3UCSC

Crystal structure of the complex between cbpa j-domain and cbpm
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
GSELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between CbpA J-domain and CbpM provides a link between chaperone and transcription regulation in bacterial heat shock response
rcsb
source organism Klebsiella pneumoniae
molecule tags Chaperone
molecule keywords Chaperone-modulator protein CbpM
total genus 25
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3ucsC00
2Y4UA 1HDJA 3UO3A 2N05A 1GH6A 2YS8A 2DN9A 2QWOB 3UCSC 1FPOA 2YUAA 4J80A 2CTWA 2PF4E 4RWUA 4IT5A 1XBLA 2KQXA 2CTRA 2QWRB 2Y4TA 3APQA 1NZ6A 1BQZA 2L6LA 1FAFA 2EJ7A 2M6YA 2OCHA 2QWNB 4J7ZA 1N4CA 2LGWA 2N04A 1IURA 2QWPB 3AG7A 2CTQA 3APOA 2QSAA 2LO1A 1WJZA 3BVOA 2DMXA 2QWQB 3UO2A 2CTPA 2GUZB 2GUZA 2CUGA 1BQ0A
chains in the Genus database with same CATH superfamily
3T1HB 4YIOA 3FB8C 5EZYA 3GVMA 5CA1B 4ZBMA 2DYSB 2LFRA 4KL1A 1PNKA 5BMVA 4WFAV 1HW7A 2WA4A 3RT3C 1W59A 4IIJB 4WFEA 3UQ8A 5B1AB 1H8EG 4K0KO 3J81N 2ZT9B 2F95B 1RFYA 2CUGA 4TV8B 2P67A 3K5LA 1VQ7V 1BQ0A 3KZIZ 3JARA 2UXCO 5D5PA 1K9MW 4TUYB 2IJJA 2EILC 1F4NA 3S3XA 1FFTB 3SYOA 4DV2O 2KG7B 2WWWA 1I5XA 2CTRA 2M7WA 2UUBO 2DYSC 3ABTA 1R73A 3RYFB 1YZBA 2YDEA 3LUTB 4MS2A 4K0KB 4GUNA 5E1AC 4JZ2A 2EX3A 3TXSA 2ZD9A 4CS4A 4FPPA 5IWAO 1XQ8A 2P06A 4QPJA 3HKEB 3MAQA 5LP6C 3DC5A 3E22A 4EEQA 4WF9V 4U7NA 3CC4V 1JCHA 3P3NA 3S3WA 3NR7A 1P84F 3ABUA 2A06H 1IDSA 2B1GA 4IGGA 3K79A 4NXNO 1HNZO 4JTAB 1OV9A 3ZIAG 1BGYH 4LH7A 1YF2A 2L35A 1R3LC 3E35A 4JV5B 1VQLV 5H6QA 5GONB 1FAFA 4F6RB 4G2KA 5JJJB 2YS8A 5LA6A 1QNMA 3D36C 5CMUA 1PV0A 3CB2A 3T4ZA 3O9OA 4PDRA 4AQYO 2EIKB 3CCQV 1BQZA 4O2BB 2ZM6B 2YC0A 4I50A 4DR4B 2IJHA 1Q8IA 2HLDG 4DV3O 3SYAA 3ABKB 4CS2A 4B3MO 1JMKC 3K59A 3RYHB 1CPYA 3DGEA 1IBLB 3ZX6A 1GH6A 4MTGA 4GKJO 4BR6A 1EFRG 5IJ0B 4TQFA 1K34A 2CGOA 1JPXA 3JD3A 4YIPA 4DR7O 2L6LA 3E8GA 1GO3F 1FXKC 1G6UA 4GX5A 4LFAO 2FTKA 1QHTA 5K1PA 1XHZA 1AJNA 4CBCA 1SF9A 3LSQA 1I7FA 1H38A 1WPBA 4DR6O 3OM3B 2Y4UA 2KB1A 5B5EZ 1Y76B 4IYIA 2UXDO 2W0FC 4DV6O 4CH6A 2JIZG 1K8AW 3ZHUA 1TAEA 1GN4A 3L75H 3N27A 4TOIA 5DM6V 3ZEDA 1M57B 3SJQC 1FXKA 1XMOB 4J7ZA 2ZXWB 4UCUA 3OGIB 4DR5O 4K3AA 1OCRC 4O4HB 1THZA 1QLNA 4WBNB 4I9QA 5J2UB 2A3QA 5IYBO 2KSDA 4PDLA 2ODMA 3JD1A 3FB5C 1QQCA 3SYCA 2ZINA 4JZGA 2CK3G 2EINB 5BR8O 3PJSK 4HNAA 3TXQA 5JQGA 3A0HZ 4XBFA 4NXMO 5KAIZ 2BSKB 2JRIA 5FLXN 2YEVA 1VF6C 4LCUC 5CA1A 4N23A 1S77D 1XBLA 4LF9O 5LOVB 3ZRSA 3BABA 4QE9A 1IXBA 3CX5F 3K58A 5JCOA 2D2CB 2QM8A 2A79B 4GCZA 4I4TA 1J95A 4EKWA 3RYCA 2Q7GA 1GN3A 2UXCB 2Z3YA 5TISZ 5LMNO 3GWOA 1AJQA 3R65A 1IBLO 2ZE7A 2OTJV 3F5WC 1M9NA 4X89A 3CCVV 2LW1A 3QVNA 3RVZA 5DEDA 4DV3B 2M6YA 1KKDA 3BY6A 1JA8A 3AK3A 4H0LB 4X1KB 4MSWC 5KAFZ 4AILC 3HKBA 1PP9H 4PA3A 5KA5A 2LO1A 3UO2A 1VQ9V 3CJHA 1N34B 4UB6Z 4K8XA 2LW7A 1Q82W 4IL6Z 2WLIB 4X62O 2LFSA 3JAKA 3SPCA 3LSUA 1S0VA 2YXHA 4F6EA 4EFEA 5KUKA 2JK5C 1K4CC 4YJ3B 1GKFA 1AP5A 1NT2B 1QLEB 2EIJC 4FM2A 4MTFA 2OT5A 3ASNB 4X65O 2WLHA 1NU1H 1NR7A 1RSOB 1AB3A 5H6RA 4JGSA 4OGQB 3UO3A 2AZ2A 4LFBO 4J41A 3E8FA 5LL6Y 2K1EA 2XAJA 3K9AA 3H1IH 1YI2V 4LFAB 3L9DA 2UXXA 2VWKA 2X7RB 2EIJB 4D6TH 3THOA 3G4SV 2HJFC 3ASNC 2E76B 5IYCO 2JJ2G 4GX2A 2UXBB 1PPJH 1K7DA 3H1HH 2XAQA 2E74B 4RUFA 1WN7A 4Z2WA 4Q20A 3F7YC 2E5LB 1ORQC 1YTFB 2DE0X 2K9PA 2OCCC 2CTPA 1K5SA 1OCRB 4WFHA 1YIJV 3Q4HA 5KMGA 3K5OA 5JJEB 4MVOA 2VQFO 2HFEC 1WA8B 4MW3A 2BCCH 3JSLA 2ZIMA 4WFBV 1URFA 3LDDA 3WFVA 1US6A 4UCTA 2CE4A 4J42A 4OPHA 4DR5B 4RQFA 1MNGA 4JTCB 3ZMUA 1YHQV 3ABMC 2Z0AA 3QO5A 3CRQA 1VQ6V 3T1CA 4J10A 4JI3O 2CH7A 1VQ8V 1TUBA 4B3SO 1FPOA 3CPWU 2JJ1G 4X64B 1WP7A 3CP1A 3B2EE 2AHZA 4L8JA 2DQ0A 3CJHB 4FLYA 5KHHA 3U10A 1NBMG 3HPLC 2ITCC 2WLKA 1K33A 1GAXA 3EHBB 1H2MA 2GUZA 3BA8A 3G80A 1E1RG 3KCXA 2B1IA 4JI5B 2EZPA 1MZFA 2GTAA 4DYLA 1Q43A 2PYLA 1V9PA 3AG1C 4MVZA 2ADPA 1I94O 3QTCA 5LGUA 1BZKA 4UB8Z 5KHJA 1XREA 2Q9LA 2RNBA 5B1AC 3K57A 5CA3A 