3UC2A

Crystal structure of a duf4426 family protein (pa0388) from pseudomonas aeruginosa pao1 at 2.09 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
124
structure length
124
Chain Sequence
YFQGEQVQRFGDLDVHYNVFNSSFLQPNVASAVGLVRSKAQGVINVVPMEKGKPVEAAVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQFPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein with immunoglobulin-like fold
publication title Crystal structure of a hypothetical protein with immunoglobulin-like fold (PA0388) from Pseudomonas aeruginosa PAO1 at 2.09 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 20
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14467 DUF4426 Domain of unknown function (DUF4426)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3340 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uc2A00
3UC2A
chains in the Genus database with same CATH superfamily
3PNRB 2VMCA 3CZLA 3CFDB 1KBPA 2K9FB 3ZO9A 1EHNA 1UASA 2N7AA 3D25A 4YSQA 3SODB 1HQ4B 3U7WL 3G08B 4ZTPH 5HGDB 1QSFB 3NABL 5DR5L 2E75C 4FQIH 4YDIL 4ALAC 1YC8A 3GMRB 3HR6A 4PJAF 1I7ZA 3CDGA 3UYOD 2H3NA 2EH7L 1U58A 4KUZL 4NUGH 2C9AA 2F54B 3NCBB 3LKRB 4G8AC 2WMPB 3BDBA 3ULUL 3GHBL 1MWAL 2D2OA 3K6OA 2GABA 3PV7A 3FRUB 2FX7H 2FIKB 2XETA 4YWGH 5KYUA 3PWLB 3UTSA 4BIKA 3LQAL 4C47A 5I8OL 1M2VA 1XGYL 3VWKD 3OVUB 3APNA 2VMEA 4DGVH 5L2KB 2W91A 4QRQA 3RIAF 1CO1A 1BZ7A 1MHCB 4P2QB 3F00A 3IN0A 1FORH 3F04A 1CDJA 4FG2A 4TXVB 1U8LA 4ZMPA 3V55A 2IWFA 3MRLB 5CFHA 2FK9A 2KZ1B 5FM4A 1EXHA 1PKQA 4FULA 1C08B 3D85B 5K1VA 4QHMA 5AW1B 5AD0A 1GS6X 1G6RB 1N0XL 4OIIL 5GS0C 4NC2B 3KW7A 2EXYC 5I18L 2QELA 3KEDA 1KN4H 3GC3A 1ZHNB 2RMNA 1Q9LA 2G3MA 5C0AB 3KYKL 1INDH 2H47C 4KJYB 3N85L 4L5FL 1R4XA 5AAMC 4P4KD 4WEUD 1O9ZA 3VI3E 3RKPA 1B2WH 5HD8C 2GTZB 3LD8C 4OCWH 3UPRA 4UM9D 2HRLA 5DUPH 4PS3A 3GMQB 3DHUA 4JMNA 4RSYA 5IM7B 5D1ZD 5AAPA 3FO9B 3TN0B 1IGTB 1NGQH 4GI6A 1I3UA 2PO6D 4I48A 3LS4L 3TTSA 5KSBE 2DWTA 2CLVB 2WAHA 1OB1B 2O72A 3K8MA 3MLSL 3DBXB 1SVZA 4Y4FC 4R90H 2X4NA 4Z7UA 1D2PA 3C6SB 3QIWC 5CILH 1ETZB 1LMKA 3U1PA 3HZMB 3DMMC 5C7XH 3OXRB 5T1MA 2CO7A 2X6BA 5GGVY 2GIYA 2FT7A 3HC4L 3DNKA 4F1SA 4YX2L 2V2TB 3BPOB 4DGUA 1U30A 3V4PA 2F53D 2KQMA 1HFUA 5DJDB 1UA7A 4MJJA 1BZDA 4NC1C 4TSAL 2AVGA 4X98B 5MEND 4U7MA 3AWFA 4Z0BH 2JJSA 3D3VD 2V9UA 2O61A 3HJ0A 1NCCH 5FF6B 4J1UA 4GKSA 4XNYH 4JGJA 2DYPD 2V3EA 5HDLA 1WVZA 5C0CD 3MRQB 4ZMXA 4N0UB 3KLAB 1FZOB 2APSA 1AD9B 5C9KA 3UROR 1DQDL 2XG5A 3QUYC 5AFAA 4NNPL 1I8LA 1TFHA 2X4PB 4PGJA 5HSFA 4PS8A 3QFJB 3QUML 1A6ZB 4HLZH 5GGSY 1Q72L 3L9EA 1JIBA 3FCGA 3K3QA 4FKEA 1MREH 2XUWA 2R39A 4XOBA 4KKCC 3RGVD 1KGXA 1T80A 2GTQA 3CSYA 2I5YH 4Z78B 1XGUA 1UOVA 4WRLA 3VXQA 4W6XB 4ZO7A 2R0ZL 4N8VB 4UQEA 1UT2A 2GJZB 4OV5B 3MUGB 4K3EL 2WTOA 4E41D 1T7WA 3EYVB 5I1IL 5CBEB 1DFBH 2AJ3A 3JV5A 5B3SB 2ALAA 3T2QA 4NO0B 5DK0A 5EBWA 3HNSH 4HJ0D 1D7BA 1VERA 5H4YA 1YY8B 1USZA 2Z3FA 4PV8A 5T1LB 4M8QB 5C09E 4WJ5A 3FMGH 2AJXH 4NN5C 4QXGL 4PJXE 4M43H 3L54A 1OAXL 5CZXD 3AC0A 5AALA 4N6RB 5BZDB 4GIPD 2XQBL 2EYTB 4JHAH 3MN8A 4HP5A 1N64H 3O6FD 4PJ9A 1OV8A 3FCUB 3CD4A 1T5WA 2YKKA 5D2NC 5JHDD 2BWDA 4C55A 3VGDA 5BVJB 1FBIL 4DEPC 5E7FA 2DTSA 5C0DB 4MZIA 5IJCC 5LQBH 1UD5A 1LWHA 2XACC 4PGCA 3ZOAA 4FCHA 1GHFH 3ZY7A 5DVMA 3LRHA 4JMXA 3HMXL 1JPTL 4U7KA 4X9BA 3MLVH 1J5IA 5E2WL 3MLWL 4Z76B 1AG6A 4LPXA 2NY2B 3ZDZF 5BRPA 1QSFE 1LEIB 5IMMA 5L4MA 1JOIA 4GB9A 2AJSL 2P5EB 4M48L 4YDIH 5DR5H 1KIRA 4LEOB 4C56B 4ZFOL 2A9DA 5LWYL 2F18A 2XLLA 2Y4SA 3HC0A 3I9PA 5AOMA 2EH7H 1OXYA 5C0GB 2F54E 4AXWB 5I1HH 2BH0A 4KUZH 4JFQB 5IROD 4JRLA 1CGXA 2DDQL 3EOYG 3LY6A 2A9BA 3ULUH 1MWAH 3BDYL 1IBDA 1CFVL 2XTJD 4LKCB 3CZFB 1ROWA 3V5HA 4O00A 5I8OH 5T3XD 4OLXH 3BEWA 1SNRA 5LN4A 3NFNB 3LNIA 5L2KE 3NZUA 4MD4B 3VG9B 5FYJD 4G9FB 4JLRA 4P2QE 2JJTC 5TPWL 4BFJA 4Y2LA 1I8IA 4OCSH 2AJZB 3AXLB 1Q9KA 1T2JA 4JZJB 5AZ2L 1BJMA 3IKKA 1Q0XL 3QEQD 4WDIA 1J88A 5C07B 4S2SA 2GITA 5JW5A 5D5MF 4UDUB 5DFVD 2YD3A 1MCOH 5DVNA 3BWSA 3ECQA 2K3TA 2YO3A 1N0XH 4H1LG 4OIIH 4OLZH 4Y2OA 5C0AE 1H5BA 3T2PA 3SIKA 5I18H 3S36L 3V9CA 3GMPA 3T1FB 3KYKH 4YE4L 3CZKA 4L5FH 3VXUA 3GUTA 1OCWL 2XJLA 1ZV9A 2DMHA 3EJPA 4KJQC 1G6VK 4L9LA 5HYFA 3WEAA 1V55B 5CN3A 4AGLA 5D1XA 3RWIA 1T7YA 1TJIL 5F9OL 3JWNG 4B0MM 2G60L 4OD2B 1X4ZA 2V7HA 4K3HA 3VO0A 3NEXA 4YHIB 4UIMB 3BP7B 3IDUA 1IU1A 2Y9RT 4W4NA 3MLSH 1BMZA 1Z9SB 4KDWA 2OXHB 3AQDA 5DZOA 1A8JH 3W9EB 4KO7A 4QKXB 1M1XA 1JXFA 3DO3A 1MAKA 4LF3A 3BAEL 5EFIB 3AG2B 1EJ8A 4MB1A 1VADB 2NQCA 1R3JB 1FAIL 2NY1B 1G7PA 3GGWA 3KEHA 3WJMB 2H4EA 3IK2A 4HUWA 4PJ5D 4DERA 2P49B 2R4SL 3HC4H 3N1MC 3BFOA 4S1RL 5DYOA 1ZS8B 3EYSL 4MAYC 3PGCA 5CWSB 1W9XA 1QFPA 3DI2B 4FFZH 1JGVL 4LBEA 4TSAH 5ICXA 2R23B 4F7MA 3HPJA 4TL4A 5JZ7C 2CA3A 1AE6L 3D0VA 5JHLL 4ZK8A 1KTBA 2C3HA 4PJGF 1C5BL 4JFXB 1SPDA 2X5PA 4N0UE 3FCSA 5BUPA 5KSVB 4YOKA 3CCHB 2J71A 4NZDA 3GSNB 3ILQD 4W4OA 5LBSH 3TWCL 2XN9A 3NSCA 4NNPH 4PREA 3FOLA 2BX5A 2AK4D 4O2EB 4HPYL 3PE9A 5KVFL 4JFDD 1Q72H 4HETA 4OZFG 1OT1A 4NFDA 2NUPA 3TA3A 1NWPA 3HNVL 2E6PA 3RVVC 1VB9A 3E1F1 4TVPD 2AXFB 3FONA 4PG2C 3QUXD 5ANMB 1KCLA 5K69A 3DPBA 4N6QA 5IJVA 2G9HA 3PDOA 4N2IA 1OM9A 3GJEB 2R0ZH 