1JVLA 1LE5B 3L9EA 4YC2B 3H8NA 1RURH 4XP4H 3TBWB 2BVQA 3FB6A 1BEYL 3M17A 4M1DL 1P5UA 2GJZA 3COOA 4LK4A 1HCFX 5KYYA 5BNXD 4JRYD 2JMRA 4HUXB 2WBWB 2K3TA 2IQAA 3D07A 3KR3L 1TVBB 3ARWA 3EJPA 2HKHL 1MHHA 3FTZA 1BF5A 3CNKA 2KDYA 4S10A 1TSHA 4DUXA 2A3TA 1YEGL 3BRFA 2WCPA 1Q0EA 5IFAH 2L3BA 2YOCA 1AE6L 3GI9L 4OZGF 4E9QA 3CDCA 2X89A 2EDYA 2MNWA 1CYGA 4AGQA 1OY3B 5H94B 1YRKA 5I1GL 1S5IL 4YL9A 4LLDB 4PJ5D 1WZ1H 3KDPB 4X6DF 2PTTA 1HH6A 5D7IE 5KS9E 3NGBB 5I5RA 4G11A 5GIRB 2A0LC 1BX2B 5FS5A 4ZMYA 3F62A 1HL9A 2PTUA 3IXTB 3QIUA 2HFGL 2BZ7A 1RULL 1JWMB 1XHHA 1YNKH 1ACCA 4Z0BH 4ANKA 4M8RA 2BNRD 1CDYA 2WHVA 1UZGA 1RH8A 4ODUA 4FE9A 3FW6A 4RWHA 1RV6X 5ERWB 1PKQB 5I74B 1KB5B 2OMTB 2XV0A 3PHQB 1UH4A 1UWGL 4L8BA 1LGVA 4ZFOL 4FZEH 3V5HA 1AZVA 1CFQA 4NAJA 5A43C 3TH3T 3P4MA 4DN4H 4RH4A 3U1SL 4GKSA 2A77H 4ANUA 4XMVA 4X4KA 1KXVC 4PVLA 3O3EA 1CLYL 2QMJA 3AZUA 1BOGB 3FCGA 3MV11 1CL7H 2VDLB 3BT2L 1D9KC 5B22A 4OI9A 1Q0YH 2A83B 1SXCA 3QDJE 2OSYA 1ODAA 1LEGB 1DSFH 4KKCD 5DYOB 4G8FA 4WW2B 1JNNH 1E8XA 3P11L 4FDWA 1QI5A 4ES8A 2MPVA 4XPTH 4Z8FH 1JPTL 4LESA 3SGKC 4N1EA 1JF6A 3DHMA 4P9HL 1A8ZA 2VZVA 5E8OB 1YEKL 1IBBA 1WAAE 5D1XC 4OFYD 4MYWB 2I69A 4P46B 3MLRL 1TETL 5E8DL 4BK5C 5F9DC 3FULA 1BIHA 1EHKB 4L1TA 2NY5L 4X5WA 3VI3A 1J8KA 5KW9H 1XT5A 4XBEL 1F13A 3O6FD 1GHFH 1X9QA 4NXKA 3U48A 4F7MB 2X4UB 3PGDB 5DRWA 2CRZA 4H8WC 5FA3B 1JZDC 1RK0A 1DVQA 2CPUA 1NGQH 1S8DA 4B9YA 3S3PA 1A3RH 1Z3GL 3DVFA 1IRAY 3BT0A 1LK2B 4YHOH 1IM3B 2BP5M 4GRLC 1Z3RA 3A5VA 4KZ0A 2CRMA 2GC7C 4JG9A 4NI3A 3CQPA 3SPVB 2BPBA 3LY6A 4F3FB 1YYLL 1NPNA 2GCYA 4ZTPL 3MXVH 1ADWA 3T8MA 2X88A 4G71B 1L0YA 5CJ8A 4WI6A 2CZNA 1C5BH 3ALPA 1AXTL 5JUEL 3EYUL 4XN7A 5E1QA 1I9IH 3HHSA 4PJBA 4NHUB 4IK7A 4EI5C 5IF0B 2ZOTA 5E0QA 3QYNA 3MACH 2Q6WB 1HKLH 3W3BA 1J8RA 5CJQL 2FEDD 3WUZA 1W2KT 3OZ9L 3FT9A 2MCPH 3FYIB 3NIFB 3P9LB 4WUUE 3RPBA 1KN4L 1UTDA 5I1CL 3GDCA 2BWQA 4XX1E 2UXGA 2H32B 3UIYA 4DCQB 1OM3H 3FH7A 4FQXB 4WFFD 2EUWA 3FXIC 3KLLA 3QRLA 3ULVL 5DRNA 1J1XH 3U9PL 4ADIA 3BP5B 2YEVB 2PCFA 1ZVHA 1FZOA 5D8JL 1RUQL 3B43A 3BEWA 1TJXA 1WFJA 3ILQD 1DLFH 2BLFA 4C56B 4WWPA 1U91B 5KSVA 2R0KL 4P48A 3WFHA 4MS8D 2TSAA 3VFPB 3PJNA 4PFEA 3NFPA 1RXLA 3FB7A 3QT2A 4MQTB 4DOHE 5FOBA 3L1OL 3L8QA 5I6OA 4XMTA 4RGMB 5LBVA 2XXMB 1URLA 4BQ8A 1VGKB 5T3XE 3GSRA 2DMHA 1IT9H 3GNML 