3UCSC

Crystal structure of the complex between cbpa j-domain and cbpm
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GSELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between CbpA J-domain and CbpM provides a link between chaperone and transcription regulation in bacterial heat shock response
rcsb
source organism Klebsiella pneumoniae
molecule tags Chaperone
molecule keywords Chaperone-modulator protein CbpM
total genus 25
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3ucsC00
2PF4E 2GUZA 1XBLA 4RWUA 2YS8A 2Y4UA 2Y4TA 2QSAA 1FAFA 2YUAA 2N04A 2OCHA 3AG7A 2CTPA 2CUGA 1BQ0A 2L6LA 2QWNB 4J7ZA 1WJZA 2GUZB 4IT5A 2DMXA 2QWQB 1IURA 4J80A 2QWRB 1BQZA 2CTWA 2KQXA 3APQA 1NZ6A 1GH6A 2QWPB 3BVOA 3APOA 2CTRA 1HDJA 1FPOA 3UO3A 2EJ7A 3UCSC 2QWOB 2M6YA 2CTQA 2DN9A 2LO1A 1N4CA 2LGWA 3UO2A 2N05A
chains in the Genus database with same CATH superfamily
2VRZA 2DYRB 3CC4V 1SS3A 4NTXA 4DR6O 1XQ8A 4H33A 4YJ2A 3QO5A 2X6BA 2OIEA 4HNAB 1V54B 2QR4A 1Q6HA 2P22C 4ICGA 4G27B 1Y76B 4TV8A 3N2KB 4FLVA 1RM1C 1KC8W 1BZKA 3JD1A 2DE0X 3VQWA 2QSAA 1LNQA 1UFIA 3P3NA 1X4TA 4X62O 3FB7C 5GTHZ 3X2QB 1BMFG 2CTRA 1KKCA 1QVGU 2Q68A 1XNRB 2E75B 3RYHB 2LGWA 3W7XA 4K35A 3C3SA 5KMGA 3G71V 4EB6B 1Q8IA 3PN1A 1HNXO 4FLUA 5L3EA 5KA5A 2ZE7A 3OAAG 3CD6V 3I56V 1LUVA 4X8AA 3KCXA 2ZE6A 2BTQA 5K1PA 2JDIG 4ABMA 3JCZA 2RQ6A 1EN6A 2WLNA 3K04A 1AI7A 5KHHA 5TISZ 3ZHQA 4FZ1A 3VQYA 5IJ0B 4LF8B 2Y69C 2N04A 2ZDIC 4J7KA 4B3TO 4FLYA 1GAXA 2Q0OC 1AI4A 4LH6A 5CA3A 1VQ8V 3OW2U 4FLTA 4FPPA 2P5OA 3F7VC 3AG3B 3S3WA 3CRRA 5IDJA 2ZD9A 2UXCO 3K06A 3M99B 3T1HB 2A3QA 3CC2V 1CP9A 2ZR2A 3UT5B 4MS2A 2NN4A 1VQ9V 2ZCEA 2YXHA 1HNXB 2CGOA 1BHAA 3B8MA 4ZHQA 5CMUA 4WFGA 4JI1O 5LYJB 4HYOA 1N34O 3H1JH 3OM3B 4W4KA 5K1XA 1XILA 4JF3A 1P4RA 3ETGA 4J41A 1NKDA 2QWNB 2Q5ZA 1ENVA 1VF6A 3ZRXA 3ZRWB 3LSSA 2UXXA 3O9OA 4FLZA 4WFHA 1JCHA 2JGDB 4DR1O 1QCEA 1AVMA 2IM9A 5E79Z 4PDMA 3SYAA 1RSOA 3G6BA 1I5YA 2MK3A 4JI5O 5JVDB 5KA6A 4NB5A 2BE3A 2DMXA 3K08A 1AP6A 2HFEC 1IBLB 3JYCA 2WLMA 4BR6A 1B06A 1J5EO 1EZJA 5LA6B 4D7SA 2A06H 3CCJV 4P9OA 3IJ4A 3K79A 3FFQA 5EIBD 2BSKB 3JAWA 1OCOB 4GLXA 1H38A 2N74A 3U10A 5LHGA 4DR2O 3CCRV 2O57A 3G80A 3R66A 4JAVA 1PPJH 3TXSA 1MOFA 4DV0O 1HNZO 2HVKC 2QWOB 2AW9A 5JQGA 2QM7A 1KU9A 2JEUA 4X20A 3TCUA 2YIBD 2F93B 5LXTB 4RWUA 4Z1MG 4IYHA 1GM7A 3CC7V 1K92A 4I0XA 4KHPO 2YIBA 1R6NA 1M93A 4UB8Z 1VQ7V 1I94O 2IJJA 5AG2A 3CPWU 3D3QA 4CH4A 3WB1A 1H2MA 4PI0A 3CMEV 3UCSC 4B3MO 4DO2A 4X88A 3CRMA 4I55B 4CH5A 2G38A 1IBKO 1MABG 1IVSA 5EK0A 4EEQA 1ZLZA 1JFFB 1DF5A 2XAGA 2BOBC 1VQPV 4TT3G 4Z2WA 3N2KA 1Q7YW 5KHGA 2Q9LA 3ABTA 3G67A 1KP2A 1YZBA 3JATB 4Z1VA 4I0XB 4HNAA 3ML0A 3K5MA 4EB6A 2YIAA 4B3TB 3OT7A 3CP1A 4R50A 4PV1B 1SC5B 4LC1A 2N05A 3D36C 4DV3B 1NBMG 3MAQA 2QM8A 4JI2B 3HKBA 2PGGA 1QBZA 1KBHA 3Q4HB 3H1HH 3BHPA 2RCVA 1YDXA 4TUYB 3A2FA 5BR8B 1FS0G 3ZRSA 3FB5C 1WPBA 3N2GA 4IIJA 1Q3EA 4O2AB 2BSKA 1VF6C 2GBOA 4O4IB 1GTOA 1WP7A 3BEHA 5B3SC 1GRJA 1ZAUA 3ZHVA 4JASA 1CXZB 2FMLA 5IYZB 1M5IA 3LNNA 4AILC 1Q86W 3TETA 5JJNB 1QLNA 5LBQA 1SQGA 1G1XB 1V55C 1HR0O 1FFTB 1AJNA 4QIWF 2ZIOA 2ZT9B 1VP7A 4LNUA 3C90A 2EX3A 4K8XA 3LNMB 1F4MA 1BGYH 3J7AU 1NT2B 4MTGA 4BW5A 3RYFA 1QQCA 1F7YA 3ZRWA 4PA4A 1EN4A 2WLIA 4TQDA 1N33O 2Q8VA 2ZQMA 3SDLA 1NR1A 3OUFA 4LF4O 2ZKOA 3KZIZ 1VQMV 3I5DA 2IJKA 1H2GA 2H8PC 2JRIA 3JAKB 4O2BA 3OGIB 4RQFA 1OCRB 2V1DA 2DN9A 4B3SB 2LO1A 1RPRA 1OCCC 2P4VA 4DR1B 2UUAO 4PA7A 5KHIA 3SYOA 1Z2GA 2MW2B 1RFYA 3JD0A 4TSFG 3W7UA 1K9MW 3N2GB 1SQFA 1TA8A 2UUAB 1P7GA 4YXWG 5B66Z 4DV3O 5IY5C 3BVOA 4QJFB 2YIDA 4I9QA 2ZE8A 1IXMA 4YIPA 4MT8A 3FYEB 2WLLA 4WFAV 1SQVH 1URFA 4JYBA 1H8HG 5JJEB 1IURA 2HG5C 5B1BB 1G8MA 5LMNO 1WP8A 4FFBA 2QKCA 1RM1B 2LFRA 2LP7A 5BY1A 2JEXA 4B3RB 5LXTA 4X65O 2DWEC 3KCYA 3D36A 2IU3A 1Y4MA 2B9ZA 1LR1A 1Y74B 5EC1C 1A32A 2YDEA 4PDRA 2R9AA 4J80A 3APQA 1D5AA 2JS3A 4TV9A 3WB2A 2WA4A 5JVDA 1EBOA 1T5EA 4YY3O 3AG1C 5EYPB 5D5PA 1GM9A 1K5SA 4DUYB 5C8YB 1PNKA 