4YPJA 2P47B 5FECA 4K3EH 1U91A 5D4JA 2NNAB 4IGBD 4PJHF 1T1ZA 5B4MC 5I1IH 1QBML 3FUJA 4L1BA 4WI5A 3B9KC 5CJ8A 3NPSC 2PCPB 3ZKXC 3I6KB 2IGLA 3SKUD 3BVUA 3S5YA 3BZ4A 3NIFE 3K4DA 5J11C 5CHNA 1OWRM 4FL4C 4M4RA 4WUKH 1A7BA 3IMRA 2A73B 1C12A 3OJMB 4QXGH 4E9WA 3LZLA 3DI3B 1OAXH 2K4AA 4JG0H 5KSUA 2XQBH 1A02N 2HB0A 2XQ0A 4BH8B 1X7QB 4M93C 1ZDQA 3BPCA 4KK8C 3UOAB 3DX1A 2BSBA 2WOYA 1DUYB 3NSDA 5AWNH 3BGMA 3O11B 2VZSA 5HI4C 4MQ7B 1CPUA 2NXZD 2GUOA 1RZ8A 3SDYL 2VQ1A 3HLAA 1JYXA 1BV8A 3EJRA 5F2FA 1MKFA 4ZTEA 3HMXH 5ENWB 1MVYA 5E2WH 3MLWH 4RZCA 5D7IF 5DK2B 3UPAA 4F3FB 2ZUXA 2BVYA 2P5EE 4PJBA 1XGPA 2AJSH 2H9GA 2JMRA 3QZPA 4IQHA 4ODXB 5LN8A 1E6OL 1MDAA 3KJ6L 2L04A 4WHYG 1F3JA 3H9HA 2DQ6A 4DGYH 1P1VA 4ZUWA 1U6AL 2P8LB 3KLHD 4AQOA 2DIEA 4QRTA 3RTQC 3BDYH 1OF0A 1P4BL 2EDWA 2YR3A 3QWRA 4IJ3B 5AVRB 4EKJA 1T04B 1M7UA 4NAQA 4ZO6A 5J3HD 2KERA 1B4JH 3IPEA 2LU7A 4MDIA 3KDMB 5JR1L 5K9QG 1LYQA 4FF9A 4L8SA 3ZTJG 4J2XA 3QORB 1S9WA 3A6BH 5EZJB 5DXWA 1UJTA 4G9FE 3U4KA 5TPWH 1JTTA 1AKJB 1CDYA 1LILA 1KJ3H 1OGAB 2CXGA 3C8KB 5GGRY 2PCFA 5AZ2H 1AHWC 5IBTL 4N2NA 1HSBA 1Q0XH 3BKCH 4N68A 4HU8A 3BH9B 3LEXA 3NVQA 4X6DE 4WU5B 5J6GA 3O4OC 5I0DA 3UZVA 4LVOB 3TFKD 3IDGB 3P3YA 1ASPA 3RZCD 3MRHA 4Y4KC 2BFVL 5EIIB 4P5KA 2A83B 4DESA 1KPVA 5GZOC 2OJEA 3S36H 1OGSA 3DTDA 5KYXB 3KM1A 4K5PA 4YE4H 2H0EA 2VABA 2VWEE 1HOEA 3FPYA 3ENEA 4OQTL 4RFEA 2OMUA 4L3EE 4HOXA 1FSKB 3RIFK 1COBA 1EXUB 1F0LA 5B38A 1IZKA 4M8RA 1JWMB 3QDHA 4YBHA 1TJIH 2QMJA 1HHHB 1J0KA 4KZEL 1YUHA 4QIRA 2G60H 3VXNB 3ECBB 1K2DB 5J8OA 3ETTA 4P2OD 1H8NA 5LKNA 1HEHC 3P9WB 5G55A 4J3OF 4KC3B 1GYWA 2X7LA 2EYRA 3MMEB 1INQA 4N25A 4QO1B 3R4RA 4POZC 3ARED 3BAEH 4KU1A 2E7MA 4G8GD 4NHUB 5FYLE 1FAIH 1EO7A 3POHA 3H6JA 3CDCA 4CA4A 1K3IA 1GC1H 2DM2A 4HKBA 4IBSA 5IVXA 2C3GA 4S1RH 4UIKL 2O5XL 3UG3A 1A3QA 1A6VL 3EYSH 2EADA 5DJZA 4Y5YA 4R7NB 1RCYA 2WLKA 4PG9B 1F4XH 5HVFB 1CR9H 1I1CA 1AE6H 4MRBA 5JHLH 3TEUA 2PETA 2ZUUA 4PS7A 3VACA 4O4YH 2BS9A 1ZVHA 2FTAA 3TWCH 4P59L 2VR7A 3KBFA 5SX4H 1CURA 1O9VA 4HPYH 5KVFH 3QI9C 2IGFH 2QSQA 1P7BA 1JFHA 3HNVH 5DU7A 1ITBB 2H1PH 3GTTA 5ANME 4M61A 2WZ5A 2YBRA 3W3BA 4DGIL 1U8NA 2G2RB 2WZ6A 1XSJA 1BXAA 4P3DB 4ZXBC 4GPVA 3VX1A 1N59B 5AUMB 5KVEE 4QRSA 3CSGA 4GQQA 4NQVB 4Y5XC 4MAUH 1W6WA 1WBZA 3Q8AA 5EUOE 2XI9A 3HMWL 7FABL 3INOA 3FQXA 4U2ZA 3DX0A 3MBEB 1BQRA 2B9AA 1A3RL 3LRMA 3QXAB 3VWJB 1L6XA 4LCCA 1M42A 4OZGA 3PP3K 4X4XB 1KCSL 1HHJA 3I85A 4MVBD 1G7IA 2P24B 4C57C 1ILSA 5HGBA 2XZAL 4OY9A 5DURB 2XPGA 2X2YA 3DVFA 3MOBL 2BW4A 3C60D 4ZAKC 3BPNC 4NN6C 3ROOA 3LOWA 3P4MA 5TK4A 1BFVL 5IW1A 1JZ2A 3EUUA 2C26A 4QTHA 1U8IB 5KBNC 4ADJA 3WU1A 3IFPB 1ZWIA 2IC2A 4DT2A 2XFXB 3L5HA 2G0KA 5D71L 4MBRA 3I6LE 1X5XA 1JGLH 1NBZB 2EINB 2J72A 3GDBA 3Q01A 4FTVD 4W68A 3VYNA 3SDYH 1ECYA 4BA0A 1OLZA 3QEUB 2VLLA 1GGIL 3C75A 4AE1A 3MPCA 3DXAB 3OGOE 2VLMD 4LXFA 2Z0UA 3EJYC 3D18A 4PS4L 4OBRA 2G4EA 3TNNB 4XGZB 2ZYHA 4LNRA 1EPFA 5I6NA 1NM9A 4Q6YA 3GMLB 1A9VA 4ZMTA 1IEHA 1AHKA 4GUPB 1J8KA 5J1AA 4HG4K 3F7KA 1J8HB 1FPTL 4XN1A 1FL6A 3ARFC 4D7PA 4GUOA 4MB3A 3L2NA 4G43A 1KJMB 5FB8B 4PJ8D 2VDKH 3KNBB 3HUJF 1U6AH 2WLNA 3QXVA 1DFXA 1KCVH 1MELA 4JFHE 1P4BH 3ZDXF 4NJ9L 2CCWA 4GRMA 4DO4A 1UWEH 2EZ0C 1UG9A 2VDQL 1IV8A 4XVUC 5F7BA 1AGFA 5FO9B 1H0DA 4G1MA 4MZ3A 5JR1H 5FYJU 1UM4L 2WQWA 4NSKA 5EU4B 1MH5A 1BBDH 3TNMA 1OD9A 2IBGA 4D0BB 4K7PX 3REVA 2MNWA 4JAMA 5E1HB 43CAA 3LXAA 5IBTH 3ZPDA 1OZTG 1M6OA 4WU7B 4TNWF 5DHVH 2NX5D 2VH5L 4GW1A 3QEHA 4N28A 3UADA 5CGYD 3NCYS 5DZVA 5LB1A 3ETSA 4O9HL 4P46A 1WLHA 2BFVH 4QRRD 2EE0A 5C0FB 3QPQC 4M56A 1QPKA 3ZYJA 4MKTA 2R0WL 3HVNA 5HHXL 4TNFA 4HS3B 5IR1B 4X80L 2E7HA 1Y1UA 2X4TB 4JHUA 3LD8B 1OP9A 1X4YA 1YEHL 3VI4B 1YY9C 4AQZA 4I5BB 4ADGA 3FB5A 3H7LA 4OR1A 4AITA 1I1AD 4OAWA 4YDZA 4LRIA 3SE3C 3T3PB 4PGBA 4HWEL 4FFYA 2G3XA 4OFKA 3Q0HA 1GCFA 3G6JE 3WS3A 1I9RL 5F1IA 1CICD 5TE4H 5EZIL 3HS0A 2ZSWB 1YC7A 5AVQB 2WINA 3DTXA 4JPWL 1KIQB 2A6KB 1OL0A 4HOZA 3C5JA 1RZQA 4TQEL 2H3KA 5LCVA 5JXAL 3LNEA 4GBXB 5DJ6A 3I75A 4UIKH 2O5XH 1J9SA 1HS6A 2X4QB 3RPIA 2IQAB 2APFA 5ESVB 2GEQA 3P2BA 1IGIL 1BQKA 2BZDA 3H9SA 4G6ML 4JZOB 1I7RA 5DJ2A 5E5MB 3BIBX 1B9ZA 2WP3O 3BSZL 4XNAA 1NIFA 4XMPL 2SEBA 4J3WA 2R0KL 4KKBD 5D7KE 3RY6C 2X2HA 3QUZD 5CLZA 5CEYB 3UBXI 5BO0D 2YPLD 4FTDA 3VFUA 1L5GA 2VAAA 2JKNA 5FGBA 1ZVNA 4P4KC 5A2AA 4P59H 1XF4B 4Z3FA 4RZKA 3M1BB 3PY9A 1ADQL 3VXTB 1S7SB 2IOIA 4H0LC 3LVTA 5D1QE 2A2QT 3AVEA 1U8HB 2OYPA 4XRCB 4ENZA 1I4FA 5HHMD 2OMXA 1FNGA 1H3WM 2AXWA 4JO1H 2MQ3A 3EOBA 5A6IA 2JI1A 4DGIH 5D1ZC 1T66D 3CBRA 2PO6C 1OGTA 3PWUB 5EO0B 4WUUD 3NGBC 4FXLA 4F93B 1U8JA 3SE4C 3CH1A 3LSOA 4IBYA 3TZVD 2CBTA 2EDOA 1D6EA 3N0AA 1UENA 4LPUA 4Y88A 4HD5A 1WWWX 3L4YA 3QNZB 5D70L 3HMWH 3PLYA 3QNFA 4MCNA 1R3HB 7FABH 2ZF9A 3OL2A 4QRPB 5A2IH 1LMIA 3V0HA 1P7QD 4ISVB 1PG7X 1PMYA 2CHXA 1A3RH 5KJRL 5D4HA 3MJGX 1FJ1B 1LWRA 1D2OA 5CIPA 4HBQA 3H56A 4H8HA 3PIQB 5ESQB 5J1TC 4NN5B 2XQYA 4UI2A 3TCLB 3G3LA 2XZAH 3Q13A 3MOBH 4H5SB 5E9DA 4D8PA 2EDXA 3C87A 2E9JA 1BFVH 1E2WA 1SXCA 3F64A 1H3XA 5D2NB 3ZE1F 5DI8A 5IF0B 5AYQA 4UQ3A 4RGNB 2H32H 4JJ5B 2WO2B 2XVBA 4N2CA 3WMQA 5BS0E 3QJOA 5D71H 4Z9KB 5EORH 1UQSB 4BQCA 4NT6A 2ZZUT 3IDNB 