3UCSC

Crystal structure of the complex between cbpa j-domain and cbpm
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
b'GSELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone-modulator protein CbpM
molecule tags Chaperone
source organism Klebsiella pneumoniae
publication title Structure of the complex between CbpA J-domain and CbpM provides a link between chaperone and transcription regulation in bacterial heat shock response
rcsb
total genus 25
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3ucsC00
2OCHA 1N4CA 3UCSC 3APQA 2QWRB 2QWNB 4J7ZA 1FPOA 3UO3A 2GUZB 2N04A 2DMXA 1HDJA 3APOA 2KQXA 2LO1A 2N05A 2PF4E 2QWQB 2YUAA 4IT5A 2CUGA 2CTWA 3BVOA 2LGWA 4RWUA 2Y4UA 2DN9A 1BQ0A 2L6LA 2M6YA 4J80A 1IURA 1GH6A 2QWPB 3AG7A 1NZ6A 2GUZA 2Y4TA 3UO2A 1FAFA 1BQZA 2CTPA 2YS8A 2EJ7A 2CTQA 2QSAA 2QWOB 2CTRA 1WJZA 1XBLA
chains in the Genus database with same CATH superfamily
4UXNA 3MHSC 3IFXA 2RJZA 3IC9A 2OT5A 3JSLA 4JI6O 1NS1A 4B3RB 1MOFA 1V54C 2F93B 3W7UA 1BE3H 2WLKA 4CH5A 3ETQA 3HKCA 4UCVA 1H2MA 2ZDIC 5IJ9A 3CB2A 2EJ7A 5LMNO 3RYIB 3UCSC 3ABKB 2UUCB 1W59A 1I7FA 3BA9A 2EINC 2ZKOA 1JCHA 2CK3G 4O2BB 4JI5O 4LWSA 3JAKA 3TCUA 1YXBA 3ZHQA 1Z5VA 3SJQC 1G1XB 1XNQO 2VQEO 3ETEA 5F2VO 2OCHA 3BHPA 2QM7A 2Q7GA 1SZXA 5EBLC 2YIBD 4L8JA 3F7VC 1BGYH 2B1GA 2CTWA 2ZE6A 3SYAA 4CC6A 1DTOA 3M8AA 1VEWA 3FFQA 3KZIZ 3SPGA 1HR0O 1BCCH 4LC1A 1NZ6A 1H2LA 3WU2Z 1K3EA 1HNZB 2UXBO 1WLEA 2PUSA 2Z0AA 3I5DA 5J2UB 4WFAV 2F1MA 3Q4HB 1K33A 1MG1A 4WBNA 3PJSK 2W6IG 3OGCC 3JALA 4J7JA 4O2AA 4RQFA 4RQEA 3K79A 1I5XA 1VF7A 3NR7A 1HNWB 5JQGA 1KMIZ 4JAAA 1NI8A 3UO3A 1AILA 2L35A 2ZM6B 4X1KB 1FFXA 1GAXA 3RVYA 4KUMA 4OPAA 4E2LA 4EFBA 4IIJA 4MTXA 3AG1C 3AG4B 5KHHA 3C3SA 1IBLO 1WB7A 5H6RA 2ITDC 1HNXB 3QVNA 5BR8B 4GKKB 2UUBB 1WB8A 2G38A 1S5HC 5K1PA 2B1IA 1MZEA 4KHPB 2E75B 4PHZA 5A9GA 3QO8A 1S77D 5DEDA 3G6BA 1TUBB 4LBEC 1AI5A 5DN6G 5EYPB 1VQ9V 1QCEA 2FKXA 4MSWC 4MTGA 3B40A 1VMGA 3OEHG 1AR1B 4HYOA 4PI0A 2ZDIA 5B3SB 2QM4A 3P3NA 2DQ3A 5L3EA 3J81N 3T1YB 2YXYA 3H9VA 4X20B 1PM9A 4I4TA 3M99B 4WFEA 2HP8A 2GDSA 4WFFA 2F4VO 3ASOB 5KX5B 2IBZH 5EC2C 2DOSA 3RYIA 4CZZA 4MW3A 3K3WA 4CS2A 1BZKA 5LHGA 3TGUH 1N36B 1V55B 2A79B 4NKGB 5B1BB 3AK2A 4ZI7A 4DR6B 2WLJA 4EKWA 5LXTA 2R72A 1DF4A 4LF5O 4CS4A 4IGGA 3LDDA 3K06A 1SA0A 3AG1B 1NR1A 4FFKA 1AB3A 1SQXH 1G6UA 1DGSA 4UCTA 4X65O 4O4JA 2VS0A 2QR4A 4B3MB 1GN6A 1SQBH 3DXRA 3J80N 3ETDA 3HR0A 3BFRA 4FZ1A 4AHCA 2QWRB 1XMQO 3ASNB 1QVGU 1N32O 2ZIMA 3X2QC 2KQXA 2GTAA 1YSCA 5CB4B 1I94O 3CJHB 4DRXA 4JYAB 3F5TA 4GX2A 4I4TB 4DV5B 2FL4A 4UFZA 3ZMSA 1K7DA 1WPBA 3RYCA 4JZ2A 1QBZA 1H2GA 4BIZA 1EZJA 3ML0A 1XL6A 4WFGA 4ZOLA 3ZHVA 2X0LA 4IHJA 3AG2C 2EIKB 3SGIA 1BMFG 1R1BA 1OCCC 3ZMTA 3HKDB 1K8AW 3OT7A 3RVZA 4X20A 1S5LZ 1Z2GA 5KA5A 4JI0B 2CGNA 2QE7G 3LSSA 5CA0B 1M57B 2GTSA 4YY3B 2KKWA 3ASNC 1ORQC 3OUSA 3CCEV 4DV6B 2DYSB 3TXSA 4B7EA 1GN2A 3O65A 3HPLC 1FXVA 3K08A 1BSMA 4X66B 4UUJC 2R70A 5KAFZ 3I55V 2YIDA 5JCOA 2JGDB 1F4MA 3D3QA 4AQYO 3ABMC 1QQCA 2Q4PA 3C3TA 1N0NA 5C93A 2PYLA 2HEPA 4WFBV 1JVMA 2N04A 4K8ZA 1QLEB 4X89A 1VIBA 1QNMA 1US6A 4J11A 4B08A 4JI2O 3JARA 2L6LA 4TUYA 2YIAA 2LJ2A 4JI0O 1G4YB 3A8TA 5JJEB 1GM7A 4FM2A 2HHHB 4KFMA 3CC4V 5B1OA 5BY1A 4MT8A 3ZMVA 2ZXWB 3U10A 2VQFB 1HNZO 2UXBB 1WP8A 2CH7A 4X1IB 5CBHA 2UXCO 4JTDB 4LF8O 3Q4HA 3W7TA 1H2KA 3K5OA 2UU9B 3HKBB 1MNGA 3FB7C 2Z3YA 4I5SA 4LNUA 4F6RB 4DV7O 1MA1A 1XI1A 1VQ6V 4NXMO 1VF5B 2HG5C 4HZ3A 3ZCCA 2CGOA 1MMMA 1IBMB 2QEXV 5D5PA 1AP6A 4LF5B 3CC2V 5JJJB 2X6AA 4J7KA 1Q81W 3ETGA 3B77A 4IL6Z 2ZT9B 4JV5O 2PGGA 4DR2B 4IYIA 3RFRA 3STLC 1AI6A 1R3JC 1TVKB 1KP3A 2A06H 2F4VB 4ZHQA 5KHKA 2XT9A 4B3SB 4K3AA 4DR5O 4UCSA 4JYBA 5HFLA 3FYIB 1N33O 4B3RO 1PNMA 3RYFA 4MVZA 1QVFU 3SPCA 4JI6B 1ZSPA 3ABUA 3O9OA 2RNBA 3KKYA 1NTZH 5B1AC 2WA4A 1NJIW 4PDLA 4R50A 3E8FA 4TOIA 4DV4B 3D36C 4GX0A 5LXTB 2LP7A 5EZYB 4FLXA 3N2GA 2F43G 4BR6A 1HW7A 1R6TA 3UO2A 4BW9A 3TJTA 2JRIA 2ATKC 1DK1A 2BTOA 4R8CA 4K0KB 