3EVKA 1HDJA 1NTKH 3BA9A 2XTAA 3UKMA 4BAYA 1P4RA 3H1JH 1DGSA 5J2TA 4G28B 3H1LH 1DTOA 2PUSA 2P4VA 4WCEV 2QEXV 4F4LA 4UVCA 3OD4A 5KHIA 4JAUA 2DMXA 1EZJA 2GBOA 3E83A 5FNVA 1WB8A 4J7KA 1GK9A 2VQFB 1YJWV 1GRJA 1GMGA 4QJFB 4MVMA 5IT9N 2Q0AA 3B8MA 5LXTA 4LF7O 3RN4A 1TUEB 4LNUA 1AI7A 1Q86W 1RM1C 1KP2A 2LQTA 4J9YB 3JD0A 3T2MA 1UPGA 5LHHA 2BOCC 4ASUG 3AG3B 2Q7HA 5J2UA 4HBNA 3E8HA 2XUMA 2UUCO 4ZOLA 2AW9A 2QKAA 3W7XA 3ABLB 2YI8A 1I5YA 3L72H 1VEWA 3ZJZA 3ZMVA 2WLNA 2OTLV 4X9QA 3APQA 1XMQO 3AG1B 3L70H 2Y69B 2BSKA 3HKCB 3JD4A 5LP6B 2PI5A 2GTSA 3ZRWA 3OUSA 3DTUB 2YIBD 2QE7G 4WFGA 2FYUH 3KG2A 4X1YB 2XHBA 1IZ3A 3D8CA 3DXRB 1QR9A 3OT7A 1D5NA 2ZXWC 1MA1A 4PA7A 4B3MB 1VF5B 4D7SA 1EN6A 5JJNB 2YIDA 3ZHRA 1VQ5V 2QR4A 2E3CA 4PI2A 2JS5A 1BL8A 1Z2GA 3LSSA 1H2GA 2DW4A 3OTOO 1L0LH 4MT8A 3OTFA 3NXSA 3F7VC 1CEZA 1L1FA 5CB4B 4TT3G 4D7TA 1B3QA 3JAKB 5EYPB 5IY5B 1WLEA 2CTWA 1VIBA 1N0NA 2XAFA 3ZHVA 4YJ3A 4H44B 2H3OA 3I55V 1R3JC 2RMKB 4JI7O 5IE9A 1S3JA 2VQEB 4AQYB 4R50A 5EBMC 3CC2V 1NKDA 1L8DA 5ITZB 1PNLA 2IW5A 1EBOA 4LF7B 4DV0B 2E5LO 3B77A 3L71H 3AG2C 1WPXA 4DV2B 2CGNA 1MSWD 1M57C 3LNNA 4TV9A 1BHBA 3E86A 3VQWA 5FNVB 3MDSA 1Q81W 2QWNB 1AROP 4FLXA 4NXMB 2WAMA 4O4JA 4B3RB 4XDJA 4LF8B 1BS3A 1P7BA 2H94A 5BR8B 4UCSA 1DLBA 3T1YB 2ILMA 4U7OA 4PELA 3ZMZA 3FAVB 3ASOC 1R3IC 3RYIA 2DYRB 1VQNV 3CYOA 1IXMA 4B3TO 1JQ0A 5CA0A 4JI4B 4FLUA 1XNQO 1FD9A 3K0DA 5C8YB 1I94B 2P4KA 1SETA 1JVMA 2EBOA 2GSMB 2XOKG 4W4KA 3JALB 1OCCC 4JYAO 3A0BZ 1SC5B 4FFKA 3CRCA 2GHYA 3VQVA 4FFBB 5LP6A 3OE7G 2FB5A 4OPAA 4FMTA 4ZI7A 3M7MX 4P9PA 1Q5OA 1WNSA 4X1YA 3I56V 2BTQA 5EIBC 1AI6A 3G67A 4Q6GA 3N2GB 1MABG 4X1IB 5J9PC 2F4VO 4DUYO 3CD6V 3ZHQA 4JI3B 4DK0A 4DR1O 3BEHA 1MSDA 4JI2B 1SQBH 4ZHQB 2LP7A 1IBKO 1OCCB 3EFFK 3DXRA 4I55A 4JI2O 4DRXA 5EIBD 5B1OA 1EN5A 1M4UA 1YJNV 2V4DA 4W4LA 4NXNB 1SRYA 2Q68A 4DR3B 3RGBA 1H2KA 1R1BA 2ZQMA 4DK1A 2F1MA 4YY3O 1B04A 4QIWF 3ZN0A 2OIEA 5KHKA 1Y4MA 2Q0OC 2QWPB 1B6QA 1ZUQA 3D3IA 2DWDC 3BVOA 4JI0O 1NH2B 5EYPA 4LF6O 2GUZB 4LF6B 1HR0B 1SQQH 3ZHTA 4B7EA 1N33O 3CE2A 2UUAO 4J80A 1VARA 4GX1A 1JR9A 3PN1A 3OFNG 2HKOA 4UCRA 3CC7V 4EFBA 3I5DA 3FYIB 5GTIZ 3FKSG 2X0LA 1K73W 4JYYA 3JYCA 1KD1W 2JGUA 1F4MA 3FAVA 3JSNA 2Y69C 2R9AA 1YDXA 4EB6A 1XL4A 1TA8A 1VF6A 2FMLA 4DV5B 1IBMO 5DN6G 3LNMB 4JI6B 3OEHG 5KA6A 2V1DA 1WP8A 1OZ0A 4E4EA 3JCZA 4FJCC 2QDOA 4NTYA 4O2AA 3STZC 3WB1A 3L73H 2BE3A 2AGAA 4R7CA 3ZBHA 3K5MA 1N0JA 4X20A 4YJ2A 3G71V 2LJ2A 5CBHA 4PA9A 2R70A 1G4YB 2W6IG 2OYQA 1MMMA 5C8YA 1M56B 3OMAB 4PV1B 4HAMA 2YXLA 2Y0IA 2JVDA 1N32B 4WBNA 4DV1O 3JATA 4P9OA 4H33A 1YCIA 4RAIA 3HKDA 4L87A 2RQ6A 4ZHQA 4JYCA 3T4DA 2ATKC 1GN2A 3N2KB 5DECA 2PI4A 4LF5O 3IAYA 4X88A 3HKCA 3AK1A 3CXCU 2A0LA 1M56C 4P2ZA 1EZVH 3RYFA 2EJRA 3WB2A 3CCJV 2XASA 5B1NA 3KCYA 1V54B 5EC1C 5B1BC 1K3EA 4B3TB 1SERA 2RJZA 3AG4B 4UCVA 2P6JA 3C3TA 4DO2A 1I08A 4RUEA 3TK1A 1HR0O 2BTOA 3SYPA 4JAVA 1Q90D 2GDSA 1R3KC 4DW1A 3D36A 2XNDG 1WAZA 3IJ4A 2QWQB 2Q67A 5IYZB 1D2DA 3RYCB 1N36B 4UFZA 3F5TA 3B09A 2HR3A 1LUWA 2RDCA 3J7AU 3ABLC 4IIJA 4GKKO 1GM7A 2HEPA 5L3DA 4LWSA 1XMQB 4KXRA 4PDVA 4TV8A 2OCHA 3CMAV 1XNRB 4KHPO 4TUYA 2ZCEA 4J11A 1ZSPA 4ABMA 3JAMN 3E8BA 4I50B 4RQEA 2ZIOA 1SQPH 3A8TA 2WA3A 2JEUA 3ASOB 4DV6B 3AG2B 4JPRA 4ICGA 4R8CA 3JD2A 3HKEA 1X4TA 3E22B 1VMGA 1WB7A 4MTXA 2Y48A 4H37A 3BAAA 4DR1B 1JFFB 3IFXA 5L3BA 2PYJA 4MW8A 3GWKC 2CAZC 4GZRB 3RYIB 2WLMA 1XEQA 1SQVH 3RYHA 4DV1B 4LFCB 4LH6A 3K9SA 1P7GA 2NLJC 3QO7A 4JYBA 5GTHZ 4MTOA 4TWKA 5LA6B 2F66C 2RCVA 1ZTEA 4CC5A 1MZEA 2ZM6O 4GX0A 1RPRA 3SR2C 1R6NA 2DWEC 1BE3H 2Q4PA 4YXWG 5BY1A 1Q6UA 4IYHA 2Q7EA 3MHHC 4MVUA 3SJBC 4NB5A 4MVSA 1Y76A 2G38A 2OIGA 2AHYA 2W0XA 4FLTA 1G1XB 1XNRO 4KHPB 2IJKA 2B9ZA 1A32A 2X6AA 4DUZB 2QM4A 1HNXO 1OHHG 3N2KA 1BMFG 1RPOA 2HHHO 3D3QA 1S5JA 1N36O 3ETQA 1VQOV 4FFBA 3CS5A 4I9WA 5L3FA 1S5HC 2X6BA 2EJ7A 4LFCO 5AG2A 4JYAB 1ZWIC 4ZKIA 1X59A 1TGOA 2QM7A 3FFQA 4I55B 2UUBB 3AK2A 2P5OA 4JI1O 1OJHA 2N05A 1KECA 4I7ZB 3BPZA 4OX9O 