4DKTA 4U0RB 3RY5A 3OD3A 1GGIH 4NO3A 3DXAE 4GFTB 2MNUA 3ULVD 1H3GA 4AL8C 5I1CL 1WDAA 4PS4H 4AGPA 3RGVC 2B7DT 3SBQA 1NGXB 3AS0A 4RH4A 4MA3A 3LH8A 3CN2A 4XCNA 2XSKA 3IU4H 1J8HE 3QVAA 1E7UA 3WBDA 2JQAA 1QSED 4LDLB 5LJYH 2R8SH 4Z1PA 5F3BB 3MJ8B 4P4RB 3QQ4B 3OR6B 4KDTC 3CLEL 4BFFA 5M94B 4NJ9H 4PJIA 1LO2L 3LDBC 3RLSA 4WI0B 1NMBL 1USQA 4YDLB 2ENSA 2VDQH 3S96A 2IAMD 4NRYB 4U1IB 1UM4H 1PGRB 1AZCA 2VUKA 3K80A 3SJVB 1NPJA 4N2LA 5E6ZA 3D39B 1PSKL 1OT2A 2LHAA 2V4LA 4WHTB 1A65A 5E7BA 5CZXC 5EH1A 4EUPG 4NGHL 1DDHB 3HI1B 5BRZE 2MTAA 3O6FC 1KY7A 2XWBB 3RTLA 2X9YA 4F9LC 1J5OL 1CD8A 1FYTD 1RZIB 1U92B 5HYJD 5FKAA 5I0ZA 5CLWA 2Q5BA 4GAJL 1JZ5A 4O9HH 5HXMA 3TBBA 4A6YA 4Q6IB 4ZBJA 3L3OA 2ZE0A 1MY5A 1ACZA 1NUNB 2WZPD 1HXYA 5ETUB 3L3DB 2R0WH 1UJ3B 2NYYD 4MS8D 5BXFA 5HHXH 1DUZB 1CD0A 4RAUB 4DUVA 1CE1L 1BQHA 2EEFA 2Y7OA 4X80H 3VI4E 1RIVL 4PU2A 5FW6A 3TWYA 1TCRA 3BP5A 5DJAA 3ULVF 3N04A 5JPMB 4ZPTA 5MERA 4FXGA 1FIEA 4LCVA 3GBMH 3QNXB 5A2BA 1BW8A 5K9JL 1AS7A 2FQGA 5L7XL 5TK2A 5IROC 3LZOA 2WXKA 2OXGA 3T3PE 1PZCA 4N8VG 2QPDB 1TMQA 2VN4A 2X4UB 2XTJC 3B2UD 4QCIB 4HWEH 2YD5A 4Y9CA 3KPRB 1TSRA 1BD2D 3VXSB 3UO1L 1NIEA 2ZJSH 1EEUA 2QPUA 4KMQA 4PJFF 4OZIA 4XX5A 1D5XB 4JPWH 4UNTA 3B43A 5C2BH 4U49A 3D4CA 4NUQA 1G84A 2BVOB 4TQEH 4UBDD 3S4SA 5IMLB 4NC1E 5L4JA 3CIQA 2NT1A 4XPFL 4P2AA 4LPTA 3PJLA 3T0ED 3FTYA 4JQXA 4BZYA 3UABA 5D8JL 5DFVC 3BSZH 4Y5VB 4YHLL 4WZ9A 4YHNB 4I8DA 1DJHA 4XMPH 2R0KH 1E9QA 1OD7A 2KUTA 3ASOB 4IKNA 4DH2A 3HZVA 1QNIA 1FL3A 1K4CA 4J4PD 4QXTB 2A38A 1R5WB 2YRPA 5EDSA 2JKWA 5FPIA 3QULB 1GYCA 4Z0XA 1X7TA 3WKYA 1N18A 1XF1A 4S1DC 4XOCA 2HH0H 5FYKL 2V3DA 1VGKA 1TTAA 2Z0BA 4ZO9A 2GSMB 3GJFK 3LKPA 1DE4B 1OE3A 1ONQA 4XVOA 2JK5A 5JIKA 3RZWA 5HY9A 2K7QA 4Z95L 4CU8A 1DVFD 4AUYA 5BW7C 3T71A 1IM9B 1HX0A 2YKLL 1S4IA 5D70H 3QAQA 2WXHA 4WSKA 4QRPE 3MRJB 3ILEA 2AQ2A 2Z93B 1CCZA 3PP3H 3GS4A 5GS1A 1TU2B 5KJRH 3BUDA 3KPQB 1NBCA 5AW6B 1BAWA 2HVBA 2A9AA 1QFHA 4I4WA 3CZNA 2BHUA 5FUOL 2F7OA 3KLSA 2GJ6D 3T2OA 3QEGH 4ELKB 3QJFA 2ZNWA 2ZP9A 4POYA 5D2NE 3E9TA 4RQQA 2ZOWA 4F2ME 2I32A 4KI5D 4JREB 4RGNE 3US9A 3MUZ1 2YA0A 3PHSA 2WBXA 2W0PA 4FD0A 1T03L 1ZCRA 2F58H 2J44A 3P0VL 4HOWA 3WI9A 3BAYA 5KBKA 4JANA 3FTGB 5AL0A 4D94A 3HE6A 5MEQB 2R1WA 4JY4B 5I1CH 3BUYB 3UC2A 3QQ3B 3Q5YA 3QUXC 3WUZA 3SKNB 3I3DA 4AQ8C 1GGBL 5FDWB 5EEWA 2V0AA 5SV3A 4MNGE 4XNMA 4YFLF 1KYOJ 4NP9A 4IGBC 2NY4D 3V0EA 3RTQB 3ISRA 3BZ5A 4NCDA 4LASL 2XVGA 2ZUSA 3LNGA 3ARGD 1RFDL 4KQ4L 1LO2H 1NMBH 2HFEB 1VFMA 4BGLA 4IU2B 4Z7WF 3SJVE 3D39E 3CFNA 5I16B 5F7MC 2OR9L 2P9RA 4WWPA 5TQ2L 1PSKH 4FLHA 1E9OA 3MUJA 3RDTB 3V0WL 4P99A 4WEMB 5CEZL 2QMKA 4HIIA 2W60A 4DIXA 4CMMA 1J5OH 2GUYA 3LS5L 1WICA 2WXGA 1X9LA 3FQRB 3H4HA 2ZSVB 2AEOA 4TQ8A 5KN5B 2NXZC 2YEZA 2FZ3B 4KI5F 5GGVH 2BNRB 2CKNA 1TLMA 4X9IA 3NZHL 1JPSL 3P11L 2NY6B 2VLKB 4DPBX 2CHNA 4F37F 5LAXB 2IWGA 4H8WC 4H8VA 2D7QA 4B9ZA 4QDGA 1D5IL 3POCA 4PTTA 1J5HA 1F1AA 1T3FA 2KZWA 5K9JH 1LK3L 3ZVVA 5L7XH 1CDIA 2NTFB 3H7BB 3U2JA 3KLHC 2PW1B 3R06B 2BRRH 1IAOB 3SGKA 4K5OA 4ESKA 2VDRL 3DX9B 1EEYB 3KPRE 2HTLC 3L7EA 3MV9D 3QDGA 4XMZA 1MXDA 5J3HC 5EG6C 3VXSE 4JM2D 3FOMB 3CC1A 3E6FA 43C9A 5I0XA 5GS2H 4XHJD 2YSSB 3KD4A 1S6NA 2QTEA 4N5EC 4N85A 4LSTL 2HKAA 1VA9A 1XT5A 2Y3AA 1FLRL 1KENL 1RUQL 1MLBB 1JXDA 3N43F 3SOBH 2JI3A 5D8JH 4JX0A 3TFKC 4YHLH 1CXEA 3W0WA 4HEPG 3RZCC 4KK5D 1UGKA 2BNQD 4WFFE 4LZKA 2DM7A 4N87A 3RVUD 3RI5F 2B0SL 1E9PB 32C2A 4GKZB 2UXGA 1CE6B 1WWAX 1W0YT 3QI9B 4ORGB 4XP6L 1L0XA 4YO0A 1AMXA 4QYAA 1E8ZA 3MFFA 3OGCB 1KLUB 3ZUCA 4ANWA 1D5ZB 1ROCA 4RNRA 3D69A 3KPLB 5LG6A 2HMID 4M7LT 1RSFA 1QAWA 5FYKH 4PD4J 3OQ3B 2Q87A 1WF5A 4GW5A 3UJIH 3MLTB 5G5DB 4R2GD 3ARPA 3K2IA 3O2DH 4IOIB 4LEXL 4LK4A 3VUAA 1DL7L 2VE6A 5J13B 3KGTA 2EDRA 3STZA 4NQQA 3MO1B 3PPEA 2O1AA 5J7CC 3AREC 2F8OA 3D9AL 1F3DJ 4AQ1A 1E65A 4JM2F 1EA9C 1PS3A 1P4LA 4E9VA 5AW3B 2QQNL 4KVNH 4EZLA 5FFLA 2V3FA 2YUXA 3WNOA 1LL1A 1PY9A 1R24B 2VKWA 1I1FB 3LPGA 3N44B 5D7LD 3CSPA 5HDBF 3TO4A 3WN5C 2EYSA 3E6HB 4HEMA 1QSZA 3BPNB 1WA1X 3WE6A 5FUOH 1ORQA 5T5FA 4D7BA 2DM4A 3L4WA 3X12A 3A6CH 3K2UL 4ONOA 3VNZA 4EN3D 3ILDA 3J2PA 1ZA6B 4WI8A 3P9LB 1YEDB 5C1MB 2G5BB 3EGSA 4IDJL 5K59E 3VFMB 3DSNB 4X9HA 5DRXA 1H6UA 3T6QC 4DN4L 1VENA 1ETA1 2V5SA 2NW3B 1MCHA 1UEMA 3BH8A 2WBJA 4PWFA 4YSDA 3RVWC 3U25A 3KCPA 3VGFA 5AG8A 2ADJA 1JJUA 3PL6A 3KPTA 3X1BA 2EE9A 4JRYB 4PJAB 1CFMA 3MCLL 3N1FC 4HOMA 3D52A 1F1DA 4EI6A 2C5DC 5I1LA 3KH3A 5IOPB 2HJLB 2UY7B 2HVJA 1A3LH 4K2UL 5B7MA 3BE1L 3LV3A 2ESVA 1GGBH 2K0RA 3OC8A 3W56A 5EHFA 4LLWA 5DS8B 4DZBA 4UM8A 1LE9A 2WY3B 3VFSB 4JK0D 5K5YA 4LASH 5EOTB 4YH6A 5HHPB 1YMMA 2ZF8A 2EP6A 1RFDH 2AKRA 2B14A 3BN3B 2R2BA 2UZYA 3ETBF 1CLCA 1E0OB 1ECZA 1ND0B 3HG1B 3LEVL 4FQ2L 4I2XE 3IKCB 3HG0A 2BCKB 4PLKD 4A66A 4DP7X 4M8VA 4J3TA 1RZJC 4ZUSA 1RP8A 4X4KA 3FU7B 5D96B 5I1AA 2DQCL 2AERT 2R2HA 2FQEA 2J12B 3LMJH 3RBSA 1GSMA 4PRDB 3GSUA 3C60C 1NDMA 3EYQC 1H15B 3V0WH 2ZWKA 5CEZH 2ZYSA 4ALAL 2FWUA 4EMZA 2PWHA 3EOAB 3VSVA 3B3IB 1WRFA 4F5CE 2AQTA 4ZYKB 4UOW0 4YXKL 1RK0A 2BVQB 5DHYB 2BNRE 5IT2L 3GMOB 4PBDA 3EBGA 3ZKND 5IQMA 1FYHB 3NZHH 3L9RB 1BECA 1IGYA 1JPSH 5IJKC 1OARL 2VLKE 3FUNA 1PD0A 1U9KA 4DVBB 