1QR8A 5LMUB 1PD3A 4GKJO 3K5OA 1TVKA 4I9WA 3B4SA 3K3WA 4WFBV 5KAIZ 4GKKO 3HKEA 1BQZA 4GX2A 2A7WA 2ZM6O 5H9CA 4YJ2B 2WSSG 2F43G 4XDJA 3A0BZ 4MVQA 2OCHA 4E4EA 1YEWA 1YCIA 3K03A 2EIMC 1XUQA 1K4DC 5LGTA 5LOVA 2JJ1G 4DR7O 3T2MA 4UCVA 1XEQA 1KB9F 3RYCA 5CB4B 3CMAV 4G2KA 5IYZA 4F6EA 3AK1A 3P3PA 1L1FA 4MTFA 1J5EB 4JI4B 4I4TA 1OCRC 4D6TH 2OTJV 1BE3H 2UU9O 5EZYA 2XAQA 4PJ0Z 1BQ0A 2QM4A 2BTOA 3RYIB 3B77A 1HNZB 5LGUA 3CCQV 3ETDA 5IYBO 4MW3A 1YI2V 2XAJA 1R1BA 2AHZA 1I5XA 2ODMA 1S5JA 4MTOA 3CYOA 5KLVH 4K0KO 5KX5B 3TK1A 4R6ZA 1JA8A 2VQEO 3E8HA 1TUBB 1JJ2U 3VOUA 5JWPA 2CAZC 3RYCB 4GKKB 1U97A 2DWDC 1G4YB 2UUBO 3ZN0A 4JYCA 2EULA 3DC5A 2AXTZ 3WB0A 2Y4TA 3A8TA 3B09A 2VQFB 4EFEA 1IBKB 4X9QA 4N23A 4FK5C 3EVKA 4LFBO 5CBFA 1XDCA 1WAZA 5GW7A 4PI2A 3WU2Z 4J11A 2EBOA 4GX0A 2PI4A 4UCUA 4WF9V 2EZPA 3JCUZ 1B04A 3OR7C 3HKCA 3ABMB 2YC0A 2XHBA 1XMQB 1PNMA 1FJGO 5BR8O 3FKSG 3JSLA 2CTWA 2OTLV 2EIKC 2WAMA 4FM2A 1BT8A 3STLC 1WA8A 4JV5O 4LWSA 3DC6A 1GM8A 2X0LA 1XOUA 2FL4A 3CCSV 2F23A 4F4LA 2R70A 3U0ZA 1FXVA 2K1EA 1OCOC 1NTMH 1EZVH 4MW8A 2KSDA 3SJCC 3WG7C 3ZBHA 1R73A 5IYDO 1I94B 5EIBC 4UB6Z 2W0FC 3JASA 1GH6A 1JJOA 5JCOC 2ZXWB 4NXNB 3ZCCA 4X89A 4DK1A 2F4VO 1GMGA 4LFCB 4IHJA 1SQBH 1LUWA 2KB1A 5IWAB 1JMKC 1AROP 4JTDB 2GUZB 4UVBA 4DRXB 4JTAB 3SYCA 4JPRA 1K34A 3UO3A 3H1KH 4TUYA 2P4KA 1Z5WA 4GZRB 4X64B 4CZZA 1M56B 1FFXA 1OCZC 2DOSA 3LSQA 3SJBC 3ZS8C 2DYSB 3GVMA 3JAWB 4ZBMA 1K97A 5LL6Y 1NS1A 1MZEA 3L9DA 2YEVB 5LA6A 1IX9A 2CDYA 4JI7O 4GT1A 4LF6O 2M6YA 4DXWA 4XBFA 1WLEA 2OCCC 4BIOA 4I50A 4UUJC 1Q81W 2GV9A 1SQXH 3FYIB 2YSUB 2OWOA 5L3BA 3ZHTA 1TVKB 4ZOLB 2ARHA 3N27A 1M90W 1N32O 5IYCO 2RMKB 4WBNA 3ZEDA 1EN5A 2KQXA 2UXDO 3ZMSA 1PL4A 1H8EG 5CBHA 2JGUA 2XOKG 2YUAA 2IH1C 2VWJA 1X59A 3K5NA 1KUQA 3HB3B 4YY3B 3H1IH 1CEZA 1TAEA 4N21A 5E1AC 3L70H 3AG3C 3D3IA 3I55V 4NR1A 5LMUO 3SR2C 4IIJB 2UXBB 5B1NA 1FFXB 1PM9A 4I5SA 4LF6B 2E74B 2P90A 3LDCA 4HBNA 4KP4A 3RYHA 3K58A 1ZTEA 4GUNA 2EIMB 4K3AA 4ASUG 1YJ9V 1BL8A 3T4DA 1WNSA 1VQ6V 2ZINA 3RWRD 4DR4O 5DEDA 1V54C 1VQLV 1L0LH 4MSWC 3K59A 5F2VO 1K4CC 2PYLA 1M1KW 1HP8A 2ADPA 2F1MA 3T1HO 5LMNB 2CH7A 1AR4A 2E3CA 1KMIZ 5KHKA 1FXKC 2W0XA 4FIPC 1AJQA 5IY5B 2D3OW 4NTWA 2HEPA 3CHXA 4UVCA 2ZDIA 1MA1A 3E8BA 3CCEV 1XHZA 2P7TC 1MMMA 2YI9A 1QNMA 3QG5A 3CCUV 4I7ZB 4OPHA 1IXBA 3UQ8A 1FAFA 1PL0A 1ZX3A 3FX7A 3T4ZA 3K0GA 4O4LB 2LFSA 1M57B 2FKXA 2GTSA 5CA1B 3CJHB 1F23A 4K0KB 1JVMA 1YITV 3IAYA 4OGQB 2H94A 4LNUB 3CX5F 1I08A 3DXRA 3PJSK 1DLBA 2F66C 4DK0A 2HJFC 1CPYA 4DV5B 4MVZA 1ZUQA 5LP6A 2ADQB 3LUTB 3HR0A 4O2BB 4YJ3A 4DW0A 2PYJA 2WLKA 2QTSA 3QO7A 4ZIBA 1VF5B 1L0NH 2A79B 4GCZA 4DW1A 4KUMA 4BIUA 4F6RB 1SKVA 2V7QG 3AEIA 3UKMA 3KG2A 4K8ZA 3F5WC 2RN9A 4KL1A 2Y0PA 5LGNA 5CB4A 4DV0B 2OT5A 2YI8A 3OGCC 2Q67A 2Z0AA 4DRXA 3R65A 5EBWC 4DR6B 1Q82W 3ASNC 3G4SV 5BMVB 2YS8A 2QDOA 2HHHO 1E79G 3CWBH 4DV4B 1FYJA 4DR3B 3SYQA 1XI1A 1XREA 3SPGA 4ZKIA 4IT5A 1IBMB 2QWPB 2ZR3A 2Z5UA 1GN6A 3X2QC 1PP9H 4GX5A 5FNVB 1GK9A 2PTMA 4FJCC 4U7OA 3CRAA 4KXRA 4E2LA 1N34B 5BZBA 5GONA 2NR5A 1N33B 3ABMC 4JV5B 2QTOA 1S0VA 2ZNIA 2DQ0A 4X65B 5FL7G 2GDSA 5L3CA 1Y6XA 1YXBA 4XDKA 5A2QN 2UXBO 5H2FZ 3CCLV 3CSXA 3SGIA 3OMAB 4BIZA 5D5QA 3K5LA 4U7NA 2PI5A 4B7KA 1R3LC 2EJ7A 1NR7A 4AI8A 3ZMTA 4O4HA 3JALB 1Q43A 4OPAA 1YSCA 3IC7A 5C93A 3RT3C 1NVPD 5IWAO 1OCZB 3ASNB 3T1YO 4JI7B 4LWSB 2E5LB 5L3GA 3OTOB 1FXKB 2LGQA 3ASOB 1SF9A 1XNRO 5H6QA 1COWG 2HP8A 3OE7G 2YXYA 3FD9A 3BRCA 4PDVA 5JH7B 1SA0A 1L8DA 1M4UA 2X6AA 2P6JA 1PNLA 4RUFA 3QO8A 2Y4UA 3JALA 4BW9A 4FMTA 2H3OA 4TV9B 5KMGB 1Q6IA 1WJZA 3OD4A 5LHIA 1P49A 3B40A 2Q0AA 5ITZA 2ZIMA 2KKWA 2Q69A 5DN6G 2Z3YA 1N0NA 1VF7A 2XTAA 4DR5B 2JGDA 2EINB 1VQOV 1H2NA 3STZC 2Q7GA 3ZJZA 4DV2O 5CA0B 3H9VA 4QPJA 3ZMVA 1U96A 3MHHC 3THOA 4KFMA 4QNHB 4LH7A 3EHBB 4YIOA 1NI8A 2E5LO 2DYRC 2AZ2A 2Q7HA 1VARA 4OXSA 1VQ5V 5KX5A 5LYJA 1K8AW 2V4DA 1W59A 3S3XA 4GKJB 2VQFO 3B2EE 2D2CB 1AB3A 4JGSA 2RJZA 4TWKA 4LF7B 1UJWB 2X6CA 4FLXA 4ZI7A 3VQXA 1E1QG 4YHHO 2VS0A 