2XRAL 4JFYB 3OR6A 2D4DA 5E7BA 4NC2B 1QATA 1N67A 3O8XC 2PYEA 1OKEA 2F58H 1F2QA 3TESA 1QKZL 3AXIA 2NY4B 4G6JL 5TDOB 1TVHA 1BVLB 4FXGB 4LRNH 5DSCA 3HAEB 4PJAB 3FAWA 4AZUA 2ZOLB 3Q2WA 1YJDL 1GGCH 2B2XL 3QJUB 4Y2DC 4XRCB 3WD5H 3GLZA 3T3MB 2J2ZB 5HVFB 4CNIB 3HS0A 3I3BA 3L08A 3PGCA 4M7JL 4PWJA 3R18A 4TTDD 2OYLA 5IV2B 1EHLH 1XGQB 3WKNA 1OW0A 1LQBC 5HHPA 5JDSA 4Z78B 1EVTC 3S2AA 4O51A 3PL6A 4J5VA 1H9DA 3DRTB 4TXVB 5LUMA 1NBYB 5MHSD 1RUPL 1E4WL 5HPMB 3FUEA 1BJ8A 5D7KD 1TUPA 2YAEA 4YE4H 1FAIL 3P3UA 1Y0LB 2XN9D 5TDPA 1CVSC 2IG2L 3A47A 2RIKA 3GO1H 1OP4A 3O8XD 3FTVA 2XACC 2P42B 2RR3A 2OJZL 1YPZA 2ZXWB 3CPUA 5BZWA 2EO7A 2OZ4L 3DROA 5FR3A 5DJ2A 4K3DL 3RFZC 4NWTH 1C1EH 1B90A 1FZJA 3U2SA 1JVKA 2IOMA 2ZWZA 4UQBA 1WT5A 3QXWA 4OUOA 4Y2DD 3SDXB 1QSFE 4YSUA 2YGNA 2FT7A 4F5CE 2DJUA 4YXHH 1KTLB 4ONFH 1A7PL 3DARA 1I4FA 1USQA 3C6LA 2MJWA 4J39A 3FQTA 5MEOB 1TO5A 3CH1A 4P05A 2LAGB 4ACPA 4EE2A 4ZZKA 4J2XA 3QJVB 1JAEA 3HPLA 2YEZB 4IBWA 4OF3A 3R06A 2VIRB 2YKLL 1XV8A 3QZPA 1A1OA 3OL2A 2F8OA 4JFTA 1EAPA 2ZCZA 1R17A 2FQEA 1ZV9A 1J10A 5GS1B 3GS4A 3IJYB 3J8F7 1LDSA 3BSHA 3NEXA 4I48B 4OZ4B 4PW3A 3Q48A 2NTFA 4YHNA 4MJJA 5DJXA 4MAYA 2BIHA 1INDH 5CCKH 3TEZA 5F1OB 4LSSH 2GTZA 3PWPA 2I27N 1OT1A 4XPAL 2OCJA 4P23B 1YY8A 4OD2B 5C0CA 1NLBL 1RQ5A 4PBWD 1QSEA 1LD9A 3KPNA 3MLUH 4LVOC 5CEYA 3S4SG 3WJJC 3OX8A 4LHUA 4ZAKD 3T0VA 4NUPA 4HPHA 2RTTA 5KSBE 3GMOA 4Z7NB 4Z95H 3WY1A 3O9WC 3P77B 5E9DE 1G7LB 3G9VA 4NFCA 1WITA 1Q1JL 3FZUC 1GCYA 1Q9KB 2C4XA 2CJTA 4LSTH 1UXMA 5ITFB 4NP4H 4P2CG 1MHEA 4DN3L 4FHBD 3AT8A 1JV2B 3QZWB 4H4NA 2OMZB 1UM4L 2AKRA 2EIZA 4FXKC 4DO5A 3DX2A 3II3A 4MMZA 5I0WA 4QEGA 2VM4A 2XBZA 4QRPD 1TFHA 4YDLB 4OZGA 1FFRA 1GKOA 4X6CF 4WENB 1KB9K 4PJ8C 5EZLB 3ULUD 3SODB 4YE0A 3DUUB 2V5RA 2OBGA 1BDYA 4YDIL 5E00B 1CGTA 5CEZH 5IGXL 5IK3A 4X6DA 2C9AA 2YAPA 4P2QD 1A47A 5CZRA 1Z5YD 1BPLB 5EIVA 4JRFA 2W38A 3TIEB 2ENQA 2OR9H 4QTIL 4IDJL 2NY0C 2GBUA 3WY4A 3GSNH 4LSQH 1NZRA 2BVYA 2YAFA 4IJ3C 4PS3A 2I9LA 3F84A 1KYDA 4WEBH 3TF7C 2R0WL 2EYRB 4YR6B 4TL5A 3LQZB 3FU6A 1BBDL 5BS0D 2D8KA 5KUMA 1AGDB 4FQCH 5DZLA 4Y4FD 2H1PH 4Y4HC 5HHQA 5JQ6H 2CXKA 4YWGL 4PJ8D 4HK0A 3ARDA 3ECWA 2VWEC 4URTB 4MBOA 5MENB 4OLZH 2PXYC 5FF6A 1X7SA 2P24B 4HP5A 2Q8AH 4JDVA 5EBWB 3NESA 3UZEA 3NFSH 1TQCB 1CIUA 4OZIE 1QFWM 4A7TA 1QLFB 1RZKH 4Q74A 4D9QD 