3UCUP

The c-di-gmp-i riboswitch bound to pgpg
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ucuP00
1FJ7A 1R8PA 5JVHQ 1FJCA 1JJ4A 1U1RA 1G2EA 2CPXA 1U1MA 1ZH5A 1K9MT 1WEZA 2U1AA 1VBXA 3MUTP 2M88A 3MD3A 1KQSR 2MZQA 2LECA 2ZJRQ 2YKAA 3U1LA 1A9NB 1R8HA 1SJFA 2MKKA 3NNAA 1SXLA 1L3KA 1M5PC 1X5TA 3P49B 2KRRA 2X1FA 2RRAA 1KD1T 2CPFA 4W90B 2OJ3A 4LIRA 3P5TL 2F9JA 4YOEA 3CF5Q 2MZTA 2KXHA 5EN1A 2M8HA 1AUDA 3BS9A 3SXLA 2OSQA 1HA1A 2GO9A 1NJIT 3IRWP 3TP2A 3CULA 1VQMS 5DDPC 3PIPQ 2F9DA 3FEYB 5DDOC 2EVZA 2DO4A 3TO8A 4F02A 1KOHA 1BY9A 2L41A 2OTJS 4WCEQ 5GAGU 1OPIA 1HL6A 2JVOA 2JVRA 3G8SA 2DK2A 2D3OR 1SJ4P 2CQBA 3G96A 4LJMA 1YIJS 5DM6Q 3MDFA 2M52A 2N3LA 5LJ5Y 3THTA 3MD1A 2DGTA 1VC5A 3EX7B 1P27B 3LPYA 2ZJPQ 2CPEA 2KU7A 2ADCA 3U1MA 2RVJA 1JJ2R 2DGWA 2MPUA 1M5VC 3K0JA 4RU2A 3J7YU 1U1NA 4W92B 5GVQA 2DHXA 4EGLA 3G6ES 1X4DA 1YWXA 5HO4A 1UAWA 1YJNS 3JB9k 1YJ9S 3I55S 2CPJA 1U1LA 2HZCA 4F25A 3CC7S 1U1PA 3NS6A 2GHPA 3THPA 2RRBA 2MJUA 2DGSA 1WI8A 2MQPA 4CH0S 3CCVS 2ERRA 2RUGA 3Q2SC 2MQOA 3G71S 1OO0B 2MKSA 2QA4S 1FJEB 5IQQA 1X4FA 5CXTA 4YUDA 2KRBA 2RT3A 4QU6A 2HVZA 1CVJA 2FY1A 1DBDA 4CQ1A 1K73T 2LYVA 1VQ5S 2DHSA 1X5SA 2MYFA 2BZ2A 2DH7A 2X1BA 1JJHA 1VBYA 3S6EA 2G1DA 2OIHA 2DGUA 2J0SD 2JRSA 3N9UC 3CXCR 2MGZA 2DGOA 5GAHU 3MXHP 2CQ0A 5DM7Q 1QVFR 5FJ4A 2KM8C 4CH1A 5MLCV 1U1QA 2MY8A 1URNA 3CMES 2G0CA 1HD1A 1OWXA 3CTRA 3VAFA 3RW7A 1FT8A 1WF0A 2MGZB 3LQVA 1WHYA 2MKHA 2MMYA 1VQNS 3ULHA 2V94A 2HGNA 1VQPS 1U2FA 1U6FA 1X5OA 2X1AA 3EGZA 2K3KA 2I2YA 2HGMA 2N7CA 2CQ1A 1M90T 3CCUS 3CUNA 2KHCA 3L3CA 4F26A 2E5GA 3H2UB 3G8TA 2KG1A 1IQTA 5IM0B 4TU8A 1D9AA 3CCLS 2RS2A 3ZZYA 1YJWS 1WEYA 2LXUA 3MURP 2FC8A 4C7QA 2JX2A 2MB0B 3MUMP 3DLLQ 4V19X 2YH0A 1QVGR 1PO6A 3BEGB 3ZZZA 2LMIA 1RK8A 1X4CA 2UP1A 5LXYA 2CQCA 2DHAA 1SJ3P 2LKZA 2CQHA 2DO0A 4UY8T 1FXLA 4LMZA 1WG1A 2DB1A 3CMAS 2L9WA 4QQBA 3CCJS 2E5HA 2DNHA 2LA4A 3UE2A 1Q81T 1M5KC 3B4DA 2YH1A 4IOCQ 5ITHA 2CQIA 1S79A 2SXLA 1VQ8S 3MI7X 3OW2R 3R1LA 4U67Q 2KN4A 2YTCA 2DH9A 5DETA 2XNRA 4WFAQ 2DGVA 2DNGA 2CPDA 2KXNB 1F9FA 5CA5A 2LQ5A 1NO8A 2JWNA 3S01A 5GMKa 2CPIA 2M4MA 3H2VE 3FEXB 4M5DB 3CCES 1KC8T 2A3JA 2KYXA 3US5A 4QU7A 2J76E 1WHWA 2AYMA 2CQGA 5LSOA 5D78A 1H2VZ 3SDEA 5D77A 3CCRS 2LEAA 2E5JA 2DNRA 2M2BA 2YWKA 3P3DA 3CC2S 1N52B 2OTLS 1YI2S 4WIIA 1X4GA 2X1GA 5LSLA 2MZ1A 1PGZA 4Y00A 1WG5A 2OSRA 1WF2A 3P6YC 3NNCA 3UWTA 2DGXA 1X4EA 3SMZA 2B0GA 4A8XA 1S72S 2DHGA 2KT5A 3HI9A 1DRZA 1N54B 1SJRA 2MQMA 4IUFA 4YB1P 1DHMA 3I56S 1U6BA 1N88A 2LXIA 3UCGA 3BO4A 4ED5A 4TLQA 3B4MA 3RW6A 2N3OA 2DNZA 3CCSS 1FHTA 4TU9A 2CJKA 1WG4A 1WEXA 4WF9Q 1H6KX 2DNLA 2VODA 3EGNA 2AYBA 3CD6S 1JMTA 2MHNA 2DH8A 3J7ZT 3NS5A 4WKRA 2M8DB 1H2UX 2CQ4A 2MZRA 2MSSA 4UQTA 1RKJA 2DNQA 2CQ2A 5JVGQ 1X4AA 2QEXS 3VAIA 2PE8A 2MZSA 3NNHA 2DGQA 2CQ3A 3DXBA 2J8AA 2CQDA 1WI6A 3CPWR 4ERDA 1SJQA 5GAEU 4FXVA 2M7SA 5HL7Q 2VOOA 4PKDB 1M5OC 1DZ5A 1H2TZ 2AD9A 2EK6A 1UW4A 2RU3A 2KFYA 2RQCA 4TU7A 5IFMA 2CQPA 2FC9A 3CCMS 3HHNB 4PRFA 2O3DA 3UCZP 3BO3A 2RNEA 2XB2D 2MKCA 1HD0A 2KXFA 2WBRA 2D9OA 3VAGA 2VONA 1OIAA 1P1TA 2HGLA 5LJ3Y 3IWNC 1VC6A 2DNKA 2DIUA 2DNOA 2KG0A 2XNQA 3UD4P 2BOPA 1U1KA 1WF1A 1KOOA 5LXRA 2FHOB 3MUVP 1WELA 2AYGA 3TYTA 2MZJA 3NMRA 4QPTA 1N8RT 3CCQS 2QFJA 1U1OA 2DNPA 4WFNQ 2DISA 1WHXA 3VALA 2LEBA 2HYIB 3S7RA 3S8SA 1VQ9S 3G9CA 2NZ4A 2MXYA 1X4BA 4J5OA 4ZKAA 2XS7A 3VAHA 3UCUP 4Y0FA 1UP1A 4PR6A 1QM9A 2LA6A 1WTBA 1Q7YT 2MQLA 5BJRA 3VF0B 3BO2A 5DDRC 1VBZA 5IM0A 4P6QA 1Q86T 2MSTA 2L08A 1D8ZA 1UFWA 2F3JA 2G4BA 2M70A 2MY7A 2XS5A 2VOPA 3Q2TC 1VQ7S 1VQ4S 2DNMA 2DNYA 1YHQS 4C4WA 3CC4S 1X0FA 3G4SS 3UD3P 1ZZFA 4C0OC 2J0QD 2I38A 2RS8A 3R27A 4OZ1A 3VAKA 2D9PA 2DITA 4BS2A 2ADBA 2KVIA 1VQ6S 1XN9A 2Q79A 1VQOS 1WWHA 1X4HA 5CYJA 4IO9Q 2CPZA 1X5PA 2MQNA 2K8GA 2KI2A 1O0PA 4CIOA 1YITS 2CPYA 1VQKS 2ZJQQ 1B7FA 2E5IA 1VQLS 5GADU 2LCWA 2MJNA 3D2WA 2E44A 2KM8B 4OZ0A 1ZZNA 4FXWA 1Q82T 3SDEB 1M1KT 2XS2A 3VAMA 2M9KA 2FPHX 2U2FA 2M0GB 2RQ4A 1VC0A 2PEHA 3MOJB 2DIVA 2N82B 2DNNA 2MKJA 2NLWA 1FO1A 2CPHA 2KH9A 5DDQC 1FNXH 3R1HA 1A7GE 3V4MA 4IOAQ 4Z2XA 1K8AT 2XSFA 2MKIA 2EK1A 3PIOQ 1NU4A 1WHVA 4WFBQ 1YTYA 5H1SV 2AYEA 2MQQA 3VAJA 1W2BR
chains in the Genus database with same CATH superfamily