1EM1A 4RO2A 2YEVB 3BHPA 4GLXA 2P7TC 2DJVA 3TGUH 4UV9A 4LF9B 1XHXA 2CTQA 4LF5B 1DK1A 2YIAA 4X8AA 4LF8O 1P49A 1OCZC 3BCCH 2R9IA 2PZSA 1W0KG 2B5UA 1M93A 5L3GA 5JQGB 2HHHB 2A7WA 1NTMH 2EIMC 1N32O 3TCUA 5KUMA 5B3SB 2PTMA 1J5EO 1I0HA 3X2QB 4DR3O 1FJGB 3OAAG 1U96A 1EN4A 5HFLA 4FLZA 3K0GA 3JARB 5FPRA 4LWSB 3HKBB 4PJ0Z 1XI1A 2D3OW 4IT5A 3C3SA 4ZIBA 4BW9A 3CCLV 1PKXA 3FYEB 3STLC 4I4TB 2RN9A 3OEEG 5A2QN 2X6CA 4J7JA 1F51A 1O9HA 5KHGA 1KUQA 1RP3B 2Y0PA 4IHJA 3ZS8C 1N8RW 4JI1B 5H9CA 5HFMA 4DR6B 1NS1A 1KKCA 1R6KA 2F4VB 4DV5O 2JEXA 4TQDA 3RFRA 1YEWA 2QGNA 5KLVH 4X64O 2LGQA 3QG5A 1JJ2U 2WLIA 1KC8W 4LFBB 1OCZB 4X20B 3G6BA 4AHCA 4QNHB 2ZDIC 2NNUA 5BXZA 2QKSA 2ZNJA 3O65A 4U3JB 1Y6XA 2UU9O 3EXAA 3ZN1A 2ZR3A 2VWJA 1QBZA 3FD9A 4HZ3A 2UUCB 4FZ0A 3X2QC 2EINC 3ABMB 1QU7A 3CCMV 2Q69A 2NN4A 4UXNA 2IU3A 4JF3A 4LBEC 2IH1C 3HKDB 3LDEA 4H13B 4JV5O 1MOFA 4JI8O 5C93A 5LYJB 2Q73A 4GT1A 2HP8A 1J5EB 1V55B 1M5IA 1Y74B 5KMGB 1R6TA 5LHIA 3CSXA 2F43G 5A9GA 3OW2U 4DV7O 1WA8A 3KKYA 1H2LA 3CRRA 3ZRWB 2NR5A 3QO8A 1AILA 4FM0A 2QWOB 2Z5UA 4DR2B 4QE7A 1VF7A 4NTWA 1OCOC 3JASB 1FXKB 2BOBC 4DR2O 2QTSA 3WB0A 3UT5B 4JAAA 1YJ9V 1XOUA 3P3PA 4KUMA 4DV7B 1UJWB 1GN6A 1CP9A 2QTOA 4RWUA 1SQGA 2V7QG 2UU9B 2CH7B 4NKGB 2R9RB 3TJTA 3VQXA 3IC7A 1W0JG 2CDYA 2EIKC 3ML0A 4DXWA 4PDMA 4JI8B 4PA6A 2QSAA 4GKKB 4A5UB 1KP3A 3Q4HB 1MG1A 5IYZA 3T1HO 4R6ZA 4O4LB 2JS3A 3K5NA 1AVMA 3UCSC 3SJAC 3OR6C 1Q6IA 1AJPA 3FX7A 5FPOA 5B3SC 2Y4TA 1NVPB 3JCUZ 1S72V 4X66B 1UFIA 2IBZH 1QVGU 2JDIG 5CBFA 1M1KW 4KFMA 3CCSV 5H5NA 3FB6C 1GTOA 1DF4A 2IH3C 1F23A 3OR7C 4JI6O 4MVRA 4DV4O 3W7WA 1B06A 1VQKV 1SZXA 2YI9A 4TV9B 1JJOA 3RVYA 1NZ6A 1PL0A 1JX9A 2JGDA 2FKXA 4FK5C 4UV8A 4BWAA 1S5LZ 1K92A 3GB7C 5LMNB 3SGIA 1YITV 4LNUB 1AI5A 4G27B 1FJGO 1CXZB 2UUAB 1QR8A 3BRCA 3W7SA 4FVMA 1H8HG 4ZOLB 3CCEV 2N74A 5EBWC 2WPDG 2HVKC 2IU0A 5JWPA 1NJIW 1SKVA 1LUVA 3H1KH 2WLLA 4FLWA 2AZ0A 3ETGA 4BIOA 2VQEO 1FKAO 1H2SB 1FFXB 1RSOA 4CH4A 5LXTB 3W7UA 4K8ZA 4JI7B 2ZNIA 2WSSG 2HJDA 2HVJC 3WU2Z 1KBHA 1Y66A 5BZBA 2YUAA 4LF4B 2ZE8A 4OX9B 4YHHO 1HWYA 1Z5VA 2VRZA 4N21A 3CHXA 2ZE6A 4B08A 3AG3C 3U0ZA 1Q7YW 5LMUO 1RM1B 1QVFU 5EBLC 2YSUB 5LYJA 1BHAA 1VQPV 1AP6A 1PD3A 3P30A 3CCUV 2AXTZ 1ENVA 2XAGA 3WG7B 5J2TB 4B3RO 1Y74A 4UUJC 5KX5A 3ZMTA 5JH7A 3VBBA 3C90A 1AI4A 2IM9A 4CH5A 3AG7A 3ETEA 2ITDC 2UXBO 4DUYB 2VS0A 1N33B 1VP7A 1GM8A 3CCRV 2ZR2A 4I5SA 1XUQA 5EZYB 4X62B 4O4IB 4CH3A 1SA0B 3MD0A 5CBGA 1T5EA 3M99B 4TSFG 2OCCB 1SS3A 2Q5ZA 3MHSC 2MK3A 4FLVA 3SPIA 3B4SA 2O57A 1K97A 2QWRB 1GM9A 4DUZO 1VQ4V 5B1BB 2ZKOA 4OXSA 1LR1A 3LDCA 3J80N 4NTXA 2P22C 3K08A 1XNQB 1LNQA 3CRAA 3RWRD 3HR0A 1W2BU 5BMVB 1AR1B 1N34O 4CS3A 4UCOA 2C2AA 4HYOA 1TUBB 2Q8VA 2YICA 3WG7C 3H9VA 2UXNA 5E79Z 4O4JB 1NQTA 1KQSU 1JOYA 3JAWB 3R66A 4E2LA 5B66Z 5CB4A 1SQFA 4FZ1A 4PI0A 4BIUA 1F7YA 1OCOB 5LGTA 2FL4A 4FIPC 2ADQB 5F2VO 1K5QA 1ZAUA 4KP4A 1COWG 3ETDA 4F6RA 3OMNB 5IJ0A 4YHHB 1NVPD 3OUFA 1IVSA 1AR4A 2DN9A 4I0XB 2QJ1A 2JGDB 3RBZA 3FB7C 3M8AA 3JALA 3HB3B 5ITZA 2W6JG 4NR1A 2IJIA 1E79G 4BIZA 4AI8A 4PHZA 4B7KA 4IHJB 4JI5O 3K06A 5GONA 4LR3A 2E75B 1ROPA 5FL7G 3VOUA 1SQXH 2MW2B 3OMIB 4X1IA 5JVDA 1QLEC 4XDKA 3IC9A 3CMEV 2GV9A 1V55C 1TVKA 4GYCB 1ZX3A 2YXYA 3K04A 3OTOB 3T1YO 1FXHA 1Q6HA 3CXHF 4NYKA 4DV4B 4PD4F 4PA4A 3RW0A 1KB9F 5IJ9B 5CA0B 4U3JA 4CZZA 2PF4E 1K4DC 5IDJA 3BFRA 3U11A 2EULA 3UT5A 1SESA 2EZOA 2LGWA 5IYDO 2UXDB 1HNXB 5EK0A 1SA0A 3H01A 4O4HA 1Z5WA 5K1XA 1HNWB 5H2FZ 4DV0O 3A2FA 4K35A 1NH2D 4Z1VA 5JH7B 1XL6A 2XAHA 3ZCCA 1PNMA 1Y67A 4MVQA 5JCOC 4DRXB 3CRMA 1WJZA 2DQ3A 4P30A 4NVPA 4BW5A 4O4LA 1ZL8B 4J9ZB 4O4IA 1FXVA 2ZDIA 3QF7A 1YXBA 1KYOF 3AG4C 1YTFD 1AR5A 5LOVA 3AEIA 1DF5A 2DYRC 1L0NH 2DOSA 3JASA 1YVWA 3SPJA 3JAWA 1FS0G 3N2GA 4CC6A 1S76D 1HNWO 3DC6A 1PL4A 4UVAA 1HNZB 4EB6B 2QKCA 4JI4O 3SPGA 3ZRXA 4UVBA 3TETA 3ICXA 4JTDB 4LC1A 3A0RA 1IURA 1N4CA 4XDLA 4I0XA 4X1KA 1PM9A 4JI0B 4O2AB 2PGGA 2ZE5A 1IBMB 2KG7A 4WFFA 1JFFA 5LHGA 1HP8A 5IWAB 1SZTA 3E89A 5LGNA 4Z1MG 