4K23L 1L6XA 1FVDA 5GZNC 3D6GA 1WISA 4QRRD 4AKPA 3HC0A 5BO0D 4A67A 1YNTB 2G2PA 5MI0C 2XTSA 3EJTA 1QFUL 4H1LA 1QEXA 5IIEB 5CP3H 3FU0A 4TQIA 2D03H 4Z7OE 3ISRA 2AAAA 3N41B 3O2DH 3TCLA 2WUCL 3LKOA 3W0WA 4RAHA 2J71A 4KMTL 3RZCD 4LF3A 2H6PB 1QASA 1VFUA 4LFHG 5JMRA 1IGIL 3EGDA 3QPQD 3RG1C 4AL8L 1R1CA 1ACXA 1WIOA 4X7DC 1XF5A 3ZTCC 1JXFA 1U3HC 5D93C 3K1KC 2FBOJ 2YD6A 5GPRA 2C5DC 5A2AA 5KVGE 2JXMB 4IRZA 4JGMA 2E76C 3WEXA 2HRPH 2XG5A 3MFFB 3X14B 4I5BA 4NQCE 3EOBA 5JO5A 5DK2A 1F58L 2HRLA 4QRUA 5CINL 3KWUA 5ICUA 4L8CA 4NPKA 3IDNB 4ZS7H 1BFVL 2PPAA 2J72A 4P49A 3QNXB 4HUWB 4G9DA 4N2HA 2OTWB 4IRJB 5E9NA 3MYJB 4XPGH 1BVKA 2YGQA 3H6JA 4WWKB 5T1LA 1ODUA 3SE4A 4RNRB 4BJLA 3OKKB 1A9VA 2V8MA 5FYKD 3G6DL 5L9DL 5DHXB 3L13A 2GHWB 5KYWA 3MI6A 2P5WB 3MJ7B 4O4YH 4DZBA 4ODSH 5DRZA 3T9WA 5CR1A 4M3KB 3NIFF 3ARUA 3KLAB 4X0KA 4Y5VB 1WA0X 2XWBA 3HB3D 2NT1A 1LL1A 3PGFH 3GSOB 1CGWA 1OAYH 4JFPA 4EZLA 2J21A 3OKNB 4PIBA 4WHDA 2Z31B 3IJ8A 2VO8A 3LNGA 1DVFB 5J12C 4ZSOB 4O5LH 2HMIC 1A4JB 1RIUL 2Z4QB 1ZHKA 1DDTA 4CC0A 2QVTA 2XTJD 4JUSA 3RE0A 4Q4IA 2R1YB 1G7HA 3D0VA 4PJ9C 1A65A 1MJ8L 2N59A 4NNPH 2OA9A 4MB3A 3X1GA 3PLYA 1KJ2A 1L6PA 4U1MA 3PIQB 1KTCA 3SDAC 2FZ3A 5FLUA 5C9JB 3MSPA 2BIMA 4MMYB 4GUPA 2R1XA 1DDHB 1I8IB 2OMWA 2YJLA 4R90L 1A14L 3BKCL 4MJ5A 3UG3A 3BP6A 1FAKT 4PJAF 4XODA 5AW6B 3D52A 3U4BL 5IHLB 1IL1A 1R33A 5DMKB 1TLKA 3HE6D 4BCYA 3BYYA 3T3MF 1XBDA 1RURL 4XP4L 3QDMD 4ZMZA 1E9QA 2Y6TE 4LL1A 4WW1B 3WNNA 3FOMA 3SIKA 4NO0D 3QUML 2ZJSH 4O02A 2Y5EA 1UWEH 4ZZFA 1YECH 3EJQA 3IAPA 3NSJA 3NP4A 2X6VA 4JPVH 3MV7A 4FZ8H 1EXUA 3SE6A 4Q9CA 3HE7A 2R29H 4AV4A 3TWCL 3WTXA 1EZVX 5CFHA 1CDGA 4G2AA 4XPHH 3IAGC 3CLEH 4AIZB 1XH0A 3LNFA 4ONHA 1JWUA 3L2NA 4PW4A 1E6JH 1YEFH 3TX4A 4KUCD 4L23A 4XCFH 1WLHA 3ECQA 3QJXA 4IRSA 1U92B 1QABA 4HGWA 1E90A 3KCPA 4OJYA 3QUMB 4RSYA 5FM5M 5I9QC 3TTSA 1PLGH 1M05A 4GS7B 1MW0A 1TPXB 5AB1A 2R7EB 1WZ1L 3NIDE 1MZYA 2X40A 3SYOA 4IBZA 3ZR5A 3N1MC 1MN4A 3MRLA 4KK5D 3CSFA 1CXFA 2JIXB 2NZ1A 3Q9QA 3QQXA 3LN5B 3RU8H 4DIXA 4Z0BL 1SGKA 4LNRA 5D2NE 5FW7A 3W39B 2DQCH 3APDA 4XXDA 4C58B 4EZJA 5A3IC 4ZNEE 3ARFA 1KIUA 2ZXBA 3AFLA 4JM4H 2EH8L 2NY2C 5FIEA 4LOUC 2GJ6D 3L3HB 3DJ9A 4FZEL 4WI5A 2ERJC 4OUUB 1UD8A 3RX7A 3VAEA 2APFA 5T1DH 3OLGA 4H2AA 3U9UA 1QSVA 4F2MB 4YLQT 5HDQH 4AY0A 2XNAA 3CFDB 2DAVA 2DQIH 