1KWMA 1XK8A 1KQKA 3L09A 2G0JA 4O4RA 1S6QA 2AF6A 4ER8A 4RW9A 3MR5A 1U1MA 2UV8G 1I6JA 1E6VB 3BGFA 4I69A 3KUGA 1HYSB 1FRHA 2AJQA 3HVTB 2FGOA 4PXBA 5AXLA 3T5LA 1K9MT 1AFIA 1C4CA 1HWJA 1WEZA 5FDLA 2BACA 2AGPA 4L76A 3VVTA 3MUTP 2M88A 3MD3A 2H4YB 4RKUC 2LECA 4RNFA 1EAYC 3R7BB 2VF3A 1R8HA 1SJFA 3DOKB 1F3FA 5ETLA 1DARA 2COLA 4OJ3A 3M6WA 3D7SB 3ZNUA 5KAKA 2VHGA 3NOCA 4GRSA 2E1MC 2MTLA 3R97A 1M5PC 3NNAA 4ZPAA 2CJBA 2KRRA 1RT5A 3NRBA 2X1FA 2CPFA 3IFEA 2XGPA 3HD2A 1SV5A 2YX7A 1RADB 4LIRA 1XBWA 3PYDA 3EZ5A 2OJ3A 2HW3A 2F9JA 3OFGA 3Q8QB 1VHFA 4HTJA 4MJKA 3CF5Q 4A48A 3PX0A 1QSSA 4DV4J 4QIWD 2PC6A 2YNGA 3DLEB 4ZPVR 3CCTA 1S9GB 2DJWA 3IBWA 2BJ1A 4CCHA 1OY6A 5D3GA 1OYEA 3AJ1A 5IS2A 4WP9A 3TOQA 2JLGA 1CULA 3CVKA 3H8YA 2HLUA 3PHEA 3N6NA 3SXLA 2EEYA 2XCPA 2KTQA 4CLKA 2IAJA 4NXMJ 2V9KA 1FF2A 3I0SB 5F41A 3TP2A 3UDEA 3MEEB 1YKWA 2VG7B 4RNHA 5F9LA 3CULA 1IR0A 1RAIB 2HK3A 2AZ1A 5DDPC 3EPGA 4OI0A 4BDPA 2QLJB 3AFGA 3NBPB 2DO4A 4OMFG 4NCGB 1TV6A 3UR0A 3JSYA 4DR7J 1S4FA 4NZ7A 2LEPA 3E8OA 5GAGU 4WCEQ 4YFUA 2W9BA 3CCWA 4MKYA 1FKOA 2VD3A 2IHR1 5E7OB 1LW2A 2JVOA 2JVRA 4RL1A 3G8SA 2YVSA 2BQUA 4Q8EA 2XO6A 1Y10A 2VDIA 1CQMA 2KO1A 1FD2A 2HFSA 4J9LA 5DM6Q 4DR1J 4UOFA 2GVZB 2ZBCA 4LR7A 4OX8A 1RAGB 3KUEA 3WX8A 1EARA 2DCUB 5KT7A 2R2RA 3MEGA 1SKWA 1Y7PA 5J1EB 1RWVB 4RUAA 1HI1A 2CNLB 2AJ4A 1SC1B 4LVOP 1Z4UA 4NLTA 3TX0A 3EX7B 3W2VA 5M2PA 3MMAA 1UEUA 2B6AB 1DLOB 4USVA 4ZP8A 3OFFA 3FSIA 1TMMA 3T1YJ 2DYAA 3K8VA 1GXUA 1V9OA 3LO3A 2D74B 4OHWA 5HN0A 2QV6A 1U02A 4UW2A 1B3TA 4KJIA 4LR8A 2ADCA 5EWFA 1KQFB 3U1MA 3Q23A 1S49A 4KTQA 4DR5F 1JJ2R 5FIIA 1NZAA 1RWXB 2E1RA 3HM9A 4LF2A 1Y5NB 3TARA 3J7YU 4LFAF 4JBCA 3KMQA 3D54A 4W92B 2VJUA 4GKKF 1RDRA 2DHXA 1BUXA 2CIMA 4L3KA 4B3OB 1NXIA 2AJFE 2H1YA 4RW7B 3I6PA 1REVA 4HHJA 4B17A 3ILLA 5HJYA 1R8BA 1X4DA 2HZAA 3PTWA 5DO2A 3ITHB 1SIZA 3PX6A 3G87A 3JSRA 3SQGA 1N6QA 3QRRA 3JB9k 1YJ9S 2PI5A 3BQ2A 1F0XA 2VFUA 3I55S 4K2JA 4HH1A 4RW8B 1U1PA 2JEJA 2IM2A 4DCPB 3CGIA 4CLFA 2Y1JA 2BR0A 1CSJA 3E51A 3HT3A 4M5JA 1P9QC 1S9FA 2MJUA 4RW8A 1ZPVA 1HR0J 2XZDB 1SC3B 2QMWA 4DF4A 2ERRA 1N5TA 1CJUB 4M5GA 4DSIA 1Z1ZA 1RCXB 3M2VB 4RNOA 1N0VC 3TUIC 3W2WB 4U95A 3G71S 5F8MA 1OO0B 2MKSA 3F41A 1C0UB 1ZS6A 2EFGA 3KG0A 2FY8A 5K8MA 5CXTA 4KFBA 2AJ1A 4KKOB 2YNHA 2G13A 4F4YA 3SZ2A 4QU6A 1U8SA 5CZVA 2J6UA 4LF7J 4LFAJ 4NXNF 1DBDA 3CW2C 1H7WA 1RWMB 3CDAA 4IG3B 3MR3A 3BDPA 5T14A 4ED3A 1JIHA 4JV5F 1RHMB 3QT7A 2BZ2A 1SPBP 2DH7A 1NPPA 2X1BA 3CDWA 1VBYA 4Y34A 4EU0A 2FYXA 3M9OB 1HI8A 5CD4H 2HHHF 1CJVB 2RIJA 2RE1A 1DTQA 2Z58B 3N9UC 3O6QA 4DUZF 2MGZA 4BCAA 4F3QA 1R0AA 5DGBA 4LVNP 4ZVUB 5DM7Q 1HMVA 1D9DA 5FJ4A 3KLGB 4Z7YA 3I4PA 2KM8C 3RR7A 2YNIB 2MY8A 4CLSA 1URNA 1V3SA 2FHJD 1OY8A 4URQU 4JI4F 1KVJA 1OWXA 2YWEA 3VAFA 2VFRA 1FWPA 1TQLA 3D6HB 4KO0B 3RW7A 1I94J 1B64A 1JXLA 4NOHA 3C16B 1N32F 3RBEA 3BGOP 1NK9A 1H73A 1GNKA 2JLFA 2RAQA 3MCOA 4FVCA 3KLHA 5C2GA 1LW2B 1D09B 2JNJA 1WHYA 3LQVA 4IRKA 3B82A 3CJ0A 3KYLA 1VQNS 3TNVA 2RHQB 3GLJA 1T9TA 3B6BA 3CE8A 3ULHA 3WHIA 2QA1A 1X5OA 2JZ5A 5KFEA 3BGRA 3MFHA 3R9LA 3GIMA 2E1CA 2HMIB 2BRKA 5L9XA 2N7CA 2VKZG 4ED0A 3MEEA 1M90T 2F8MA 4RNMA 4A8MP 1YGYA 2E1AA 2KHCA 2Q43A 1K44A 1ZTWA 2IJFA 4GO5X 2FLOA 3WC2A 4TN2A 1EP4B 2QGFB 4U6PA 1VIXA 1JLFA 3KHGA 2YNGB 2KG1A 3CCLS 1D9AA 2QYCA 3FFIA 1UJ4A 3HZGA 2FZGB 3QYYA 1YJWS 1X60A 2R2UA 3PO5A 2LXUA 2OAUA 2XSJA 1T9VA 3AD7C 2N4DA 4CTAB 4EFAC 1RT3B 4C7QA 3MURP 3MFIA 1WDTA 5J1NA 5B0BA 1XQIA 4TLRA 1FXDA 3ZTRA 1T0TV 4H4OA 2YH0A 3TZWA 4IRDA 3BEGB 3K5PA 2R8KA 4KHPF 3ZZZA 3MR2A 4K4WA 4BBYA 4ELUA 2QA2A 5EUHA 2LMIA 1X9WA 1IKYB 1RK8A 3M8PA 2IYGA 4MFBB 1S0NA 5HQ8A 4C98A 4KYZA 1TU0B 1TKTA 3FDSA 2B9WA 2LKZA 2DO0A 2Z57B 5CYQB 1H72C 4HKQA 4WFXA 5HMXA 3DMJB 4RNNA 3EXYA 4DLGA 2HNDA 2JHEA 2L9WA 4YHHJ 3CMAS 3D1QA 1R8AA 4KV8B 3RZAA 2FZCB 1HYSA 1OPZA 3FRZA 3ZZUA 3FBFA 3CCJS 3W3SA 2DNHA 1EKSA 2GGPB 5E2QA 1Q81T 2CJAA 1H0HB 4Q2LA 1GMWA 3G82A 4L72B 3M2RB 3V6JA 3KTQA 2D41A 4XAKA 3B4DA 5GMEA 4H4OB 2EBGA 2HVEA 4ZPWR 5ETPA 4K2XA 4CNZA 1S79A 1B99A 2AEMA 4TY8A 4P7TA 3A8JA 2XSJB 4KGKA 1PC4A 2ILZA 3VGSA 2HEKA 1AROP 4P2XA 3EVMA 4BWJA 4QBUA 1S48A 2VQFJ 2XNRA 2KFNA 2G2OA 3HO1A 3CJTA 1GXTA 2QRRA 2BE2A 2JJ4D 3CJSA 2PMZD 4R8UA 