4IYIA 3JD3A 4JI8B 4UXNA 1AP5A 4PDLA 2WLJA 2CK3G 4EKWA 3MD0A 3WG7B 1AR1B 1XMOO 4X1KA 4YJ3B 1OZ0A 2ITCC 4LF8O 4HZ3A 3CCMV 1QU7A 4RQEA 1NVPB 3SPCA 3JD4A 1N36B 2DQ3A 1P84F 5FPRA 3SPJA 4B7EA 5CA0A 1R6KA 4X1YB 1XMOB 5IT9N 4X66B 1YHQV 4IHJB 4LBEC 1XBLA 4O4JA 1XNQB 1P7BA 1Y67A 4UCTA 1H2LA 3ABKC 1YTFD 4P9PA 2WWWA 5HFMA 4PA3A 3LSUA 3EXAA 2CE4A 2XNDG 3ABKB 4UV8A 1Y66A 3E22B 5DM6V 1XHXA 4JI2O 1XNQO 3BPZA 3IGAC 1SQPH 1N0JA 4B3RO 2B1GA 4JZ2A 2LJ2A 1HW7A 5B3SB 2QEXV 2PUSA 4DUZO 4QPKA 4CS2A 3K9SA 1YJNV 1NQTA 1FD9A 1ROPA 4UV9A 4J10A 3L75H 1YTFB 4X62B 4X1IA 2PF4E 1PV0A 1OV9A 3JAKA 4JI8O 2VWKA 4AHCA 5LHHA 2JK5C 2A9HA 3E22A 4J7ZA 5JCOA 1GN2A 3QTCA 4X20B 1S5LZ 4C7UA 4NYKA 4MVOA 1THZA 2IBZH 4JTCB 3OEEG 1WB7A 1DK1A 4I55A 1AJPA 4P2ZA 3B8NA 3U11A 3E8FA 1MSWD 4F6RA 1VEWA 5H5NA 3GWOA 4J7JA 4IGGA 1K3EA 3K0DA 2QWRB 3C3TA 3A0HZ 3W7SA 3F7YC 4TV8B 3SYPA 4CC5A 1Z5VA 5J2UA 4TOIA 3CXHF 4LFBB 2XUMA 5BMVA 2GHYA 1KQSU 4PELA 2W6JG 1DGSA 4DV4O 2WLIB 3DGEA 4JI3B 3CB2A 5KAFZ 1Q6UA 2L6LA 1R6TA 4JI6O 2ZE5A 3ZX6A 1K5QA 1KP3A 3M7MX 3CXCU 3Q4HA 3RGBA 1SZTA 2UU9B 4DV2B 5B1AB 5B1BC 3RVZA 3NXSA 1XL6A 1RPOA 2R72A 3BA8A 2NNUA 2GUZA 4LFAB 1O9HA 1ZL8A 3J81N 1JPXA 5EC2C 2PY5A 5JJJB 1WB8A 3FAVB 2LW7A 3AG2C 1NJIW 4JYAB 3L72H 2EJRA 2WA3A 4PA6A 2B1IA 4DYLA 1RSOB 1AILA 2LW1A 1V9PA 1NTKH 2C2AA 1S5HC 1YF2A 1K7DA 4QE7A 3F5TA 4FZ0A 4CS4A 4WCEV 2AHYA 1IBLO 3JSNA 2ETNA 1RP3B 5B5EZ 1MSDA 4LF5O 5CA1A 4LF7O 3CCVV 5KUMA 3JARB 1D2DA 2Q4PA 3AG1B 2R9RB 4J9YB 3E8GA 1KYOF 1M9NA 4MVUA 5KHJA 3HKEB 1Q5OA 1W0KG 3P30A 3K9AA 3QVNA 5J2TA 1FJGB 2CH7B 4DUYO 4Q6GA 1E1RG 2JIZG 3O65A 4HAMA 1D5NA 3L74H 2ZXWC 2HVJC 2DYSC 1S3JA 2HJDA 3BA9A 4DR4B 5C8YA 2JVDA 1TUEB 3AG7A 3ICXA 1YVWA 3FB8C 3OTFA 4XDLA 4IL6Z 4O4LA 1QLEC 1KKDA 2M7WA 2BCCH 3IFXA 4L87A 5CN0A 3ZRVA 2ZNJA 3L73H 3JD2A 2CTQA 5BXZA 4JI4O 4DR2B 2UXNA 1FXHA 1OHHG 1Y76A 3HKCB 2QKAA 4DV7B 1HNWO 4X1YA 4W4LA 1YIJV 4CBCA 2EIJB 4LF4B 3DSQA 4LCUC 4O4HB 4H0LB 1TUBA 1GN3A 3BFRA 3SPHA 1W0JG 2FYUH 4QGPA 3JARA 5B1OA 3CRCA 4FFBB 3J80N 1VQNV 2ATKC 4UCRA 2UUCO 3OR6C 2NLJC 3OTOO 4MVRA 4DV1B 3MDSA 4DR7B 1GO3F 2LQTA 2Y48A 1AR5A 2Q73A 4J42A 5FNVA 1IZ3A 2YXLA 5LP6C 3T1CA 4MTXA 5IJ9A 5JQGB 1AI5A 3CE2A 3BY6A 4WBNB 5L3FA 2EILB 2R9IA 5J2UB 4X66O 2RNBA 2QGNA 3EFFK 1F51A 4JI5B 2UXCB 3UT5A 3TGUH 2L35A 1N4CA 4RUEA 4DUZB 4JI6B 1I0HA 2DW4A 1MZFA 3A0RA 4PA9A 4JI3O 4NXMO 4DV6O 3RW0A 4J9ZB 1SESA 1HWYA 2WPDG 4WFFA 4DV7O 1HNWB 3RYIA 1N32B 4PD4F 1V55B 4ZHQB 3SPIA 4FVMA 4KHPB 4H13B 2IW5A 1WPXA 3ABLB 4I50B 3W7TA 2IJHA 4U3JA 3UO2A 1M56C 1MG1A 4CC6A 1K73W 2WLHA 1PKXA 2DJVA 4JI0B 4B3MB 5EBMC 5EYPA 1JOYA 3UM7A 2UUCB 2EINC 5CBGA 2RDCA 4LF5B 2E76B 1SRYA 3HKBB 3CJHA 1FKAO 4NVPA 4RO2A 5IJ0A 1VQKV 2HLDG 4L8JA 4CH6A 1H2KA 5DECA 1SA0B 4LR3A 3K57A 4BAYA 4O4JB 4LF9B 4H44B 3IC9A 3JASB 1SQQH 4GYCB 2X7RB 1NH2B 1HDJA 1R3JC 1FPOA 1KECA 1R3KC 2EIJC 1XL4A 3OMNB 2UXDB 4BWAA 4X1KB 1JR9A 3RFRA 4DR5O 3RVYA 5H6RA 5FPOA 2EZOA 4NTYA 4B08A 3VBBA 2BTQB 2ITDC 2IH3C 4AQYB 3M8AA 1GKFA 1HR0B 4CH3A 1VMGA 5GTIZ 1NU1H 4UCOA 3KKYA 2Q6AA 2WLLB 4JAAA 3BABA 2Q7EA 3GB7C 2F4VB 3AK3A 3ETEA 2XAFA 3JAMN 1R3IC 3QF7A 2QE7G 4NXNO 3AG4B 3BCCH 2YICA 1N36O 4YHHB 1SERA 2XAHA 3ZHRA 3APOA 1DF4A 1ZSPA 4UCSA 2FB5A 2IJIA 3T1YB 3NR7A 4GX1A 3LDEA 1SZXA 1Q90D 4OX9B 3W7WA 3ASOC 4WFEA 2Y69B 2OCCB 4LFCO 2B5UA 2QA4V 5FLXN 2A0LA 4R8CA 3VQVA 2HHHB 2KG7B 5J9PC 1VIBA 4D7TA 4LF9O 1BSMA 3HKDB 1JX9A 4OX9O 1IBMO 4U3FH 4MVSA 3CS5A 2XT9A 4DV1O 4O4IA 4DR3O 1M57C 3H1LH 4H37A 5EZYB 2QKSA 1ZWIC 2OYQA 5B1AC 1BCCH 2AGAA 4NKGB 4LP8A 1QHTA 1ZL8B 2BOCC 2HR3A 3SJAC 4O2AA 5ITZB 1KD1W 4JYYA 3RBZA 1B3QA 3H01A 4NXMB 3CRQA 3AG2B 1AI6A 3RN4A 3DXRB 5EBLC 4LFAO 3JATA 2HKOA 4JAUA 1NH2D 3E2EA 1F4NA 1G6UA 4DV5O 1OJHA 3WFVA 5IJ9B 4P30A 5L3DA 1JFFA 3DTUB 5JH7A 4X64O 1I7FA 1WA8B 4RAIA 1N8RW 5KUKA 3E35A 4Q20A 2CGNA 3LDDA 1TGOA 2OIGA 4MVMA 2P67A 3ZHSA 1K33A 3ZMZA 1Y74A 2EIKB 2VQEB 3P32A 2GSMB 4R7CA 5HFLA 4A5UB 2Y0IA 1NTZH 1DTOA 2EILC 1FXKA 