4KKRA 4J12A 1F11A 5DEGB 5E70A 2IH9A 4UTAH 1CL7L 5E8PA 1M2OA 5I6MA 3WMSA 3BW9B 4AG4H 1Z9OA 3AM8C 5D1ZI 4EXPX 3L17A 3QDGE 5F0PB 5IKCA 4E0RB 4KJQC 1DJXA 3ZGIA 1IC4L 1A6UH 3G5ZA 1CGSH 4F8PA 1DSFL 3VD5A 1JNNL 2LU5A 1I7UA 3DOHA 4A2HA 3UAJA 3QFJA 3TBWA 4XPTL 1MCKA 4Z8FL 2O5YL 1ORSB 5JLZB 2VMDA 4PJ5B 3H2PA 5E7FA 1LMIA 5A2JH 1ZPLA 5H4ZA 5FDYA 3T4AC 3V7AE 2KUTA 1NBZB 4V2CB 3V0VB 1MOEA 4HUXA 4PS4H 5IW1B 2E5EA 2GITB 3FH8A 5I8OH 2IAMD 4N26A 3NSYA 3SN6N 1VRSA 5KW9L 2BX5A 2BINA 1GHFL 2BNRB 3KVDD 3OKEB 5F96H 3Q2NA 5B39G 4DO4A 3HMXH 4X6CA 3RA7H 1SY6A 5ESAA 4IDLA 4MDIB 2G2RB 2OV0A 2Z91A 1NGQL 2EKSA 3GMRB 5CCHE 3A6BH 1A3RL 3SDDA 1H3GA 1WZMA 1UB6B 4YHOL 1TJMA 4KJQD 1EK3A 3C6SA 3NRFA 1HEHC 3J07A 4U6VH 3D69A 3UBXI 3MZTA 1CD1A 2FD6H 4PRHA 5I23A 2GW5A 4GAYB 4XMKH 2P5PA 3MXVL 2P7TB 2VABB 3F5WA 2QEJA 4EI0A 5F6HI 1C5DA 1C5BL 4GRWF 4YGVB 3GXDA 3IXTA 5BVJB 5AKRA 1EDQA 4QPEA 2WVVB 4Z7VB 1I9IL 3HHMA 3IRZA 4I2XB 1KYAA 2EP6A 3ZE2B 3JV6B 3F85A 4K7FA 5E1GA 5ERWA 3TL5A 3A4EA 1WCBB 3MACL 1HKLL 3PHQA 5DF0A 1YEDB 5BW7C 2DL2A 2MCPL 2EYTB 5TE4H 1F4AA 2ZPKL 4FRWA 3W5NA 3RWFA 1DQLH 5HDRA 1OM3L 4FQQB 3MDJA 1J1XL 4K94C 3RVTD 3PXLA 1BOGA 3L3KB 3KGTA 3O6FB 1DLFL 4HG4K 4FI7A 2EDJA 5HVGB 2Y2YA 1YO4A 4MTMA 2PMZA 3JTSA 1S7VA 2J1YA 2HVKB 2YPLD 5AB2A 1C08B 4ZXBC 1LEGA 2KKQA 5LNDA 2DL9A 3RWGA 2XBDA 1YNTF 3IXAB 4XCNB 5DFVC 1ASQA 1YC8A 2FLBT 1AZCA 3WMPA 1IT9L 4M9OA 5E8OA 1IAOA 4H8WL 4Z7UB 1EXHA 4N2OA 5KVMC 1BZ7B 3RIFK 4H8HA 2A38A 1RAMA 5D1XB 3FSAA 2QPFA 3BAEH 4G80A 4LRNL 4F7MA 3RJOA 4YMPA 3D09A 2JELH 3IN2A 2DICA 5TJWK 4NZRH 4IBQA 4OM0H 5FA3A 1FDLH 1GGCL 3WD5L 1I8KA 3WHXA 4WSKA 4MXWH 4P2YA 1N5AB 1LK2A 1UA6H 3ME0A 1IM3A 4ZI8A 1W0WB 2A4CA 2ZIDA 2IDTA 1AQDB 2GFBA 4L4VD 3P2BA 2VDMB 1EHLL 4LLAA 1RVFH 3CFMA 4QRSB 1HHIB 2C8NA 2OKMA 4G8AC 4GRLB 4PVNA 2NR6C 3B2MA 1G7MB 3NT0A 4JM2F 5DVMA 1FV1B 2BVPA 2XKNB 3JTTA 3UBXG 3UMTA 4LRIA 4PJXE 3T6QC 3GIZH 1ZLSH 2TRYA 4DPAX 5ADOH 4UINL 1DUYA 1AQHA 4YE4L 5EDXA 1G9EA 2NUTB 3EZJB 3GO1L 5E2WH 1GZPB 4TLSA 3TBVA 1U41A 4NHUA 2VISA 3G04A 1OP5K 4E2OA 1NEZB 4K94H 2DYSB 2Q6WA 5JIPA 5C0BE 3TZVC 3DOSA 4GI8A 4NWTL 1HYRC 1C1EL 4AENB 2EDOA 4NNYB 1PLBA 1GY1A 4WI0A 3DPBB 4YFLI 1OP5H 2EVHA 3ZKQD 4WUKH 3ZE1B 4FQXA 4LCWB 3QI9D 4YXHL 4MVBC 3B9KA 3BDYH 1MG3C 5F0MB 2JKTM 3BP5A 3OAUH 2OMYB 4ONFL 4FN0A 