4RAIA 5IWAB 3ZRSA 5KUMA 5LYJB 4IT5A 4YXWG 1GRJA 4FM0A 2ADPA 3UKMA 5B66Z 1OHHG 5CB4A 5KHGA 1GM8A 2E5LO 1VARA 4JTAB 2JGDA 5LGNA 4JZGA 1WPXA 2CTPA 1ROPA 2AHZA 3WB2A 1B06A 5KAIZ 4DV0O 2EZOA 3A0RA 1RFYA 2WLIB 5IT9N 2UXDO 2BTQA 1IBMO 2VWJA 2DE0X 1J5EO 3JYCA 4DV1O 2VQFO 1GH6A 2LFSA 3K5NA 2FTKA 2Q69A 1SRYA 1M1KW 3FAVA 1FAFA 1D2DA 1YF2A 2CDYA 3QNEA 2AZ0A 1UJWB 3RGBA 4AI8A 1JJ2U 2WA3A 3BRCA 2EULA 3SJAC 5E1AC 4CBCA 3OR6C 2PZSA 2ILMA 1K5QA 1EN6A 4ICGA 5IDJA 1Z5WA 3K9AA 2OCCB 1VQ8V 5AG2A 5B1AB 3CXCU 2YIBA 4FM1A 2AZ2A 1MZFA 4J9ZB 2HHHO 1E79G 4DV3O 3FD9A 3AG4C 1IZ3A 4K0KO 2WLLA 4X1YB 1K9MW 3UQ8A 3FB8C 3RYFB 1NH2D 1COWG 3FYEB 1MSDA 3D8CA 3JASB 4J41A 4J10A 2WLNA 1Y76A 5LMNB 2DYRB 3AEIA 2MW2B 4PV1B 2RDCA 1QU7A 5DECA 2HKOA 3CX5F 3ZMUA 3L71H 3P32A 5LP6B 4LCUC 1PD3A 4D7TA 3MDSA 4MVSA 4DR5B 5JCOC 4DV2B 3ICXA 4Z2WA 2CH7B 3ZRWA 1L1FA 1K4DC 1CP9A 3N2GB 3ASOC 3DXRB 3QO7A 5J2UA 3G4SV 1UFIA 3JD1A 1F51A 3JAMN 3BABA 3CRQA 4B3MO 1PNLA 5FNVA 2VWKA 1XMOB 2W0FC 3VOUA 2EIMC 1RM1B 1J5EB 3JD4A 5LMUB 2ZIOA 5B3SC 4GYCB 2IJIA 1KBHA 1FPOA 1JR9A 2LQTA 2Q8VA 1FFTB 3OFNG 4J9YB 1XL4A 4UCRA 4DYLA 4DV7B 4J80A 3E83A 2WLLB 3CCLV 2KSDA 1P49A 1RPOA 2RMKB 2WLIA 2N74A 4QE9A 4DR7O 4GKJO 3ABKC 1NH2B 5JWPA 4I7ZB 2H94A 2QTOA 2JJ1G 4FPPA 1SQQH 1JFFA 3T1YO 2E5LB 3RT3C 3DGEA 1WP7A 4HAMA 3STZC 5EIBD 3DC6A 2HVJC 2GUZA 3HKEB 1K34A 5KHJA 1WA8A 2W6JG 4X8AA 1UPGA 1XBLA 4ZHQB 1N0JA 1N34B 3JSNA 1LUVA 2DWDC 3CWBH 4JAUA 1MABG 4DV4O 1NTKH 2W0XA 4PDMA 2OIEA 3RYCB 1W0JG 2KB1A 4GKKO 3DSQA 1I0HA 3CCMV 3AG2B 1Q7YW 4NXNO 3CCRV 1WJZA 3FB5C 2F23A 2OYQA 3UM7A 1THZA 4DUYO 2PYJA 1N33B 2OIGA 4CS3A 4Q20A 3ABTA 5JH7B 1F23A 1U97A 1G8MA 1L8DA 5B1NA 4O4LA 1Q43A 5DM6V 3OM3B 3A0BZ 2A3QA 4LNUB 4ASUG 1WAZA 3K04A 1OJHA 2QKSA 3QTCA 1VQ7V 1GMGA 3BEHA 2AHYA 4FFBA 3BPZA 4FLUA 2OTJV 3C90A 3G80A 2YC0A 4DV3B 1H2SB 2HLDG 1IBLB 3GVMA 1P7BA 5LHIA 4I9QA 2OTLV 1T5EA 3G71V 4GT1A 1AROP 1EZVH 1GN4A 2Q5ZA 3FAVB 4LF8B 3ZMZA 1WA8B 2ZE5A 5FL7G 4X88A 4MTOA 5EBWC 5IYCO 5L3CA 4FMTA 3ZX6A 1EM1A 5IYZB 1XNRO 4JF3A 3CE2A 1KU9A 4J7ZA 3L73H 2ZXWC 1AJNA 4LF6O 1Y6XA 2Y69C 1FYJA 4JI3O 1GTOA 3DC5A 2WWWA 1VQMV 1BL8A 1ZWIC 3ZHSA 1YJ9V 5LL6Y 2DWEC 4CH6A 1BS3A 1B3QA 2YSUB 1BHAA 1K4CC 1SETA 1SS3A 4O2BA 4F6EA 4DW0A 3CRAA 3AK3A 2ZNJA 4EB6A 2XASA 3ABMB 5CMUA 2H3OA 2UUCO 2LGQA 1ZL8A 5EZYA 1P4RA 2BOBC 3EFFK 4K8XA 3EXAA 2ZR3A 4D7SA 1AVMA 2P4VA 1OV9A 3A2FA 4WFHA 3KCYA 1KD1W 2Y4UA 3CMEV 2YDEA 4JI4B 1VQ5V 2QWPB 3SJBC 1LR1A 4JI7O 1TAEA 5LP6A 2CTRA 2DYSC 4I0XA 2F66C 4UVCA 2P5OA 3I56V 1OZ0A 2ADQB 2P6JA 2UXNA 3RYHB 2ZCEA 5EIBC 2PI4A 2P06A 3ZHUA 2UUBO 4JTCB 2AW9A 5IE9A 3KG2A 1FJGB 4GZRB 4NXNB 1AJPA 1NTMH 1IX9A 3LNMB 5IY5C 4IIJB 2K9PA 2PI5A 2ZR2A 3E22A 3GB7C 1D5AA 1VQPV 2DQ0A 2GSMB 4DUZB 2A7WA 1NVPB 4UB8Z 4UVBA 1KUQA 2V4DA 5GTHZ 1RSOB 4H0LB 4NXMB 1PV0A 1ZTEA 5B5EZ 1F7YA 4X65B 3HKEA 4GX5A 5ITZB 5LMUO 1N36O 1D5NA 4UV9A 4Z1MG 3WFVA 2NLJC 2YI8A 3N2KA 3ZRXA 3ZBHA 1Y74A 4H37A 2DW4A 3WB1A 3N27A 3AG3B 2AGAA 4JI3B 2ARHA 4KL1A 1K97A 4U7OA 4DK0A 2D3OW 5BXZA 4RO2A 3JAKB 1XHZA 1AI4A 3IJ4A 2UXCB 4G27B 1IXBA 2FYUH 2QKCA 2QTSA 3JAWB 3ZEDA 4CC5A 3MHHC 1XMOO 3K03A 1LUWA 2IH1C 4JI2B 3P30A 5CA3A 2IU3A 3CMAV 1NU1H 4H33A 2HJDA 2YEVA 2WPDG 1XILA 4ZBMA 5LP6C 2ODMA 2RQ6A 4QPKA 2UXXA 2Y0PA 1IURA 5C8YA 3OMIB 2XAFA 4KHPO 2KG7B 3RW0A 1GN3A 2XAGA 2DYRC 3SPJA 1I08A 4PA6A 4O4LB 1YCIA 2ZINA 4MVRA 4R6ZA 4YHHO 4P2ZA 3H01A 4B7KA 1Q6UA 2LFRA 3RYHA 3D36A 4X66O 4PD4F 2R9RB 3FX7A 1JPXA 2QGNA 3JAWA 5LA6B 1W0KG 2BTQB 4DV6O 5LYJA 2NR5A 2JS5A 1E1QG 4JGSA 1CPYA 3A0HZ 3JATB 5KA6A 5L3FA 1H8HG 5KUKA 1MSWD 2XAJA 4FZ0A 5JJNB 1M9NA 4XBFA 4DXWA 4FLZA 5H5NA 3K5MA 2X6BA 1O9HA 1SC5B 2V1DA 3AG7A 2P7TC 2LW7A 3CYOA 5HFMA 1JOYA 2EIKC 2UU9O 4JYAO 3JCUZ 3T1HB 4GX1A 3SYQA 2D2CB 4D6TH 4GCZA 4TV8B 1RSOA 1VQNV 4DR7B 1I94B 4LH6A 2XHBA 1B6QA 1XOUA 3ZN1A 4O4JB 1R3KC 4TV9A 4OGQB 1Y4MA 1FXHA 1M93A 2GUZB 3F5WC 2Q6AA 3SDLA 4K35A 1ZUQA 1YVWA 2RN9A 1K5SA 3CRRA 3SPHA 4JI5B 3CC7V 1JX9A 1ZX3A 