2N4IA 1MDTA 5IBLD 3DETD 4P5MB 4TQIA 4ZQKA 1U3HB 3U0PB 1UACL 2CG9X 4M8UA 2ZUTA 1KACB 3U36B 1EJOL 1D5IH 1DSYA 5IVZA 4AGOA 8PAZA 5C8JB 2VO5A 3UAJD 3U1SL 3FT0A 3N9GL 2O93L 4QJ4B 1DYZA 4PJ8C 3MRIB 2DTML 5MHSD 1ILUA 3QNYB 5I76A 1WFUA 2ICWA 4LSSL 4F2FA 1FH5H 3X14B 2E6JA 2FECL 3ZKMC 5SWZA 4LFHD 4DP9X 4RX4A 2C4FT 3KBEA 4AJYV 3VWKB 5GS0L 2XOTA 4QD2E 3FF7A 3ATDA 4ZI8A 2DQJH 2EJ1A 3X3GL 5AB1A 4AGNA 2PXYD 3ESOA 2BSRB 1MFCL 2JCCA 2CMRH 4JEGB 5IFJA 4LSTH 2W95A 3QZWA 3OM3B 4HIJB 4U6HA 3MX0B 1MF2L 2P52A 1FLRH 1KENH 1RUQH 3D09A 3F7PC 1CU4L 1QVOA 3FTXA 3IPBA 2WUBH 4GT7A 4B9KC 4ZPVA 4C83A 5EUKA 5CGYC 4M7ZC 2OK0L 5B1KA 1H6FA 2JH2A 4B3VA 3QFDA 1N0LB 2A74B 4B41A 2JWYA 2B0SH 1MN4A 4FLSA 2XZCH 2WVTA 2ENPA 1DSWA 1NBYB 2AQSA 5E8PB 3LN5A 3FH7A 3X1NA 3F01A 3O0RH 2NY5C 1ZT7A 3VB9A 2FQFA 1A4KA 2VDLL 3WTVA 1I1AC 2PWFA 1NAML 5TDPB 5ISZD 1P0SE 2M1KA 3IFOA 1PNCA 3A4AA 2HRGA 2NSQA 3QUMA 3P9MB 4C4KT 1DL7H 4LEBA 2GHZA 3CHRA 3QQDB 2Z64C 4OF8A 3J8F7 4NCC2 1CICC 1NGPH 1QRNB 1X5YA 1ZE3H 3D9AH 2ENYA 2I07B 3K81A 5HJ3A 1FRGL 4XWGL 3HEIB 4BCYA 1IGJA 2QQNH 1URIA 2HYMA 4GQRA 3WHXB 2XKNA 1MHPL 2WPGA 3CFEA 4NPYB 2LAAA 4ZJ9A 1F11B 1KWKA 4XO8A 4AG4H 3TYFB 5MENB 1L3NA 1NOFA 4EQ3A 1YUKB 1SDAB 4W93A 4UT9A 2X4OB 5T5NG 5BPPA 5E95B 3GMMA 1R3IL 2GK2A 4KKBC 4OFYD 4OCYL 1CI3M 1WWBX 1TQSA 3IFLH 5C0CB 2IG2L 4IDJH 2AF2A 3UG4A 4HHAA 4TVSa 1UD6A 5F1KC 3V5KA 3UO8B 2MTPA 3ZDZB 5FW8A 3DX2A 3BQUD 2X0UA 5KAQF 3LPWA 3LKQB 4JRYE 2HJFB 2ZXQA 3VFVB 3A4FA 3AAZA 3ULUD 4TTDD 1CVRA 4JG1L 3OHXA 1E4HA 2WTRA 3O3BB 3EG9A 4K3DH 1YNKH 1FNSH 3A6OA 1SJEB 1T66C 3GRBA 4X6EA 3G04A 4YNYA 4JN1L 3MRDB 4E41B 1YN6B 1KEGH 3FQ4A 3DRTB 3P4NA 3TLRA 4FQCL 2XHNA 3MNWA 3KYNB 1WUNT 3RL2A 3LDBB 3HG1E 4N0YL 1JYNA 4C54A 3LEVH 2VCOA 4FQ2H 1K3ZA 1N2RA 2ZX6A 3GS7A 3GSVB 4L9DA 5CLXA 5D7SL 4ANKA 3CDGB 1UKSA 2O30A 2YD4A 4MYWB 5EBLA 3DHPA 3WIFA 1XL4A 2NXYB 3MGOA 1GL4B 1YDPA 2DQCH 5I6XB 5JPNC 5DS1A 5D5MB 4HFWB 2ADGB 3O6FB 5IP4A 1VCBC 1ERNA 1IEAB 1A9BB 5JHDB 5A2CA 5DJXA 4YSEA 4ABVA 1A2YA 3LQZA 2P42B 4JQIA 4QRQB 1J0ZA 3IGAB 2Q0ZX 2N0MA 3WJLA 1U95B 4OJEH 3U46A 1GZQA 4NZUL 2PCYA 5IT2H 3SDCC 3E8UL 4MMYA 3ULVC 2JKLA 1PX3A 4IRZL 4PM1A 3KR3H 2O5ZL 1OARH 1ZHLB 1XSKA 3BP6A 3T09A 1FDLH 1MCQA 3ULUF 4I3GA 1FO0B 3UTSD 3MV11 1UACH 1C1EL 4MXWL 2ZCZA 3QIUD 4Q8BA 1EJOH 1OAYH 3ECWA 3N9GH 2WSKA 5C0JA 1HI6B 2E56A 4LSSH 3UFIA 1NEZB 2CCLA 3VFWA 3UTPD 3MJWA 3UPRB 3IETB 2ZXWB 1LK2A 5GS0H 4EI5A 2IAMC 3KLKA 1EBPA 3WKML 5D2LA 3WOVA 4I18C 3X3GH 3HG3A 1RP9A 3N2JA 4RMRA 1C16A 1MFCH 5CEXA 3JUZA 1T6WA 1GW6A 1BIIA 1ZDSA 1FFOA 2P1YA 1A6TB 2O5YH 1FVEA 5DLLA 4Y8DC 4PJGB 5D7JA 2AQRA 3DX4A 1CU4H 2HN7A 4YDMA 3WL9A 4KQ4H 2AXGB 2GTWB 5B39B 2ZOKA 4KITB 2OK0H 2YZ8A 5CJOL 3V5DA 4P23D 3VGEA 2VMFA 4MS8C 2NYYC 1S7RA 1TO5A 3ZR6A 5IIEA 1X5IA 3T0XA 3V4PB 2PP7A 3ZL2A 4F7CB 4MNHA 3P4OA 3QYCA 4LKXB 3TBWB 1ID2A 2BSDA 3CUPA 1NBVL 5ALCH 4MJIA 2VDLH 3EADA 4PJHB 5DHMC 1NAMH 1PJWA 2O6CA 1BQSA 3BGFC 3WFCL 4JPQA 1XMWA 2O5NA 1HWHB 3CFBB 2DD8H 2WQUA 3B2UC 1XGRA 1KIUB 1Z6JT 2FO4B 2XWDA 4KJPD 4V1DA 2Z7ZA 1VHPA 1A4JB 3UGXA 3EO1B 4XXWC 2KZBA 3LRSA 4DAGL 3MHZA 1XH2A 5KVDH 1F4YL 4FAAB 3V0FA 2XN1A 3A24A 4WKXA 3U4EA 3ESUF 3QUGA 1OAQL 4JDTL 3IBEA 3L48A 3P2DA 2YAPA 3QDJA 4F33B 2F6AA 1HT6A 4B9IA 5A3ID 1FRGH 4UBDC 5JOFA 4XWGH 2JIXA 1QTPA 1N4XL 1F6AB 1KB9J 1R0AL 1MHPH 4U1GC 3S98A 5MENE 3D3VE 3AXIA 2AJ3B 2PUQT 3T0EC 1V3KA 3CLFH 2JLPA 2WXRA 1A1MA 1B4LA 1DR9A 4IMKC 4I1RA 3HA0A 2P3YA 3W5NA 5C0CE 1R3IH 1CGVA 4OCYH 4AM0A 4A2DA 2IG2H 4Z7VA 3NFPA 5CU9A 3QJTB 4J4PC 1HKLL 3ZDZE 4UMGA 4WTXA 5D7IB 3ZIYA 1QEWB 4JFDB 1G43A 1G1YA 3TT1H 4CNIB 1VZIA 1ZSHA 2RQ8A 2Z31B 2D0FA 1OWWA 3VRIB 3QUXB 3UMTA 1TIUA 3QJHA 4FXKC 1OF2B 5TTRA 3I3EA 4H88L 4E41E 2XVKA 4JN1H 1WCBA 4OUUB 5DGQA 3QIBA 4IGBB 3NQKA 2KC0A 2CJ3A 3UYPA 5IQ7H 1E90A 3SY0A 4XXCC 2WGXA 3CHSA 2EVIA 1HH9A 4FQCH 2NCMA 5EC1B 4W6YB 4UILH 5BQ7B 2HXAA 1MRDL 3WEXA 4N0YH 4DUWA 3NZ8B 4PJ9D 4GG6E 5D7SH 4KKLD 5EA0L 1YMHA 4G70B 5IQ9B 2Z8WC 3NOIA 2IWKA 5IK3B 4QHNB 3NEOA 4HYTB 4WLCA 5D5ME 5D6DC 5TDNB 1RZGA 3MRPA 3W39B 3ET9F 3E2HC 1P6WA 1ET8A 2WKOA 2DQEH 1BG1A 4UU9A 4WWKB 5JHDE 2E4TA 4H1LH 2Q20A 4KI5C 1SFHA 2BS8A 2C9UA 3LHPH 1LO0L 4FOMA 3Q2WA 2JXMB 1H6EA 4UNVA 4W81A 5CBAA 2X1PA 3WUWG 4NZ8A 3QG6A 4BKTC 3E8UH 2QADB 2D8KA 4IRZH 4WJG3 4KNQA 1KCWA 1DJSA 2O5ZH 3NESA 3S3CB 3T77A 1NGYB 4WW2A 3JWNH 4Y2OB 3SO5A 3QO1A 1NJ9A 2Y06L 2WXOA 2BIIA 3JV4A 3SGEH 5TGBA 2ATPA 3RFZA 2CBQA 1T1WA 4HHWA 4MD5A 5IKCA 2NY4C 6TAAA 2XTJE 2WQVA 4G80A 4TRPL 3G5XA 5CP7A 5EZOH 3ARGC 1MHEB 4JDZA 5EWIL 3S5LA 4I9WD 1F4WL 2NUTB 5E6ID 5T3XE 3Q3GA 3WTTA 1T0PB 1IKFH 2NY7L 4NZRL 4A68A 4HUNB 2BMKB 5FYJE 2YHGA 1XD1A 3PHOB 1A6PA 1WAAF 2I69A 4PJDF 1T20B 3R1GH 4GY4A 3QEQE 3MRNA 1UZGA 2I7OA 4PJGE 1NUFA 1O75A 4GRLA 4O51A 3VXUD 4Y7MA 2QFRA 2GSGA 4B5ZA 5EU3A 4JY5L 1M1XB 3CPLA 4ODWA 3N5AA 2B1AL 2IADA 2OMZB 2F7RA 5C0NC 2IH3B 1YNTA 5D1XD 5CJOH 2IWEA 4WFGD 1VEMA 3EJTA 5IHZA 3EH5B 4JM4L 2H1LM 3DECA 4BDVA 4OZFH 3NN8A 5AB0A 3ROLB 4NI6A 1IVLA 4JQVA 3F62A 4F7MB 2FX8L 3RWDA 4FQHB 4YEFA 1AC6A 3OMIB 1TEYA 4PJHE 1ZT4A 2XWTA 4QGYA 3FCSB 2EDBA 4UINH 4HJ1A 2NQDA 4XPTL 2ATAA 4P2OB 1U8KB 4TN9A 5KSBA 