3ETQA 1GN4A 1QR9A 3AG4C 2ZM6B 1W2BU 1S72V 1H2SB 2K9PA 1MNGA 3ABUA 4QE9A 1SETA 5J2TB 4B3SO 1US6A 4FM1A 3MHSC 1S77D 2P06A 3OFNG 3ZN1A 2JJ2G 4FFKA 1BHBA 3D8CA 4X1IB 3E86A 4CS3A 2IU0A 1BS3A 2W6IG 3AK2A 4U3JB 1UPGA 3ABLC 1YJWV 4TQFA 3OMIB 1XMQO 3ZIAG 4DV6B 3TJTA 2CUGA 3QNEA 3E89A 1O9GA 3FB6C 2FTKA 2GTAA 2QWQB 4UVAA 1QVFU 1EFRG 4ZOLA 3OEHG 3TXQA 2F95B 1ORQC 2QJ1A 1JQ0A 2AZ0A 1S76D 5A9GA 3SJQC 2ILMA 4I4TB 1IDSA 4JI1B 2CTPA 1QLEB 3GWKC 4G28B 3OUSA 4JYAO 1WN7A 5GONB 1B6QA 4AQYO 2XASA 2YEVA 4JI0O 3G6EV 2JS5A 5LP6B 4FLWA 3L71H 5LOVB 3CEIA 4FM0A 5IE9A 4EFBA 3HKDA 4UFZA 3FAVA 4PHZA 2UUBB 3HPLC 2KG7A 4JZGA 3E83A 1J95A 3BAAA 1NZ6A 1EM1A 3ZMUA 3ZHUA 3RYFB 4ZI7B 1OCCB 2PZSA 1VQ4V
chains in the Genus database with same CATH topology
2PF4E 2GUZA 1XBLA 4RWUA 2YS8A 2Y4UA 2Y4TA 2QSAA 1FAFA 2YUAA 2N04A 2OCHA 3AG7A 2CTPA 2CUGA 1BQ0A 2L6LA 2QWNB 4J7ZA 1WJZA 2GUZB 4IT5A 2DMXA 2QWQB 1IURA 4J80A 2QWRB 1BQZA 2CTWA 2KQXA 3APQA 1NZ6A 1GH6A 2QWPB 3BVOA 3APOA 2CTRA 1HDJA 1FPOA 3UO3A 2EJ7A 3UCSC 2QWOB 2M6YA 2CTQA 2DN9A 2LO1A 1N4CA 2LGWA 3UO2A 2N05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PF4 E;  2GUZ A;  1XBL A;  4RWU A;  2YS8 A;  2Y4U A;  2Y4T A;  2QSA A;  1FAF A;  2YUA A;  2N04 A;  2OCH A;  3AG7 A;  2CTP A;  2CUG A;  1BQ0 A;  2L6L A;  2QWN B;  4J7Z A;  1WJZ A;  2GUZ B;  4IT5 A;  2DMX A;  2QWQ B;  1IUR A;  4J80 A;  2QWR B;  1BQZ A;  2CTW A;  2KQX A;  3APQ A;  1NZ6 A;  1GH6 A;  2QWP B;  3BVO A;  3APO A;  2CTR A;  1HDJ A;  1FPO A;  3UO3 A;  2EJ7 A;  3UCS C;  2QWO B;  2M6Y A;  2CTQ A;  2DN9 A;  2LO1 A;  1N4C A;  2LGW A;  3UO2 A;  2N05 A; 
#chains in the Genus database with same CATH topology
 2VRZ A;  2DYR B;  3CC4 V;  1SS3 A;  4NTX A;  4DR6 O;  1XQ8 A;  4H33 A;  4YJ2 A;  3QO5 A;  2X6B A;  2OIE A;  4HNA B;  1V54 B;  2QR4 A;  1Q6H A;  2P22 C;  4ICG A;  4G27 B;  1Y76 B;  4TV8 A;  3N2K B;  4FLV A;  1RM1 C;  1KC8 W;  1BZK A;  3JD1 A;  2DE0 X;  3VQW A;  2QSA A;  1LNQ A;  1UFI A;  3P3N A;  1X4T A;  4X62 O;  3FB7 C;  5GTH Z;  3X2Q B;  1BMF G;  2CTR A;  1KKC A;  1QVG U;  2Q68 A;  1XNR B;  2E75 B;  3RYH B;  2LGW A;  3W7X A;  4K35 A;  3C3S A;  5KMG A;  3G71 V;  4EB6 B;  1Q8I A;  3PN1 A;  1HNX O;  4FLU A;  5L3E A;  5KA5 A;  2ZE7 A;  3OAA G;  3CD6 V;  3I56 V;  1LUV A;  4X8A A;  3KCX A;  2ZE6 A;  2BTQ A;  5K1P A;  2JDI G;  4ABM A;  3JCZ A;  2RQ6 A;  1EN6 A;  2WLN A;  3K04 A;  1AI7 A;  5KHH A;  5TIS Z;  3ZHQ A;  4FZ1 A;  3VQY A;  5IJ0 B;  4LF8 B;  2Y69 C;  2N04 A;  2ZDI C;  4J7K A;  4B3T O;  4FLY A;  1GAX A;  2Q0O C;  1AI4 A;  4LH6 A;  5CA3 A;  1VQ8 V;  3OW2 U;  4FLT A;  4FPP A;  2P5O A;  3F7V C;  3AG3 B;  3S3W A;  3CRR A;  5IDJ A;  2ZD9 A;  2UXC O;  3K06 A;  3M99 B;  3T1H B;  2A3Q A;  3CC2 V;  1CP9 A;  2ZR2 A;  3UT5 B;  4MS2 A;  2NN4 A;  1VQ9 V;  2ZCE A;  2YXH A;  1HNX B;  2CGO A;  1BHA A;  3B8M A;  4ZHQ A;  5CMU A;  4WFG A;  4JI1 O;  5LYJ B;  4HYO A;  1N34 O;  3H1J H;  3OM3 B;  4W4K A;  5K1X A;  1XIL A;  4JF3 A;  1P4R A;  3ETG A;  4J41 A;  1NKD A;  2QWN B;  2Q5Z A;  1ENV A;  1VF6 A;  3ZRX A;  3ZRW B;  3LSS A;  2UXX A;  3O9O A;  4FLZ A;  4WFH A;  1JCH A;  2JGD B;  4DR1 O;  1QCE A;  1AVM A;  2IM9 A;  5E79 Z;  4PDM A;  3SYA A;  1RSO A;  3G6B A;  1I5Y A;  2MK3 A;  4JI5 O;  5JVD B;  5KA6 A;  4NB5 A;  2BE3 A;  2DMX A;  3K08 A;  1AP6 A;  2HFE C;  1IBL B;  3JYC A;  2WLM A;  4BR6 A;  1B06 A;  1J5E O;  1EZJ A;  5LA6 B;  4D7S A;  2A06 H;  3CCJ V;  4P9O A;  3IJ4 A;  3K79 A;  3FFQ A;  5EIB D;  2BSK B;  3JAW A;  1OCO B;  4GLX A;  1H38 A;  2N74 A;  3U10 A;  5LHG A;  4DR2 O;  3CCR V;  2O57 A;  3G80 A;  3R66 A;  4JAV A;  1PPJ H;  3TXS A;  1MOF A;  4DV0 O;  1HNZ O;  2HVK C;  2QWO B;  2AW9 A;  5JQG A;  2QM7 A;  1KU9 A;  2JEU A;  4X20 A;  3TCU A;  2YIB D;  2F93 B;  5LXT B;  4RWU A;  4Z1M G;  4IYH A;  1GM7 A;  3CC7 V;  1K92 A;  4I0X A;  4KHP O;  2YIB A;  1R6N A;  1M93 A;  4UB8 Z;  1VQ7 V;  1I94 O;  2IJJ A;  5AG2 A;  3CPW U;  3D3Q