4HMEA 5ICXA 4DPRA 3WNOA 4RGNE 4B5ZA 1TNNA 2X2HA 3TTYA 5ENWB 2E7BA 4C56A 1U91A 3I02B 2QV4A 2X2JA 2CKBA 2EICA 3EADA 1H3WM 5IB5B 4DZ8B 4X9GA 4L2YA 3MRBB 2WAHA 1VGKA 5BZDB 4QXGH 1GIGH 1XGRA 2ITCB 1MPAH 4TKWA 3LTVA 4TSCL 4KX8A 4IM8A 4UANA 4AMXA 4TNFA 5CU9A 3OV6A 4JZNB 5I1JH 1QWNA 4HS6A 4X7EC 5TDOA 5DHYA 1HX0A 1BVLA 1INDL 4FXGA 5CCKL 1AGCB 4LSSL 2YRPA 1DZBA 1S7QB 3O8XB 3QQ9C 1GXEA 4F7EB 1R34A 3HLKA 4IBUA 3O41A 4PJAA 3QEHA 5DQDH 1FL3A 1SHMA 1SDDB 3RWIA 1BECA 3CN2A 3SY6A 1I3GL 3RUGE 3O45B 4RFEB 3MLUL 1CO1A 4W93A 5JW4N 4A6YH 1IKNA 3D30A 4K5NA 1ZA3B 4O2EA 5D55A 5FW8A 5IV2A 4Y2DB 1XGPA 2XQYG 4MRCA 4EVNB 4Z78A 1T1WA 2C9UA 4XNMB 2DOCA 5D1ZC 1JNHA 1DZ0A 4KRPC 4ZT1A 1JTTA 1N9PA 3DRTA 2VXSH 3B7YA 3BGFC 2NUPA 4LSTL 1CLCA 1VESA 2AEQL 2MRYA 4LPUA 4NP4L 5BQ7B 1Y0LA 4R4FH 3BMWA 2BNQB 3SJVE 5I16A 5JHLH 1AMYA 1B3IA 4LL9A 1AD0A 1BD2D 4BV1A 1MFAH 5HJ3B 2ZOOA 1JV5A 4RISH 1N4XH 1T7ZA 4D2NA 5CEZL 5T1JA 5CHNB 1BFTA 2DWXA 2IGLA 4BWUA 3VVWA 5CMAA 3LSOA 3SQOH 4WFGE 3CX2A 1M7UA 1FGNL 3GSNL 1IB5A 1OAJA 4LSQL 3BPOC 3KCWA 1F2XK 1G1CA 4WEBL 3KLQA 4G7YL 5MEOA 2NQ3A 3L6FA 4RAUA 5T3ZE 3SBWC 3CHSA 3C87A 5HY9A 2VLKD 1XGYH 2VOTA 2DIEA 2F1BA 4ZAKB 3NK3A 1HAWA 5C2UB 3NJFA 1XZ0B 1CQYA 2H1PL 2QFPA 3LDBC 5F7LB 4X4YA 4X5PA 1E2VA 1EEUA 3RFRA 3ZZ1A 1T4WA 3IJYA 5HD8C 1Z9LA 4I48A 2J6EA 1BQHB 5JHDA 2HG5A 5IMMA 1SEQH 3L54A 2Q8AL 3GB7A 1Z9MA 4B9JA 4MNHA 2G75A 2ZYRA 4XN4A 5F7EH 3NFSL 3DI2B 1RZKL 4QRPB 2HAZA 3RB7A 3OXSB 4TNWF 5K59F 1G7PB 5LGJA 5E1HB 1FYTE 1MWAB 1DP0A 1IFGA 3BPLB 4GXVL 4P3CH 3IDXH 4P2QB 1T5XA 2NX5A 5GGRB 4I85A 1B0RB 5K9OB 1QNZH 1TJIH 4PV1C 1G7LA 4XN5A 1M6UA 1O6TA 2F74A 5KOVC 4XVOA 1XEUA 3O9WB 2Q7NA 1JV2A 2OMZA 4JRLA 4WWNA 2UVEA 2WLZA 4U3CA 1LXMA 5CLWA 3WFBL 5BS0B 3GPEA 4U7SA 3X1FA 2DLHA 2FL5B 5EZLA 3B5TA 3DGGB 2HRPL 5LCVH 4JZOA 2WZAA 4Y4FB 5C0AA 3C5SB 4C8XA 4PJ8B 3WUWB 4PW9A 4XXWC 1M7XA 3H7BA 4MA1B 1KCVH 1KCBA 4CADB 4P2RD 1I8UA 2ED8A 2AV7B 4ENED 3QYCA 1BF8A 1VFAB 5IVXE 4I77H 2A6JB 5BRQA 4DK5A 2WNKA 4CMMA 3D0AA 4DP9X 3FFCD 5CSZA 1FZMB 2V8LA 2EYRA 4JDZB 1URIA 2PTVA 4IJ3B 4J3OG 2Q8BH 3RIKA 3ULAB 3F7QA 3QJFA 4NOFA 4QRRB 2XY1A 5BOPA 5ICZA 1NQBA 5ACZA 1SXZA 4PLKC 1BJ1H 4KNUA 3BP4A 1NAKH 2CBMA 5EG6C 2AV1A 4ODSL 3MNZB 5IHWA 3ZUNC 2BSSA 2FJHA 1HYSC 2CLVB 2DWDB 2FX7H 4NKQB 3RZCB 1D6VH 1LO0H 1TQSA 5MENA 3EXLA 