1IX9A 3SJCC 4YY3B 5LMUB 1D5AA 4QGPA 2PY5A 2H8PC 3G6EV 3B40A 1M90W 5GW7A 1FYJA 1FFXA 3SYQA 2Q6AA 5D5QA 4LF4O 4FM1A 1NI8A 1XMOO 3OGCC 5JVDB 5L3CA 2EILB 2P90A 1V54C 1BCCH 3L74H 3VQYA 1Q3EA 2EIMB 1TVKB 3CWBH 1G8MA 1U97A 3ZRVA 2YIBA 2KQXA 1XDCA 2WLJA 3JATB 3ZHSA 4C7UA 1IBKB 2HG5C 1KMIZ 2R72A 1KU9A 3B8NA 1O9GA 4QPKA 3QNEA 5EC2C 4DR7B 2F23A 4O2BA 3W7TA 4B3SB 2ETNA 1BT8A 3K03A 2XT9A 1ZLZA 5IY5C 4GKJB 1NR1A 5LBQA 3UM7A 4U3FH 1NTZH 4DR4O 2WLLB 5IJ9A 1QCEA 3SPHA 4LP8A 5L3EA 2KKWA 1BSMA 5CN0A 2A9HA 3P32A 4X65B 4X66O 2OWOA 1ZL8A 3CEIA 1H2NA 4ZI7B 5KX5B 3ZMSA 1E1QG 1VQMV 2N04A 3ABKC 2QA4V 3E2EA 2BTQB 3K3WA 3APOA 3IGAC 1YSCA 4YJ2B 4JASA 3DSQA 1XILA 2F93B 4DW0A 4HNAB 2ARHA 3SDLA
chains in the Genus database with same CATH topology
2Y4UA 1HDJA 3UO3A 2N05A 1GH6A 2YS8A 2DN9A 2QWOB 3UCSC 1FPOA 2YUAA 4J80A 2CTWA 2PF4E 4RWUA 4IT5A 1XBLA 2KQXA 2CTRA 2QWRB 2Y4TA 3APQA 1NZ6A 1BQZA 2L6LA 1FAFA 2EJ7A 2M6YA 2OCHA 2QWNB 4J7ZA 1N4CA 2LGWA 2N04A 1IURA 2QWPB 3AG7A 2CTQA 3APOA 2QSAA 2LO1A 1WJZA 3BVOA 2DMXA 2QWQB 3UO2A 2CTPA 2GUZB 2GUZA 2CUGA 1BQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  1HDJ A;  3UO3 A;  2N05 A;  1GH6 A;  2YS8 A;  2DN9 A;  2QWO B;  3UCS C;  1FPO A;  2YUA A;  4J80 A;  2CTW A;  2PF4 E;  4RWU A;  4IT5 A;  1XBL A;  2KQX A;  2CTR A;  2QWR B;  2Y4T A;  3APQ A;  1NZ6 A;  1BQZ A;  2L6L A;  1FAF A;  2EJ7 A;  2M6Y A;  2OCH A;  2QWN B;  4J7Z A;  1N4C A;  2LGW A;  2N04 A;  1IUR A;  2QWP B;  3AG7 A;  2CTQ A;  3APO A;  2QSA A;  2LO1 A;  1WJZ A;  3BVO A;  2DMX A;  2QWQ B;  3UO2 A;  2CTP A;  2GUZ B;  2GUZ A;  2CUG A;  1BQ0 A; 
#chains in the Genus database with same CATH topology
 3T1H B;  4YIO A;  3FB8 C;  5EZY A;  3GVM A;  5CA1 B;  4ZBM A;  2DYS B;  2LFR A;  4KL1 A;  1PNK A;  5BMV A;  4WFA V;  1HW7 A;  2WA4 A;  3RT3 C;  1W59 A;  4IIJ B;  4WFE A;  3UQ8 A;  5B1A B;  1H8E G;  4K0K O;  3J81 N;  2ZT9 B;  2F95 B;  1RFY A;  2CUG A;  4TV8 B;  2P67 A;  3K5L A;  1VQ7 V;  1BQ0 A;  3KZI Z;  3JAR A;  2UXC O;  5D5P A;  1K9M W;  4TUY B;  2IJJ A;  2EIL C;  1F4N A;  3S3X A;  1FFT B;  3SYO A;  4DV2 O;  2KG7 B;  2WWW A;  1I5X A;  2CTR A;  2M7W A;  2UUB O;  2DYS C;  3ABT A;  1R73 A;  3RYF B;  1YZB A;  2YDE A;  3LUT B;  4MS2 A;  4K0K B;  4GUN A;  5E1A C;  4JZ2 A;  2EX3 A;  3TXS A;  2ZD9 A;  4CS4 A;  4FPP A;  5IWA O;  1XQ8 A;  2P06 A;  4QPJ A;  3HKE B;  3MAQ A;  5LP6 C;  3DC5 A;  3E22 A;  4EEQ A;  4WF9 V;  4U7N A;  3CC4 V;  1JCH A;  3P3N A;  3S3W A;  3NR7 A;  1P84 F;  3ABU A;  2A06 H;  1IDS A;  2B1G A;  4IGG A;  3K79 A;  4NXN O;  1HNZ O;  4JTA B;  1OV9 A;  3ZIA G;  1BGY H;  4LH7 A;  1YF2 A;  2L35 A;  1R3L C;  3E35 A;  4JV5 B;  1VQL V;  5H6Q A;  5GON B;  1FAF A;  4F6R B;  4G2K A;  5JJJ B;  2YS8 A;  5LA6 A;  1QNM A;  3D36 C;  5CMU A;  1PV0 A;  3CB2 A;  3T4Z A;  3O9O A;  4PDR A;  4AQY O;  2EIK B;  3CCQ V;  1BQZ A;  4O2B B;  2ZM6 B;  2YC0 A;  4I50 A;  4DR4 B;  2IJH A;  1Q8I A;  2HLD G;  4DV3 O;  3SYA A;  3ABK B;  4CS2 A;  4B3M O;  1JMK C;  3K59 A;  3RYH B;  1CPY A;  3DGE A;  1IBL B;  3ZX6 A;  1GH6 A;  4MTG A;  4GKJ O;  4BR6 A;  1EFR G;  5IJ0 B;  4TQF A;  1K34 A;  2CGO A;  1JPX A;  3JD3 A;  4YIP A;  4DR7 O;  2L6L A;  3E8G A;  1GO3 F;  1FXK C;  1G6U A;  4GX5 A;  4LFA O;  2FTK A;  1QHT A;  5K1P A;  1XHZ A;  1AJN A;  4CBC A;  1SF9 A;  3LSQ A;  1I7F A;  1H38 A;  1WPB A;  4DR6 O;  3OM3 B;  2Y4U A;  2KB1 A;  5B5E Z;  1Y76 B;  4IYI A;  2UXD O;  2W0F C;  4DV6 O;  4CH6 A;  2JIZ G;  1K8A W;  3ZHU A;  1TAE A;  1GN4 A;  3L75 H;  3N27 A;  4TOI A;  5DM6 V;  3ZED A;  1M57 B;  3SJQ C;  1FXK A;  1XMO B;  4J7Z A;  2ZXW B;  4UCU A;  3OGI B;  4DR5 O;  4K3A A;  1OCR C;  4O4H B;  1THZ A;  1QLN A;  4WBN B;  4I9Q A;  5J2U B;  2A3Q A;  5IYB O;  2KSD A;  4PDL A;  2ODM A;  3JD1 A;  3FB5 C;  1QQC A;  3SYC A;  2ZIN A;  4JZG A;  2CK3 G;  2EIN B;  5BR8 O;  3PJS K;  4HNA A;  3TXQ A;  5JQG A;  3A0H Z;  4XBF A;  4NXM O;  5KAI Z;  2BSK B;  2JRI