5KX5A 5FPOA 2GHYA 4BIUA 1FD9A 4DUYB 3E2EA 3SJCC 3L75H 5GW7A 4ZOLB 1FKAO 4PELA 3SYOA 2WLMA 1FXKA 3L9DA 1NBMG 2EJRA 4TV8A 1RPRA 4FIPC 4RWUA 3ZJZA 3IGAC 1M56B 4BAYA 3QO5A 1YJNV 1WNSA 3TXQA 3LSQA 4UVAA 1NQTA 4JAVA 5GTIZ 2QWNB 4L87A 3CEIA 2K1EA 4YIPA 3G6EV 2EILC 1HNXO 1OCRC 3ZN0A 3W7SA 4GUNA 2M7WA 4JI1O 2XOKG 5L3GA 3T4DA 2DJVA 3SR2C 4O4HA 5BR8O 3JCZA 4LFCB 1Q90D 2FB5A 3JD2A 4EEQA 1RP3B 1Y74B 4AILC 2ZE8A 1IXMA 1PP9H 2PY5A 5KLVH 5JQGB 1JJOA 4NR1A 1KKDA 4TQDA 4JV5B 4FVMA 2R9IA 1O9GA 4YJ2B 4YJ2A 1HNWO 4UCOA 1SQVH 3E8GA 5KHIA 1Q82W 3T1HO 3B4SA 3UT5A 4MVQA 1R6KA 2O57A 4DR4O 3OMAB 4BW5A 3ZHTA 4X1KA 3T4ZA 5J2TA 1PKXA 2PTMA 1P84F 4JI8B 4NTWA 3E35A 2Q68A 1X59A 1JMKC 3K0GA 5JH7A 2NNUA 1NVPD 3U11A 1NT2B 3ZIAG 4U3JB 1CEZA 1KC8W 1TUBA 4NTXA 2XAQA 2H8PC 1Q3EA 4X1YA 2IW5A 3G67A 2UXDB 1P7GA 4FK5C 3AG3C 3ZS8C 1YDXA 4DRXB 1VQKV 1YZBA 2BOCC 1QHTA 3RN4A 4U7NA 1QLEC 4LFBO 3SYPA 4Z1VA 2EINB 1XREA 3JD3A 5EBMC 4HNAB 5IYBO 1Q5OA 4LF4B 4X1IA 1Q6IA 3K5LA 3ABLC 3OTFA 4YY3O 4LF9O 5L3BA 1TGOA 4LF9B 1SA0B 2JDIG 3EHBB 2Q0AA 5EK0A 4MW8A 4LF4O 2GV9A 4JPRA 1J95A 2Q67A 1V54B 4LFBB 5A2QN 4W4LA 2P22C 2QM8A 1AP5A 2ZE7A 2Q0OC 4CH3A 1R3LC 2Q9LA 3CCVV 4RUFA 4E4EA 4I0XB 4B3TO 1VQLV 5IYZA 2V7QG 4FLTA 3K59A 4DK1A 2P4KA 4DV5O 2YEVB 5LBQA 1XUQA 1OCCB 4U3JA 2Y69B 3ZRVA 2BE3A 4OX9O 1VP7A 1TA8A 3APQA 4X9QA 2E74B 2N05A 1Y67A 2QWQB 4NB5A 3H1KH 1GO3F 4TWKA 3HKDA 1H2NA 1EN5A 4TT3G 4MTFA 2QKAA 2QWOB 1H8EG 4MVUA 3BY6A 5ITZA 3CS5A 3R66A 2YI9A 1NR7A 3CCUV 2PF4E 4A5UB 4QNHB 1L0NH 1H38A 2ZNIA 3K9SA 5D5QA 1PPJH 2CUGA 2P67A 4KXRA 3S3XA 1V9PA 5IYDO 2LGWA 3D3IA 4LF7O 3LSUA 1JQ0A 3DTUB 4UV8A 3JATA 4ABMA 1XMQB 1YI2V 3FKSG 1DF5A 2ETNA 1QR9A 4JASA 4LH7A 4UB6Z 2AXTZ 3OGIB 3OTOB 2JS3A 3CP1A 2VQEB 1SF9A 2YICA 4N21A 2A9HA 1V55C 1SQGA 5B1BC 3ZRWB 5LGTA 3KCXA 2ZD9A 4EFEA 4XDJA 2X6CA 5FNVB 2GBOA 3OE7G 3CCJV 1KKCA 4DR6O 4BIOA 1K73W 5LHHA 4FJCC 2EZPA 1HWYA 4O4HB 5TISZ 3X2QB 4LFAB 3WG7B 3H1LH 4DO2A 3HKCB 2IJJA 4DV2O 3LDEA 1S72V 2P90A 3T2MA 5CN0A 1KP2A 3U0ZA 1M5IA 1LNQA 2WAMA 2IJHA 4QE7A 4JI4O 1JA8A 5H6QA 4AQYB 2YS8A 2ZQMA 4LR3A 4NTYA 3K57A 4U3FH 2WLHA 2Q73A 2ZM6O 1SKVA 4H44B 2UUAB 4IHJB 2LO1A 1S3JA 5J2TB 1IBKO 2Z5UA 5IJ0B 4DR1O 4PJ0Z 2Y4TA 5CA0A 2XUMA 4BWAA 4I55A 1Q8IA 4YJ3A 5H9CA 1M4UA 1OCZB 2HVKC 5BMVA 5IJ9B 3APOA 4RUEA 4DR4B 2CAZC 4FLWA 2QA4V 2RCVA 4O4IB 1YHQV 1OCOC 3CPWU 1SZTA 1BQZA 5EC1C 2EBOA 3E86A 3B09A 3CCSV 1TUEB 5K1XA 2EIJC 4MVOA 4X62B 1N32B 3NXSA 1Y76B 4PI2A 1KQSU 4O4IA 1KB9F 4QJFB 4LFCO 1OCOB 4P9PA 3HB3B 4G2KA 1AJQA 1S0VA 3HKBA 3R65A 1AI7A 1IBKB 1N4CA 2XTAA 5C8YB 1HR0B 2A0LA 5CBFA 5GONB 2BSKA 2Q7EA 4DR1B 2MK3A 1B04A 3CSXA 1OCRB 3RWRD 1VQ4V 2QDOA 2JJ2G 2BCCH 5KMGB 1PL0A 4DUZO 2NN4A 4MS2A 3ABLB 3FB6C 4YJ3B 2JK5C 1KECA 4YHHB 2F95B 5H2FZ 3BA8A 1GKFA 3EVKA 1XQ8A 1XNQB 5LA6A 2OCCC 1YITV 1NKDA 1Q86W 1E1RG 4LFAO 4OXSA 3OMNB 3OUFA 2Y48A 5BZBA 4WBNB 1TVKA 4QIWF 3L72H 2B5UA 3JD0A 4YIOA 2KG7A 4PDRA 2YUAA 5GONA 4XDKA 4FLVA 3J7AU 3SPIA 1U96A 2X7RB 1AR5A 4GLXA 4B3SO 3LUTB 4ZKIA 4J42A 2QSAA 2E3CA 1FXKB 3IAYA 3CRCA 3IC7A 4XDLA 1FFXB 4N23A 3OW2U 4DR3O 3LDCA 4DR2O 4GKJB 3L70H 5EYPA 4I55B 1Q6HA 1S5JA 3QG5A 4LF7B 3H1HH 3K0DA 1ZLZA 3OR7C 2IH3C 2R9AA 3MAQA 1XEQA 4UCUA 1YJWV 2OWOA 1R6NA 4PA3A 2JEXA 3B8NA 3BAAA 2Y0IA 2JGUA 3VQWA 2EX3A 3BCCH 1CXZB 4R7CA 3BVOA 2E76B 3T1CA 1YTFD 2HJFC 3E22B 4X62O 3JASA 3E8HA 4WCEV 3VBBA 3M7MX 4FFBB 1SQFA 4LF6B 5LOVB 5LOVA 2IM9A 4B3TB 5LGUA 1XNRB 4IYHA 4O2AB 1VF6A 2DMXA 2Q7HA 1HDJA 1ENVA 4ZIBA 3JALB 1XHXA 4TQFA 1L0LH 4DW1A 4QGPA 4OPHA 4WF9V 4F6RA 5JVDB 4NVPA 4ZI7B 4I50B 4P9OA 1S76D 3CD6V 4I9WA 2VRZA 2ITCC 1ZL8B 4JI1B 1VF6C 4PDVA 5FLXN 5IJ0A 3OEEG 1OCZC 1Y66A 4QPJA 1PNKA 5FPRA 2UUAO 1GM9A 5CA1B 1W2BU 4LWSB 1IVSA 4JI7B 2JIZG 4PA7A 1SQPH 4CH4A 4PA9A 4PA4A 1VQOV 3QF7A 4I50A 4LP8A 3LNNA 2QJ1A 1PL4A 2C2AA 4FLYA 3S3WA 5J9PC 2CE4A 1YEWA 4Q6GA 1HP8A 3H1IH 3JARB 4TUYB 3SYCA 3W7XA 1M90W 1ZAUA 4C7UA 2EIMB 3OD4A 1RM1C 3AK1A 1X4TA 3K58A 3VQXA 1URFA 1JFFB 