1ZVYA 1K5NA 2MPAL 3STLA 1IC7L 2ZOLB 4HGWB 1NCAL 3VE0A 1LO4L 4NZJA 1CLVA 4GUCA 2P5PA 3P2TA 3PS6A 4B95C 3PWJB 1V8HA 4ZNEE 4DAGH 5DD6A 1F4YH 3AREB 3IU3A 3FONB 2CUAA 3SYCA 1WAEA 4I3RL 2F74A 1OAQH 2GCYB 2R1XA 2XXMB 3OAYK 4I77L 1G0YR 2KKQA 1NCNA 4ZFZA 3WN5B 5DQ9A 5C08D 4MAZA 2WXPA 3IJEA 1ACYH 2XN9D 1D5BB 1ZLUK 4X6FB 3K6NA 1XZWA 4QF1A 4MXVF 1YNLL 4TUKL 4GSRA 3WYRA 1H6TA 4KK5C 1QASA 3TA3D 3IDXL 4WWNA 1MFMA 4Q4IA 3RVUC 1MFDL 1SY6L 1UM5L 2H5UA 2YXFA 4JFOB 4N8UA 4XCFL 5D7IE 2PN5A 1C12B 4JFDE 5DD5L 2ZICA 4GXVL 5AOLA 3VXPB 4AT6B 1UD8A 4BK5C 4HJIA 1JZ4A 5F7NC 2VQ4A 3R0NA 4L48A 1AZRA 1P6AB 4TVPE 1RIUH 2HMIC 5CSZA 3IAQA 1U41A 2EEBA 3K5SA 5BRQA 3VMOA 1I3RB 1MVFA 3HUJB 3ZR5A 4R2GC 4WHYH 2D3JA 3ARDA 4H88H 3ZDXB 3UBXB 1BFSA 4J7RA 2UX6A 2W07A 1JD9A 3SQRA 3APCA 3M17A 3QR2A 3W9DA 6FABH 5H4ZA 1KPUA 3D2TA 2APVA 5CCGE 3EGXB 3SGDH 3F58H 1A14L 1MRDH 2WD0A 3ZTJH 1HHIB 5DJ8B 5EA0H 4E9QA 1IAKA 4U4IA 1KF9B 2WK2A 4ZUUA 4Q9RL 1MCPL 3DA0A 3QWQB 4PJXA 3ARBB 1E2VA 2VQTA 2VDOB 4LCIL 1P5UC 1MW0A 3WN6A 1XF2A 4EN3C 1AQDA 2HJKB 1DP0A 1SGKA 4DHLA 3C6EA 5B3JE 3QDMB 1DJGA 2TSBA 1S9VA 1J5CA 3TO2A 1WK0A 1JK9A 2AEIT 2IEPA 3ME0A 4IMLB 4TM9A 4PY7B 3VXOB 1OHZA 1LO0H 1QPXA 1G7MB 1BM3L 3VVWA 1KULA 3MC0A 1W72B 4X6BB 1UXSA 2BM3A 1QRKA 4ZS7L 2OYKA 4W9ZA 1W16A 3LEXB 4JRXB 1HQ4A 3G08A 4OF5A 5HGDA 1QSFA 5J6GB 4XMWA 5AVZB 4DQOL 2BVTA 5F8QC 2B15A 3WIIH 4F8TA 2Y06H 5I1KL 2OJEB 2F54A 2PABA 3LKRA 2VABB 4PJ8B 4EEEA 2IF7A 4K3JL 1WV7T 1C5DB 4OKVB 2V9RA 3FRUA 2FIKA 5EWIH 3PWLA 5KBLA 1FNHA 3HZ3A 1F4WH 4YUEL 4Z3HA 5B7EA 4U6YB 2NY7H 3EFDL 4PLKC 4NZRH 1YUHB 2FEJA 3F7VB 5L2KA 4YSSA 4YIQB 3BX7C 5IMOB 3QG7L 1MHCA 3OAUL 4P2QA 5HHVL 4PW3A 1WD9A 2BS71 3UYRL 1HHKB 5F70A 3RBGA 3N50A 5LDSA 3MRLA 4FI8A 2PW2B 1KTJA 1R6VA 1DBML 1C08A 3D85A 2NX5B 3MJ9L 2YA2A 1BLNB 4E5XG 1G6RA 2VRQA 3SCMB 4QRRB 4QMEA 1CFQB 2HT4D 3OKKB 5C0AA 1ZHNA 1ZT1B 4H0IA 3WJJA 4KJYA 2DQGL 1DJZA 2ZT9C 4RETB 1OCCB 2VAJA 3LKSB 3ZKNC 3FU6A 3SDXE 4LOEA 1DLFH 2GTZA 5IBLC 1B6DA 2W5PA 5FEBA 3DETC 4I0PD 4TLSA 2L4OA 2EC9T 4NNYB 4XNZB 1KGJA 2V8LA 2VXQL 3A22A 3GMQA 2C9SA 5IM7A 2DL2A 4S1SL 3FO9A 3RA7L 4Y4HB 1IGTA 1TFPA 4L05A 3V0GA 3WD5L 4XPTH 3UAJC 2CLVA 1KT2B 5I75B 1OB1A 3RJOA 1PZ2A 2MPAH 3DBXA 5F7DA 2PP9A 1IC7H 1JN6A 1W15A 1LO4H 1ADQA 1EZVX 2PYED 1AQKL 3ATEA 3OAWA 4J23A 3ABGA 1ETZA 5IGXL 3ZU8A 3DTUB 2WSPA 2MHAB 3HZMA 5DLML 4O02L 4G8GE 3GI8L 3VI3F 3QR1A 1QLEB 1BP3B 3OXRA 4I3RH 1MIMH 2PXYC 2DBJA 3WS6C 3GS0A 2IIJA 2V2TA 2L7EA 4I77H 4CVUA 5DJDA 4EOWL 1PCSA 1FV1B 4NQED 5DJ0B 3ZE1B 1FNAA 1O6VA 1R33A 4X98A 3HNTL 1JZ8A 2GW5A 1ZV2A 4V11A 3DX6B 1YEFH 3O9WC 3NTCH 1YNLH 4TUKH 3U9UB 3MRQA 3QUZB 5GRWA 1E4WL 3OG6B 4AK2A 4N0UA 3IDXH 4OZGB 3KLAA 1FZOA 1AD9A 2WXJA 3RNKB 3PF2A 1XGTB 1MFDH 1WUZA 3TEZA 1ZGLM 1UM5H 1NGZB 2KH2B 2X4PA 5EOQH 3QFJA 1ED3B 3ABKB 2Y7NA 1A6ZA 5TQ0L 4CDGC 4GXVH 4FS0A 5D4IA 4DN3L 3V79C 3P4MB 2CCVA 4XBMA 4M6OL 1NFIB 2J6WA 3OZLA 3NP4A 4Z78A 2HFFB 3RWGA 3ABZA 3HUJE 2EO9A 4WUUB 2IDCA 5I1EL 5I5MA 4N8VA 3TZVB 5F8RC 2GJZA 4OV5A 1LM8V 3CFUA 2ZTBA 4AZUA 3OPUA 1XGQB 2Y24A 3EYVA 4NRXB 5CBEA 2CK2A 4AOFA 3KPOB 4X83A 3HB3D 3D18B 4ETQB 1IBYA 2P5WB 3GSXA 4NO0A 4OBSA 2ODIA 2CKBB 2E86A 1KGCD 1A14H 3I6GA 3K72B 3ATBA 3MBXH 1YY8A 3FCBA 1Z9LA 3BVXA 4OFPA 5T1LA 1XQ4A 3WXWL 4RWYH 1I8AA 4Q9RH 1MCPH 1KEML 2Y6SD 5DS2A 3VH8G 3BD3A 4N6RA 5BZDA 4AL8L 2EYTA 1OAZH 4LCIH 2R29L 3ZMRA 4UT6L 3KXFD 2OSLA 5E1AB 3QDME 4N0FB 4ZOCA 4H8QA 4UMSA 4XVJL 4PWGA 4MB4A 4JCWA 1E27B 1RZFH 3Q2VA 1EHAA 5F7UA 5GZND 4XNDA 3A0OA 4FTVE 1EHLH 3GRGA 1HQRB 2VXVH 1J1OL 5C0DA 4AYFB 3PGDB 4AY0A 1IC5L 1E5CA 3P30L 3BQUC 1XVSA 5JW4Q 4ZS7H 2LFEA 3D5OF 4OFIA 3ULUC 2FDBP 4Z76A 4TTDC 2CBOA 1LEIA 1BZ8A 2DH3A 3BUQA 5FHBL 2EUWA 4U6VL 2P5EA 1KCUH 2Q6WB 2AEPL 4LEOA 4C56A 4DQOH 1RPKA 2W9EH 5E8DL 4AVJA 4LVEA 5C0GA 1AZVA 4AXWA 3WFEH 5I1KH 5A16B 4JFQA 4M62H 3C9NB 2O6EA 2DM3A 2DLTA 2YXVA 4K4KA 4PJFB 4LKCA 3B2VL 2MCPH 3CZFA 2COQA 3BLBA 5HVHC 3U1QA 2UVFA 2IAMB 3GUFA 3FB5B 3NFNA 1HYRC 3RAJL 4MD4A 1F58L 3IAPA 4M29A 4G9FA 3QG7H 1OVZA 1KXQE 3OAUH 3OF6D 4NQSB 3UZQB 2AJZA 4ODVL 3AXLA 4JZJA 4U0QB 3TJEL 4P46D 3BLPX 1ET7A 2NX5E 1DBMH 2GT9B 3NCWA 3MJ9H 2DYSB 4UDUA 3PGFL 3RIFF 3VG0H 1FO0L 5HYJB 3R0MA 2VDML 4QRRE 3L4UA 3EGDB 4KX7A 3WXVL 1EEZB 3C5JB 1P1ZB 4NKQB 3T1FA 4MA8L 5FM5O 3FH5A 4P8QA 3HI6H 2YIHA 3FFOA 1EQWA 4X5XB 4L3EA 1JK8B 4LHUB 4XN8A 3FRPB 1DVZA 1PLGL 2I60L 3SQOL 2NCEA 4MCZB 4F92B 3UBGA 3PWNB 3L3JB 2VLRD 4O5LL 2IOMA 3OKEB 2IH1B 2XXCB 5I6KA 4HAGA 4XB8A 3T0VA 3DROB 2VXQH 3NIGE 3G5VB 4OD2A 4S1SH 3QIUC 2ADFH 1X4XA 3BGFB 4YAQB 1PCXA 4JHVA 4Y19D 3WD5H 2B2XL 1HAWA 4YHIA 4UIMA 3BP7A 2VR6A 1QI4A 1I8KB 1Z9SA 2OXHA 4HXBL 3WTYA 1NAKL 1XH1A 3W9EA 1KB5B 2A9NL 1GOGA 2BXYA 5IGXH 1CD1B 5DLMH 5DFAA 3ZDYE 4O02H 5EFIA 3GI8H 1VADA 3OAYH 5BZXA 1UOLA 1R3JA 3H9SD 1GY2A 3UTOA 1MRFH 3ULSB 2QSTA 5H37G 4E2OA 2Y23A 4UNIA 4WEEA 1ZS8A 1JDCA 4Y9FA 3L45A 4X6CF 5CWSA 4EOWH 4QGTA 3ZE1E 3SO3C 3U7YL 3T0EB 2R23A 3HNTH 2VUOA 4LL1A 1SXBA 2IDQA 3MYJB 1UUNA 3EZ8A 5I2IB 1F45A 5KYYA 3HFML 1E4WH 4P23C 2YPLE 3T0WA 1E4JA 3CCHA 5KSVA 3S8GB 3GSNA 4DUXA 2ZOTA 5FCUH 4O2EA 4GSXA 5TQ0H 5JQ6H 3RWHB 3UP6A 4DN3H 5E9DB 1BZQK 