A;  5FLX N;  2YEV A;  1VF6 C;  4LCU C;  5CA1 A;  4N23 A;  1S77 D;  1XBL A;  4LF9 O;  5LOV B;  3ZRS A;  3BAB A;  4QE9 A;  1IXB A;  3CX5 F;  3K58 A;  5JCO A;  2D2C B;  2QM8 A;  2A79 B;  4GCZ A;  4I4T A;  1J95 A;  4EKW A;  3RYC A;  2Q7G A;  1GN3 A;  2UXC B;  2Z3Y A;  5TIS Z;  5LMN O;  3GWO A;  1AJQ A;  3R65 A;  1IBL O;  2ZE7 A;  2OTJ V;  3F5W C;  1M9N A;  4X89 A;  3CCV V;  2LW1 A;  3QVN A;  3RVZ A;  5DED A;  4DV3 B;  2M6Y A;  1KKD A;  3BY6 A;  1JA8 A;  3AK3 A;  4H0L B;  4X1K B;  4MSW C;  5KAF Z;  4AIL C;  3HKB A;  1PP9 H;  4PA3 A;  5KA5 A;  2LO1 A;  3UO2 A;  1VQ9 V;  3CJH A;  1N34 B;  4UB6 Z;  4K8X A;  2LW7 A;  1Q82 W;  4IL6 Z;  2WLI B;  4X62 O;  2LFS A;  3JAK A;  3SPC A;  3LSU A;  1S0V A;  2YXH A;  4F6E A;  4EFE A;  5KUK A;  2JK5 C;  1K4C C;  4YJ3 B;  1GKF A;  1AP5 A;  1NT2 B;  1QLE B;  2EIJ C;  4FM2 A;  4MTF A;  2OT5 A;  3ASN B;  4X65 O;  2WLH A;  1NU1 H;  1NR7 A;  1RSO B;  1AB3 A;  5H6R A;  4JGS A;  4OGQ B;  3UO3 A;  2AZ2 A;  4LFB O;  4J41 A;  3E8F A;  5LL6 Y;  2K1E A;  2XAJ A;  3K9A A;  3H1I H;  1YI2 V;  4LFA B;  3L9D A;  2UXX A;  2VWK A;  2X7R B;  2EIJ B;  4D6T H;  3THO A;  3G4S V;  2HJF C;  3ASN C;  2E76 B;  5IYC O;  2JJ2 G;  4GX2 A;  2UXB B;  1PPJ H;  1K7D A;  3H1H H;  2XAQ A;  2E74 B;  4RUF A;  1WN7 A;  4Z2W A;  4Q20 A;  3F7Y C;  2E5L B;  1ORQ C;  1YTF B;  2DE0 X;  2K9P A;  2OCC C;  2CTP A;  1K5S A;  1OCR B;  4WFH A;  1YIJ V;  3Q4H A;  5KMG A;  3K5O A;  5JJE B;  4MVO A;  2VQF O;  2HFE C;  1WA8 B;  4MW3 A;  2BCC H;  3JSL A;  2ZIM A;  4WFB V;  1URF A;  3LDD A;  3WFV A;  1US6 A;  4UCT A;  2CE4 A;  4J42 A;  4OPH A;  4DR5 B;  4RQF A;  1MNG A;  4JTC B;  3ZMU A;  1YHQ V;  3ABM C;  2Z0A A;  3QO5 A;  3CRQ A;  1VQ6 V;  3T1C A;  4J10 A;  4JI3 O;  2CH7 A;  1VQ8 V;  1TUB A;  4B3S O;  1FPO A;  3CPW U;  2JJ1 G;  4X64 B;  1WP7 A;  3CP1 A;  3B2E E;  2AHZ A;  4L8J A;  2DQ0 A;  3CJH B;  4FLY A;  5KHH A;  3U10 A;  1NBM G;  3HPL C;  2ITC C;  2WLK A;  1K33 A;  1GAX A;  3EHB B;  1H2M A;  2GUZ A;  3BA8 A;  3G80 A;  1E1R G;  3KCX A;  2B1I A;  4JI5 B;  2EZP A;  1MZF A;  2GTA A;  4DYL A;  1Q43 A;  2PYL A;  1V9P A;  3AG1 C;  4MVZ A;  2ADP A;  1I94 O;  3QTC A;  5LGU A;  1BZK A;  4UB8 Z;  5KHJ A;  1XRE A;  2Q9L A;  2RNB A;  5B1A C;  3K57 A;  5CA3 A;  3EVK A;  1HDJ A;  1NTK H;  3BA9 A;  2XTA A;  3UKM A;  4BAY A;  1P4R A;  3H1J H;  1DGS A;  5J2T A;  4G28 B;  3H1L H;  1DTO A;  2PUS A;  2P4V A;  4WCE V;  2QEX V;  4F4L A;  4UVC A;  3OD4 A;  5KHI A;  4JAU A;  2DMX A;  1EZJ A;  2GBO A;  3E83 A;  5FNV A;  1WB8 A;  4J7K A;  1GK9 A;  2VQF B;  1YJW V;  1GRJ A;  1GMG A;  4QJF B;  4MVM A;  5IT9 N;  2Q0A A;  3B8M A;  5LXT A;  4LF7 O;  3RN4 A;  1TUE B;  4LNU A;  1AI7 A;  1Q86 W;  1RM1 C;  1KP2 A;  2LQT A;  4J9Y B;  3JD0 A;  3T2M A;  1UPG A;  5LHH A;  2BOC C;  4ASU G;  3AG3 B;  2Q7H A;  5J2U A;  4HBN A;  3E8H A;  2XUM A;  2UUC O;  4ZOL A;  2AW9 A;  2QKA A;  3W7X A;  3ABL B;  2YI8 A;  1I5Y A;  3L72 H;  1VEW A;  3ZJZ A;  3ZMV A;  2WLN A;  2OTL V;  4X9Q A;  3APQ A;  1XMQ O;  3AG1 B;  3L70 H;  2Y69 B;  2BSK A;  3HKC B;  3JD4 A;  5LP6 B;  2PI5 A;  2GTS A;  3ZRW A;  3OUS A;  3DTU B;  2YIB D;  2QE7 G;  4WFG A;  2FYU H;  3KG2 A;  4X1Y B;  2XHB A;  1IZ3 A;  3D8C A;  3DXR B;  1QR9 A;  3OT7 A;  1D5N A;  2ZXW C;  1MA1 A;  4PA7 A;  4B3M B;  1VF5 B;  4D7S A;  1EN6 A;  5JJN B;  2YID A;  3ZHR A;  1VQ5 V;  2QR4 A;  2E3C A;  4PI2 A;  2JS5 A;  1BL8 A;  1Z2G A;  3LSS A;  1H2G A;  2DW4 A;  3OTO O;  1L0L H;  4MT8 A;  3OTF A;  3NXS A;  3F7V C;  1CEZ A;  1L1F A;  5CB4 B;  4TT3 G;  4D7T A;  1B3Q A;  3JAK B;  5EYP B;  5IY5 B;  1WLE A;  2CTW A;  1VIB A;  1N0N A;  2XAF A;  3ZHV A;  4YJ3 A;  4H44 B;  2H3O A;  3I55 V;  1R3J C;  2RMK B;  4JI7 O;  5IE9 A;  1S3J A;  2VQE B;  4AQY B;  4R50 A;  5EBM C;  3CC2 V;  1NKD A;  1L8D A;  5ITZ B;  1PNL A;  2IW5 A;  1EBO A;  4LF7 B;  4DV0 B;  2E5L O;  3B77 A;  3L71 H;  3AG2 C;  1WPX A;  4DV2 B;  2CGN A;  