1GK9A 4KP4A 3MD0A 1IDSA 3TETA 4EB6B 4W4KA 2HFEC 4H13B 3B2EE 4HNAA 4TSFG 3GWKC 1SESA 1EN4A 4TV9B 3CJHA 2XNDG 3E89A 1EFRG 3H1JH 1R73A 2JVDA 4JI8O 1XDCA 1N34O 3WG7C 1QR8A 3THOA 2B9ZA 3PN1A 4X64B 3GWOA 5CA1A 3P3PA 2BSKB 4NYKA 1I5YA 5CBGA 3E8BA 3CXHF 3B8MA 2IU0A 1QLNA 2YXLA 3VQVA 3ZHRA 4DV1B 3UT5B 3OAAG 1BT8A 2CTQA 3CRMA 3OTOO 2XAHA 1R3IC 1AR4A 4DV0B 2YXHA 3W7WA 5KMGA 3RBZA 3WB0A 1YTFB 2HR3A 4F4LA 3L74H 1DLBA 1BQ0A 2DN9A 4HBNA 1F4NA 1K92A 3N2KB 1N8RW 5L3DA 5BMVB 1A32A 2WSSG 1FS0G 5E79Z 1FJGO 1KYOF 4JYYA 4JYCA 5IWAO 2EIJB 5IY5B 1YIJV 4X64O 3CCQV 4P30A 3TK1A 3VQYA 1BHBA 1M57C 1FXKC 1WN7A 2M6YA 2IJKA 1M56C 3F7YC 5JVDA 4DR3B 2FMLA 2EILB 4G28B 4MVMA 2LW1A 1SERA 3CHXA 1EBOA 2JEUA 4OX9B
chains in the Genus database with same CATH topology
2OCHA 1N4CA 3UCSC 3APQA 2QWRB 2QWNB 4J7ZA 1FPOA 3UO3A 2GUZB 2N04A 2DMXA 1HDJA 3APOA 2KQXA 2LO1A 2N05A 2PF4E 2QWQB 2YUAA 4IT5A 2CUGA 2CTWA 3BVOA 2LGWA 4RWUA 2Y4UA 2DN9A 1BQ0A 2L6LA 2M6YA 4J80A 1IURA 1GH6A 2QWPB 3AG7A 1NZ6A 2GUZA 2Y4TA 3UO2A 1FAFA 1BQZA 2CTPA 2YS8A 2EJ7A 2CTQA 2QSAA 2QWOB 2CTRA 1WJZA 1XBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCH A;  1N4C A;  3UCS C;  3APQ A;  2QWR B;  2QWN B;  4J7Z A;  1FPO A;  3UO3 A;  2GUZ B;  2N04 A;  2DMX A;  1HDJ A;  3APO A;  2KQX A;  2LO1 A;  2N05 A;  2PF4 E;  2QWQ B;  2YUA A;  4IT5 A;  2CUG A;  2CTW A;  3BVO A;  2LGW A;  4RWU A;  2Y4U A;  2DN9 A;  1BQ0 A;  2L6L A;  2M6Y A;  4J80 A;  1IUR A;  1GH6 A;  2QWP B;  3AG7 A;  1NZ6 A;  2GUZ A;  2Y4T A;  3UO2 A;  1FAF A;  1BQZ A;  2CTP A;  2YS8 A;  2EJ7 A;  2CTQ A;  2QSA A;  2QWO B;  2CTR A;  1WJZ A;  1XBL A; 
#chains in the Genus database with same CATH topology
 4UXN A;  3MHS C;  3IFX A;  2RJZ A;  3IC9 A;  2OT5 A;  3JSL A;  4JI6 O;  1NS1 A;  4B3R B;  1MOF A;  1V54 C;  2F93 B;  3W7U A;  1BE3 H;  2WLK A;  4CH5 A;  3ETQ A;  3HKC A;  4UCV A;  1H2M A;  2ZDI C;  5IJ9 A;  3CB2 A;  2EJ7 A;  5LMN O;  3RYI B;  3UCS C;  3ABK B;  2UUC B;  1W59 A;  1I7F A;  3BA9 A;  2EIN C;  2ZKO A;  1JCH A;  2CK3 G;  4O2B B;  4JI5 O;  4LWS A;  3JAK A;  3TCU A;  1YXB A;  3ZHQ A;  1Z5V A;  3SJQ C;  1G1X B;  1XNQ O;  2VQE O;  3ETE A;  5F2V O;  2OCH A;  3BHP A;  2QM7 A;  2Q7G A;  1SZX A;  5EBL C;  2YIB D;  4L8J A;  3F7V C;  1BGY H;  2B1G A;  2CTW A;  2ZE6 A;  3SYA A;  4CC6 A;  1DTO A;  3M8A A;  1VEW A;  3FFQ A;  3KZI Z;  3SPG A;  1HR0 O;  1BCC H;  4LC1 A;  1NZ6 A;  1H2L A;  3WU2 Z;  1K3E A;  1HNZ B;  2UXB O;  1WLE A;  2PUS A;  2Z0A A;  3I5D A;  5J2U B;  4WFA V;  2F1M A;  3Q4H B;  1K33 A;  1MG1 A;  4WBN A;  3PJS K;  2W6I G;  3OGC C;  3JAL A;  4J7J A;  4O2A A;  4RQF A;  4RQE A;  3K79 A;  1I5X A;  1VF7 A;  3NR7 A;  1HNW B;  5JQG A;  1KMI Z;  4JAA A;  1NI8 A;  3UO3 A;  1AIL A;  2L35 A;  2ZM6 B;  4X1K B;  1FFX A;  1GAX A;  3RVY A;  4KUM A;  4OPA A;  4E2L A;  4EFB A;  4IIJ A;  4MTX A;  3AG1 C;  3AG4 B;  5KHH A;  3C3S A;  1IBL O;  1WB7 A;  5H6R A;  2ITD C;  1HNX B;  3QVN A;  5BR8 B;  4GKK B;  2UUB B;  1WB8 A;  2G38 A;  1S5H C;  5K1P A;  2B1I A;  1MZE A;  4KHP B;  2E75 B;  4PHZ A;  5A9G A;  3QO8 A;  1S77 D;  5DED A;  3G6B A;  1TUB B;  4LBE C;  1AI5 A;  5DN6 G;  5EYP B;  1VQ9 V;  1QCE A;  2FKX A;  4MSW C;  4MTG A;  3B40 A;  1VMG A;  3OEH G;  1AR1 B;  4HYO A;  4PI0 A;  2ZDI A;  5B3S B;  2QM4 A;  3P3N A;  2DQ3 A;  5L3E A;  3J81 N;  3T1Y B;  2YXY A;  3H9V A;  4X20 B;  1PM9 A;  4I4T A;  3M99 B;  4WFE A;  2HP8 A;  2GDS A;  4WFF A;  2F4V O;  3ASO B;  5KX5 B;  2IBZ H;  5EC2 C;  2DOS A;  3RYI A;  4CZZ A;  4MW3 A;  3K3W A;  4CS2 A;  1BZK A;  5LHG A;  3TGU H;  1N36 B;  1V55 B;  2A79 B;  4NKG B;  5B1B B;  3AK2 A;  4ZI7 A;  4DR6 B;  2WLJ A;  4EKW A;  5LXT A;  2R72 A;  1DF4 A;  4LF5 O;  4CS4 A;  4IGG A;  3LDD A;  3K06 A;  1SA0 A;  3AG1 B;  1NR1 A;  4FFK A;  1AB3 A;  1SQX H;  1G6U A;  1DGS A;  4UCT A;  4X65 O;  4O4J A;  2VS0 A;  2QR4 A;  4B3M B;  1GN6 A;  1SQB H;  3DXR A;  3J80 N;  3ETD A;  3HR0 A;  3BFR A;  