2GQCA 4O3OA 2ZH8A 1BHNA 2OD4A 2UUAJ 3LALA 2ZZMA 2QX0A 2HAFA 3ILIA 1NO8A 1ZETA 1NB7A 4LF9F 3HKWA 2VIHA 4C8LA 4ETZA 3MMCA 1IBLF 1W25A 2O66A 1KFDA 2BW7A 2JC0A 1BXNA 1WHWA 2CQGA 1AYEA 4ZJQA 3PX4A 4CLTA 4NL5A 2ZDOA 3TZYA 2LU2A 3T1HJ 4ZHRA 2YWKA 1HNIB 3VQTA 3DLKB 2PI4A 2ZD1B 4EK2A 3GILA 1X4GA 5LSLA 5D15A 4PZVA 2MZ1A 1JK9B 1JQGA 1F6TA 1A6LA 1F9EB 2G2ZA 3NXZA 2OEKA 3ZZTA 1RTHB 4F04B 3VR1A 2IC3B 1NJZA 4DMZA 4ZLLA 4QYZK 2UXBJ 2HS4A 2V8GA 1T05A 1R8CA 4LF8J 1JKHB 2DHGA 2NXCA 3M6UA 4HACB 4ALZA 4XIUA 2IYIA 2F8HA 3HI9A 5IV4A 1VQYA 3M8ZA 1F2HA 2DY9A 1CJVA 1XTZA 4IUFA 1NSQA 2C3UA 1KONA 2YY3A 5D8HB 1TR0A 2MHEA 4X4VA 3QGHA 3TA1A 3P8BB 3BO4A 1UPMB 2ZVIA 3CMQA 4MIWA 4DUYF 2GVDA 4ED5A 4NLSA 4OI3A 5ETQA 2N3OA 5B08A 2HVIA 3TJAA 4OYMA 5I4MA 1NCLA 5L46A 1C0UA 1RABB 4ZLNA 3I32A 1WG4A 2NXUA 3PCOB 4Y2KA 5LM7E 5KFWA 3M2VA 4TQSA 2EG2A 2O1PA 1EHWA 3MPVA 5T41A 3DLHA 1FDDA 2WOMB 1H6KX 1NK8A 4DJBA 2VODA 4ED6A 4ZVSB 5KT5A 1FRLA 2A6OA 3LP2B 1UZHA 2EFPA 4NLPA 3TI0A 1T9WA 2AJ2A 4Q44A 5I42A 5IT9Y 3J7ZT 2W4DA 3E3XA 5HQMA 1JKHA 4LQ3A 5L1JA 3C6TB 1RWUA 5D6GA 5A2QY 1EJ7L 3J7AN 2CQ4A 3IBFB 2A2DA 4KH1B 3ITHA 3EZOA 2MSSA 1CQNA 2VV5A 3IG1B 5HVFA 3TX8A 1B0VA 3SV3A 1NHVA 1D3WA 2DNQA 5EX0A 4RW7A 4IQMA 4IG0B 2YKNA 1TP7A 3G6YA 2RMLA 3VAIA 2WVEA 2MZSA 4FNIA 3OFHA 3ZZRA 2CJ9A 5KG7A 1RT1A 4USMA 1IKXA 4B9MA 4U7UD 4AYBD 4ZCMA 1TVRA 4M95A 6FD1A 1IBKF 3RAQA 1D0EA 2W7PA 3PVXA 2IFXA 2E9ZA 1HHTP 4DPXA 1XJWB 5RUBA 3TUZC 2QSWA 5F8LA 4DV0F 2EK6A 2AD9A 1UW4A 2HNYB 3AJDA 4OZLA 4USIA 2BXJA 3D0GE 5JXSA 4X4UA 2D69A 2KFYA 4JI2J 1S6OA 2PIIA 3W2VB 2CQPA 1ZA1B 1OQ6A 3PJXA 3SI8A 1WJ9A 4WP8A 3OPKA 3DCAA 3AOAA 1FVSA 3NCRA 2XMUA 3BO3A 1C1CB 3AODA 3QO9B 2B9YA 1HQUA 3D1OA 3N6MA 5C25B 3IM8A 4LBHA 3NCQA 2D9OA 3TUJC 3VAGA 1O5JA 2R7VA 3TA2A 1P1TA 2WHOA 3K2YA 5A0YA 5GAGI 4IH6A 4MTPA 3T9ZA 3BJYA 1QJHA 2XWYA 4HT7A 2BUNA 4DV7J 4DV2J 3UD4P 2V2QA 2XNQA 3GPAA 1FKOB 4J90A 4WJBA 4Z37A 2NSBA 2YNFA 1U1KA 3M9MB 2ZH5A 2VL1A 3IN5A 1T7PA 2ZBPA 3D9BA 3W9HA 1QSYA 4ZVTB 3UDCA 1N56A 1TUGB 4PQUB 1K1SA 1TKDA 2Q6BA 2MZJA 3TAMB 3NMRA 3C15B 4QPTA 2PT0A 5B09A 2BKPA 4NA3A 4I64A 1FA0A 2AWZA 2DNPA 2HNDB 1Q16B 3QGGA 5DS7A 1KFSA 4C8OA 1P1LA 4FYVB 2KJVA 3BKTA 3PKYA 4PEOA 5ETOA 4EMDA 2Y8WA 2EXUA 2E7WA 2HVHA 2MXYA 3HK2A 2XS7A 1LWXA 2C3YA 3UCUP 2XTJP 1TUWA 2RDJA 4PR6A 2ZM6J 2ZH7A 2UUCF 4NE9C 4DR6J 1RAHB 2P6TA 4IFVB 4LF6F 3FCHA 1JLBA 1JLBB 2AMCB 3V81B 4X4NA 1RU1A 1W7WA 3LW5C 4A8OA 4ZDNA 1WTBA 3F73A 1Q7YT 1JWWA 5BJRA 4HDHA 1VBZA 3FCVA 2HHPA 3M1VA 2UVWA 3CJ3A 4UF4A 1Q86T 2MSTA 3JSMA 1S77D 4K5RA 1EP4A 3PRBA 4A47A 1N33F 1UMJA 1UFWA 1YZ7A 4FYYB 3U27A 3ETOA 4JI7F 3U7JA 2Y8YA 1RISA 4Y2IA 1SCJB 1YX2A 2RHSB 3DGPA 3HVTA 4OJHA 2XMAA 2DD8S 1AXQA 3LGMA 3GONA 4H4MB 4M5MA 4ELTA 4I0WA 1VQ7S 3T5JA 3IXQA 3Q2TC 3A8EA 3M2UB 3FMWA 4IH5A 3TEGA 2FVRA 4JI8J 3PYFA 4C4WA 2F5GA 3CC4S 1VK3A 1X8DA 4X4TA 2JFDA 2RUSA 1TK5A 4Y6IA 1Q78A 1GX6A 1T03A 2J0QD 2W4PA 3D4JA 4B08A 2B7BB 5K20B 4ECWA 1M5HA 2DT9A 3JQMA 3VAKA 1RHKB 4F4KA 1WOPA 5SUHA 2NXNA 3HFZB 1CC7A 4U96A 4BS2A 4H4KC 2R8HA 5DG7A 2QO3A 3ZO7A 1N5QA 2ALYB 2DR5A 3A12A 4RLEA 3C2PA 5CYJA 2VDHA 4IO9Q 4LBIA 4LRAA 1IBMF 4DV6F 3FJ2A 3A3PB 4EUVA 3VZHA 4ZPTR 1SH2A 2YNIA 2ZHOA 4M5NA 4OYXA 4YP3A 2K8GA 4ZPBA 1J5EF 4AE5A 1VLYA 3OL7A 4JI7J 2UXCF 2BQRA 5GAHI 2IRYA 1SQFA 3EUNA 4QOTA 2W7OA 2ZJQQ 4DV5J 3JQJA 1URRA 2HQ3A 2MJNA 3THVA 1O51A 4OX9F 1TVRB 1U49A 1WC5A 2EKNA 1LFWA 1MU2A 5J2QB 3DOMA 5LMNF 2E9RX 4LF5F 1NJXA 1UKUA 4NXNJ 5D0RA 3M30A 1IJEB 1KQGB 1YG0A 1FRMA 2PEHA 2Y1LB 3GQCA 5HLFA 4WTOB 5J1PA 4FS2A 3QATA 1VC0A 5DLGA 4HI1A 4NLVA 5E3QA 4IR1A 1EETB 5D4PA 3C6TA 1YLXA 1RCOB 3R5JB 5T7LA 4Q2MA 3CCZA 2GC8A 4DR1F 3GYGA 4E98A 1A7GE 4PYDA 2BJEA 5I42B 2RILA 4NZ0A 4WWSA 1WHVA 2R2SA 2GIRA 3NG8A 3BF4A 3MAAA 4IDKB 2AYEA 3KHHA 1UZDA 2MQQA 1WKLA 3R6GB 2R7QA 1WC6A 1N6QB 1FJ7A 5JVHQ 2FJVA 2ZE2B 3SEOA 1RHQB 2C2RA 4ECUA 1U1RA 4ANDA 3KJQB 1RWWB 3PW0A 4ZVHA 4DR3F 5BR8F 1FE0A 5G0RB 1RTDA 2C1EB 2B8QA 4ZLPA 1ZH5A 3AJ2A 3CSKA 2NYHA 2W2NP 3SQOP 3UNYA 4DQRA 1Q53A 3ICLA 3CJKA 3V5RA 1HI0P 1DAXA 2QG9B 5E3RA 2ZBIA 2VQEJ 2ZJRQ 4F2RA 3WQPA 4L74A 2DEIA 1A9NB 4QIFA 5U47A 5CAAA 3HFKA 3QGPA 3GG0A 2WVDA 3I5AA 3SCKE 2WSCC 2AU0A 1Y5IB 1F2GA 2GO8A 