A;  4CH4 A;  3WB1 A;  1H2M A;  4PI0 A;  3CME V;  3UCS C;  4B3M O;  4DO2 A;  4X88 A;  3CRM A;  4I55 B;  4CH5 A;  2G38 A;  1IBK O;  1MAB G;  1IVS A;  5EK0 A;  4EEQ A;  1ZLZ A;  1JFF B;  1DF5 A;  2XAG A;  2BOB C;  1VQP V;  4TT3 G;  4Z2W A;  3N2K A;  1Q7Y W;  5KHG A;  2Q9L A;  3ABT A;  3G67 A;  1KP2 A;  1YZB A;  3JAT B;  4Z1V A;  4I0X B;  4HNA A;  3ML0 A;  3K5M A;  4EB6 A;  2YIA A;  4B3T B;  3OT7 A;  3CP1 A;  4R50 A;  4PV1 B;  1SC5 B;  4LC1 A;  2N05 A;  3D36 C;  4DV3 B;  1NBM G;  3MAQ A;  2QM8 A;  4JI2 B;  3HKB A;  2PGG A;  1QBZ A;  1KBH A;  3Q4H B;  3H1H H;  3BHP A;  2RCV A;  1YDX A;  4TUY B;  3A2F A;  5BR8 B;  1FS0 G;  3ZRS A;  3FB5 C;  1WPB A;  3N2G A;  4IIJ A;  1Q3E A;  4O2A B;  2BSK A;  1VF6 C;  2GBO A;  4O4I B;  1GTO A;  1WP7 A;  3BEH A;  5B3S C;  1GRJ A;  1ZAU A;  3ZHV A;  4JAS A;  1CXZ B;  2FML A;  5IYZ B;  1M5I A;  3LNN A;  4AIL C;  1Q86 W;  3TET A;  5JJN B;  1QLN A;  5LBQ A;  1SQG A;  1G1X B;  1V55 C;  1HR0 O;  1FFT B;  1AJN A;  4QIW F;  2ZIO A;  2ZT9 B;  1VP7 A;  4LNU A;  3C90 A;  2EX3 A;  4K8X A;  3LNM B;  1F4M A;  1BGY H;  3J7A U;  1NT2 B;  4MTG A;  4BW5 A;  3RYF A;  1QQC A;  1F7Y A;  3ZRW A;  4PA4 A;  1EN4 A;  2WLI A;  4TQD A;  1N33 O;  2Q8V A;  2ZQM A;  3SDL A;  1NR1 A;  3OUF A;  4LF4 O;  2ZKO A;  3KZI Z;  1VQM V;  3I5D A;  2IJK A;  1H2G A;  2H8P C;  2JRI A;  3JAK B;  4O2B A;  3OGI B;  4RQF A;  1OCR B;  2V1D A;  2DN9 A;  4B3S B;  2LO1 A;  1RPR A;  1OCC C;  2P4V A;  4DR1 B;  2UUA O;  4PA7 A;  5KHI A;  3SYO A;  1Z2G A;  2MW2 B;  1RFY A;  3JD0 A;  4TSF G;  3W7U A;  1K9M W;  3N2G B;  1SQF A;  1TA8 A;  2UUA B;  1P7G A;  4YXW G;  5B66 Z;  4DV3 O;  5IY5 C;  3BVO A;  4QJF B;  2YID A;  4I9Q A;  2ZE8 A;  1IXM A;  4YIP A;  4MT8 A;  3FYE B;  2WLL A;  4WFA V;  1SQV H;  1URF A;  4JYB A;  1H8H G;  5JJE B;  1IUR A;  2HG5 C;  5B1B B;  1G8M A;  5LMN O;  1WP8 A;  4FFB A;  2QKC A;  1RM1 B;  2LFR A;  2LP7 A;  5BY1 A;  2JEX A;  4B3R B;  5LXT A;  4X65 O;  2DWE C;  3KCY A;  3D36 A;  2IU3 A;  1Y4M A;  2B9Z A;  1LR1 A;  1Y74 B;  5EC1 C;  1A32 A;  2YDE A;  4PDR A;  2R9A A;  4J80 A;  3APQ A;  1D5A A;  2JS3 A;  4TV9 A;  3WB2 A;  2WA4 A;  5JVD A;  1EBO A;  1T5E A;  4YY3 O;  3AG1 C;  5EYP B;  5D5P A;  1GM9 A;  1K5S A;  4DUY B;  5C8Y B;  1PNK A;  1QR8 A;  5LMU B;  1PD3 A;  4GKJ O;  3K5O A;  1TVK A;  4I9W A;  3B4S A;  3K3W A;  4WFB V;  5KAI Z;  4GKK O;  3HKE A;  1BQZ A;  4GX2 A;  2A7W A;  2ZM6 O;  5H9C A;  4YJ2 B;  2WSS G;  2F43 G;  4XDJ A;  3A0B Z;  4MVQ A;  2OCH A;  4E4E A;  1YEW A;  1YCI A;  3K03 A;  2EIM C;  1XUQ A;  1K4D C;  5LGT A;  5LOV A;  2JJ1 G;  4DR7 O;  3T2M A;  4UCV A;  1XEQ A;  1KB9 F;  3RYC A;  5CB4 B;  3CMA V;  4G2K A;  5IYZ A;  4F6E A;  3AK1 A;  3P3P A;  1L1F A;  4MTF A;  1J5E B;  4JI4 B;  4I4T A;  1OCR C;  4D6T H;  2OTJ V;  1BE3 H;  2UU9 O;  5EZY A;  2XAQ A;  4PJ0 Z;  1BQ0 A;  2QM4 A;  2BTO A;  3RYI B;  3B77 A;  1HNZ B;  5LGU A;  3CCQ V;  3ETD A;  5IYB O;  4MW3 A;  1YI2 V;  2XAJ A;  1R1B A;  2AHZ A;  1I5X A;  2ODM A;  1S5J A;  4MTO A;  3CYO A;  5KLV H;  4K0K O;  5KX5 B;  3TK1 A;  4R6Z A;  1JA8 A;  2VQE O;  3E8H A;  1TUB B;  1JJ2 U;  3VOU A;  5JWP A;  2CAZ C;  3RYC B;  4GKK B;  1U97 A;  2DWD C;  1G4Y B;  2UUB O;  3ZN0 A;  4JYC A;  2EUL A;  3DC5 A;  2AXT Z;  3WB0 A;  2Y4T A;  3A8T A;  3B09 A;  2VQF B;  4EFE A;  1IBK B;  4X9Q A;  4N23 A;  4FK5 C;  3EVK A;  4LFB O;  5CBF A;  1XDC A;  1WAZ A;  5GW7 A;  4PI2 A;  3WU2 Z;  4J11 A;  2EBO A;  4GX0 A;  2PI4 A;  4UCU A;  4WF9 V;  2EZP A;  3JCU Z;  1B04 A;  3OR7 C;  3HKC A;  3ABM B;  2YC0 A;  2XHB A;  1XMQ B;  1PNM A;  1FJG O;  5BR8 O;  3FKS G;  3JSL A;  2CTW A;  2OTL V;  2EIK C;  2WAM A;  4FM2 A;  1BT8 A;  3STL C;  1WA8 A;  4JV5 O;  4LWS A;  3DC6 A;  1GM8 A;  2X0L A;  1XOU A;  2FL4 A;  3CCS V;  2F23 A;  4F4L A;  2R70 A;  3U0Z A;  1FXV A;  2K1E A;  1OCO C;  1NTM H;  1EZV H;  4MW8 A;  2KSD A;  3SJC C;  3WG7 C;  3ZBH A;  1R73 A;  5IYD O;  