4FZ1 A;  4AHC A;  2QWR B;  1XMQ O;  3ASN B;  1QVG U;  1N32 O;  2ZIM A;  3X2Q C;  2KQX A;  2GTA A;  1YSC A;  5CB4 B;  1I94 O;  3CJH B;  4DRX A;  4JYA B;  3F5T A;  4GX2 A;  4I4T B;  4DV5 B;  2FL4 A;  4UFZ A;  3ZMS A;  1K7D A;  1WPB A;  3RYC A;  4JZ2 A;  1QBZ A;  1H2G A;  4BIZ A;  1EZJ A;  3ML0 A;  1XL6 A;  4WFG A;  4ZOL A;  3ZHV A;  2X0L A;  4IHJ A;  3AG2 C;  2EIK B;  3SGI A;  1BMF G;  1R1B A;  1OCC C;  3ZMT A;  3HKD B;  1K8A W;  3OT7 A;  3RVZ A;  4X20 A;  1S5L Z;  1Z2G A;  5KA5 A;  4JI0 B;  2CGN A;  2QE7 G;  3LSS A;  5CA0 B;  1M57 B;  2GTS A;  4YY3 B;  2KKW A;  3ASN C;  1ORQ C;  3OUS A;  3CCE V;  4DV6 B;  2DYS B;  3TXS A;  4B7E A;  1GN2 A;  3O65 A;  3HPL C;  1FXV A;  3K08 A;  1BSM A;  4X66 B;  4UUJ C;  2R70 A;  5KAF Z;  3I55 V;  2YID A;  5JCO A;  2JGD B;  1F4M A;  3D3Q A;  4AQY O;  3ABM C;  1QQC A;  2Q4P A;  3C3T A;  1N0N A;  5C93 A;  2PYL A;  2HEP A;  4WFB V;  1JVM A;  2N04 A;  4K8Z A;  1QLE B;  4X89 A;  1VIB A;  1QNM A;  1US6 A;  4J11 A;  4B08 A;  4JI2 O;  3JAR A;  2L6L A;  4TUY A;  2YIA A;  2LJ2 A;  4JI0 O;  1G4Y B;  3A8T A;  5JJE B;  1GM7 A;  4FM2 A;  2HHH B;  4KFM A;  3CC4 V;  5B1O A;  5BY1 A;  4MT8 A;  3ZMV A;  2ZXW B;  3U10 A;  2VQF B;  1HNZ O;  2UXB B;  1WP8 A;  2CH7 A;  4X1I B;  5CBH A;  2UXC O;  4JTD B;  4LF8 O;  3Q4H A;  3W7T A;  1H2K A;  3K5O A;  2UU9 B;  3HKB B;  1MNG A;  3FB7 C;  2Z3Y A;  4I5S A;  4LNU A;  4F6R B;  4DV7 O;  1MA1 A;  1XI1 A;  1VQ6 V;  4NXM O;  1VF5 B;  2HG5 C;  4HZ3 A;  3ZCC A;  2CGO A;  1MMM A;  1IBM B;  2QEX V;  5D5P A;  1AP6 A;  4LF5 B;  3CC2 V;  5JJJ B;  2X6A A;  4J7K A;  1Q81 W;  3ETG A;  3B77 A;  4IL6 Z;  2ZT9 B;  4JV5 O;  2PGG A;  4DR2 B;  4IYI A;  3RFR A;  3STL C;  1AI6 A;  1R3J C;  1TVK B;  1KP3 A;  2A06 H;  2F4V B;  4ZHQ A;  5KHK A;  2XT9 A;  4B3S B;  4K3A A;  4DR5 O;  4UCS A;  4JYB A;  5HFL A;  3FYI B;  1N33 O;  4B3R O;  1PNM A;  3RYF A;  4MVZ A;  1QVF U;  3SPC A;  4JI6 B;  1ZSP A;  3ABU A;  3O9O A;  2RNB A;  3KKY A;  1NTZ H;  5B1A C;  2WA4 A;  1NJI W;  4PDL A;  4R50 A;  3E8F A;  4TOI A;  4DV4 B;  3D36 C;  4GX0 A;  5LXT B;  2LP7 A;  5EZY B;  4FLX A;  3N2G A;  2F43 G;  4BR6 A;  1HW7 A;  1R6T A;  3UO2 A;  4BW9 A;  3TJT A;  2JRI A;  2ATK C;  1DK1 A;  2BTO A;  4R8C A;  4K0K B;  4RAI A;  5IWA B;  3ZRS A;  5KUM A;  5LYJ B;  4IT5 A;  4YXW G;  1GRJ A;  4FM0 A;  2ADP A;  3UKM A;  5B66 Z;  1OHH G;  5CB4 A;  5KHG A;  1GM8 A;  2E5L O;  1VAR A;  4JTA B;  2JGD A;  5LGN A;  4JZG A;  1WPX A;  2CTP A;  1ROP A;  2AHZ A;  3WB2 A;  1B06 A;  5KAI Z;  4DV0 O;  2EZO A;  3A0R A;  1RFY A;  2WLI B;  5IT9 N;  2UXD O;  2BTQ A;  1IBM O;  2VWJ A;  2DE0 X;  1J5E O;  3JYC A;  4DV1 O;  2VQF O;  1GH6 A;  2LFS A;  3K5N A;  2FTK A;  2Q69 A;  1SRY A;  1M1K W;  3FAV A;  1FAF A;  1D2D A;  1YF2 A;  2CDY A;  3QNE A;  2AZ0 A;  1UJW B;  3RGB A;  4AI8 A;  1JJ2 U;  2WA3 A;  3BRC A;  2EUL A;  3SJA C;  5E1A C;  4CBC A;  3OR6 C;  2PZS A;  2ILM A;  1K5Q A;  1EN6 A;  4ICG A;  5IDJ A;  1Z5W A;  3K9A A;  2OCC B;  1VQ8 V;  5AG2 A;  5B1A B;  3CXC U;  2YIB A;  4FM1 A;  2AZ2 A;  1MZF A;  4J9Z B;  2HHH O;  1E79 G;  4DV3 O;  3FD9 A;  3AG4 C;  1IZ3 A;  4K0K O;  2WLL A;  4X1Y B;  1K9M W;  3UQ8 A;  3FB8 C;  3RYF B;  1NH2 D;  1COW G;  3FYE B;  1MSD A;  3D8C A;  3JAS B;  4J41 A;  4J10 A;  2WLN A;  1Y76 A;  5LMN B;  2DYR B;  3AEI A;  2MW2 B;  4PV1 B;  2RDC A;  1QU7 A;  5DEC A;  2HKO A;  3CX5 F;  3ZMU A;  3L71 H;  3P32 A;  5LP6 B;  4LCU C;  1PD3 A;  4D7T A;  3MDS A;  4MVS A;  4DR5 B;  5JCO C;  4DV2 B;  3ICX A;  4Z2W A;  2CH7 B;  3ZRW A;  1L1F A;  1K4D C;  1CP9 A;  3N2G B;  3ASO C;  3DXR B;  3QO7 A;  5J2U A;  3G4S V;  1UFI A;  3JD1 A;  1F51 A;  3JAM N;  3BAB A;  3CRQ A;  4B3M O;  1PNL A;  5FNV A;  2VWK A;  1XMO B;  2W0F C;  3VOU A;  2EIM C;  1RM1 B;  1J5E B;  3JD4 A;  5LMU B;  2ZIO A;  5B3S C;  4GYC B;  2IJI A;  1KBH A;  1FPO A;  1JR9 A;  2LQT A;  2Q8V A;  1FFT B;  3OFN G;  4J9Y B;  1XL4 A;  4UCR A;  