5D4OA 4CO5A 1X5TA 4U7CA 3Q83A 3RBXA 1HHSA 2RRAA 4ICLB 5J1EA 3MF5A 4W90B 4JV2A 2NS1B 4DL3A 4ZN3A 3LP1B 1HNWF 4KGMA 2W9AA 2I8EA 3LANA 1NDCA 5KTQA 3HKZD 3UN3A 1TL3B 2HWTA 5A8WB 1WTFA 1U8WA 3DLKA 3MM9A 4IQXA 2KXHA 2DRAA 4OHYA 1H98A 3AAWB 4OYOA 5ETSA 2XI2A 3TVKA 1AUDA 1VIOA 1EIYB 1APSA 3QT8A 2GHVC 4DFJA 4AL7A 1XNQJ 1S7HA 4K0KJ 2OSQA 4EWTA 2GO9A 4YB5A 2HG4A 1MROA 3W61A 3IRWP 4Y2CA 2WSFC 2ZKTA 2QLFB 1B70B 1KS2A 1VQMS 2F9DA 4NZ6A 2A18A 3NBPA 2EVZA 3MMCB 4DPUA 3TO8A 4F02A 3MM7A 1BY9A 3M32A 4OHZA 2VG7A 4USKA 4WXWA 1V5VA 4QR0A 2FDNA 4D3HA 1HHQA 4DLEA 1RLDA 1VBKA 3M8QA 1CS4B 2HRUA 1OPIA 1HL6A 2KYZA 2D3OR 1S12A 1IUJA 5L1IA 1SJ4P 3G96A 1KP6A 1S9GA 5AT1B 4HVZA 3W64A 4DG1A 2C2DA 1IJFB 3CO9A 4DX5A 3MDFA 5LSRA 2R8GA 1U0HA 2EW9A 2IBOA 2JOQA 4EO6A 1MN9A 2P8IA 3MECB 2DCLA 4OYBA 2IPOB 1BGXT 1FK9B 2R3VA 3THTA 4DV3J 2Y0SD 3DHXA 3F56A 2OPRA 1GEHA 5EGYA 5M2UA 1PYTA 4MK9A 3B54A 3W60A 4P9SA 3SYZA 4ZIWA 4LF5J 2WCXA 1FRXA 2GHWA 3AT1B 5B0GA 4DPOA 3DOKA 3DOLB 1Q8KA 4Q43A 1R6YA 5CYMA 1BC6A 3TW0A 3MAHA 4LFCF 1ZM2A 5FDLB 1X7VA 1VFJA 2MDAA 4NLDA 4WYLA 3KK3A 2R7RA 2GZOA 2IRXA 3M8PB 4MFBA 4URSA 2AQ4A 2RF2B 2B56A 1WSVA 2V0NA 1NK0A 3G86A 3KG1A 1HARA 1FKAF 1XMBA 1HNZJ 4UY85 1F1BB 3I5BA 2ILYA 4EBDA 3P96A 3G2XA 2LQBA 2QE5A 1C0TA 1F5BA 3FKBA 2N7YA 3LAKA 5HO4A 1NK6A 2XY5A 2GFFA 2Z2LA 3HVAA 3PRDA 2HWHA 6FDRA 4PWDA 3FFIB 5LT5A 2KJWA 3W62A 3RUBL 1FWKA 2OGUA 3HCXA 1Y9OA 5K14B 2UVUA 4F4WA 2H5EA 3OTOF 3ENWA 2MQPA 1UWAA 1WOSA 2GJ2A 2RUGA 1RHRB 2X3GA 1R7IA 3M8QB 2I6WA 4X66J 4LFBJ 1PBUA 3KJNB 4NASA 1H38A 2MQOA 1FJEB 2QA4S 1SKUB 1S10A 1WDDA 5BXIA 1KR4A 1NM2A 2ROEA 2RSQA 2RT3A 2VFVA 1TL7B 3BGRB 4B9LA 4O3RA 4JB8B 1VI7A 3GJTB 4X65F 5K5MA 4CQ1A 2ASLA 1NHKL 3VQSA 3ONQA 1VQ5S 1H74A 3QT6A 2GS8A 2MYFA 3L95X 3EJMA 3HULA 3KLHB 3H5YA 1RHJB 1UVJA 4JP8A 2J7UA 5L1KA 1MWQA 2Y0BB 4FF2A 4OLOA 3UVJB 4YS2A 2IM3A 3J80U 2JRSA 3BSNA 3CXCR 4DL4A 4U8YA 3V6DB 2DGOA 4Q5VA 3V4IA 5GAHU 3CDEA 3QIDA 4NA1A 3LP1A 5KFZA 2GA7A 1RTJB 1JLAA 4F3MA 3J81j 3NP5A 3PM9A 1TAQA 3DRRA 3W7BA 2XC9A 2W4CA 4NYPA 1BD6A 3OHAA 2OPPB 3GIJA 3QMQA 4LFBF 1WF0A 2MGZB 1R0AB 4KAIA 4PG5A 3GSIA 3K7RA 3MM5A 3PW2A 2Y9HA 2XMKA 3QLHB 2V6AA 3EGWB 3TAPA 1KTQA 2HSEB 4C8YA 3KLIA 2DPIA 2LVWA 1NMEB 1REGX 4LSNB 1QY7A 4IG3A 5E0OA 2FVPA 1U09A 5D0GA 4N56A 2UXCJ 3EGZA 2K3KA 1S1WA 1X0PA 4WFYA 2HGMA 2I2YA 2D3O1 2ZE2A 1J5OB 5EX3A 4IFYA 4LREA 1GT8A 2ZNZA 2FTRA 2KDOA 3PEJA 4IH7A 5B0DA 3CCUS 1UA1A 2VU5A 5KOWA 3MAAB 4K4UA 3J7YI 4ZITA 5IQ6A 1DURA 4X62F 3R6LB 3VCDA 1LEOA 3ISND 3OL6A 1NNDA 4TU8A 4DR5J 1KN6A 4FN5A 5DZ6A 2XMTA 2ZOGA 2GMHA 2HPUA 3PRVA 3ZZYA 1XMQF 4DX6A 1VQSA 1HWLA 3MUMP 2ZHBA 1S0OA 5E3PA 1REVB 2BRLA 3K59A 2QC3A 2P5VA 4DWIA 2YWGA 3MMBA 2BJ9A 4QWEA 1R6VA 1HWIA 3KDOA 2FJEB 4QZVB 3SV4A 1RLCL 4QWAA 5LXYA 4NWBA 1TK0A 4ZVOB 1R43A 4F0MA 5KG5A 4Q0BA 3MAQA 4WK3A 2BVZA 4N41A 4UY8T 1YDLA 4J9NA 1QE1A 1S99A 2DB1A 4RJVA 2WK4A 2YKMB 4QQBA 5KFJA 5IWAJ 4OZ2A 1S57A 2CFXA 2KHDA 4ES2A 3FQLA 5KT3A 4MIAA 3AHPA 5THWA 3NCPA 4ZOSA 1KHVA 1WC0A 3MMAB 4KHMA 4C3LA 1M5KC 4DR7F 3OJSA 2J0XA 4U7UK 5CCLA 1SB6A 2YH1A 1T8EA 4IOCQ 2HHXA 3D66A 1HBOA 2CQIA 4H54A 1RT4B 3OR1B 4ENOA 3R1LA 1BMQB 2KT2A 3M9NB 4DU7A 5DETA 2V8DA 4RZRA 1S6PA 2NQPA 3I31A 4C11B 4OX6A 4ZPDA 2DNGA 2J9EA 8ATCB 2KXNB 4DS4A 3L4BC 3KJVB 2BX6A 3EZUA 1YVFA 2BKOA 4F4AA 5CA5A 4DR2J 3JAMY 3ZNJ1 5IT9U 1F60B 4DV4F 2W9BB 1EB0A 2JWNA 2V50A 3GFYA 2M4MA 3S01A 5GMKa 1XR6A 3FEXB 5HP1B 1Y3KA 3CCES 2HBQB 3UFCX 1KC8T 5ETTA 3AOCA 2QFIA 3KDNA 3US5A 3IGNA 2YKMA 5KFRA 1HQEB 1G4CA 1H2VZ 2POKA 3HF5A 4TNOA 5I3QA 3CCRS 3TANA 1Q5YA 1TAUA 3WBZA 2EWHA 1LWCA 1ZM9A 1U2CA 3MHYA 4PXCA 2M2BA 8RUCA 3JSMB 1VMBA 1JLGB 1N0UA 3GR1A 3QAEA 3R5DA 4WIIA 2HQGA 4DBQA 1WG5A 5E41A 2I5JA 3JTNA 3VGTA 2V68A 3EVOA 3QNWB 2C2EA 2LP4A 2CVIA 2OSRA 2RKIA 4LF6J 1U0SA 3H5XA 3NNCA 5E3CA 2L48A 2MLZA 4F7VA 3MCNA 4DV2F 3PW7A 3OFEA 1Q7LB 2B0GA 3VGVA 2C3MA 4ITSA 5C24B 4HHUA 2C22A 1TFYA 1NRKA 3AXMA 2LXFA 3KLEB 3D6FB 2CAJA 2BANB 4OI6A 3IWXA 1JLQB 1ZAVA 4R0EA 1M1GA 1T9YA 4TYBA 4TYAA 4P73A 4XPCA 3H25A 1PBAA 2AX0A 2F8EX 3PY8A 3NL0A 4CP5A 1Z2ZA 4LSLA 1FRJA 4ETXA 5DLFA 3T1YF 1I51B 4RX6A 4DR4F 1N88A 2DXFA 2E7XA 2CJYB 2LXIA 4FKXA 3UCGA 3UNGC 4RW9B 3A1YG 3TAMA 