1I94 B;  5EIB C;  4UB6 Z;  2W0F C;  3JAS A;  1GH6 A;  1JJO A;  5JCO C;  2ZXW B;  4NXN B;  3ZCC A;  4X89 A;  4DK1 A;  2F4V O;  1GMG A;  4LFC B;  4IHJ A;  1SQB H;  1LUW A;  2KB1 A;  5IWA B;  1JMK C;  1ARO P;  4JTD B;  2GUZ B;  4UVB A;  4DRX B;  4JTA B;  3SYC A;  4JPR A;  1K34 A;  3UO3 A;  3H1K H;  4TUY A;  2P4K A;  1Z5W A;  4GZR B;  4X64 B;  4CZZ A;  1M56 B;  1FFX A;  1OCZ C;  2DOS A;  3LSQ A;  3SJB C;  3ZS8 C;  2DYS B;  3GVM A;  3JAW B;  4ZBM A;  1K97 A;  5LL6 Y;  1NS1 A;  1MZE A;  3L9D A;  2YEV B;  5LA6 A;  1IX9 A;  2CDY A;  4JI7 O;  4GT1 A;  4LF6 O;  2M6Y A;  4DXW A;  4XBF A;  1WLE A;  2OCC C;  4BIO A;  4I50 A;  4UUJ C;  1Q81 W;  2GV9 A;  1SQX H;  3FYI B;  2YSU B;  2OWO A;  5L3B A;  3ZHT A;  1TVK B;  4ZOL B;  2ARH A;  3N27 A;  1M90 W;  1N32 O;  5IYC O;  2RMK B;  4WBN A;  3ZED A;  1EN5 A;  2KQX A;  2UXD O;  3ZMS A;  1PL4 A;  1H8E G;  5CBH A;  2JGU A;  2XOK G;  2YUA A;  2IH1 C;  2VWJ A;  1X59 A;  3K5N A;  1KUQ A;  3HB3 B;  4YY3 B;  3H1I H;  1CEZ A;  1TAE A;  4N21 A;  5E1A C;  3L70 H;  3AG3 C;  3D3I A;  3I55 V;  4NR1 A;  5LMU O;  3SR2 C;  4IIJ B;  2UXB B;  5B1N A;  1FFX B;  1PM9 A;  4I5S A;  4LF6 B;  2E74 B;  2P90 A;  3LDC A;  4HBN A;  4KP4 A;  3RYH A;  3K58 A;  1ZTE A;  4GUN A;  2EIM B;  4K3A A;  4ASU G;  1YJ9 V;  1BL8 A;  3T4D A;  1WNS A;  1VQ6 V;  2ZIN A;  3RWR D;  4DR4 O;  5DED A;  1V54 C;  1VQL V;  1L0L H;  4MSW C;  3K59 A;  5F2V O;  1K4C C;  2PYL A;  1M1K W;  1HP8 A;  2ADP A;  2F1M A;  3T1H O;  5LMN B;  2CH7 A;  1AR4 A;  2E3C A;  1KMI Z;  5KHK A;  1FXK C;  2W0X A;  4FIP C;  1AJQ A;  5IY5 B;  2D3O W;  4NTW A;  2HEP A;  3CHX A;  4UVC A;  2ZDI A;  1MA1 A;  3E8B A;  3CCE V;  1XHZ A;  2P7T C;  1MMM A;  2YI9 A;  1QNM A;  3QG5 A;  3CCU V;  4I7Z B;  4OPH A;  1IXB A;  3UQ8 A;  1FAF A;  1PL0 A;  1ZX3 A;  3FX7 A;  3T4Z A;  3K0G A;  4O4L B;  2LFS A;  1M57 B;  2FKX A;  2GTS A;  5CA1 B;  3CJH B;  1F23 A;  4K0K B;  1JVM A;  1YIT V;  3IAY A;  4OGQ B;  2H94 A;  4LNU B;  3CX5 F;  1I08 A;  3DXR A;  3PJS K;  1DLB A;  2F66 C;  4DK0 A;  2HJF C;  1CPY A;  4DV5 B;  4MVZ A;  1ZUQ A;  5LP6 A;  2ADQ B;  3LUT B;  3HR0 A;  4O2B B;  4YJ3 A;  4DW0 A;  2PYJ A;  2WLK A;  2QTS A;  3QO7 A;  4ZIB A;  1VF5 B;  1L0N H;  2A79 B;  4GCZ A;  4DW1 A;  4KUM A;  4BIU A;  4F6R B;  1SKV A;  2V7Q G;  3AEI A;  3UKM A;  3KG2 A;  4K8Z A;  3F5W C;  2RN9 A;  4KL1 A;  2Y0P A;  5LGN A;  5CB4 A;  4DV0 B;  2OT5 A;  2YI8 A;  3OGC C;  2Q67 A;  2Z0A A;  4DRX A;  3R65 A;  5EBW C;  4DR6 B;  1Q82 W;  3ASN C;  3G4S V;  5BMV B;  2YS8 A;  2QDO A;  2HHH O;  1E79 G;  3CWB H;  4DV4 B;  1FYJ A;  4DR3 B;  3SYQ A;  1XI1 A;  1XRE A;  3SPG A;  4ZKI A;  4IT5 A;  1IBM B;  2QWP B;  2ZR3 A;  2Z5U A;  1GN6 A;  3X2Q C;  1PP9 H;  4GX5 A;  5FNV B;  1GK9 A;  2PTM A;  4FJC C;  4U7O A;  3CRA A;  4KXR A;  4E2L A;  1N34 B;  5BZB A;  5GON A;  2NR5 A;  1N33 B;  3ABM C;  4JV5 B;  2QTO A;  1S0V A;  2ZNI A;  2DQ0 A;  4X65 B;  5FL7 G;  2GDS A;  5L3C A;  1Y6X A;  1YXB A;  4XDK A;  5A2Q N;  2UXB O;  5H2F Z;  3CCL V;  3CSX A;  3SGI A;  3OMA B;  4BIZ A;  5D5Q A;  3K5L A;  4U7N A;  2PI5 A;  4B7K A;  1R3L C;  2EJ7 A;  1NR7 A;  4AI8 A;  3ZMT A;  4O4H A;  3JAL B;  1Q43 A;  4OPA A;  1YSC A;  3IC7 A;  5C93 A;  3RT3 C;  1NVP D;  5IWA O;  1OCZ B;  3ASN B;  3T1Y O;  4JI7 B;  4LWS B;  2E5L B;  5L3G A;  3OTO B;  1FXK B;  2LGQ A;  3ASO B;  1SF9 A;  1XNR O;  5H6Q A;  1COW G;  2HP8 A;  3OE7 G;  2YXY A;  3FD9 A;  3BRC A;  4PDV A;  5JH7 B;  1SA0 A;  1L8D A;  1M4U A;  2X6A A;  2P6J A;  1PNL A;  4RUF A;  3QO8 A;  2Y4U A;  3JAL A;  4BW9 A;  4FMT A;  2H3O A;  4TV9 B;  5KMG B;  1Q6I A;  1WJZ A;  3OD4 A;  5LHI A;  1P49 A;  3B40 A;  2Q0A A;  5ITZ A;  2ZIM A;  2KKW A;  2Q69 A;  5DN6 G;  2Z3Y A;  1N0N A;  1VF7 A;  2XTA A;  4DR5 B;  2JGD A;  2EIN B;  1VQO V;  1H2N A;  3STZ C;  2Q7G A;  3ZJZ A;  4DV2 O;  5CA0 B;  3H9V A;  4QPJ A;  3ZMV A;  1U96 A;  3MHH C;  3THO A;  4KFM A;  4QNH B;  4LH7 