4DYL A;  4DV7 B;  4J80 A;  3E83 A;  2WLL B;  3CCL V;  2KSD A;  1P49 A;  1RPO A;  2RMK B;  2WLI A;  2N74 A;  4QE9 A;  4DR7 O;  4GKJ O;  3ABK C;  1NH2 B;  5JWP A;  4I7Z B;  2H94 A;  2QTO A;  2JJ1 G;  4FPP A;  1SQQ H;  1JFF A;  3T1Y O;  2E5L B;  3RT3 C;  3DGE A;  1WP7 A;  4HAM A;  3STZ C;  5EIB D;  3DC6 A;  2HVJ C;  2GUZ A;  3HKE B;  1K34 A;  5KHJ A;  1WA8 A;  2W6J G;  4X8A A;  1UPG A;  1XBL A;  4ZHQ B;  1N0J A;  1N34 B;  3JSN A;  1LUV A;  2DWD C;  3CWB H;  4JAU A;  1MAB G;  4DV4 O;  1NTK H;  2W0X A;  4PDM A;  2OIE A;  3RYC B;  1W0J G;  2KB1 A;  4GKK O;  3DSQ A;  1I0H A;  3CCM V;  3AG2 B;  1Q7Y W;  4NXN O;  3CCR V;  1WJZ A;  3FB5 C;  2F23 A;  2OYQ A;  3UM7 A;  1THZ A;  4DUY O;  2PYJ A;  1N33 B;  2OIG A;  4CS3 A;  4Q20 A;  3ABT A;  5JH7 B;  1F23 A;  1U97 A;  1G8M A;  1L8D A;  5B1N A;  4O4L A;  1Q43 A;  5DM6 V;  3OM3 B;  3A0B Z;  2A3Q A;  4LNU B;  4ASU G;  1WAZ A;  3K04 A;  1OJH A;  2QKS A;  3QTC A;  1VQ7 V;  1GMG A;  3BEH A;  2AHY A;  4FFB A;  3BPZ A;  4FLU A;  2OTJ V;  3C90 A;  3G80 A;  2YC0 A;  4DV3 B;  1H2S B;  2HLD G;  1IBL B;  3GVM A;  1P7B A;  5LHI A;  4I9Q A;  2OTL V;  1T5E A;  3G71 V;  4GT1 A;  1ARO P;  1EZV H;  1GN4 A;  2Q5Z A;  3FAV B;  4LF8 B;  3ZMZ A;  1WA8 B;  2ZE5 A;  5FL7 G;  4X88 A;  4MTO A;  5EBW C;  5IYC O;  5L3C A;  4FMT A;  3ZX6 A;  1EM1 A;  5IYZ B;  1XNR O;  4JF3 A;  3CE2 A;  1KU9 A;  4J7Z A;  3L73 H;  2ZXW C;  1AJN A;  4LF6 O;  1Y6X A;  2Y69 C;  1FYJ A;  4JI3 O;  1GTO A;  3DC5 A;  2WWW A;  1VQM V;  1BL8 A;  1ZWI C;  3ZHS A;  1YJ9 V;  5LL6 Y;  2DWE C;  4CH6 A;  1BS3 A;  1B3Q A;  2YSU B;  1BHA A;  1K4C C;  1SET A;  1SS3 A;  4O2B A;  4F6E A;  4DW0 A;  3CRA A;  3AK3 A;  2ZNJ A;  4EB6 A;  2XAS A;  3ABM B;  5CMU A;  2H3O A;  2UUC O;  2LGQ A;  1ZL8 A;  5EZY A;  1P4R A;  2BOB C;  3EFF K;  4K8X A;  3EXA A;  2ZR3 A;  4D7S A;  1AVM A;  2P4V A;  1OV9 A;  3A2F A;  4WFH A;  3KCY A;  1KD1 W;  2Y4U A;  3CME V;  2YDE A;  4JI4 B;  1VQ5 V;  2QWP B;  3SJB C;  1LR1 A;  4JI7 O;  1TAE A;  5LP6 A;  2CTR A;  2DYS C;  4I0X A;  2F66 C;  4UVC A;  2P5O A;  3I56 V;  1OZ0 A;  2ADQ B;  2P6J A;  2UXN A;  3RYH B;  2ZCE A;  5EIB C;  2PI4 A;  2P06 A;  3ZHU A;  2UUB O;  4JTC B;  2AW9 A;  5IE9 A;  3KG2 A;  1FJG B;  4GZR B;  4NXN B;  1AJP A;  1NTM H;  1IX9 A;  3LNM B;  5IY5 C;  4IIJ B;  2K9P A;  2PI5 A;  2ZR2 A;  3E22 A;  3GB7 C;  1D5A A;  1VQP V;  2DQ0 A;  2GSM B;  4DUZ B;  2A7W A;  1NVP B;  4UB8 Z;  4UVB A;  1KUQ A;  2V4D A;  5GTH Z;  1RSO B;  4H0L B;  4NXM B;  1PV0 A;  1ZTE A;  5B5E Z;  1F7Y A;  4X65 B;  3HKE A;  4GX5 A;  5ITZ B;  5LMU O;  1N36 O;  1D5N A;  4UV9 A;  4Z1M G;  3WFV A;  2NLJ C;  2YI8 A;  3N2K A;  3ZRX A;  3ZBH A;  1Y74 A;  4H37 A;  2DW4 A;  3WB1 A;  3N27 A;  3AG3 B;  2AGA A;  4JI3 B;  2ARH A;  4KL1 A;  1K97 A;  4U7O A;  4DK0 A;  2D3O W;  5BXZ A;  4RO2 A;  3JAK B;  1XHZ A;  1AI4 A;  3IJ4 A;  2UXC B;  4G27 B;  1IXB A;  2FYU H;  2QKC A;  2QTS A;  3JAW B;  3ZED A;  4CC5 A;  3MHH C;  1XMO O;  3K03 A;  1LUW A;  2IH1 C;  4JI2 B;  3P30 A;  5CA3 A;  2IU3 A;  3CMA V;  1NU1 H;  4H33 A;  2HJD A;  2YEV A;  2WPD G;  1XIL A;  4ZBM A;  5LP6 C;  2ODM A;  2RQ6 A;  4QPK A;  2UXX A;  2Y0P A;  1IUR A;  5C8Y A;  3OMI B;  2XAF A;  4KHP O;  2KG7 B;  3RW0 A;  1GN3 A;  2XAG A;  2DYR C;  3SPJ A;  1I08 A;  4PA6 A;  4O4L B;  1YCI A;  2ZIN A;  4MVR A;  4R6Z A;  4YHH O;  4P2Z A;  3H01 A;  4B7K A;  1Q6U A;  2LFR A;  3RYH A;  3D36 A;  4X66 O;  4PD4 F;  2R9R B;  3FX7 A;  1JPX A;  2QGN A;  3JAW A;  5LA6 B;  1W0K G;  2BTQ B;  4DV6 O;  5LYJ A;  2NR5 A;  2JS5 A;  1E1Q G;  4JGS A;  1CPY A;  3A0H Z;  3JAT B;  5KA6 A;  5L3F A;  1H8H G;  5KUK A;  1MSW D;  2XAJ A;  4FZ0 A;  5JJN B;  1M9N A;  4XBF A;  4DXW A;  4FLZ A;  5H5N A;  3K5M A;  2X6B A;  1O9H A;  1SC5 B;  2V1D A;  3AG7 A;  2P7T C;  2LW7 A;  3CYO A;  5HFM A;  1JOY A;  2EIK C;  2UU9 O;  4JYA O;  3JCU Z;  3T1H B;  4GX1 A;  3SYQ A;  2D2C B;  4D6T H;  4GCZ A;  4TV8 B;  