1QHOA 2NNRA 2P8PB 2DQFB 1TQTA 3VM7A 2VJ0A 3WCYA 1NLDL 4M6OH 2AXFA 4PD4K 1XXFC 5ANMA 3MKGA 4WUUE 2BY3A 3GJEA 4HJGA 1OP5H 2MIZA 2AJUL 1XBDA 3C2AL 1GZPB 2NNAA 2YN3A 1UOKA 3IFNL 1DVFB 5E03A 4H20H 4KJPC 1MCDA 4PJEF 4UTBL 3W37A 1MI5B 1VAHA 1XF3B 4Z7WB 5LXVA 3CVHL 4AW7A 2PCPA 2VDPL 3GRWA 3I6KA 5DZNA 3J27A 1EDYA 2JJSC 1KFAH 4OLYL 1TQWA 5A3IC 3OKNB 3FC8A 4GI8A 3WXWH 1UWGL 4DW2L 4I3SH 1JZJA 2NR6A 4EUPH 3NAAL 2A73A 4DP6X 1KEMH 3GK8L 3JVGC 4PRPD 1Z5YD 1S5HB 2NY3D 5HDOA 4AL8H 4GQ9L 2HP4A 4QAMB 4UT6H 4TVPL 3U0TA 3U6XA 3VSUA 4BH8A 1X7QA 2Z8SA 5IB4B 1DUYA 4XVJH 1HL8A 4DFHA 2ENQA 1QNZH 3O11A 3FN3A 3PHAA 1Z3GL 4HUKB 4JHBA 1O7SA 4NB7A 4MQ7A 1J1OH 2GBAA 2XBTA 5CJQH 1IC5H 3P30H 3MSPA 4LLYB 4UQIM 3ULVE 3NIFF 3SQBB 5ENWA 3HE7D 5DK2A 3GBDA 4F3FA 4B53A 1KY6A 4U6VH 4GJTB 2BVUA 3CDFA 2FB4L 4ODXA 2DI7A 3C5XA 1HH6B 1ZAGA 3UC0L 4OJCA 1PZ5B 4XC3L 5ALBL 3BCDA 5GS2D 2NY4B 4YGVB 5CCJA 2D7OA 2ALWA 2P8LA 5FCSH 3KS0H 2Z92B 3F7RA 5F9DC 2XZZA 5GISL 3CPUA 3B2VH 2LVEA 1T04A 3SBWA 1GGCL 5H94B 4DSYA 4PJ9C 5DZAA 4FQXD 3KDMA 4KKLC 1F8TL 3QORA 2FJFB 3RAJH 5EZJA 1ZTXE 1CFNB 1ZPUA 4L3CB 3U4BL 3N43B 1BWWA 1AJ7H 2EILB 1AKJA 1OGAA 3C8KA 4HAFA 2VR8A 4ODVH 3TJEH 5IW3A 3ESVF 3CZJA 3P0YL 1KGWA 3RG1C 1QBLL 1RERA 2YPVL 3SN6N 3N06B 1FYTE 1DQQB 4H8WL 3OB0K 4WU5A 4BZ2A 2GEEA 5HYJE 3HN5A 3OPZH 3IDGA 1P84K 2VDMH 5FYKD 5CZRA 5I74B 4LSQH 5EIIA 2A83A 1DBJH 3AG3B 4R3SB 5KYXA 2XY1A 1A4CA 1I3GL 3PXHA 2VT0A 1I31A 1D5RA 3KCWA 4MDJB 2BIPA 3ZO0A 4JS7A 3WIHH 1EXUA 2B39A 4BCZA 1FWXA 2I60H 3SQOH 4DNLA 3OMNB 1FE8L 1JWMA 3VXRD 1FIGL 4O5LH 3CFIC 1E9QB 1HHHA 3VFTA 4X6DF 2DAVA 3ECBA 3HZVB 1K2DA 4MMXC 3VXNA 5KANI 1GC1C 2B2XH 1B0RB 2KZKA 3PDDA 4GAGL 4FGMA 3L5WA 1Q0EA 3MMEA 5E4EC 3LZFH 3MV9B 3C6LD 4HXBH 1BD2E 3EJZD 4QO1A 4Z0XB 4JM2B 1N70A 1VFAB 1TZGL 4QTIH 1UXWB 3GJFA 4OLEA 3US0A 4NHUA 3O45B 3O2VL 4JN2B 5HDBB 5A1AA 3CMOH 1EH9A 1QUPA 3A67H 4L0PB 4JPSA 4CC0A 5IUCA 1GAFL 1A47A 1MPAL 1IJ9A 5AQ0A 2QV2A 5HY9B 2QEJA 4L4TB 2GVYA 3T0EE 3U7YH 4R7NA 4PG9A 2AP2A 2YXWA 1EERB 1SOSA 1YQ2A 4TNGA 4JUSA 4LRNL 3KVQA 2ED7A 5D1XC 3HFMH 4GRWH 4KKPA 4LHQB 4MCMA 2FHBA 2UZPA 3CH8A 5EZLB 3G6DL 1J9QA 5CINH 4XAKD 1X44A 1XIWD 2OMNA 2QGDA 4YSCA 2OULB 1EUTA 5D1QA 1UFGA 3AB0C 4PB9L 3FYIB 3OZ9H 1PFOA 5IWLA 1S5IH 3BPLB 3ZQXA 1M7DB 4PWHA 4IBTA 1BZEA 4KGJA 2P44B 2G2RA 3LKNB 3BRFA 3EYFB 2EXWD 2WNWA 2Z91B 1NCBH 3OJ2C 4P3DA 1FFRA 3TEXA 5C9JB 2AJUH 3JT2A 1N59A 4MLSA 1TNNA 3C2AH 4PRHD 2GQHA 3F6IA 3OQRA 1PAZA 3NP3A 3GXUB 3IFNH 4XB7A 4NQVA 1MI5E 4UTBH 2QGBA 4Z7WE 4K5LA 2ADYA 1TQBB 1NEPA 1BLIA 4EXKA 2VO8A 3EDDA 3AADB 1G7JB 3MBEA 3QUHA 5EULV 3QXAA 4OLYH 4WI2A 3VWJA 4QLRA 5I1GL 1JTOA 3IVKB 1KXVA 4X4XA 3T4AC 1D9KD 1G7QB 1YQVL 5HHOD 1UWGH 4DW2H 2P24A 5D7LB 3NAAH 3JUYA 4ZMLA 1F18A 3GK8H 1PX8A 4W4OC 4M3KB 1P5UB 2GJ6E 4GQ9H 3FB8B 4A37A 5AYTA 2ZX9A 3MZGB 4TVPH 1QWHA 5JA8B 5IB3A 1DVTA 1BEYL 1QPPA 4KI5E 2CRIA 1K85A 1U8IA 3TA3C 4XO9A 4LIQL 5EUOF 1L7TL 4K0OA 1V3MA 4ZFQA 3IFPA 2OL3L 2XFXA 1AFVL 2FH6A 5BS0A 1NBZA 3FN0L 4HC1L 4PCSA 2WNGA 3T2NH 3QEUA 3SDDB 1UH2A 3CGTA 4HPHA 3DXAA 5KUKA 5EBGA 3KPSB 5IUSA 5F3FA 4AYID 1JCKA 4FQLH 4P5SA 5DC0A 1KN2L 3TNNA 4AV0A 4XGZA 4J3VA 5I1JL 3VD4A 1QWNA 4AKOA 4TULL 1E3FA 1S9XB 2ERJB 4KPHL 3I74A 4LOVA 1X9UA 2FB4H 4GUPA 5BMFL 1L9RA 2Y7SA 3NCCB 4JRWA 3UC0H 1DBAL 1J8HA 4XC3H 5ALBH 2UWEE 1KJMA 4U1HB 5FB8A 3KNBA 4Z3JA 3EZJB 3CQFA 4WCYL 2EE6A 3UL4A 4M1CD 3JSSA 4ZOEA 3Q8CA 5KW9L 4IOSA 5GISH 4PLNC 4HUXB 3MRBB 4JB9L 1GGCH 4FP8H 5FO9A 5KWYC 2DZEA 4HV8B 1F8TH 5EU4A 4ZX5A 4PTTB 1A1NB 4P5TD 1BBJB 4D0BA 1N7ML 1I3VA 2XXFA 3HN8A 2YBGA 4LESA 1R5IA 4HJJL 4JDEB 4X7CC 3HI5L 4MWFB 2QDWA 5BRZA 5DQDH 4WU7A 1EGJA 4AMKL 1PLAA 3NJNA 3P0YH 4G7YL 1QBLH 2YPVH 3O6ML 3GXPA 4H8WH 3L1FA 5PAZA 1VZGA 3D87B 3PG2A 2XY2A 3V4UH 5CZKA 3PPSA 1SUHA 4NQXB 3VFOB 2VSCA 4Z7NF 4OTXL 5CM1A 1OT4A 2YQ3A 5AKTA 3CC5B 5C0FA 3FK3A 1HJBC 3CV5A 3M8OL 2ITCB 4OJFL 3GPEA 2VW6A 1I3GH 4HS3A 5IR1A 1EFQA 4XP5L 4PQXA 2X4TA 4JZNB 3VI4A 4XP9L 4YHPA 4ELMF 1DQMH 5C86A 3IDYC 2IO5A 1EO5A 1CLYL 1FE8H 1EXGA 4FDWA 4GMSH 4I5BA 1QEXA 1JG9A 5JLZB 4RMUA 4PAZA 5JHMA 4L8SC 1SN5A 4OQ1A 3WNJA 4QHKI 5AOKA 3GIZL 4MRCA 3VYOA 3B9EA 4GAGH 3MV9E 3TV8A 1ICTA 1HDMB 5EU5B 3TP4A 3C09B 2ZSWA 4N22A 3Q05A 5HDQL 4NJAL 2ZOUA 1KIQA 2A6KA 4DKEH 2CD0A 3ZGIA 3O2VH 3FT2B 3D12B 2ETWA 5DF0A 4YXLH 1B0IA 3SE6A 4X7SH 1GAFH 1MPAH 2X4QA 3LPOA 4QNPF 2IQAA 3REWB 4A1RA 2VM3A 2XX1A 2FJHB 2Y1ZA 4GLRI 3T8VA 2X6MA 1UXLA 5ESVA 2NY5L 4G8EB 2LLNA 3P3RA 5E5MA 3ZQWA 2V8MA 1JHKL 1MCJA 1TO4A 3I9AA 2J1KA 1DJXA 4D0DB 4LRNH 4H26B 2HT4C 4PRIB 3G6JF 5CEYA 3QUYA 3II1A 3APDA 3FU3A 3QK0A 1TXKA 2IAND 1NCOA 5E0QA 1XF4A 3G6DH 3M1BA 4AKPA 5DC4B 3VXTA 5FX3A 1ZIBA 2DICA 4XNXH 1U8HA 1DVUA 4JL2A 4I0PC 4TNVK 1I7TB 2XZQL 5MI0C 1TTGA 1F97A 5A2FA 3OKOA 3P69A 5ISZB 3ORJA 4F58L 1TTFA 2H8PB 3O8XB 3PWUA 5EO0A 5CN1A 5I15L 2FATL 4CUCA 5KJ4A 3ASNB 3K2KA 4TPRL 1I8MB 1GMIA 2EDNA 4N20A 4AW4A 1IAIH 3FU8A 5DVKA 3B1TA 3QNZA 3QC6X 1R3HA 3KPMB 1JPEA 4LCYB 4QRPA 4RMWA 4ISVA 4DP0X 2BJMH 1FJ1A 4XP4L 5HPOA 5I1GH 1SDYA 1TOXA 5IHUH 3PIQA 5ESQA 1R34A 4D9QD 4NENB 3L95B 5D7LE 4EBQL 4AYBA 4UM8B 2R2EB 4WY7L 5HGAB 3TCLA 1TZ8A 4L29B 3L7FB 