A;  3EHB B;  4YIO A;  1NI8 A;  2E5L O;  2DYR C;  2AZ2 A;  2Q7H A;  1VAR A;  4OXS A;  1VQ5 V;  5KX5 A;  5LYJ A;  1K8A W;  2V4D A;  1W59 A;  3S3X A;  4GKJ B;  2VQF O;  3B2E E;  2D2C B;  1AB3 A;  4JGS A;  2RJZ A;  4TWK A;  4LF7 B;  1UJW B;  2X6C A;  4FLX A;  4ZI7 A;  3VQX A;  1E1Q G;  4YHH O;  2VS0 A;  4IYI A;  3JD3 A;  4JI8 B;  4UXN A;  1AP5 A;  4PDL A;  2WLJ A;  2CK3 G;  4EKW A;  3MD0 A;  3WG7 B;  1AR1 B;  1XMO O;  4X1K A;  4YJ3 B;  1OZ0 A;  2ITC C;  4LF8 O;  4HZ3 A;  3CCM V;  1QU7 A;  4RQE A;  1NVP B;  3SPC A;  3JD4 A;  1N36 B;  2DQ3 A;  1P84 F;  5FPR A;  3SPJ A;  4B7E A;  5CA0 A;  1R6K A;  4X1Y B;  1XMO B;  5IT9 N;  4X66 B;  1YHQ V;  4IHJ B;  4LBE C;  1XBL A;  4O4J A;  1XNQ B;  1P7B A;  1Y67 A;  4UCT A;  1H2L A;  3ABK C;  1YTF D;  4P9P A;  2WWW A;  5HFM A;  4PA3 A;  3LSU A;  3EXA A;  2CE4 A;  2XND G;  3ABK B;  4UV8 A;  1Y66 A;  3E22 B;  5DM6 V;  1XHX A;  4JI2 O;  1XNQ O;  3BPZ A;  3IGA C;  1SQP H;  1N0J A;  4B3R O;  2B1G A;  4JZ2 A;  2LJ2 A;  1HW7 A;  5B3S B;  2QEX V;  2PUS A;  4DUZ O;  4QPK A;  4CS2 A;  3K9S A;  1YJN V;  1NQT A;  1FD9 A;  1ROP A;  4UV9 A;  4J10 A;  3L75 H;  1YTF B;  4X62 B;  4X1I A;  2PF4 E;  1PV0 A;  1OV9 A;  3JAK A;  4JI8 O;  2VWK A;  4AHC A;  5LHH A;  2JK5 C;  2A9H A;  3E22 A;  4J7Z A;  5JCO A;  1GN2 A;  3QTC A;  4X20 B;  1S5L Z;  4C7U A;  4NYK A;  4MVO A;  1THZ A;  2IBZ H;  4JTC B;  3OEE G;  1WB7 A;  1DK1 A;  4I55 A;  1AJP A;  4P2Z A;  3B8N A;  3U11 A;  3E8F A;  1MSW D;  4F6R A;  1VEW A;  5H5N A;  3GWO A;  4J7J A;  4IGG A;  1K3E A;  3K0D A;  2QWR B;  3C3T A;  3A0H Z;  3W7S A;  3F7Y C;  4TV8 B;  3SYP A;  4CC5 A;  1Z5V A;  5J2U A;  4TOI A;  3CXH F;  4LFB B;  2XUM A;  5BMV A;  2GHY A;  1KQS U;  4PEL A;  2W6J G;  1DGS A;  4DV4 O;  2WLI B;  3DGE A;  4JI3 B;  3CB2 A;  5KAF Z;  1Q6U A;  2L6L A;  1R6T A;  4JI6 O;  2ZE5 A;  3ZX6 A;  1K5Q A;  1KP3 A;  3M7M X;  3CXC U;  3Q4H A;  3RGB A;  1SZT A;  2UU9 B;  4DV2 B;  5B1A B;  5B1B C;  3RVZ A;  3NXS A;  1XL6 A;  1RPO A;  2R72 A;  3BA8 A;  2NNU A;  2GUZ A;  4LFA B;  1O9H A;  1ZL8 A;  3J81 N;  1JPX A;  5EC2 C;  2PY5 A;  5JJJ B;  1WB8 A;  3FAV B;  2LW7 A;  3AG2 C;  1NJI W;  4JYA B;  3L72 H;  2EJR A;  2WA3 A;  4PA6 A;  2B1I A;  4DYL A;  1RSO B;  1AIL A;  2LW1 A;  1V9P A;  1NTK H;  2C2A A;  1S5H C;  1YF2 A;  1K7D A;  4QE7 A;  3F5T A;  4FZ0 A;  4CS4 A;  4WCE V;  2AHY A;  1IBL O;  3JSN A;  2ETN A;  1RP3 B;  5B5E Z;  1MSD A;  4LF5 O;  5CA1 A;  4LF7 O;  3CCV V;  5KUM A;  3JAR B;  1D2D A;  2Q4P A;  3AG1 B;  2R9R B;  4J9Y B;  3E8G A;  1KYO F;  1M9N A;  4MVU A;  5KHJ A;  3HKE B;  1Q5O A;  1W0K G;  3P30 A;  3K9A A;  3QVN A;  5J2T A;  1FJG B;  2CH7 B;  4DUY O;  4Q6G A;  1E1R G;  2JIZ G;  3O65 A;  4HAM A;  1D5N A;  3L74 H;  2ZXW C;  2HVJ C;  2DYS C;  1S3J A;  2HJD A;  3BA9 A;  4DR4 B;  5C8Y A;  2JVD A;  1TUE B;  3AG7 A;  3ICX A;  1YVW A;  3FB8 C;  3OTF A;  4XDL A;  4IL6 Z;  4O4L A;  1QLE C;  1KKD A;  2M7W A;  2BCC H;  3IFX A;  4L87 A;  5CN0 A;  3ZRV A;  2ZNJ A;  3L73 H;  3JD2 A;  2CTQ A;  5BXZ A;  4JI4 O;  4DR2 B;  2UXN A;  1FXH A;  1OHH G;  1Y76 A;  3HKC B;  2QKA A;  4DV7 B;  1HNW O;  4X1Y A;  4W4L A;  1YIJ V;  4CBC A;  2EIJ B;  4LF4 B;  3DSQ A;  4LCU C;  4O4H B;  4H0L B;  1TUB A;  1GN3 A;  3BFR A;  3SPH A;  1W0J G;  2FYU H;  4QGP A;  3JAR A;  5B1O A;  3CRC A;  4FFB B;  3J80 N;  1VQN V;  2ATK C;  4UCR A;  2UUC O;  3OR6 C;  2NLJ C;  3OTO O;  4MVR A;  4DV1 B;  3MDS A;  4DR7 B;  1GO3 F;  2LQT A;  2Y48 A;  1AR5 A;  2Q73 A;  4J42 A;  5FNV A;  1IZ3 A;  2YXL A;  5LP6 C;  3T1C A;  4MTX A;  5IJ9 A;  5JQG B;  1AI5 A;  3CE2 A;  3BY6 A;  4WBN B;  5L3F A;  2EIL B;  2R9I A;  5J2U B;  4X66 O;  2RNB A;  2QGN A;  3EFF K;  1F51 A;  4JI5 B;  2UXC B;  3UT5 A;  3TGU H;  2L35 A;  1N4C A;  4RUE A;  4DUZ B;  4JI6 B;  1I0H A;  2DW4 A;  1MZF A;  3A0R A;  4PA9 A;  4JI3 O;  4NXM O;  4DV6 O;  3RW0 A;  4J9Z B;  1SES A;  1HWY A;  2WPD G;  4WFF A;  4DV7 O;  