1MSW D;  1M57 C;  3LNN A;  4TV9 A;  1BHB A;  3E86 A;  3VQW A;  5FNV B;  3MDS A;  1Q81 W;  2QWN B;  1ARO P;  4FLX A;  4NXM B;  2WAM A;  4O4J A;  4B3R B;  4XDJ A;  4LF8 B;  1BS3 A;  1P7B A;  2H94 A;  5BR8 B;  4UCS A;  1DLB A;  3T1Y B;  2ILM A;  4U7O A;  4PEL A;  3ZMZ A;  3FAV B;  3ASO C;  1R3I C;  3RYI A;  2DYR B;  1VQN V;  3CYO A;  1IXM A;  4B3T O;  1JQ0 A;  5CA0 A;  4JI4 B;  4FLU A;  1XNQ O;  1FD9 A;  3K0D A;  5C8Y B;  1I94 B;  2P4K A;  1SET A;  1JVM A;  2EBO A;  2GSM B;  2XOK G;  4W4K A;  3JAL B;  1OCC C;  4JYA O;  3A0B Z;  1SC5 B;  4FFK A;  3CRC A;  2GHY A;  3VQV A;  4FFB B;  5LP6 A;  3OE7 G;  2FB5 A;  4OPA A;  4FMT A;  4ZI7 A;  3M7M X;  4P9P A;  1Q5O A;  1WNS A;  4X1Y A;  3I56 V;  2BTQ A;  5EIB C;  1AI6 A;  3G67 A;  4Q6G A;  3N2G B;  1MAB G;  4X1I B;  5J9P C;  2F4V O;  4DUY O;  3CD6 V;  3ZHQ A;  4JI3 B;  4DK0 A;  4DR1 O;  3BEH A;  1MSD A;  4JI2 B;  1SQB H;  4ZHQ B;  2LP7 A;  1IBK O;  1OCC B;  3EFF K;  3DXR A;  4I55 A;  4JI2 O;  4DRX A;  5EIB D;  5B1O A;  1EN5 A;  1M4U A;  1YJN V;  2V4D A;  4W4L A;  4NXN B;  1SRY A;  2Q68 A;  4DR3 B;  3RGB A;  1H2K A;  1R1B A;  2ZQM A;  4DK1 A;  2F1M A;  4YY3 O;  1B04 A;  4QIW F;  3ZN0 A;  2OIE A;  5KHK A;  1Y4M A;  2Q0O C;  2QWP B;  1B6Q A;  1ZUQ A;  3D3I A;  2DWD C;  3BVO A;  4JI0 O;  1NH2 B;  5EYP A;  4LF6 O;  2GUZ B;  4LF6 B;  1HR0 B;  1SQQ H;  3ZHT A;  4B7E A;  1N33 O;  3CE2 A;  2UUA O;  4J80 A;  1VAR A;  4GX1 A;  1JR9 A;  3PN1 A;  3OFN G;  2HKO A;  4UCR A;  3CC7 V;  4EFB A;  3I5D A;  3FYI B;  5GTI Z;  3FKS G;  2X0L A;  1K73 W;  4JYY A;  3JYC A;  1KD1 W;  2JGU A;  1F4M A;  3FAV A;  3JSN A;  2Y69 C;  2R9A A;  1YDX A;  4EB6 A;  1XL4 A;  1TA8 A;  1VF6 A;  2FML A;  4DV5 B;  1IBM O;  5DN6 G;  3LNM B;  4JI6 B;  3OEH G;  5KA6 A;  2V1D A;  1WP8 A;  1OZ0 A;  4E4E A;  3JCZ A;  4FJC C;  2QDO A;  4NTY A;  4O2A A;  3STZ C;  3WB1 A;  3L73 H;  2BE3 A;  2AGA A;  4R7C A;  3ZBH A;  3K5M A;  1N0J A;  4X20 A;  4YJ2 A;  3G71 V;  2LJ2 A;  5CBH A;  4PA9 A;  2R70 A;  1G4Y B;  2W6I G;  2OYQ A;  1MMM A;  5C8Y A;  1M56 B;  3OMA B;  4PV1 B;  4HAM A;  2YXL A;  2Y0I A;  2JVD A;  1N32 B;  4WBN A;  4DV1 O;  3JAT A;  4P9O A;  4H33 A;  1YCI A;  4RAI A;  3HKD A;  4L87 A;  2RQ6 A;  4ZHQ A;  4JYC A;  3T4D A;  2ATK C;  1GN2 A;  3N2K B;  5DEC A;  2PI4 A;  4LF5 O;  3IAY A;  4X88 A;  3HKC A;  3AK1 A;  3CXC U;  2A0L A;  1M56 C;  4P2Z A;  1EZV H;  3RYF A;  2EJR A;  3WB2 A;  3CCJ V;  2XAS A;  5B1N A;  3KCY A;  1V54 B;  5EC1 C;  5B1B C;  1K3E A;  4B3T B;  1SER A;  2RJZ A;  3AG4 B;  4UCV A;  2P6J A;  3C3T A;  4DO2 A;  1I08 A;  4RUE A;  3TK1 A;  1HR0 O;  2BTO A;  3SYP A;  4JAV A;  1Q90 D;  2GDS A;  1R3K C;  4DW1 A;  3D36 A;  2XND G;  1WAZ A;  3IJ4 A;  2QWQ B;  2Q67 A;  5IYZ B;  1D2D A;  3RYC B;  1N36 B;  4UFZ A;  3F5T A;  3B09 A;  2HR3 A;  1LUW A;  2RDC A;  3J7A U;  3ABL C;  4IIJ A;  4GKK O;  1GM7 A;  2HEP A;  5L3D A;  4LWS A;  1XMQ B;  4KXR A;  4PDV A;  4TV8 A;  2OCH A;  3CMA V;  1XNR B;  4KHP O;  4TUY A;  2ZCE A;  4J11 A;  1ZSP A;  4ABM A;  3JAM N;  3E8B A;  4I50 B;  4RQE A;  2ZIO A;  1SQP H;  3A8T A;  2WA3 A;  2JEU A;  3ASO B;  4DV6 B;  3AG2 B;  4JPR A;  4ICG A;  4R8C A;  3JD2 A;  3HKE A;  1X4T A;  3E22 B;  1VMG A;  1WB7 A;  4MTX A;  2Y48 A;  4H37 A;  3BAA A;  4DR1 B;  1JFF B;  3IFX A;  5L3B A;  2PYJ A;  4MW8 A;  3GWK C;  2CAZ C;  4GZR B;  3RYI B;  2WLM A;  1XEQ A;  1SQV H;  3RYH A;  4DV1 B;  4LFC B;  4LH6 A;  3K9S A;  1P7G A;  2NLJ C;  3QO7 A;  4JYB A;  5GTH Z;  4MTO A;  4TWK A;  5LA6 B;  2F66 C;  2RCV A;  1ZTE A;  4CC5 A;  1MZE A;  2ZM6 O;  4GX0 A;  1RPR A;  3SR2 C;  1R6N A;  2DWE C;  1BE3 H;  2Q4P A;  4YXW G;  5BY1 A;  1Q6U A;  4IYH A;  2Q7E A;  3MHH C;  4MVU A;  3SJB C;  4NB5 A;  4MVS A;  1Y76 A;  2G38 A;  2OIG A;  2AHY A;  2W0X A;  4FLT A;  1G1X B;  1XNR O;  4KHP B;  2IJK A;  2B9Z A;  1A32 A;  2X6A A;  4DUZ B;  2QM4 A;  1HNX O;  1OHH G;  3N2K A;  1BMF G;  1RPO A;  2HHH