1LE9B 4FYSA 4H5SA 3W81A 1AXIB 1R47A 3MODL 1XV8A 3FU0A 2WBJD 1SJHB 3SPGA 4BUHA 1J9CT 5D2NA 3VA2C 4MZ2A 5MEPA 4ZRGA 4F2MA 5IF0A 2UUDK 4LIQH 2WJ7A 1AGCB 2FBRA 4ZUSB 3EIFA 2OL3H 1AFVH 1NIBA 1O7DC 4OZHE 1UQSA 3FN0H 4HC1H 2R2HB 3PJSB 4XBEL 3IDNA 2ESVD 3GSUB 3G5YB 1MWAB 4N8CL 3FTZA 1N26A 2DEYX 4OGQC 1GJIA 4I88A 2CKBL 2Y36L 3FFCD 1W8OA 3MXVL 1KN2H 4E36A 5E6SB 1NGXA 1AGEB 5D7EA 3BT2L 1XDTT 4YPGB 5GS0D 2B1HL 1UC6A 4AIZB 2OMBA 1C8PA 1YPZF 2EIZA 1CWVA 3WY2A 3ALPA 5F3BA 3MJ8A 1Z3RA 2D03H 4N2OA 4P4RA 4WCYH 3QQ4A 1AR2A 3HB3C 3IJ9A 3B8SA 5KW9H 3UH8A 2WQRA 4LOUD 4WI0A 2VGLM 1A3ZA 1MUJB 2OMVB 1G9NH 2K3HA 2ZUYA 4U1IA 1HJCA 1A5FL 1EZUA 3SJVA 2JB5L 4FABL 4LSRL 3KYOA 3D39A 3B9AA 5DA0B 5DEJA 5TD4A 1N7MH 4WHTA 3H55A 5IB5B 5LLIC 5K9OB 1T5KA 3ULVL 1DDHA 1KDJA 3NMEA 2IPTH 3HI1A 1QUNB 4Y4FD 5FIEA 1FZMB 1RMFL 2XWBA 3NJIA 4G7YH 3O6MH 4BSWB 5FYKU 3DMMD 2IFFL 2X1WL 4YK4C 1I9IH 1U92A 4OTXH 1TT6A 5GZNC 4Q6IA 3BAJA 5DMJB 2E27H 3SYAA 5ETUA 3L3DA 1UJ3A 4OJFH 2YGQA 1DUZA 4RAUA 4L3AA 3NCJL 1SBSL 5DD3L 2HSIA 4ZPVB 4LBAA 4BK8A 3LPPA 1QR1B 1DN2A 2WYZA 5JPMA 2Y7LA 5SWZD 1ZTXL 4HWBL 3QIUB 3ZTCC 1WH0A 4RX4D 3QNXA 4X5WB 3SPJA 3UX9B 3QS2A 1TVDA 4RA0C 5B8CB 1OKEA 5MHSE 4YE0A 1DQIA 3LN5B 2X4UA 2R9HD 4QCIA 5CAYB 2K6WA 4ZFGL 5HHQB 4WIQA 3KPRA 3VXSA 3CN0A 1ZT7B 2GFBA 3M07A 2Z7UA 1ZXKA 3QQNA 1KC5H 4JCLA 1D5XA 3KWWB 3C5ZB 4BV1A 1RURL 2IXQB 3DUUB 3ARUA 2BVOA 3DHJA 3NJKA 3CN3A 2A4CA 5IMLA 3LXUX 4P46C 2G75B 3WIAA 3ZLQC 3QUMB 3J7HA 2Q7YB 3AGVA 4PFEA 5D93C 1QKZL 1UHVA 4DEWA 1RJLB 1NINA 2PYFB 3N40F 3NK3A 3HHMA 3NDZE 4PY8J 4Q56A 4K7PL 4Q89A 4Y5VA 4N2KA 4YHNA 5CLYA 1T5XB 2J2ZB 1BXUA 3TEYA 4P23B 2AQ3A 2H0FA 1DANT 5HJ3B 3BMWA 3UAAA 1OE2A 5DFTA 4DO6A 4QXTA 1XBRA 4PCKA 1SRDA 3CFEB 1R5WA 5EDXA 1RUAL 3LB6D 3QULA 4HK0B 1KB5L 1N6QL 3ZTNH 3S3PA 2EIDA 3ARTA 2XZQH 4JFYB 5ISZE 3D48R 3DLQR 2FEEL 1UUSA 4F58H 1UYWL 3HS0C 3VGBA 2B4CC 1DE4A 2W81C 2WC7A 4OJYA 4ZW8A 1KJ2L 3T6WA 5I15H 1QZ1A 2FATH 3L3GB 2V5RA 4TPRH 1BPLB 2WO3B 2Z4TA 3QCTL 4OGXH 2ZCLH 5CP3A 4E42A 1IM9A 1Q4NX 4XN7A 2DMKA 2EH8L 2IPUK 4PJCF 1U2HA 5ECGA 1KTKE 2IVFC 3IT8D 3MRJA 4KRPB 4RAHA 3KGSA 1I85A 2Z93A 5KUMA 4BFRA 3TESA 4XB3A 1TU2A 5EF2A 1HOCB 3B3BA 2YFOA 4ZS6D 3KPQA 4KHXL 4UAOC 4CAGA 3JXAA 5L4IA 2VM9A 3FNKA 3KW8A 2KLSA 3JYBA 4OF7A 4WY7H 5L0QC 5EOCJ 5T1KB 2FECI 5FGBC 3FW6A 3MODH 2UY6B 4ELKA 1NWOA 4HF5L 5JORB 1UWYA 2X9XA 3D6GA 4Y1TA 4NNXB 2DS4A 2FH8A 5TF1L 5JA9A 4POUB 4LO9A 4YMPA 4I87A 4ZFOB 4P05A 3IDIB 4WEBL 2E8YA 2P48B 3FSVA 4LL9A 4KUCD 4XBEH 2VW7A 1H3UA 3ULUE 3P1VA 3FTGA 5DSCB 1H8OA 4N8CH 4DO5A 5MEQA 2X1OA 4JY4A 3V8CA 4RGMC 3BUYA 2VERA 2Y36H 3MXVH 3BAKA 3H3KA 1PZAA 3QQ3A 4ZTOL 5J9PA 4XO3A 1M7IB 3SKNA 4I0KA 3QRLA 3BT2H 1QBBA 3CDYA 2B1HH 2DQHL 5FDWA 1YJDH 4XO4A 1JWUB 3E38A 3V4VL 4DK5A 5DD1L 3RTQA 5I71B 3L17A 3EH4B 3CZEA 4PP1D 3ISWA 2C7FA 2V37A 4OLUL 3BD5A 3SZKC 3KBHE 3MTRA 2HFEA 3O3DB 4R97C 4IU2A 2ICES 4PJDB 4PSPA 4QRBA 3BT0A 1Q90A 2F68X 3PABB 1A5FH 1TVHB 2JB5H 4FABH 1DQKA 4LSRH 1WD8A 5F7KC 4L5FE 3RDTA 5KBMA 1SHWA 2APTA 2NY3C 3EHBD 3RUGE 1PG7L 3A47A 3APMA 4U3HA 3H2PA 2CO4A 1TENA 1LK2B 1V05A 2IFFH 1OY3B 2CBMA 4KXZH 1M53A 3FQRA 2X6UA 1M6UA 2MOQA 2ZSVA 4F5CA 2YQGA 2XRAL 1URZA 2FZ3A 4OCRL 1E43A 3NFSL 2P28B 2BNRA 4YDVB 1J86A 3Q2CA 1FFOB 2NYZA 3O41B 2VERN 5F21B 3GZOA 4ZT1A 3HE7C 4Y2DD 2XQYG 3ZE0F 2VLKA 1MFVA 12E8H 1V27A 2WN2A 1WFTA 3II2A 5DD3H 1N5AB 1EAJA 1S3KH 1W8NA 5LAXA 5LNDA 3UTSE 1FN4A 3V7MA 4RESB 2QQQA 4PP2B 1ZTXH 1V5JA 1AY1L 4MMXB 4NUJB 5DFWH 2NTFA 3BOVA 1OTTC 2Y6TE 3H7BA 5IIEB 1DLHB 2PW1A 3R06A 1IAOA 2ZP8A 3DX9A 1EEYA 3UTPE 3GM8A 1VEOA 4ZFGH 1YCSA 4IOFD 1RV6X 5E6IB 3RVVD 3FOMA 4FQXC 3FCTB 4MJIB 4YFDB 4YVUA 3VD2A 2XTLA 1RURH 4NHCL 4A7GF 2HX9A 2YSSA 4AYSA 5SWQB 1IBGH 1YRKA 1HEJC 2LVCA 4IRSD 2IJ0C 4NWUL 3UP1A 1MLBA 1FHGA 1JI1A 4AE0A 3GBEA 5IB2B 4PMEA 2FT8A 3I50L 1M57B 1TYJA 4FADA 4XOEA 4YFEA 2N7BA 4K7PH 4PW4A 1U4FA 3CXFA 4LARL 1ASQA 4WV1B 3UBFA 3B2XA 3B2DC 2ZWNA 5FUCC 5IW6A 1E9PA 1A4BA 2HRPL 4XCYB 5ICYB 4GKZA 4FXGC 1CE6A 1OGPA 3H8NA 3QI9A 4ORGA 4K9JA 5T1JA 3OGCA 4GKLA 1KLUA 1D5ZA 2CA4A 2XNAB 3DK2A 2V5TA 3KPLA 3QJQB 4IKLA 4Z7UE 4V1DD 2W0FB 3IJSB 2F2HA 3MLTA 5HI4D 4KROD 1UYWH 2ZUQB 5FKPB 4AGMA 1KJ2H 4PEEA 1SY6A 4IOIA 4B9PA 3GT6A 2W0KA 5JXEA 3QCTH 4FE9A 2JIXD 3C6LC 3EJZC 4PGEB 3MO1A 5J5EA 4UQCA 4ZMWA 1BQHG 4JQXC 1SMOA 1JUFA 3SGEI 2AQNA 3ISYA 2C9XA 3DV4B 4FMKA 2B77A 4KHXH 1ET5A 4FMVA 4JO4H 3GBNH 3H2WA 4GAAA 1I1FA 2V2XB 3QISA 1S9YB 5C08B 3E6HA 2YWYA 4NQDB 1UT9A 1UATA 3LJ3A 1MFAL 4PB0L 4WTQA 5FGSA 2UUDH 1ZA6A 1LJMA 3IDJA 4JGUA 3MNDA 3P9LA 1YEDA 4KAQL 5IHBA 2KLRA 2G5BA 3ARWA 3M45A 3VFMA 5ABZA 4HQQL 4FNLL 1BJ1J 2VC2L 5TH2A 1UB5B 3DSNA 4Y1AD 2F9BT 1B4RA 4JNXA 1A7OL 4A55A 2NW3A 3IMBA 4K7FB 4M7LL 3WTWA 1RZGB 2J73A 3MRPB 2VDKB 1A7QH 2V9TA 4X7TB 4JRYA 3S4SG 1P4IL 4PJAA 5AKVA 4KZDH 4J39A 5IOPA 4FLOA 2HJLA 4ZTOH 1LXMA 4YHZH 3FO2B 2CR0A 4JKKA 2WLHA 4KNUA 2EXWC 4U1SB 2DQHH 3DK0A 5GZOD 5GS1C 3V4VH 5DS8A 2FJSA 2QL1A 5E8NB 4TUUA 3VFSA 4ES8A 2A4ZA 3H1ZA 5EOTA 5HHPA 4NYLB 5FA3B 2J5LC 2TRHA 4ZTPL 5A2LH 4Y89A 3T77B 4M6AA 4B7IA 5JW4M 3HG1A 1WAAE 5DHVB 4PJDE 3CZSA 4WWID 3L3IB 4DZ8B 3IKCA 2BCKA 9CGTA 2WWMD 