1HNW B;  3RYI A;  1N32 B;  4PD4 F;  1V55 B;  4ZHQ B;  3SPI A;  4FVM A;  4KHP B;  4H13 B;  2IW5 A;  1WPX A;  3ABL B;  4I50 B;  3W7T A;  2IJH A;  4U3J A;  3UO2 A;  1M56 C;  1MG1 A;  4CC6 A;  1K73 W;  2WLH A;  1PKX A;  2DJV A;  4JI0 B;  4B3M B;  5EBM C;  5EYP A;  1JOY A;  3UM7 A;  2UUC B;  2EIN C;  5CBG A;  2RDC A;  4LF5 B;  2E76 B;  1SRY A;  3HKB B;  3CJH A;  1FKA O;  4NVP A;  4RO2 A;  5IJ0 A;  1VQK V;  2HLD G;  4L8J A;  4CH6 A;  1H2K A;  5DEC A;  1SA0 B;  4LR3 A;  3K57 A;  4BAY A;  4O4J B;  4LF9 B;  4H44 B;  3IC9 A;  3JAS B;  1SQQ H;  4GYC B;  2X7R B;  1NH2 B;  1HDJ A;  1R3J C;  1FPO A;  1KEC A;  1R3K C;  2EIJ C;  1XL4 A;  3OMN B;  2UXD B;  4BWA A;  4X1K B;  1JR9 A;  3RFR A;  4DR5 O;  3RVY A;  5H6R A;  5FPO A;  2EZO A;  4NTY A;  4B08 A;  3VBB A;  2BTQ B;  2ITD C;  2IH3 C;  4AQY B;  3M8A A;  1GKF A;  1HR0 B;  4CH3 A;  1VMG A;  5GTI Z;  1NU1 H;  4UCO A;  3KKY A;  2Q6A A;  2WLL B;  4JAA A;  3BAB A;  2Q7E A;  3GB7 C;  2F4V B;  3AK3 A;  3ETE A;  2XAF A;  3JAM N;  1R3I C;  3QF7 A;  2QE7 G;  4NXN O;  3AG4 B;  3BCC H;  2YIC A;  1N36 O;  4YHH B;  1SER A;  2XAH A;  3ZHR A;  3APO A;  1DF4 A;  1ZSP A;  4UCS A;  2FB5 A;  2IJI A;  3T1Y B;  3NR7 A;  4GX1 A;  3LDE A;  1SZX A;  1Q90 D;  4OX9 B;  3W7W A;  3ASO C;  4WFE A;  2Y69 B;  2OCC B;  4LFC O;  2B5U A;  2QA4 V;  5FLX N;  2A0L A;  4R8C A;  3VQV A;  2HHH B;  2KG7 B;  5J9P C;  1VIB A;  4D7T A;  4LF9 O;  1BSM A;  3HKD B;  1JX9 A;  4OX9 O;  1IBM O;  4U3F H;  4MVS A;  3CS5 A;  2XT9 A;  4DV1 O;  4O4I A;  4DR3 O;  1M57 C;  3H1L H;  4H37 A;  5EZY B;  2QKS A;  1ZWI C;  2OYQ A;  5B1A C;  1BCC H;  2AGA A;  4NKG B;  4LP8 A;  1QHT A;  1ZL8 B;  2BOC C;  2HR3 A;  3SJA C;  4O2A A;  5ITZ B;  1KD1 W;  4JYY A;  3RBZ A;  1B3Q A;  3H01 A;  4NXM B;  3CRQ A;  3AG2 B;  1AI6 A;  3RN4 A;  3DXR B;  5EBL C;  4LFA O;  3JAT A;  2HKO A;  4JAU A;  1NH2 D;  3E2E A;  1F4N A;  1G6U A;  4DV5 O;  1OJH A;  3WFV A;  5IJ9 B;  4P30 A;  5L3D A;  1JFF A;  3DTU B;  5JH7 A;  4X64 O;  1I7F A;  1WA8 B;  4RAI A;  1N8R W;  5KUK A;  3E35 A;  4Q20 A;  2CGN A;  3LDD A;  1TGO A;  2OIG A;  4MVM A;  2P67 A;  3ZHS A;  1K33 A;  3ZMZ A;  1Y74 A;  2EIK B;  2VQE B;  3P32 A;  2GSM B;  4R7C A;  5HFL A;  4A5U B;  2Y0I A;  1NTZ H;  1DTO A;  2EIL C;  1FXK A;  3ETQ A;  1GN4 A;  1QR9 A;  3AG4 C;  2ZM6 B;  1W2B U;  1S72 V;  1H2S B;  2K9P A;  1MNG A;  3ABU A;  4QE9 A;  1SET A;  5J2T B;  4B3S O;  1US6 A;  4FM1 A;  3MHS C;  1S77 D;  2P06 A;  3OFN G;  3ZN1 A;  2JJ2 G;  4FFK A;  1BHB A;  3D8C A;  4X1I B;  3E86 A;  4CS3 A;  2IU0 A;  1BS3 A;  2W6I G;  3AK2 A;  4U3J B;  1UPG A;  3ABL C;  1YJW V;  4TQF A;  3OMI B;  1XMQ O;  3ZIA G;  4DV6 B;  3TJT A;  2CUG A;  3QNE A;  3E89 A;  1O9G A;  3FB6 C;  2FTK A;  2GTA A;  2QWQ B;  4UVA A;  1QVF U;  1EFR G;  4ZOL A;  3OEH G;  3TXQ A;  2F95 B;  1ORQ C;  2QJ1 A;  1JQ0 A;  2AZ0 A;  1S76 D;  5A9G A;  3SJQ C;  2ILM A;  4I4T B;  1IDS A;  4JI1 B;  2CTP A;  1QLE B;  3GWK C;  4G28 B;  3OUS A;  4JYA O;  1WN7 A;  5GON B;  1B6Q A;  4AQY O;  2XAS A;  2YEV A;  4JI0 O;  3G6E V;  2JS5 A;  5LP6 B;  4FLW A;  3L71 H;  5LOV B;  3CEI A;  4FM0 A;  5IE9 A;  4EFB A;  3HKD A;  4UFZ A;  3FAV A;  4PHZ A;  2UUB B;  3HPL C;  2KG7 A;  4JZG A;  3E83 A;  1J95 A;  3BAA A;  1NZ6 A;  1EM1 A;  3ZMU A;  3ZHU A;  3RYF B;  4ZI7 B;  1OCC B;  2PZS A;  1VQ4 V; 
#chains in the Genus database with same CATH homology
 2PF4 E;  2GUZ A;  1XBL A;  4RWU A;  2YS8 A;  2Y4U A;  2Y4T A;  2QSA A;  1FAF A;  2YUA A;  2N04 A;  2OCH A;  3AG7 A;  2CTP A;  2CUG A;  1BQ0 A;  2L6L A;  2QWN B;  4J7Z A;  1WJZ A;  2GUZ B;  4IT5 A;  2DMX A;  2QWQ B;  1IUR A;  4J80 A;  2QWR B;  1BQZ A;  2CTW A;  2KQX A;  3APQ A;  1NZ6 A;  1GH6 A;  2QWP B;  3BVO A;  3APO A;  2CTR A;  1HDJ A;  1FPO A;  3UO3 A;  2EJ7 A;  3UCS C;  2QWO B;  2M6Y A;  2CTQ A;  2DN9 A;  2LO1 A;  1N4C A;  2LGW A;  3UO2 A;  2N05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...