1RSO A;  1VQN V;  4DR7 B;  1I94 B;  4LH6 A;  2XHB A;  1B6Q A;  1XOU A;  3ZN1 A;  4O4J B;  1R3K C;  4TV9 A;  4OGQ B;  1Y4M A;  1FXH A;  1M93 A;  2GUZ B;  3F5W C;  2Q6A A;  3SDL A;  4K35 A;  1ZUQ A;  1YVW A;  2RN9 A;  1K5S A;  3CRR A;  3SPH A;  4JI5 B;  3CC7 V;  1JX9 A;  1ZX3 A;  5KX5 A;  5FPO A;  2GHY A;  4BIU A;  1FD9 A;  4DUY B;  3E2E A;  3SJC C;  3L75 H;  5GW7 A;  4ZOL B;  1FKA O;  4PEL A;  3SYO A;  2WLM A;  1FXK A;  3L9D A;  1NBM G;  2EJR A;  4TV8 A;  1RPR A;  4FIP C;  4RWU A;  3ZJZ A;  3IGA C;  1M56 B;  4BAY A;  3QO5 A;  1YJN V;  1WNS A;  3TXQ A;  3LSQ A;  4UVA A;  1NQT A;  4JAV A;  5GTI Z;  2QWN B;  4L87 A;  3CEI A;  2K1E A;  4YIP A;  3G6E V;  2EIL C;  1HNX O;  1OCR C;  3ZN0 A;  3W7S A;  4GUN A;  2M7W A;  4JI1 O;  2XOK G;  5L3G A;  3T4D A;  2DJV A;  3SR2 C;  4O4H A;  5BR8 O;  3JCZ A;  4LFC B;  1Q90 D;  2FB5 A;  3JD2 A;  4EEQ A;  1RP3 B;  1Y74 B;  4AIL C;  2ZE8 A;  1IXM A;  1PP9 H;  2PY5 A;  5KLV H;  5JQG B;  1JJO A;  4NR1 A;  1KKD A;  4TQD A;  4JV5 B;  4FVM A;  2R9I A;  1O9G A;  4YJ2 B;  4YJ2 A;  1HNW O;  4UCO A;  1SQV H;  3E8G A;  5KHI A;  1Q82 W;  3T1H O;  3B4S A;  3UT5 A;  4MVQ A;  1R6K A;  2O57 A;  4DR4 O;  3OMA B;  4BW5 A;  3ZHT A;  4X1K A;  3T4Z A;  5J2T A;  1PKX A;  2PTM A;  1P84 F;  4JI8 B;  4NTW A;  3E35 A;  2Q68 A;  1X59 A;  1JMK C;  3K0G A;  5JH7 A;  2NNU A;  1NVP D;  3U11 A;  1NT2 B;  3ZIA G;  4U3J B;  1CEZ A;  1KC8 W;  1TUB A;  4NTX A;  2XAQ A;  2H8P C;  1Q3E A;  4X1Y A;  2IW5 A;  3G67 A;  2UXD B;  1P7G A;  4FK5 C;  3AG3 C;  3ZS8 C;  1YDX A;  4DRX B;  1VQK V;  1YZB A;  2BOC C;  1QHT A;  3RN4 A;  4U7N A;  1QLE C;  4LFB O;  3SYP A;  4Z1V A;  2EIN B;  1XRE A;  3JD3 A;  5EBM C;  4HNA B;  5IYB O;  1Q5O A;  4LF4 B;  4X1I A;  1Q6I A;  3K5L A;  3ABL C;  3OTF A;  4YY3 O;  4LF9 O;  5L3B A;  1TGO A;  4LF9 B;  1SA0 B;  2JDI G;  3EHB B;  2Q0A A;  5EK0 A;  4MW8 A;  4LF4 O;  2GV9 A;  4JPR A;  1J95 A;  2Q67 A;  1V54 B;  4LFB B;  5A2Q N;  4W4L A;  2P22 C;  2QM8 A;  1AP5 A;  2ZE7 A;  2Q0O C;  4CH3 A;  1R3L C;  2Q9L A;  3CCV V;  4RUF A;  4E4E A;  4I0X B;  4B3T O;  1VQL V;  5IYZ A;  2V7Q G;  4FLT A;  3K59 A;  4DK1 A;  2P4K A;  4DV5 O;  2YEV B;  5LBQ A;  1XUQ A;  1OCC B;  4U3J A;  2Y69 B;  3ZRV A;  2BE3 A;  4OX9 O;  1VP7 A;  1TA8 A;  3APQ A;  4X9Q A;  2E74 B;  2N05 A;  1Y67 A;  2QWQ B;  4NB5 A;  3H1K H;  1GO3 F;  4TWK A;  3HKD A;  1H2N A;  1EN5 A;  4TT3 G;  4MTF A;  2QKA A;  2QWO B;  1H8E G;  4MVU A;  3BY6 A;  5ITZ A;  3CS5 A;  3R66 A;  2YI9 A;  1NR7 A;  3CCU V;  2PF4 E;  4A5U B;  4QNH B;  1L0N H;  1H38 A;  2ZNI A;  3K9S A;  5D5Q A;  1PPJ H;  2CUG A;  2P67 A;  4KXR A;  3S3X A;  1V9P A;  5IYD O;  2LGW A;  3D3I A;  4LF7 O;  3LSU A;  1JQ0 A;  3DTU B;  4UV8 A;  3JAT A;  4ABM A;  1XMQ B;  1YI2 V;  3FKS G;  1DF5 A;  2ETN A;  1QR9 A;  4JAS A;  4LH7 A;  4UB6 Z;  2AXT Z;  3OGI B;  3OTO B;  2JS3 A;  3CP1 A;  2VQE B;  1SF9 A;  2YIC A;  4N21 A;  2A9H A;  1V55 C;  1SQG A;  5B1B C;  3ZRW B;  5LGT A;  3KCX A;  2ZD9 A;  4EFE A;  4XDJ A;  2X6C A;  5FNV B;  2GBO A;  3OE7 G;  3CCJ V;  1KKC A;  4DR6 O;  4BIO A;  1K73 W;  5LHH A;  4FJC C;  2EZP A;  1HWY A;  4O4H B;  5TIS Z;  3X2Q B;  4LFA B;  3WG7 B;  3H1L H;  4DO2 A;  3HKC B;  2IJJ A;  4DV2 O;  3LDE A;  1S72 V;  2P90 A;  3T2M A;  5CN0 A;  1KP2 A;  3U0Z A;  1M5I A;  1LNQ A;  2WAM A;  2IJH A;  4QE7 A;  4JI4 O;  1JA8 A;  5H6Q A;  4AQY B;  2YS8 A;  2ZQM A;  4LR3 A;  4NTY A;  3K57 A;  4U3F H;  2WLH A;  2Q73 A;  2ZM6 O;  1SKV A;  4H44 B;  2UUA B;  4IHJ B;  2LO1 A;  1S3J A;  5J2T B;  1IBK O;  2Z5U A;  5IJ0 B;  4DR1 O;  4PJ0 Z;  2Y4T A;  5CA0 A;  2XUM A;  4BWA A;  4I55 A;  1Q8I A;  4YJ3 A;  5H9C A;  1M4U A;  1OCZ B;  2HVK C;  5BMV A;  5IJ9 B;  3APO A;  4RUE A;  4DR4 B;  2CAZ C;  4FLW A;  2QA4 V;  2RCV A;  4O4I B;  1YHQ V;  1OCO C;  3CPW U;  1SZT A;  1BQZ A;  5EC1 C;  2EBO A;  3E86 A;  3B09 A;  3CCS V;  1TUE B;  5K1X A;  2EIJ C;  4MVO A;  4X62 B;  1N32 B;  