3VGGA 1NJ9B 1D9KC 4BKSC 3FU7A 2XWXA 3FFDB 5IKCB 4NUMA 1HE8A 3TBTB 4PRDA 2ZX8A 4AYEC 1PG7H 4ZUVB 2FX7L 3EDKA 4QOKD 4YWGL 2DB8A 3S5LB 4NPJA 3Q3GB 3D08A 3GSRB 3EOAA 3HE6C 2WWKT 4FERA 3B3IA 3LN4B 4CMHC 1WO2A 4FNSA 4ZYKA 3CXHJ 4UTCA 1V3LA 4EF3A 2BVQA 5DHYA 4EAEA 2XRAH 3QR0A 3GMOA 1M56B 3NFSH 4OCRH 3V6FB 4TLTA 1PJ9A 1TSHA 5KS9F 4GIOA 3L9RA 2R69H 4F15C 1MVUB 3D1MC 4ZUTB 4DVBA 2VJXA 1XXDC 3WEMA 3IDYB 5IVNA 3BKML 4P5MA 2CXKA 1OPOA 4R0LC 4FNTA 1U3HA 3U0PA 2X88A 1KN4L 3U36A 1AY1H 4WAFA 5C8JA 1NSNL 4RVBA 4HUCA 1URLA 5CKAA 4U3CA 3K4AA 3IMSA 3MRIA 4CDHA 2EDEA 4M1CC 1S78C 3VI3B 3DGCR 1LQBC 4I9WE 3X14A 1HNYA 4HS8L 3RWDB 1Y07A 2DJSA 4JFFD 3VWKA 4GRLD 1RZ7L 4PV9B 1LNUB 2G2PA 5KVGL 3B7RL 5LBVA 1NGQL 3CFMA 3MOQA 2ED9A 2A6IA 1I53A 2BSRA 4ZW3A 5F1SA 1RSYA 1BM7A 2DYRB 4FEMA 5F3HB 4HIJA 4MXVE 4N2EA 3MX0A 4ECNA 5KVFE 4NWUH 1EBAA 3VXUE 1J0JA 4HJSA 1C7SA 2PF6A 3I50H 3DURB 1Q8MA 5K9QI 3OTTA 3RHWK 5IEHB 4RIRB 2OJZL 4HZLB 1U3JA 1X5FA 2F1BA 3DV6B 1MCIA 1MCFA 5JUEH 5J89A 1N0LA 4ZODA 1CXLA 4XWOD 3GHEL 5F7AA 2DL9A 1NBYA 2VDNL 3KGRA 5E8PA 4DKFL 2QLVB 4G6FD 3VU2A 1VRSA 2CJSA 2CLZA 2OZ4A 4I0PB 3SGKC 4ABWA 1X6LA 5MI0B 3U6RB 4G7SB 1TVBB 5TDPA 2PO6A 5DUBB 1MG2C 3NPZB 1D7DA 4HXAH 1NLBH 3THMH 3RGBA 4XNUH 3GSQB 5HGHB 3N1GC 2YGPA 3P9MA 1S7VB 4Y0GA 1KB3A 1MREL 1QLRB 4E9LA 5IQLA 1JV5A 3G9VA 5LGKA 5I23A 1JGUL 2F8VA 2W9LA 2I5YL 2V6HA 1QLFB 3S37X 1QP1A 4L1SA 3UZEA 2OV0A 2I07A 2W9DH 4AMWA 1S3RA 2H32B 2ZKXA 4R8WL 5L4FA 3WHXA 3NIDE 3CVBA 4Y8AA 4NPYA 1F11A 5C08E 4NQEB 4NQDE 5MENA 2XN9E 1DFBL 5FS5A 2DKSA 2PLTA 3QJXA 1JSYA 3G5ZB 3DSFL 2X4OA 4PB0H 1U21A 1LP9F 2DYPA 2J43A 4KAQH 4Q58C 3SGJC 5C0CA 2N56A 2J6EL 4HQQH 4FNLH 2VC2H 4QR7A 2JELH 2XCMC 4EO5A 3QA3B 3FMGL 4LLQB 5C09B 1DBKL 1YAZA 2AJXL 1UWFA 1A7OH 4KVCH 1FG9C 3F83A 3EFOB 4M7LH 3OLDA 2J8HA 1Q9WB 3CFCL 4JHAL 3ARDD 3LKQA 2HJFA 3VFVA 1P4IH 1JPFB 1KGYE 5GHWH 2GJJA 3O3BA 1HVXA 1KZYA 2VDQB 2X1XR 1SJEA 1K6QH 3ME0B 1R3KA 5I0YA 2PPDA 3K71A 1A66A 5F1NB 2IQ9L 2BY2A 3GTVA 3MRDA 4E41A 2JNZA 1YN6A 1OSEA 1GHFL 3DRTA 3UERA 1IGML 1SDDB 3MLVL 3KYNA 2DBLL 2CBPA 2DLFL 3T04D 3ECUA 1YY9D 2WVSA 1XGZA 5H37A 2RIKA 3GSVA 2A5UA 3RILA 2EC8A 3IWVA 4YDNA 5GGTH 1E7VA 5I1HL 3Q5OA 2EUZA 2X41A 5D5MA 2EO1A 5H35B 4HFWA 2ADGA 2HKFH 1XAUA 3O6FA 2WWOA 4GS7B 2YOAA 3KXFB 3U7AA 5ACZB 3K4ZA 2WBJC 4ZFFB 1IEAA 1A9BA 3NJGA 3B7SA 3K2MC 4NFCA 5JHDA 4OLXL 5BOPA 3DJTA 4CVXB 1BOGB 1S7TB 5B22A 2HCZX 2ICCA 3HC3L 3IGAA 5SV4A 4ONHB 4W6WB 1U95A 4OCSL 3UMNA 1YECL 4NUPA 5KAQG 2OSXA 1JP5A 1XH0A 5CD3B 1H9VA 1LEKA 3TBSB 1G87A 1RH8A 2F54D 4MMZC 4U1MB 2Z8VC 1ZHLA 1MCOL 3T6VA 4CC4C 3BKMH 1NANH 3ECVA 1O6TA 4OLZL 1FO0A 1EZVY 1YVLA 2GIMA 3TGXA 4P06A 5F0JB 4CKQA 5IROA 2E59A 5DZPA 5HTSA 1NSNH 3MR9A 1P7HL 2Y07L 4A2LA 1E28B 3KM2A 1G5AA 1HI6A 4QLWA 5AW9B 3DIDA 1NEZA 1BHGA 2X6VA 4OH2A 3MREB 4LOUC 4HS8H 3IETA 3H4FA 4WO4D 3US1A 2AXHA 2HG0A 1CGYA 5EEXA 1RZ7H 4EIBA 4E9TA 3NT0A 4M5SA 5C7ZA 5KVGH 1T89C 3D85D 3NCMA 4U1NA 4X6CB 4EIZC 3K6SA 2J8UF 2UZIL 2ZAHA 4DJMA 1HXKA 3IM1A 3IGUA 2R56L 2MWCA 3TF7C 5F7DB 3QEQA 3U2SB 2ARJB 1A6TA 1JN6B 4PJGA 5DTFB 2ZONA 3DYOA 3PXJA 2FR4B 4JJHA 4FMFA 1KV7A 1T7XA 5D4QA 1UCBL 1E6JL 1M05B 1OSZA 4J6RH 5G4OA 1Z32X 1I8UA 2APXA 2AXGA 2E5EA 2GTWA 2OJZH 4OLVL 5B39A 1FFQA 2ICWJ 1ZHKB 3LH2L 4OU3A 5GXBB 1K8DB 3GHEH 4IYKA 3LZPA 4UV7H 3TN0D 2VDNH 4FFZL 3QBTB 4DKFH 1B6UA 4F7CA 2FSEB 3TBWA 4LKXA 2HLFD 5CD5D 4NIYE 2VLRB 5E94B 5HVGB 3VMPA 1JZGA 3H42L 2XYBA 1N12A 4AGQA 1HIML 5JOEA 1TQCC 2X40A 2ZNXA 2BIMA 2X53A 4FI6A 4PJHA 2X70A 4GSDL 4PJEB 4Y19B 4YZFF 5LBSL 4NRZB 4IIQC 2B9BA 1UURA 4K55A 3OJDB 3CFBA 2PYEE 4K9EL 2R9HC 1F3RB 1KIUA 2FO4A 3AITA 1A4JA 3EO1A 4Z7QF 4KRMB 1ZLVK 3ZL4L 4NXSA 1X5JA 1JGUH 5DEGB 1F1GA 5JMRA 3M86A 3RWGB 4F33A 4B3EA 3MCYA 1KSRA 4R8WH 3MTXA 2LABA 1F6AA 3U79A 3VD3A 4XNQB 4NQEE 5L0QB 5DWPA 2OP4L 1OEZW 3D30A 2BPBA 2CIIB 3CLWA 4TYUA 2W38A 3DSFH 3GSXB 3QFJD 2GC4C 2X89D 2ZUVA 3CVHA 4K71C 4RMQA 4U6TA 2VQUA 3I6GB 3SY6A 1BQ5A 2J6EH 3NIFB 1O7DE 2GAZB 2H0PA 1DBKH 4WUKL 1T0NB 3ZL1A 4RCAA 5D7IA 4JG0L 1QEWA 1CL7I 2YA1A 4JFDA 3LB6C 1R5VB 4IBUA 3CFCH 2EE3A 2FWOB 4M1GL 4CNIA 4MA1C 5CJXC 1AKPA 3QZWG 2OSLB 2WYIA 2Z31A 5F9AC 3WAKA 1PY4A 4GAFB 3VRIA 3WHE0 3QUXA 4QXVA 2YK1H 3Q44A 3P02A 5AWNL 2OR8A 5GS3A 4LP5A 4NO0D 1OF2A 4HJUA 1T1YB 1AIFB 1T22B 3AS1A 2IQ9H 4OUUA 4IGBA 1IBFA 1VIWA 1P69B 4BFKA 3TL5A 4GQPH 4K94C 3DIFB 3D8MA 1IGMH 3P73B 5EC2B 5EC1A 1FI8C 2DBLH 2H41A 5BQ7A 1MRCH 2DLFH 2Y5QA 1KGCE 2NQ3A 1VCAA 2DMGA 1JDDA 1HCVA 3MQIA 2ZXGA 3NZ8A 3QAZC 4R97B 4C59B 3FSZA 4ZS6C 3NQIA 3FKUS 5IQ9A 1NC2D 1W6LA 3BVNB 5IK3A 4NKMB 4QHNA 5I66B 4DGYL 3ZDWA 1EAQA 1MW3A 5TDNA 3VQ2C 4PRPB 4F9PC 3W39A 4BZ1H 4UTAA 3KXFE 4OJAA 2RALA 3INUH 5EEUA 3L2MA 3RFZB 1B4JL 3GINA 4WWKA 1XB6A 3V7AE 4RFNC 1RPUA 2WM0A 3IJ8A 4Z23A 1LEGB 4ENEC 3A6BL 4W9EC 4AIXA 2KI6A 2NY2D 3JWNC 3O3AA 4HMCA 3OHXC 5EO9B 4NFBA 3RX9A 2BSTB 3HC3H 15C8L 2JXMA 5DHDA 3X1FA 4W9LC 4C56D 1KJ3L 1YECH 4GG6F 3GSWB 2QSVA 3MLUH 3BKCL 4NM8H 3Q8BA 4FA6A 4PWJA 5GGSB 4X6DB 3ESMA 4YDKL 1NGYA 5D1ZI 3GSOB 3TH4T 1JVOA 1WT5C 1N5YH 1BIHA 2MKLC 5EZPA 5DMGD 4TKWA 3MUY1 3GXDA 2Y07H 4K23L 5EU6D 1LDPL 4G59C 4L3EB 4PP1C 5EBMB