2P24A 1FUNA 1E4KA 5CXPA 5FYJE 1OAYL 5KBKA 4ZPTA 4NQDA 1SRDA 2QV2A 3CVHA 3NTCH 4MD5A 3IMRA 1JGDA 1UB5B 2VSCA 2D7TL 5B1BB 3PREA 4GG8A 3RL1A 4FCHA 4O5LL 4WSGA 4JEGB 1I7TA 1OM9A 1XF4B 4J27A 2YD7A 4F80A 5EO0B 4U0RC 3PNWA 2G9KA 4FQHB 1PZUB 3DBXB 1HN1A 3V0EA 2DBLH 2MKWA 4NNPL 5EH1A 4ADGA 1MXDA 2YGVA 2BIPA 1UXLA 5ESQA 3K6FA 3FSZA 1P4IL 1KDJA 2NW2B 1HYSD 1KBWA 3UG5A 2XWCA 1I7ZA 3OLIA 2UZYB 2FWOB 2X0UA 4JZJC 4P5TA 4TVPH 2VR9A 4WU5B 2XQYK 2G60H 4XAKE 5HXMA 5E51A 1OTSC 2QFRA 3QZLA 3U36A 2UWEB 1T5WB 5T1KD 2WQWA 4UQEA 1UUSA 4DGVL 3MFFA 2AQPA 4X83A 2P80D 3VACA 3UGUA 2F5AH 1P5VA 2EZ0D 3AXHA 1T1ZB 3IDNA 1X7QA 4JJHA 5IW3A 3HB3B 2GK0B 4JM2A 2BSCA 1OIOA 1PZSA 2CU9A 4JVUA 4RZCA 5DMIH 1AOHA 1UWEL 4JREC 3T0ED 3QNXA 1YECL 5I1EH 3MROB 1U58B 4JPVL 3WEAA 3V4PA 4FZ8L 3Q2VA 4FL4C 3S3CB 2FIKA 4NKDB 3HZYA 4XPHL 3CLEL 4PGZA 1J0ZA 4IGBC 3T6WA 2XY2A 1RUKH 1U8QA 1YEFL 3KXFA 3OQ3B 1UURA 3EYQD 4QHNA 4WJKB 2FQGA 4XCFL 1XIWD 4KKLD 2XTJB 4B9GA 2WTOA 1E8ZA 2ZUQB 2EYSB 2P5WA 3MJ7A 3RB5A 1MCJA 4MCMA 1S7RB 3U25A 5JW5B 1JI2A 4Y5VA 3E80A 1PLGL 1SFDA 1X4XA 5KBPA 4OV5B 3NAAH 4N2NA 2CO6A 3IMUA 3LHPH 3MV01 2X9YA 1OPOA 3MNVB 4CMHC 4XH2A 1BXVA 3EJJX 3ZKND 3GSWB 3RU8L 2Z31A 2NNAB 2UXVA 2ZNWA 2PF6A 1U8IA 3L9YA 5C0RH 5C7XH 1CGXA 3ZL4L 2DQCL 2Y7LA 4ZSOA 2BVUA 4C59B 4EZMA 1A4JA 2Z4QA 3U1QA 2DQTH 1T0MA 2F7IA 3GMPB 4TNEA 2QR0A 2RALA 4R7VA 3HE6B 5J12B 4JM4L 4Q9QH 4K3GA 2C7UB 5FDWB 3QDMB 1HNFA 1ZAGA 4PJDF 3ZMEA 2ORBH 1HXYA 3FQ2A 5T1DL 3BN3B 1GL4B 4NO0B 1OP3H 4MA3A 2JI3A 2RD0A 3L4CA 2J8UF 2PP8A 3GRWH 5HDQL 1P1VA 5FUCC 5J3HC 3TEWA 3AT0A 2YWYA 4MMYA 1B2WL 4KHXL 5CWSA 3V4VH 1DDHA 1TITA 1F45A 4AG4L 1OE1A 2VDQL 3DSNA 4G7VL 5DJ0A 4BE5A 3MLWH 1NMCB 1UD6A 4AYFB 1MFDH 2MQ3A 1LO2H 1C7TA 2X42A 2WJ5A 4NKOA 1A6UL 3GEWB 5DMKA 3SOBH 2FJSA 2GIYA 3T6VA 4B53A 3OVUB 3QJHB 1PAZA 3DYMA 2CH8A 2H3XC 1IC7H 3IFPA 4I4WB 4FF9A 4N6RA 3UDWA 1ZTXE 1BV8A 3CHPA 2BOBA 1X4YA 3D85A 3FPYA 4PS4L 2VDQB 5I8OL 2D2OA 4GXFA 3BUBA 4IMKC 2Y72A 4KKAC 3ZTJG 3MV8B 3MJ9H 2F68X 1E8YA 1AQ8A 5F96L 4AIZA 2F53E 1A9EA 3RA7L 5BMFH 1MI5A 1XAUA 3E6FB 4KO5A 5DJ6B 2K4WA 2W07B 1AIFA 3FCSB 5LAXA 5I26A 1P0SE 1ZT7B 1KB3A 3C5ZD 2GJ6B 1PDKB 3RTQC 3B2XA 2FD6L 1NJ9A 6CGTA 3ZO0A 1ZIBA 4XMKL 5I9QB 1IO4C 5D2LE 1HEZB 2JIXA 2P4AB 2CG9X 4NQTA 3LN5A 3D05A 2JB6A 4J3OH 3QXDB 5AVWB 1F56A 