O;  3D3Q A;  1S5J A;  1N36 O;  3ETQ A;  1VQO V;  4FFB A;  3CS5 A;  4I9W A;  5L3F A;  1S5H C;  2X6B A;  2EJ7 A;  4LFC O;  5AG2 A;  4JYA B;  1ZWI C;  4ZKI A;  1X59 A;  1TGO A;  2QM7 A;  3FFQ A;  4I55 B;  2UUB B;  3AK2 A;  2P5O A;  4JI1 O;  1OJH A;  2N05 A;  1KEC A;  4I7Z B;  3BPZ A;  4OX9 O;  1EM1 A;  4RO2 A;  2YEV B;  3BHP A;  4GLX A;  2P7T C;  2DJV A;  3TGU H;  4UV9 A;  4LF9 B;  1XHX A;  2CTQ A;  4LF5 B;  1DK1 A;  2YIA A;  4X8A A;  4LF8 O;  1P49 A;  1OCZ C;  3BCC H;  2R9I A;  2PZS A;  1W0K G;  2B5U A;  1M93 A;  5L3G A;  5JQG B;  2HHH B;  2A7W A;  1NTM H;  2EIM C;  1N32 O;  3TCU A;  5KUM A;  5B3S B;  2PTM A;  1J5E O;  1I0H A;  3X2Q B;  4DR3 O;  1FJG B;  3OAA G;  1U96 A;  1EN4 A;  5HFL A;  4FLZ A;  3K0G A;  3JAR B;  5FPR A;  4LWS B;  3HKB B;  4PJ0 Z;  1XI1 A;  2D3O W;  4IT5 A;  3C3S A;  4ZIB A;  4BW9 A;  3CCL V;  1PKX A;  3FYE B;  3STL C;  4I4T B;  2RN9 A;  3OEE G;  5A2Q N;  2X6C A;  4J7J A;  1F51 A;  1O9H A;  5KHG A;  1KUQ A;  1RP3 B;  2Y0P A;  4IHJ A;  3ZS8 C;  1N8R W;  4JI1 B;  5H9C A;  5HFM A;  4DR6 B;  1NS1 A;  1KKC A;  1R6K A;  2F4V B;  4DV5 O;  2JEX A;  4TQD A;  3RFR A;  1YEW A;  2QGN A;  5KLV H;  4X64 O;  2LGQ A;  3QG5 A;  1JJ2 U;  2WLI A;  1KC8 W;  4LFB B;  1OCZ B;  4X20 B;  3G6B A;  4AHC A;  4QNH B;  2ZDI C;  2NNU A;  5BXZ A;  2QKS A;  2ZNJ A;  3O65 A;  4U3J B;  1Y6X A;  2UU9 O;  3EXA A;  3ZN1 A;  2ZR3 A;  2VWJ A;  1QBZ A;  3FD9 A;  4HZ3 A;  2UUC B;  4FZ0 A;  3X2Q C;  2EIN C;  3ABM B;  1QU7 A;  3CCM V;  2Q69 A;  2NN4 A;  4UXN A;  2IU3 A;  4JF3 A;  4LBE C;  2IH1 C;  3HKD B;  3LDE A;  4H13 B;  4JV5 O;  1MOF A;  4JI8 O;  5C93 A;  5LYJ B;  2Q73 A;  4GT1 A;  2HP8 A;  1J5E B;  1V55 B;  1M5I A;  1Y74 B;  5KMG B;  1R6T A;  5LHI A;  3CSX A;  2F43 G;  5A9G A;  3OW2 U;  4DV7 O;  1WA8 A;  3KKY A;  1H2L A;  3CRR A;  3ZRW B;  2NR5 A;  3QO8 A;  1AIL A;  4FM0 A;  2QWO B;  2Z5U A;  4DR2 B;  4QE7 A;  1VF7 A;  4NTW A;  1OCO C;  3JAS B;  1FXK B;  2BOB C;  4DR2 O;  2QTS A;  3WB0 A;  3UT5 B;  4JAA A;  1YJ9 V;  1XOU A;  3P3P A;  4KUM A;  4DV7 B;  1UJW B;  1GN6 A;  1CP9 A;  2QTO A;  4RWU A;  1SQG A;  2V7Q G;  2UU9 B;  2CH7 B;  4NKG B;  2R9R B;  3TJT A;  3VQX A;  3IC7 A;  1W0J G;  2CDY A;  2EIK C;  3ML0 A;  4DXW A;  4PDM A;  4JI8 B;  4PA6 A;  2QSA A;  4GKK B;  4A5U B;  1KP3 A;  3Q4H B;  1MG1 A;  5IYZ A;  3T1H O;  4R6Z A;  4O4L B;  2JS3 A;  3K5N A;  1AVM A;  3UCS C;  3SJA C;  3OR6 C;  1Q6I A;  1AJP A;  3FX7 A;  5FPO A;  5B3S C;  2Y4T A;  1NVP B;  3JCU Z;  1S72 V;  4X66 B;  1UFI A;  2IBZ H;  1QVG U;  2JDI G;  5CBF A;  1M1K W;  4KFM A;  3CCS V;  5H5N A;  3FB6 C;  1GTO A;  1DF4 A;  2IH3 C;  1F23 A;  3OR7 C;  4JI6 O;  4MVR A;  4DV4 O;  3W7W A;  1B06 A;  1VQK V;  1SZX A;  2YI9 A;  4TV9 B;  1JJO A;  3RVY A;  1NZ6 A;  1PL0 A;  1JX9 A;  2JGD A;  2FKX A;  4FK5 C;  4UV8 A;  4BWA A;  1S5L Z;  1K92 A;  3GB7 C;  5LMN B;  3SGI A;  1YIT V;  4LNU B;  1AI5 A;  4G27 B;  1FJG O;  1CXZ B;  2UUA B;  1QR8 A;  3BRC A;  3W7S A;  4FVM A;  1H8H G;  4ZOL B;  3CCE V;  2N74 A;  5EBW C;  2WPD G;  2HVK C;  2IU0 A;  5JWP A;  1NJI W;  1SKV A;  1LUV A;  3H1K H;  2WLL A;  4FLW A;  2AZ0 A;  3ETG A;  4BIO A;  2VQE O;  1FKA O;  1H2S B;  1FFX B;  1RSO A;  4CH4 A;  5LXT B;  3W7U A;  4K8Z A;  4JI7 B;  2ZNI A;  2WSS G;  2HJD A;  2HVJ C;  3WU2 Z;  1KBH A;  1Y66 A;  5BZB A;  2YUA A;  4LF4 B;  2ZE8 A;  4OX9 B;  4YHH O;  1HWY A;  1Z5V A;  2VRZ A;  4N21 A;  3CHX A;  2ZE6 A;  4B08 A;  3AG3 C;  3U0Z A;  1Q7Y W;  5LMU O;  1RM1 B;  1QVF U;  5EBL C;  2YSU B;  5LYJ A;  1BHA A;  1VQP V;  1AP6 A;  1PD3 A;  3P30 A;  3CCU V;  2AXT Z;  1ENV A;  2XAG A;  3WG7 B;  5J2T B;  4B3R O;  1Y74 A;  4UUJ C;  5KX5 A;  3ZMT A;  5JH7 A;  3VBB A;  3C90 A;  1AI4 A;  2IM9 A;  4CH5 A;  3AG7 A;  3ETE A;  2ITD C;  2UXB O;  4DUY B;  2VS0 A;  1N33 B;  1VP7 A;  1GM8 A;  3CCR V;  2ZR2 A;  4I5S A;  1XUQ A;  5EZY B;  4X62 B;  4O4I B;  4CH3 A;  1SA0 B;  3MD0 A;  5CBG A;  