3R8YA 4BC9A 2W9CA 3GV5B 3PW4A 4DQSA 1S6QB 2AEJA 3RAMA 4PQUA 4X4SA 3DGVA 5KFPA 1YRUA 2BOAA 2HBZB 3UR3C 1J2VA 4BC7A 1RACB 4IKAA 4L6V3 4DL0C 2JL9A 4N47A 2EFOA 3HHLA 3HJVA 2XO7A 2R9LA 2AYBA 2HQDA 4JI5J 2ZEJA 4Q45A 5K8OA 3BBCA 3IR6B 5ETMA 2KL8A 2L9DA 3NS5A 3QRPA 2BDPA 3AB2B 1JX4A 4PG8A 3HHLC 1C1CA 1H2UX 1OMSA 2YWFA 3FMBA 1IR1A 2XI3A 3DYAB 4PABA 3OVAA 3KHLA 1T02A 1U4BA 1RYRA 4LRCA 2CQ2A 4B3SJ 1X4AA 3IP0A 2W8KA 2Z0GA 2ZH1A 4RUBA 2QEXS 2PE8A 1RAFB 4I1TA 3QGIA 2CQ3A 2YQ1A 2J8AA 1RI7A 2CQDA 2N4CA 3DXBA 3DHWC 1XIQA 4FBTA 1WI6A 3DI6B 4ERDA 4LUBA 4USWA 3FNNA 4FXVA 5IC6B 4F4ZA 4O44B 4J37A 1RT1B 5JJBA 1YBAA 4PKDB 1H2TZ 4ZVQB 2ZDPA 4AD6A 2RU3A 2M3DA 3DU5A 4ZVGA 4E2FB 1PKUA 3MEKA 1BQMA 1RBAA 4IG0A 4X4PA 2F4VF 3CCMS 1SKSA 2BYCA 2HWIA 3C14B 1C2PA 4LBPA 3K89A 3DRSB 3P5BP 4KT0C 3HHNB 3UCZP 2HAIA 1FTCA 3FC9A 2W1BA 4DHVA 5L39A 2G0IA 4DR2F 2DR6A 2MKCA 2OFHX 3GE9A 3GWCA 4CO0A 4YR0A 1XNRF 3RGIA 3I96A 4LFCJ 2R7TA 2XLKA 1FERA 4ELVA 1NK7A 2HIYA 2V2VA 3DN9A 4X4QA 3N6LA 1R0CB 1SJ1A 1GH8A 2VONA 5G4DA 3RBDA 3RB0A 3D3BJ 2PD1A 3IBCB 1IBKJ 1UFLA 2Z2MA 1PG5B 2UUTA 2WOMA 2DIUA 1G7CB 1S9EA 4NRUA 4R0JA 1I94F 1UVLA 2BOPA 3H90A 2YPZA 4NX9A 2FB0A 2CDQA 2QL5B 1CJKB 2NUHA 4EO8A 7FDRA 4JI3J 1WF1A 1KOOA 5LXRA 2UUBF 4RBVA 2OH2A 3NKYA 1SQGA 5K8NA 5HMWA 2GVDB 3WZ0A 1TKXA 2XM3A 1R89A 3TQ1A 4JI6J 3BGUA 2QFJA 4HH0A 2UUCJ 1RT6B 2DISA 1G1XA 4KH0B 1WHXA 3DLGB 2XYHB 3GJRB 3UQSA 3NAIA 5CYMB 4J9SA 2HYIB 4Q7AA 4CLZA 1S1TB 3GJQB 3DOLA 4DSJA 5D4LA 4JYAF 3OXLA 3P4UB 4J5OA 3RB3A 2HS0A 2CZ4A 3LPEA 4KRWA 4Y0FA 1UP1A 4KIAA 4NLUA 1FDBA 2NYIA 1AZSB 4O3QA 1DTTB 1QM9A 1RGVA 2IC3A 2K3IA 1UL3A 2LA6A 3I0RB 4UZCA 1HWKA 2H5IB 2H4WB 3U02A 4YR3A 2V67A 2MQLA 4I6YA 3LH2S 1LWEB 1B7YB 1U0HB 5DDRC 1S6UA 5ETKA 4OV6A 5IM0A 4ZS6A 2L08A 3Q86A 2ZH9A 4EZ6A 2YX1A 3FUYA 4G1QB 5E33A 4DL2A 1NBEB 3CB4A 2E5LJ 4LF4J 2HHTA 3LTOA 3OHBA 4QW9A 3EVWA 4DQQA 1T11A 2A0FB 2DNMA 2WRMA 2P9EA 5A8KB 2FJXA 2H65B 3NGKA 1RT2A 1N5YA 1IBMJ 2ACYA 1MROB 2I38A 3I82A 4YY3J 4XK8C 2Z2ZA 3Q89A 2GAHC 2V2ZA 2IIHA 2HHSA 2HNZB 2IRUA 2LLZA 3GYXB 2FJAB 2ADBA 1VQ6S 1FEHA 1XN9A 2WTFA 3ISZA 2HHWA 5LMUF 3RYLA 4DV1J 4ILRA 5HJXA 4M63A 2A6MA 3EDQB 2ZFHA 2B5JB 3M05A 4A8FA 2CPZA 1HLWA 4I6AA 1X5PA 1BQNB 1ZPWX 4OYIA 2WONA 1F5AA 2MQNA 2KI2A 3M2RA 3HHDA 4CYUA 1RKIA 3HVRA 4NCBA 4KC5A 1V3RA 2GGPA 5E3AA 4ED7A 2IY5B 1FKPB 2H51B 1VQKS 3DRYA 3DLBA 1C4AA 5F0UA 2E5IA 4KV8A 1LK5A 2LQJA 4UOGA 3PW5A 5GADU 2LCWA 3OXFA 3BDEA 3D2WA 1ZM3A 1TL4A 3H42A 4OZ0A 1TUVA 1CC8A 3DKDA 1HKAA 1HPZA 3IR7B 4FXWA 4KPCA 3CJKB 3SDEB 1VRUA 4A4JA 1Q82T 2XS2A 2HBYB 3N0VA 4J9OA 2HZVA 2M9KA 4I7FA 5KG3A 2FPHX 2ZC3A 4KY3A 1FDAA 4N77A 4LF9J 1ZAXA 5J2NB 4DOZA 3TQEA 1T95A 4DR6F 1IVZA 4YQWA 2YQ0A 4URGA 3EMTA 3EWGA 5J2PA 2MKJA 3BN4A 4DV3F 2G9OA 4F2SA 1R31A 1FO1A 2CPHA 2NLWA 2K7KA 1V5IB 5DDQC 1TK8A 2LQ9A 3M6VA 3V4MA 2XSFA 1U26A 2AW0A 3K5OA 5IOLA 1UJ5A 1RUSA 1JLFB 4XDCA 2V4QA 4C3KA 1FTRA 3X3UA 1F5CA 1VOMA 2FQQB 4JI6F 5F3TA 3C6UB 1LXJA 2FJBB 2AX1A 3MPYA 3CD5A 1RAEB 1W2BR 3QIPA 1UFKA 1Y5LB 1NHUA 3LP0B 5A8RA 3QZ7A 3KK1A 1GTHA 1RBOB 3C14A 1FJCA 4LQ9A 1TMJA 3CCVS 2J6SA 3DC2A 2LU1A 4S0MA 5HLFB 4ZJLA 1G2EA 3EGVA 3K5NA 4JI8F 2ATLA 2VKRA 1FWLA 3HP6A 3L9ZA 1QAYA 1HBUA 4UT4A 3FSYA 2W25A 2U1AA 5C42B 2DEJA 1MNEA 1Q5VA 1KQSR 3IRXB 2MZQA 2LQ8A 3D6TB 3HSGA 3MM6A 1P8GA 4CI0B 3U1LA 2YKPA 1XNRJ 2V4JA 1QSLA 1IKWB 1SH3A 2ZOMA 3SSSA 1WC3A 5KFFA 2ZC4A 4OI2A 4OZJA 1IKVB 4JI2F 4A46A 5KFBA 2MKKA 2Q66A 3P49B 3OL9A 4X66F 3W5XA 5B7WA 1NZ8A 4FBUA 3KLGA 2BW2A 3D0IE 3DNCA 1IKVA 3CDBA 4B9VA 3RRKA 2UV8A 2FVSA 4QIVA 3C3LA 3E2EA 4YOEA 2MZTA 1M5SA 4C2MA 5K8PA 1DTQB 4R25A 4F8RA 1X0FA 3KG4A 2PDAA 3KUHA 2NCKL 5EN1A 3OVBA 4FF4A 4ZPCA 1FNOA 3IRXA 3MM6B 3BB5A 4ED2A 4DX7A 2IM0A 1HA1A 1UVNA 3NS7B 1BLUA 2ZOFA 5DG8A 1T03B 5DRKA 3LGHA 5CABA 3Q8RB 5B0FA 4B3SF 1NPRA 3AD8C 3BBBA 4GKKJ 5C2CA 2FVQA 3NGRA 1NPKA 4JV1A 2NREA 2VBYA 3BKUA 1GAOA 2OKQA 3QIPB 2VG6A 2BA9A 4ES1A 2UXDF 1LNQA 1Q0NA 1QUPA 1YK9A 3C6UA 3O5TB 4NRTA 1MWYA 2YPYA 1VLOA 4ZVFA 2KB2A 2APOA 1S7IA 1RWOB 1PJ7A 2CQBA 2VPXB 3QBCA 4FP9A 4J7CA 4LJMA 2BEFA 2BANA 4DV5F 1YIJS 1XC9A 2B9XA 2M52A 4WE1A 3HXMA 3J80Y 5EWGA 4Y28C 4NLWA 5LJ5Y 3TR5A 3VHQA 3MD1A 2YX4A 5F8HA 5KFKA 