1H3TA 2Z8SA 4PBVC 5KVDE 3RVVC 4U7MA 1YEHH 3F01A 3VFNB 3V6ZB 2DTMH 5IB2B 4W9CC 1QFPA 3DX3A 1HDMA 3H2WA 3G9AB 2AQQA 2JJSA 1QAWA 3DURA 4XVJH 4U1JB 1U8MA 2J1WA 3KPRD 5TE4L 3LNDA 3L3HA 2ZUWA 3B2VH 3U2JA 4OCRL 3TBYB 1ZS8B 1OGAD 1DQLL 3AU1B 3AG2B 4F2MA 1WK0A 4JRYA 1HHGA 3SGDH 2IAMB 1EO8H 2R2HA 3I50L 3ILPB 2Y9RT 4TPRH 5DEGA 3CHQA 3CLFH 2NXYC 1G7QA 2X9WA 3RWHB 2ALAA 2ICES 2JTDA 2V2WA 4GT0A 2EINB 4JO5A 4E0RA 2PWGA 4HKZB 5GRVL 1YZZA 2YRBA 1CDBA 5GS2H 4KKNA 2EDFA 3RVVD 3U46A 3ULUF 1CXHA 4M00A 5B3JF 4DQAA 2IH3B 3D25B 4YNYA 4GNKB 4B0MB 5I2IA 1K5WA 1QO3A 3AS0A 4OFPA 1R3KA 2A74C 4JQIA 5DI8B 3V0VA 5E9AA 3IETB 2ZG1A 4C4UA 4CVUA 4YVNA 1U42A 3LD8C 2DWEB 4HH9B 3UTOA 3BKYH 3I9AA 3QWQB 2Y2TA 3CXFA 4X8JB 3BAEL 3F65A 4PJGB 3OKEA 4DF9A 5EF3A 4LCUB 5M94B 2JELL 5F7NC 5EEZA 1ZLEA 4NZRL 1S9XB 4MDIA 5GGSY 4PJHB 1FDLL 4ZK8A 1JDCA 1BW8A 1U33A 2HFTA 3BWAA 3D18A 5C8JB 1UB6A 1UA6L 4H26B 4JJ5B 1AIZA 1PQZA 1T20A 1J1OH 1EFXD 1NLDH 3KM1A 4JMNA 1RVFL 5MEPB 3HLAB 4NS0A 4GAYA 5SWZD 4A1RA 2Q7YB 3IDUA 4JVPA 1JSYA 3M7FB 3RQ3A 2FECI 3KZ8A 1NC2D 3FHEA 2BY2A 1YYMH 4WDIA 3R7QA 1MFMA 1HILA 3GIZL 5ADOL 5HI3D 4D0CB 2A6KB 3V9FA 1OF2B 2VRKA 3EZ8A 5DYFA 3UTTD 2CA4A 2DV6A 2YPLB 4PRDA 4ZMTA 1KCWA 4K94L 4MNGA 1G4MA 2YAOA 2I07B 3LX9A 2HT4C 2XA3A 5JNYB 1PKQE 1YEDA 4FERA 2OK0H 4KK9C 2VH5H 4LLWB 3LVTA 2K6ZA 4WI2A 3L1FA 2XPGB 1I3RB 3EJZD 2ADGA 2P49B 4UV7H 5IVZB 4OFYA 2K3HA 1UZ8B 4UT9H 5I1AA 5JR1H 5KSAC 3VFVA 3BDYL 3OAUL 2G5RA 3H55A 1V7NL 2Y2WA 1SYSB 3L3KA 1CI3M 3O6FA 2OULB 5EA0H 1SMDA 5FGBC 2DLGA 1TCRB 3TCTA 1J12A 4LMQE 2X12A 4H13C 2YIHA 4HJSA 1C08A 4M8VA 4F7PB 5F70A 2ENPA 5FECA 3VJ6B 2CDEB 3A4DA 3KPSD 4L8DA 1TENA 2WVUA 4L4VB 5IWLA 4XCNA 1IAII 1GIGL 3QQDA 3R1GH 5KJRH 1V27A 2W9LA 2B9AA 1H8NA 3FBQA 1BQSA 3G6JF 3QR0A 4D9RD 5BV7C 3VD7A 1JWSA 3ZQXA 5I1JL 3OGOE 5DUBB 3VA2C 1XF2B 4Q6IB 1W8OA 3HG2A 5KSAD 5F1IB 3BPCB 4I9XA 2CBOA 1MSPA 1BZQK 1TTUA 5DQDL 5EU7E 1YUKB 4FNPA 3RDTD 4AJYV 3VX1A 1UJ3C 1A6PA 1N5AA 4QXWA 4MCZB 1H3PH 4NRYB 4XBGA 4A55A 4GSRA 4UIKH 3AROA 1ZVNA 2ADIB 4A2GA 5IB1B 1HHIA 3QI9B 3U0PB 2WXOA 4HXAH 1G7MA 2ZXGA 2XKNA 1A9BA 3OKLA 4KKPA 5DT1H 5KBMA 1ITCA 1GGBH 1QR1A 4AT6A 4FFVC 5FGSA 2BWDA 3MGOB 2FJGA 4R4FL 5J5EA 5I30H 5FA4B 5JHLL 5JOPE 3MC0A 1NEZA 2GVYA 2VW4A 3FTXA 3NCCB 3Q06A 3CIQA 3QULA 4OCSH 2BMKB 5FO2A 3CFKA 