3NXS A;  1Y76 B;  4PI2 A;  1KQS U;  4O4I A;  1KB9 F;  4QJF B;  4LFC O;  1OCO B;  4P9P A;  3HB3 B;  4G2K A;  1AJQ A;  1S0V A;  3HKB A;  3R65 A;  1AI7 A;  1IBK B;  1N4C A;  2XTA A;  5C8Y B;  1HR0 B;  2A0L A;  5CBF A;  5GON B;  2BSK A;  2Q7E A;  4DR1 B;  2MK3 A;  1B04 A;  3CSX A;  1OCR B;  3RWR D;  1VQ4 V;  2QDO A;  2JJ2 G;  2BCC H;  5KMG B;  1PL0 A;  4DUZ O;  2NN4 A;  4MS2 A;  3ABL B;  3FB6 C;  4YJ3 B;  2JK5 C;  1KEC A;  4YHH B;  2F95 B;  5H2F Z;  3BA8 A;  1GKF A;  3EVK A;  1XQ8 A;  1XNQ B;  5LA6 A;  2OCC C;  1YIT V;  1NKD A;  1Q86 W;  1E1R G;  4LFA O;  4OXS A;  3OMN B;  3OUF A;  2Y48 A;  5BZB A;  4WBN B;  1TVK A;  4QIW F;  3L72 H;  2B5U A;  3JD0 A;  4YIO A;  2KG7 A;  4PDR A;  2YUA A;  5GON A;  4XDK A;  4FLV A;  3J7A U;  3SPI A;  1U96 A;  2X7R B;  1AR5 A;  4GLX A;  4B3S O;  3LUT B;  4ZKI A;  4J42 A;  2QSA A;  2E3C A;  1FXK B;  3IAY A;  3CRC A;  3IC7 A;  4XDL A;  1FFX B;  4N23 A;  3OW2 U;  4DR3 O;  3LDC A;  4DR2 O;  4GKJ B;  3L70 H;  5EYP A;  4I55 B;  1Q6H A;  1S5J A;  3QG5 A;  4LF7 B;  3H1H H;  3K0D A;  1ZLZ A;  3OR7 C;  2IH3 C;  2R9A A;  3MAQ A;  1XEQ A;  4UCU A;  1YJW V;  2OWO A;  1R6N A;  4PA3 A;  2JEX A;  3B8N A;  3BAA A;  2Y0I A;  2JGU A;  3VQW A;  2EX3 A;  3BCC H;  1CXZ B;  4R7C A;  3BVO A;  2E76 B;  3T1C A;  1YTF D;  2HJF C;  3E22 B;  4X62 O;  3JAS A;  3E8H A;  4WCE V;  3VBB A;  3M7M X;  4FFB B;  1SQF A;  4LF6 B;  5LOV B;  5LOV A;  2IM9 A;  4B3T B;  5LGU A;  1XNR B;  4IYH A;  4O2A B;  1VF6 A;  2DMX A;  2Q7H A;  1HDJ A;  1ENV A;  4ZIB A;  3JAL B;  1XHX A;  4TQF A;  1L0L H;  4DW1 A;  4QGP A;  4OPH A;  4WF9 V;  4F6R A;  5JVD B;  4NVP A;  4ZI7 B;  4I50 B;  4P9O A;  1S76 D;  3CD6 V;  4I9W A;  2VRZ A;  2ITC C;  1ZL8 B;  4JI1 B;  1VF6 C;  4PDV A;  5FLX N;  5IJ0 A;  3OEE G;  1OCZ C;  1Y66 A;  4QPJ A;  1PNK A;  5FPR A;  2UUA O;  1GM9 A;  5CA1 B;  1W2B U;  4LWS B;  1IVS A;  4JI7 B;  2JIZ G;  4PA7 A;  1SQP H;  4CH4 A;  4PA9 A;  4PA4 A;  1VQO V;  3QF7 A;  4I50 A;  4LP8 A;  3LNN A;  2QJ1 A;  1PL4 A;  2C2A A;  4FLY A;  3S3W A;  5J9P C;  2CE4 A;  1YEW A;  4Q6G A;  1HP8 A;  3H1I H;  3JAR B;  4TUY B;  3SYC A;  3W7X A;  1M90 W;  1ZAU A;  4C7U A;  2EIM B;  3OD4 A;  1RM1 C;  3AK1 A;  1X4T A;  3K58 A;  3VQX A;  1URF A;  1JFF B;  1GK9 A;  4KP4 A;  3MD0 A;  1IDS A;  3TET A;  4EB6 B;  4W4K A;  2HFE C;  4H13 B;  3B2E E;  4HNA A;  4TSF G;  3GWK C;  1SES A;  1EN4 A;  4TV9 B;  3CJH A;  2XND G;  3E89 A;  1EFR G;  3H1J H;  1R73 A;  2JVD A;  4JI8 O;  1XDC A;  1N34 O;  3WG7 C;  1QR8 A;  3THO A;  2B9Z A;  3PN1 A;  4X64 B;  3GWO A;  5CA1 A;  3P3P A;  2BSK B;  4NYK A;  1I5Y A;  5CBG A;  3E8B A;  3CXH F;  3B8M A;  2IU0 A;  1QLN A;  2YXL A;  3VQV A;  3ZHR A;  4DV1 B;  3UT5 B;  3OAA G;  1BT8 A;  2CTQ A;  3CRM A;  3OTO O;  2XAH A;  1R3I C;  1AR4 A;  4DV0 B;  2YXH A;  3W7W A;  5KMG A;  3RBZ A;  3WB0 A;  1YTF B;  2HR3 A;  4F4L A;  3L74 H;  1DLB A;  1BQ0 A;  2DN9 A;  4HBN A;  1F4N A;  1K92 A;  3N2K B;  1N8R W;  5L3D A;  5BMV B;  1A32 A;  2WSS G;  1FS0 G;  5E79 Z;  1FJG O;  1KYO F;  4JYY A;  4JYC A;  5IWA O;  2EIJ B;  5IY5 B;  1YIJ V;  4X64 O;  3CCQ V;  4P30 A;  3TK1 A;  3VQY A;  1BHB A;  1M57 C;  1FXK C;  1WN7 A;  2M6Y A;  2IJK A;  1M56 C;  3F7Y C;  5JVD A;  4DR3 B;  2FML A;  2EIL B;  4G28 B;  4MVM A;  2LW1 A;  1SER A;  3CHX A;  1EBO A;  2JEU A;  4OX9 B; 
#chains in the Genus database with same CATH homology
 2OCH A;  1N4C A;  3UCS C;  3APQ A;  2QWR B;  2QWN B;  4J7Z A;  1FPO A;  3UO3 A;  2GUZ B;  2N04 A;  2DMX A;  1HDJ A;  3APO A;  2KQX A;  2LO1 A;  2N05 A;  2PF4 E;  2QWQ B;  2YUA A;  4IT5 A;  2CUG A;  2CTW A;  3BVO A;  2LGW A;  4RWU A;  2Y4U A;  2DN9 A;  1BQ0 A;  2L6L A;  2M6Y A;  4J80 A;  1IUR A;  1GH6 A;  2QWP B;  3AG7 A;  1NZ6 A;  2GUZ A;  2Y4T A;  3UO2 A;  1FAF A;  1BQZ A;  2CTP A;  2YS8 A;  2EJ7 A;  2CTQ A;  2QSA A;  2QWO B;  2CTR A;  1WJZ A;  1XBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...