1KVIA 3CWJA 2DGTA 3C19A 2YXLA 3GIRA 3ISNC 1I5OB 2FZKB 1I3OB 1RT7A 1RE1B 3LPYA 5HVHA 2I5JB 5KFQA 5KFTA 5J2NA 3BSAA 2H9ZA 4TXSA 5I3PA 2FD2A 2CPEA 2KU7A 2JEFA 3OT9A 5ETNA 2V9WA 1S1UB 2ZBQA 2RVJA 4O3PA 2WBMA 2MPUA 2V4RA 2J7KA 4W98A 1M5VC 3W66A 4ECYA 2MLXA 1HQEA 1S0VA 2ZVSA 1FRIA 4MYTA 1DQ9A 1GMWD 2OPQB 3D5MA 3IWLA 1FKPA 5GVQA 4EGLA 4ECXA 4ZP6A 4DR3J 4GC7A 2VA3A 1CJTB 4JUZA 1YWXA 3BPDA 5HBMA 1YJNS 4PXDA 7FD1A 3AOBA 1H3DA 4X4OA 2VA2A 4DS5A 4CDIA 2GVZA 5HSPA 2EFVA 4F25A 1WNEA 1N34F 3W8GA 2VG5B 5F9NA 5A0YB 3Q8VA 1U24A 2XYGB 3W65A 3BBFA 3OJUA 3PZPA 2RRBA 5F8JA 2DGSA 1WI8A 3OR2A 5C25A 2CXEA 3H40A 2F4FA 4FNHA 4NYOA 3CNQP 2ZH4A 4JOUA 4TQRA 1YSJA 1ROFA 1I1GA 3KLVA 1XERA 3KLFA 5IQQA 1X4FA 4A8KA 3D1HA 3WX4A 1TV6B 1CJTA 4CWBA 1TELA 1LFPA 2HHUA 2VJVA 4HDGA 2FY1A 1CVJA 3CJQA 4ATNA 3BV8A 3PJ9A 3M8YA 4GO7X 2EBEA 1K73T 4GVLA 5EDWA 2XEXA 3I0SA 4YB7A 1L3SA 2DHSA 3TWZA 1KKHA 3QWUA 5A2QU 1FFSB 2PA3A 2B9EA 2IVYA 4DR4J 2PFDA 1N33J 2IVMA 2B4OA 2QL9B 2G1DA 2LDIA 4L3NA 1N32J 3TVZA 3DLEA 1R0BG 5K9FA 3DU6A 4FYWB 1VJQA 3L7OA 2CQ0A 4ZCKA 4B9UA 1QVFR 3ETMA 2AGQA 4ZLJA 4CH1A 3R5AA 4OZ3A 4C0BA 5MLCV 3QJPA 1EQMA 1RBLA 2J8SA 4AQYJ 2BBEA 4PG4A 1HD1A 3CTRA 3CEDA 1RSCA 1FT8A 1SVDA 2BKNA 1V3ZA 3BGLA 1QAXA 3FZBA 2XQCA 5KG6A 2ZZTA 2XULA 3HJFA 2ZZNA 3AQPA 2A10A 4JV5J 2HS3A 2RB7A 3W8PA 2HFUA 4OYAA 5B0CA 3JYTB 2WW8A 3PACA 3R2CJ 2VG6B 3PDNA 3M8SA 1LOUA 2NXJA 4ILLA 3W5YA 1J5OA 2XBPA 1LW0A 1U2FA 1U6FA 4OQJA 4M8LA 3HSZA 1BE4A 2QLBB 3IGVA 3RU0A 4N76A 2CQ1A 2F40A 3C66A 3WIVA 1JLCA 1GXLA 3SSQA 2BJ8A 2UZAA 3CUNA 2NSCA 3KLIB 3M7VA 4HI2A 2C2OB 3HHLD 1S9EB 4QIGA 3RB4A 1VK8A 3KXDA 3X1LB 1SUQB 2CRLA 3L3CA 4MIBA 9ATCB 5F3ZA 1J27A 2YKQA 3MM5B 5MAOA 2PMHA 2E5GA 3H2UB 4USUA 2X7IA 3G8TA 1IQTA 1MSWD 2WSEC 3LGNA 1NDPA 1WD6A 1WEYA 5JMNA 4NYZA 4DPTA 1FX4A 2CG8A 2FC8A 2OPPA 3HFVA 4HACA 2JX2A 4PXEA 3GFXA 4DSFA 3HDSA 4PWUA 3J81U 1KNZA 1SBRA 4V19X 1S1XA 4ECRA 4HR2A 4U9RA 1QVGR 1Q79A 4LF7F 1BQMB 3KK2B 2OPSA 4J9RA 4M5LA 1TKZA 3N01A 2V63A 3GP9A 2QN6B 2E9TA 5KFHA 4QPXA 1HNXJ 1X4CA 2CNKB 3UVJA 4DUTA 3KMSA 1IKWA 2V4JB 2BE7D 2CQCA 3H4BA 1YBTA 3CDUA 5AXKA 2AV5A 3OTDA 2JH3A 1S1VB 3NAHA 2B4PA 2QT7A 5CZXA 4LMZA 1WG1A 4FXDA 1FXLA 5H9FJ 1RB0A 2HBRB 3ENVA 3HZEA 4YN3B 2P9GA 4M1KA 1P9YA 1Y4ZB 4QWBA 4R5PB 2XY6A 4P74A 3MR6A 4PUOA 2B8PA 2L9NA 2LA4A 1DY3A 1YJVA 2OPSB 1PIEA 5F0WA 2VICA 1YRXA 1L5UA 3T41A 4B3TJ 2HFOA 2DBBA 4KGVB 5AE3A 5ITHA 3JS9A 4LRFA 2R8JA 3AH6A 5ADZA 2ZM6F 5KFGA 3MI7X 2QL7B 3UD5A 1NJWA 2C2MB 2KN4A 2GJIA 2XMVA 2CUYA 4M94A 1GFWB 2DH9A 5HATA 4WFAQ 5H9EK 1UVMA 2DGVA 3FGVA 3KJFB 1ELOA 1BQXA 4FYXB 4B3RF 4P2FA 4TY8B 3IM9A 1FNMA 1OQ3A 1LV5A 2PEBA 3Q8SB 1JLCB 1T9XA 1WKKA 3FVYA 4JI1J 1C0TB 3H20A 4AL6A 1UEKA 2VFSA 1FD8A 2PGCA 3E01A 5CD4A 3G82B 4M5DB 3TJ8A 5LMNJ 2ASJA 2W9CB 4DL7A 1UPPA 1UEVA 1LW0B 4WPAA 2A3JA 2GV1A 1G3OA 2KYXA 3OSNA 2R2TA 1HR0F 2J76E 4J9VA 1WC1A 1JNRB 1XNQF 4QU7A 2P6SA 2CA9A 2ZKUA 5D78A 3SDEA 4Z7CA 3LWMA 4EI2A 2LEAA 5CYQA 1FESA 2QTWA 2E5JA 5D0EA 2DNRA 2JSXA 5HK4A 3G6XA 2XZWA 3K8WA 5A6PA 2Y1RI 3LUYA 2R7SA 1N34J 2B3TB 1QTNB 3P3DA 3CC2S 4C9DA 1IKYA 3GU0A 2OTLS 4AL5A 2VQFF 1PAUB 4EBEA 1PGZA 1KLNA 3AB4B 4ZMMA 4YY3F 4CYUB 1PILA 1E6YB 1WF2A 2OPRB 3IS9B 3K58A 2J0WA 3KNGA 5B0EA 3UWTA 8AT1B 1X4EA 2R4FA 2H3EB 1FK9A 4ID5A 2B5JA 3SMZA 1S72S 4JI1F 2W8LA 4CTAA 3DLJA 3RG6A 4BLGA 2IDEA 2FHJA 2KT5A 3F0NA 5BYSA 2FJWA 4NLGA 4CO3A 3ZTPA 1OYDA 1N54B 2HFZA 4DEZA 3T3FA 3T1HF 1F9HA 2MQMA 5KG1A 1DRZA 4OL8A 2FHMA 1VYAA 3H5SA 4YB1P 1LWCB 1QAJA 1DHMA 1RWPB 1XWLA 2BABA 2LDYA 5F8IA 3KFWX 1T9UA 3I56S 2HIQA 1Y0HA 4P71A 4RR5A 2L3MA 1P6TA 3AXKA 3QQCD 1XMOJ 2E66A 2HMIA 3MM7B 2FLNA 1KTVA 3B4MA 4TLQA 4WKYA 3RW6A 1N36J 2A2CA 1Y00A 2DNZA 3CCSS 4I67A 1FHTA 5DZ7A 2RQMA 2HQIA 4WBFA 1JNZB 1Q8LA 4KGZB 4RW4B 4YB6A 2VFTA 2XMMA 2H54B 4TU9A 2CJKA 2IMWP 2W2PP 3KJVA 2DNLA 3OR2B 4HT5A 4NLQA 3IAS9 1HBMB 2OFGX 3EGNA 3D67A 3HHKA 4LSZB 1S6PB 3N28A 4QW8A 4CO4A 4I2QB 3H98A 2DTJA 3MEDB 3MM9B 3O1LA 3VGUA 3CJ8A 1JMTA 2MHNA 2V5HG 2VG5A 3CJ2A 3DFEA 2R8IA 3BQ0A 1RT4A 3D6MB 4I4BA 4DFKA 2K1RB 1PAEX 3W1YC 4OZ5A 1X9MA 1HBOB 1DQAA 2EC2A 1QTMA 2UXBF 4CRJA 4MKVA 1RKJA 1AZSA 5KFNA 4C3MA 1HMVB 3DRPB 1XMQJ 1VISA 1S59A 2NXEA 4L75A 2OI2A 