2XVLA 1WBYB 1MFAL 4ZMQA 1NIDA 3VXMA 3L3OC 4XX1G 3VSTA 5IEKB 1N4XL 2IH1A 3FU5A 5SWSA 4BKTC 2VDNH 4DTGH 4JK0D 3GBDA 1GYAA 2X7LB 1T1XA 5CGYC 3SQOL 2IWGA 2R69A 3WJLC 5JPNB 1DANU 3ETBF 1JPSH 3T0DA 3OJMB 4TQEH 4LT7A 1NC4D 4ESKA 2BSED 4B9FA 3HRZC 1ED3B 5ENWA 1QZNA 2P43B 3EYVB 3NQKA 3I02A 5DJZB 3L4UA 5BV7H 3L5IA 4K0OA 3CMOH 5IB5A 4DZ8A 4WCYH 3LKNA 3KYOA 2ZQKA 3KJ6H 1S7UB 4PJDA 4WI3A 4DFIA 4KTYA 4R97B 3KDMB 3UTSD 2ITCA 3H3BC 4FJ6A 3TA3D 5CBAB 1E9OB 3NABH 2C9RA 2WB1A 2J8UA 3ULVE 5DTFB 5IBUG 3UG4A 2FNBA 3ZRFC 3H54A 1PG7W 3P2TA 3WS3B 4J7RA 2EUXA 1A2YB 4HX1A 1TF4A 3MTXA 2WNXA 1A4KA 4OD3H 1Z9NA 2XN9A 4QRFA 4GH7B 1S7QA 5F1KC 5F6IB 1G6RB 3RPKA 3WLWD 1Q72H 1CTOA 1CQKA 1J9SA 2X4NB 4WIQA 1N6QL 3DX8B 3HFMH 1LVEA 3FU9A 5K5YA 1BD2B 4HZAA 4KUCF 5HYEA 2BCKB 2LU3A 2ZYHA 3ZE0F 3MRCB 3MPCA 3T3ME 1ZA3A 4GXUN 2E7LA 4P3CL 3IDXL 5IJVA 3K71B 4IU3A 1FO0B 4EVNA 3OKMB 1TJIL 1QA9A 3KWVA 4R96B 4XNMA 4LLVA 3FUKA 2BP0B 3LN4B 5IUCA 3NFNB 1MVYA 1I53A 1ZDQA 4HIIA 1HQRB 4KO6A 3GJFK 5BQ7A 3CU7A 2CAKA 2DI9A 4CRPA 2I9TA 1J9QA 4R4ND 2ZF9A 3BGFB 1HZHL 2D3LA 4JKMA 4U1GB 2N3JA 2BFVH 3BRGC 2VLKB 3GJFH 5HJ3A 2UXFA 3V5KA 3D4ZA 3K2UH 1TEYA 1MRDH 4GKLA 1F6AB 1X5FA 4GAFB 3CXDL 5ETUB 1QRND 3SDXE 4KMLB 5CCJA 3VD9A 2V2XB 4I77L 1I1YB 5DHVB 4XGZA 5J1TC 3CHOA 3FSVA 2FB4H 4WKXA 3VGGA 5GSRA 1ZOXA 4HWBA 4YVUA 3L1GA 4HUUB 1HSAB 4QRAA 2Q8BL 4U3XA 2XIBA 3ZKSD 3CDZA 4M8UA 3QRGH 3V55A 3CSGA 4ZAKA 3RVXC 3FT1A 3K72B 3LZOA 3Q1SL 3SQBA 2XWZA 4YPJA 5J11C 1NAKL 4JFDD 3DC0A 4BBWA 4FNLH 1C9SA 2YD1A 3NG5A 1T7YA 3IFOA 3VXSE 2HFEA 5BUPA 4AW7A 3M86A 3VXPB 1MUJB 1CD0A 5AZEL 5I6XC 4XO9A 4YBQD 3DV6B 1QTYT 3C8HA 4I0PD 3BN9C 3PWVA 2V3EA 3KD4A 4KI5C 5EO9B 4QXTA 2WM0A 4AI7A 1ORQB 2WSKA 1FGVL 1MWAA 1NM9A 3ML9A 1RZFH 1ND0A 3MR9A 1A64A 3DHPA 3D2UD 5DQ9B 3JWOC 4EKXA 1QBBA 5GGRA 5K9OA 1DQQA 3VFUB 2QZ5A 4N2CA 2DBLL 3GBEA 1DBJH 3MJ6A 4JO4H 4P2RB 5E56A 4WEEA 1CWVA 4Z7NE 7PAZA 1JZ2A 2J44A 4OLUH 2CJSA 4J3VA 1L9RA 5B1KA 4KZDH 1SYVB 4XOCA 3X12B 1U8OA 2QKSA 3D3VA 1IGCH 1WPCA 4PP1C 1FRGH 1OE2A 4PG9B 5D70H 3VFWB 3LKQB 3UPRB 4PJEB 1FFOA 1FFPB 3E6HA 5IQ9A 2KERA 2JKIS 4N90E 4J8QA 4LOEA 4MB5A 4XP1H 3C5SA 1DSYA 2F5AL 4QD2E 4OCLC 4H8PA 4QRBA 1B4LA 4TUOB 5F93C 2WTRB 3ZLQC 5A6IA 1AS6A 4CADA 1PSKH 2P8PB 2HRGA 4FNRA 2DJ4A 5DMIL 1AO7D 4Z1PA 4WFHE 3US0A 2WWKT 4H20L 4I1RA