The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
99
|
structure length |
99
|
Chain Sequence |
ATVTVTFTITELCLRTGVSEEELTEIVGLGMIEPHQPQADTWLFDDSAVTIVHRAVRLRNELELDWPGIAVALTLLDENARLTRENRLLQQRLARFLAH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the complex between CbpA J-domain and CbpM provides a link between chaperone and transcription regulation in bacterial heat shock response
rcsb |
molecule tags |
Chaperone
|
source organism |
Klebsiella pneumoniae
|
molecule keywords |
Chaperone-modulator protein CbpM
|
total genus |
36
|
structure length |
99
|
sequence length |
99
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-10-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13591 | MerR_2 | MerR HTH family regulatory protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 | Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 |
#chains in the Genus database with same CATH superfamily 4R22 B; 1Q09 A; 3D71 A; 1Q08 A; 4J2N A; 3D70 A; 2ZHG A; 1R8D A; 1Q06 A; 2JML A; 3UCS A; 1JBG A; 2DG6 A; 3HH0 A; 3Q1M A; 4R4E A; 3Q2Y A; 2VZ4 A; 5E01 A; 3Q3D A; 3IAO A; 3D6Y A; 1EXJ A; 1Q07 A; 3Q5S A; 5D8C A; 4R24 B; 3QAO A; 5D90 A; 1Q05 A; 3D6Z A; 5I44 A; 1R8E A; 4WLW A; 5I41 B; 3Q5P A; 3GPV A; 3GP4 A; 3Q5R A; 2ZHH A; 4WLS A; 1EXI A; 1Q0A A; #chains in the Genus database with same CATH topology 4R22 B; 3EZ2 A; 1Q09 A; 3D71 A; 1Q08 A; 3EZ6 A; 4J2N A; 3D70 A; 2OG0 A; 2ZHG A; 1Y6U A; 4WLS A; 1R8D A; 1Q06 A; 2JML A; 3EZ9 A; 3UCS A; 1JBG A; 2DG6 A; 3EZ7 A; 3HH0 A; 3Q1M A; 1RH6 A; 4R4E A; 3Q2Y A; 2VZ4 A; 5E01 A; 3Q3D A; 3IAO A; 1LX8 A; 1PM6 A; 3D6Y A; 1EXJ A; 1Q07 A; 3Q5S A; 5D8C A; 4R24 B; 3QAO A; 1Q05 A; 5D90 A; 3D6Z A; 5I44 A; 1R8E A; 2KVV A; 2IEF A; 4WLW A; 3EZF A; 5I41 B; 4DCZ A; 3Q5P A; 3GPV A; 3GP4 A; 3Q5R A; 2ZHH A; 4LHF A; 1EXI A; 1Q0A A; #chains in the Genus database with same CATH homology 4R22 B; 3EZ2 A; 1Q09 A; 3D71 A; 1Q08 A; 3EZ6 A; 4J2N A; 3D70 A; 2OG0 A; 2ZHG A; 1Y6U A; 4WLS A; 1R8D A; 1Q06 A; 2JML A; 3EZ9 A; 3UCS A; 1JBG A; 2DG6 A; 3EZ7 A; 3HH0 A; 3Q1M A; 1RH6 A; 4R4E A; 3Q2Y A; 2VZ4 A; 5E01 A; 3Q3D A; 3IAO A; 1LX8 A; 1PM6 A; 3D6Y A; 1EXJ A; 1Q07 A; 3Q5S A; 5D8C A; 4R24 B; 3QAO A; 1Q05 A; 5D90 A; 3D6Z A; 5I44 A; 1R8E A; 2KVV A; 2IEF A; 4WLW A; 3EZF A; 5I41 B; 4DCZ A; 3Q5P A; 3GPV A; 3GP4 A; 3Q5R A; 2ZHH A; 4LHF A; 1EXI A; 1Q0A A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...