4NXMF 3PXGa 1UWBB 4JI3F 1UJ6A 4M5IA 1VCTA 3A3OB 3NGTA 4NMLA 3JTPA 1QE1B 1MMDA 4PCQA 3CPWR 2RJZA 4P2MA 4P75A 4I56A 4MK8A 3Q8PB 3DLGA 5GAEU 4Q0BB 1NEEA 2M7SA 1W26A 1S1UA 3QSIA 3IAM9 5G0RA 5I3UB 1VRTA 4F3OA 4DUYJ 3KHRA 2CNNB 1NSAA 4IOBA 3E01B 4J9UE 1NH8A 3L7UA 2HKEA 3KNAA 1S0MA 4WTYA 1CJKA 3R7SB 3B78A 3W2WA 1YBUA 4ES3A 4A8WA 3RB6A 3GV8B 2PFFB 2IA6A 1UVIA 3N4WA 4O23A 1HD0A 4AUKA 1GK8A 2E7VA 2P9CA 3WDOA 4PPDA 2KXFA 1TL1A 2DXEA 5IT4A 1DQ8A 1OIAA 2HGLA 2QMXA 3O2IA 4B02A 1RZMA 4ZCIA 3IWNC 5IXUA 3SCJE 2JLEA 4CH7A 4KSEB 3PO4A 3R2DJ 4DL6A 3CJRA 2KG0A 3QPIA 4JI0F 3FK4A 3SQGB 1FDNA 2CWXA 4J91A 3DRSA 2BM1A 3OQ2A 3RJMB 2W24A 5HROA 3MUVP 2FHOB 4QCLA 1S1WB 4MKBA 3W9JA 2AYGA 1VS3A 5AJ3F 4LF4F 1U25A 4ED8A 1IN0A 1MU2B 2XHCA 2I9SA 3CCQS 1NKCA 1IWAA 1U1OA 3POTA 2G1HA 2CJQA 3R7NB 3VALA 3EDRB 2LEBA 1XEZA 5L38A 2K7JA 3S7RA 1XR7A 3BR9A 3S8SA 4JI5F 3H4DA 1D8YA 1X4BA 2E29A 2Z56B 3VAHA 1RTIB 3ENAA 1SL0A 2J5AA 3KK2A 2B6AA 2VUGA 2K06A 4Y65A 1SH0A 1M0SA 2PSZA 3FBBA 1S1XB 4I68A 2VPYB 4RBUA 5F8GA 3Q24A 4V1Ak 3MTKA 3UN2A 3PR5B 1SQEA 1RAJA 4I2PB 5J2MB 4JI0J 1XMOF 2DHHA 3BO2A 1YJUA 5KT6A 2XYPB 2UU9F 1FJGF 2RDIA 2V34A 2AT1B 1AB8A 4IYQA 4P6QA 3K17A 4PG6A 5FLXY 5KFAA 3HHLB 2VH7A 2XCAA 4EYIB 5D0HA 1QLNA 4UOCA 4K4XA 3HVWA 5KT4A 5C42A 3POTB 1Q8IA 4M5KA 1IBCB 2M70A 4RW6A 3UI3A 1RU2A 4A8YA 2MY7A 2XS5A 2VOPA 1HBNA 5KFYA 1RWKB 1J5EJ 3BPSP 1VGYA 4NCGA 2IA0A 1VQ4S 3RAXA 3PEHA 2DNYA 4CM2A 3UPFA 3PKMA 3NGUA 1RAOA 3UD3P 2IAJB 1FVQA 1G6BA 1PC5A 5ETVA 1FFGB 2WVCA 4LSLB 3TVYA 4PYAA 9RUBA 1CULB 3JYTA 4PAAA 5L1LA 4OZ1A 4YMEA 1ITPA 3PNIA 4EEYA 2DITA 5K14A 2JC1A 4U8VA 1TL1B 3ZZ0A 2XMWA 4DI6A 1OJ4A 3S1TA 4KGXB 3KLEA 4PWDB 2ZH2A 1VQOS 1WWHA 1X4HA 1PCAA 2EKYA 2IDLA 3SCIE 3DDIA 1FFWB 1IWGA 1RWNB 1SV5B 3MPDA 3PHTA 3V81A 4EZ9A 1TL5A 4AQYF 4G3IA 4A8QA 1JXVA 2HLTA 3FQKA 2C3PA 3DXSX 1NUEA 3ILJA 4OYWA 4FDFA 7AT1B 3HSDA 3IMQJ 1WOOA 4K59A 4USJC 5HMZA 1YITS 2CPYA 4I7FB 1GX5A 3AY0A 2HFVA 3SIPB 3D28A 2F63A 1B7FA 1JLGA 1HFEL 2OMLA 2VBZA 3M8WA 1VQLS 5GADI 3D0HE 4FF1A 1ZZNA 4F0KA 3VZIA 2W2QP 1HW8A 2XG8A 3J81Y 2Y1IA 4ZK7M 1S4EA 1LQ9A 5KFLA 2GMLA 3GIKA 2VBXA 1IBLJ 1EX8A 4DPWA 4X64J 1PJ6A 2RQ4A 4V19J 4K4TA 4G65A 2HRTA 2WONB 3KLFB 2D1CA 2QJ3A 2QLWA 2YNFB 3NOGA 2UUAF 4Q8FA 5H9FK 2UUBJ 2R42A 2Q1LA 4ZA1A 1HNWJ 2KH9A 3GG1A 2K1RA 3CIMA 1FNXH 3MECA 5IT0A 5HMYA 3G6VA 3R1HA 2DR9A 4DCOB 1KVKA 4MAKA 4IOAQ 1K8AT 3KOAA 4OI4A 2RU9A 2W7AA 1O8BA 2EK1A 4I2QA 1NU4A 2B51A 3FBCA 1YTYA 1HBMA 5H1SV 5LMUJ 3OR1A 1CS4A 3GIIA 2VQEF 4MH8A 3VAJA 3QO9A 1VJWA 1CPZA 1R8PA 1RTZA 4RW4A 5HQLA 4G6VB 2BE9B 4QWCA 1JJ4A 2GX8A 2IMOA 2CPXA 5EWEA 4DF8A 2NZCA 5DQHA 3R5CA 4TVAB 3TJ9A 2V8VA 4DV7F 3MM8B 3J7A1 5M2RA 3OV7A 1RA7A 3DM2A 4OYPA 1YRTA 3H59A 3SFUA 2ROPA 3VWSA 1VBXA 3DDKA 5HANA 4C6AA 2B4VA 3AD9C 2YKAA 3CD0A 1D9FA 4IR9A 2FVCA 1R27B 2HQCA 1K0VA 3ELHA 5E5NA 4ED1A 4C8NA 1R3NA 1TL3A 4RPFA 1RA6A 1LWEA 3BYRA 1VDHA 3SFGA 5A8WA 2O67A 3VVUA 2YKNB 2IVFB 2F4VJ 4OIXA 1DJ0A 1L3KA 1NAQA 1SXLA 3I0RA 5H9EJ 4MMOA 3IG1A 4ICLA 1KD1T 4FYDA 2GAGC 1MWZA 3PYGA 3ADAC 1NH7A 3P5TL 2M5YA 4W4MA 3CJ5A 1Q4RA 3Q8YA 3QWPA 4FPIA 4WZMA 3ILOA 2CJXB 2E1PA 5KT2A 1KBRA 1SC6A 4B9SA 3ZTOA 5L8RC 3IR5B 1MLAA 4P7VA 3CIZA 2M8HA 2F1FA 4AFFA 4AXIA 4RUCA 4B3RJ 2WAQD 2MLYA 3BS9A 4RWWA 4J9KA 2J6TA 3A13A 1DFDA 4F67A 1NJIT 4WFZA 4FPRA 4CLUA 1TTHB 2ZUAA 1RTDB 1TKXB 2MKYA 3OD2A 3PIPQ 2P2CB 1N4LA 3HLUA 3FEYB 5DDOC 4JI4J 2XMJA 4M5DA 3VV2B 2XLIA 2WB4A 1KOHA 1SL1A 1RHUB 2WW4A 2L41A 4QR1A 4NCAA 2OTJS 2KZMA 4LIWA 1SL2A 3V2UC 3A8IA 1JLEB 3NEKA 3M8RA 1S76D 2C3OA 2CZ9A 4A8SA 4CZCA 5HI7A 2DK2A 3QAUA 2ZH6A 4GKJF 2R7XA 2EG1A 4ECQA 4RO0A 3LAMA 1HQ2A 1S5ZA 1NK5A 1RJJA 4FKYA 1L3TA 3LF0A 4DN9A 3KKFA 5T7LB 1S97A 3T5HA 4DQPA 2N3LA 1RAAB 2IJNA 4F50A 1N36F 2RRNA 2HFNA 4B3MF 3TUPA 3WIUA 1SC4B 2C2ZB 1LWFB 1NSKL 2PN6A 5KFDA 1VC5A 4PPZA 1P27B 2ZJPQ 2FLPA 3M30B 5KFMA 4M5HA 4B9NA 2BV3A 2WZ1A 3BH7B 2ZD1A 3DOMB 1AFJA 3LOUA 1OSDA 2ACMA 3MZIA 3TRGA 3OTOJ 1S1VA 2DGWA 2PMWA 2Q6CA 2Y3YA 3NGSA 2C2KB 3K0JA 5JUMA 3GCWP 1AUSL 4RU2A 1U1NA 1HBUB 3HX9A 2BJ3A 2JDJA 2DKOB 2OEJA 2KT3A 2OHDA 3W63A 4CT8A 3V6KA 1IQZA 3MOZA 4X4RA 2QSFA 2AJ0A 3G6ES 3ZTSA 1LWFA 2RH3A 3BM7A 3LP0A 4WU2A 5A8RB 1UAWA 1Y3JA 2OLWA 