1T5E A;  3M99 B;  4TSF G;  2OCC B;  1SS3 A;  2Q5Z A;  3MHS C;  2MK3 A;  4FLV A;  3SPI A;  3B4S A;  2O57 A;  1K97 A;  2QWR B;  1GM9 A;  4DUZ O;  1VQ4 V;  5B1B B;  2ZKO A;  4OXS A;  1LR1 A;  3LDC A;  3J80 N;  4NTX A;  2P22 C;  3K08 A;  1XNQ B;  1LNQ A;  3CRA A;  3RWR D;  3HR0 A;  1W2B U;  5BMV B;  1AR1 B;  1N34 O;  4CS3 A;  4UCO A;  2C2A A;  4HYO A;  1TUB B;  2Q8V A;  2YIC A;  3WG7 C;  3H9V A;  2UXN A;  5E79 Z;  4O4J B;  1NQT A;  1KQS U;  1JOY A;  3JAW B;  3R66 A;  4E2L A;  5B66 Z;  5CB4 A;  1SQF A;  4FZ1 A;  4PI0 A;  4BIU A;  1F7Y A;  1OCO B;  5LGT A;  2FL4 A;  4FIP C;  2ADQ B;  5F2V O;  1K5Q A;  1ZAU A;  4KP4 A;  1COW G;  3ETD A;  4F6R A;  3OMN B;  5IJ0 A;  4YHH B;  1NVP D;  3OUF A;  1IVS A;  1AR4 A;  2DN9 A;  4I0X B;  2QJ1 A;  2JGD B;  3RBZ A;  3FB7 C;  3M8A A;  3JAL A;  3HB3 B;  5ITZ A;  2W6J G;  4NR1 A;  2IJI A;  1E79 G;  4BIZ A;  4AI8 A;  4PHZ A;  4B7K A;  4IHJ B;  4JI5 O;  3K06 A;  5GON A;  4LR3 A;  2E75 B;  1ROP A;  5FL7 G;  3VOU A;  1SQX H;  2MW2 B;  3OMI B;  4X1I A;  5JVD A;  1QLE C;  4XDK A;  3IC9 A;  3CME V;  2GV9 A;  1V55 C;  1TVK A;  4GYC B;  1ZX3 A;  2YXY A;  3K04 A;  3OTO B;  3T1Y O;  1FXH A;  1Q6H A;  3CXH F;  4NYK A;  4DV4 B;  4PD4 F;  4PA4 A;  3RW0 A;  1KB9 F;  5IJ9 B;  5CA0 B;  4U3J A;  4CZZ A;  2PF4 E;  1K4D C;  5IDJ A;  3BFR A;  3U11 A;  2EUL A;  3UT5 A;  1SES A;  2EZO A;  2LGW A;  5IYD O;  2UXD B;  1HNX B;  5EK0 A;  1SA0 A;  3H01 A;  4O4H A;  1Z5W A;  5K1X A;  1HNW B;  5H2F Z;  4DV0 O;  3A2F A;  4K35 A;  1NH2 D;  4Z1V A;  5JH7 B;  1XL6 A;  2XAH A;  3ZCC A;  1PNM A;  1Y67 A;  4MVQ A;  5JCO C;  4DRX B;  3CRM A;  1WJZ A;  2DQ3 A;  4P30 A;  4NVP A;  4BW5 A;  4O4L A;  1ZL8 B;  4J9Z B;  4O4I A;  1FXV A;  2ZDI A;  3QF7 A;  1YXB A;  1KYO F;  3AG4 C;  1YTF D;  1AR5 A;  5LOV A;  3AEI A;  1DF5 A;  2DYR C;  1L0N H;  2DOS A;  3JAS A;  1YVW A;  3SPJ A;  3JAW A;  1FS0 G;  3N2G A;  4CC6 A;  1S76 D;  1HNW O;  3DC6 A;  1PL4 A;  4UVA A;  1HNZ B;  4EB6 B;  2QKC A;  4JI4 O;  3SPG A;  3ZRX A;  4UVB A;  3TET A;  3ICX A;  4JTD B;  4LC1 A;  3A0R A;  1IUR A;  1N4C A;  4XDL A;  4I0X A;  4X1K A;  1PM9 A;  4JI0 B;  4O2A B;  2PGG A;  2ZE5 A;  1IBM B;  2KG7 A;  4WFF A;  1JFF A;  5LHG A;  1HP8 A;  5IWA B;  1SZT A;  3E89 A;  5LGN A;  4Z1M G;  1IX9 A;  3SJC C;  4YY3 B;  5LMU B;  1D5A A;  4QGP A;  2PY5 A;  2H8P C;  3G6E V;  3B40 A;  1M90 W;  5GW7 A;  1FYJ A;  1FFX A;  3SYQ A;  2Q6A A;  5D5Q A;  4LF4 O;  4FM1 A;  1NI8 A;  1XMO O;  3OGC C;  5JVD B;  5L3C A;  2EIL B;  2P90 A;  1V54 C;  1BCC H;  3L74 H;  3VQY A;  1Q3E A;  2EIM B;  1TVK B;  3CWB H;  1G8M A;  1U97 A;  3ZRV A;  2YIB A;  2KQX A;  1XDC A;  2WLJ A;  3JAT B;  3ZHS A;  4C7U A;  1IBK B;  2HG5 C;  1KMI Z;  2R72 A;  1KU9 A;  3B8N A;  1O9G A;  4QPK A;  3QNE A;  5EC2 C;  4DR7 B;  2F23 A;  4O2B A;  3W7T A;  4B3S B;  2ETN A;  1BT8 A;  3K03 A;  2XT9 A;  1ZLZ A;  5IY5 C;  4GKJ B;  1NR1 A;  5LBQ A;  3UM7 A;  4U3F H;  1NTZ H;  4DR4 O;  2WLL B;  5IJ9 A;  1QCE A;  3SPH A;  4LP8 A;  5L3E A;  2KKW A;  1BSM A;  5CN0 A;  2A9H A;  3P32 A;  4X65 B;  4X66 O;  2OWO A;  1ZL8 A;  3CEI A;  1H2N A;  4ZI7 B;  5KX5 B;  3ZMS A;  1E1Q G;  1VQM V;  2N04 A;  3ABK C;  2QA4 V;  3E2E A;  2BTQ B;  3K3W A;  3APO A;  3IGA C;  1YSC A;  4YJ2 B;  4JAS A;  3DSQ A;  1XIL A;  2F93 B;  4DW0 A;  4HNA B;  2ARH A;  3SDL A; 
#chains in the Genus database with same CATH homology
 2Y4U A;  1HDJ A;  3UO3 A;  2N05 A;  1GH6 A;  2YS8 A;  2DN9 A;  2QWO B;  3UCS C;  1FPO A;  2YUA A;  4J80 A;  2CTW A;  2PF4 E;  4RWU A;  4IT5 A;  1XBL A;  2KQX A;  2CTR A;  2QWR B;  2Y4T A;  3APQ A;  1NZ6 A;  1BQZ A;  2L6L A;  1FAF A;  2EJ7 A;  2M6Y A;  2OCH A;  2QWN B;  4J7Z A;  1N4C A;  2LGW A;  2N04 A;  1IUR A;  2QWP B;  3AG7 A;  2CTQ A;  3APO A;  2QSA A;  2LO1 A;  1WJZ A;  3BVO A;  2DMX A;  2QWQ B;  3UO2 A;  2CTP A;  2GUZ B;  2GUZ A;  2CUG A;  1BQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...