4ZN1A 4FS1A 4IRCA 2R7UA 3ET6B 4OI1A 2BJDA 2CPJA 2BE2B 2HZCA 2X51A 4TY9A 4WYWA 2QA4G 1U1LA 3CC7S 1CEZA 3NS6A 2CYYA 4AXJA 3OLBA 3R5GA 2AKWB 2FHKA 2GHPA 3PJWA 3THPA 4K4YA 4JYAJ 1FXRA 2W2MP 2Z2YB 2UVRA 1KLMB 1SUQA 1WC4A 3UN5A 4CH0S 4WK1A 2QMUB 2RD5C 1C1BB 3Q2SC 3JSBA 2DR8A 1ULRA 4ZIVA 4HL9A 5D4NA 1WORA 1FE4A 2CZVC 2KRBA 3CJ4A 4YUDA 3M2UA 3JAMU 2HVZA 1KSPA 2ATCB 4OX7A 3QSYB 2HQFA 4P2SA 4H4MA 2RF2A 4GC6A 2AEFA 1QDUB 1D1UA 2MQ8A 2LYVA 2E5LF 1GMVA 1VRUB 3BH6B 3BREA 3DMJA 1X5SA 4RBTA 4BHQA 4DU8A 3Q0AA 3RR8A 1FEEA 3K57A 1JJHA 4K50A 2J7WA 3S6EA 2CADA 1HWUA 1EZZB 4ZVPB 4BWMA 4QWDA 4HLBA 1N48A 2OIHA 2DGUA 3M1VB 4C0HA 2J0SD 4TKTA 4OHXA 1AT1B 1ZAWA 1RP5A 3QFWA 3MXHP 2ZWPA 4GVBB 4N8OA 2YBVA 4X65J 1U1QA 3ENQA 4YR2A 1BQNA 1Y11A 3HSJA 4NA2A 4C8MA 4CNYA 3CMES 2G0CA 2WB1D 1B0PA 4F0HA 2W2OP 4ANCA 4CLLA 4ZVRB 1PJ5A 5DQGA 2VPZB 2OO4A 1XR5A 2UXDJ 4DPYA 1RYSA 2O01C 3ZTQA 3PFEA 1M1HA 1WSRA 4I6WA 4QJVA 4NEZA 2MKHA 2MMYA 1FRKA 4X62J 1ZM4A 4P72A 1B4SA 3DM2B 5CH7B 2DRDA 4O3NA 1RT2B 4L73A 5KG0A 4NPOA 2V94A 5DGAA 2HGNA 1U45A 2X3DA 1N5YB 3M32B 4QIEA 5A8KA 1KEKA 1VQPS 2X1AA 2AZ3A 2QLXA 2GQ2A 5HP1A 2IJRA 3MPUB 1EQ0A 5FLXU 4OZNA 2DXDA 3RTVA 4DQIA 1FCAA 2BM0A 3MCSA 4ZVEA 4DV6J 3PV8A 1ICEB 4OX9J 3T19A 4G1QA 4NLOA 5KFCA 1YJRA 2RDDA 2XZTB 4N7TA 4USHA 4DDFA 1CLFA 5GMDA 3T9NA 4C11A 2OD6A 3GFHA 2XHWA 4F26A 4ZHRB 3OVSA 1YQHA 2DR7A 1AW0A 3AA9A 5IM0B 4XDDA 1A0OB 2RS2A 1ACMB 1U7LA 4MYUA 2Q3PA 2HURA 2YQ3A 5HBMB 1HNZF 5SZTA 2MB0B 1YJTA 1L3UA 1DTTA 1U48A 3DLLQ 2ZHAA 2OUGA 3RRGA 1PO6A 2PO4A 3ZXWA 3EXCX 3J7Z5 4UUWA 1MG7A 1HW9A 1V6HA 3O44A 2HNYA 2CDRB 2AHOB 2QZ8A 4X84A 1BWEA 2WVFA 2UP1A 1T94A 2OPQA 3DDNA 2DY1A 2ZUGA 1S1TA 3HPOA 1FI4A 1Z2LA 2F65A 2DHAA 3HHEA 3M4XA 4LT6A 4LR9A 3A3NB 4PQAA 3P45B 4CO1A 2CQHA 4C97A 2OELA 4UZBA 1SJ3P 4E0DA 4QYZJ 1F3VA 1IKXB 1U47A 1RT6A 4DSLA 4GKJJ 4OLPA 3DRXA 2E5HA 3UE2A 1MN7A 1QUVA 3MMBB 2NPIA 2H5JB 1RT7B 4K5SA 1N5VA 2FIUA 1PYSB 4KFBB 4KKOA 5BYQA 4DUZJ 2XLJA 2EI5A 3FEZA 2D7SA 4KQZA 5KFOA 4Y2MA 2SXLA 4YHHF 1CJUA 1X9SA 1VQ8S 1KDNA 4NEYA 4IDKA 5KFUA 3OW2R 1AA1B 4U67Q 4WE1B 4ZP7A 1ZYQA 2H48B 4NLYA 2YTCA 4F36A 2FJDB 3GJSB 3C46A 3LP2A 2CNOB 3TA0A 3KWMA 2KFZA 3R3TA 4OJ1A 2CPDA 3D3CJ 1F9FA 3L7PA 1T3NA 5DG9A 2QIFA 4KHPJ 2LQ5A 4IFYB 4KBIA 1MMLA 3H0PA 3ZFVA 4ECTA 2CPIA 2Z8QA 1NKBA 5A76A 3H2VE 2HHVA 2V2KA 3BQ1A 4B3OA 4B9TA 3MCMA 4MKAA 3MR7A 3K5MA 1HBNB 3UDVA 3UO0A 4H4KA 3W5ZA 4DX8H 4HEA9 5J2QA 2AYMA 3MWBA 4RW6B 5LSOA 5D77A 2GJFA 3GTYX 3TEHB 5C7PA 5IC4B 1LKZA 2WVBA 3DI6A 2J9DE 3OTBA 5BYRA 4ZJOA 4CT9A 5FD1A 1B0TA 2D3UA 1N52B 2C2NA 4O0NA 1YI2S 2X1GA 2B43A 3OXGA 4Y00A 5J2MA 2GNKA 3NLCA 3IA0A 3F44A 1DLOA 4I2PA 2Z30B 2V8PA 2QYGA 3DRRB 2GQQA 4RWXA 2R7WA 1T05B 2DPJA 3GCXP 4DSKA 3P6YC 1WKJA 2DGXA 1JLAB 1SIWB 3T6BA 4LF1A 2AIRB 1RTHA 5HAOA 4A8XA 2YWWA 4G1IA 1ZTTA 1RTIA 5C5JA 2GMJA 2K2PA 2VC1A 3V4IB 3V6DA 3QJLA 3NMAA 2OP5A 2NPFA 3UDLA 2ASDA 1SJRA 2B4UA 4K8RA 1JB0C 1VHIA 1ZOTA 5LOQA 3JQKA 4OJGA 1K1QA 2VB6A 2HRYA 4RUHA 2HHHJ 1U6BA 2J9DA 2CVEA 3TAQA 4UTGA 3CT9A 2DRBA 2I0XA 1FX2A 4P10A 3PG9A 4FF3A 2VASA 1GMUA 3FBEA 3AA8A 3KK1B 3OL8A 3DGPB 2XWXA 2GCFA 1WEXA 5IWAF 1JXEA 3CD7A 3NY0A 5AXNA 3O3LA 4WF9Q 3BYPA 2EFQA 3GMGA 1IM6A 3H2LA 1HIYA 1JJCB 5D3GB 1JLQA 3BKFA 4N8NA 4ZP9A 3CD6S 2B7CB 1PYOB 1K47A 4D3GA 2DH8A 2ROGA 1KHWA 3NWGA 2NR0A 3A4TA 1CG2A 2UUWA 2BJ7A 5C24A 3O8WA 2Z4PA 4WKRA 4WZQA 1NDKA 5DQIA 4ECZA 2M8DB 1IXKA 2MZRA 5J2PB 1U6ZA 4UQTA 1RT5B 4IFVA 3H7HB 2RKIB 5JVGQ 4K4VA 2D3ZA 4GVBA 4K0KF 2DVIA 4O0IA 2LFVA 5CQGA 3N5BA 2AP6A 1UVKA 1BWVA 1VRTB 3IC1A 4LRBA 2DGQA 3GV7B 5I3UA 2ZNYA 3GYNA 3G8QA 4DZDA 3NNHA 1K0TA 2O5DA 3SBMA 5HROB 1NK4A 3MGJA 4DXLA 1HPZB 5IV3A 2A1BA 1SJQA 4NMXA 5KFXA 4C8ZA 1TKTB 3SCLE 1Q95G 3N79A 4WP3A 3PYEA 4WU3A 2HHQA 1PSDA 2R7OA 2CKWA 5HL7Q 5A6WA 2VOOA 1M5OC 1DZ5A 5DJBA 1E6VA 1N5SA 1UWBA 3C15A 1TZ0A 4ED4A 2RQCA 3DRPA 1NSPA 3C8YA 3FRYA 2GW8A 5IFMA 4TU7A 2VC0A 4N5SA 2FC9A 1OSCA 4EYHB 1SKRA 2KKHA 4PRFA 2O3DA 3FSXA 3B8HA 4OHVA 2ASYA 1C1BA 4DV1F 2RNEA 4OV1A 1RT3A 2XB2D 3HMJG 1KLMA 3GR0A 4DZ6A 5EHHA 4UQGA 4X2BA 4DV0J 2CWKA 4O3SA 2WBRA 3QFHA 3MEDA 4KR0B 2ZBRA 4RU9A 4AT1B 4DG1B 2HNZA 5LJ3Y 1U2RA 4NI2A 6AT1B 3TZXA 3EE3A 3R5BA 4DSEA 3ET6A 3BSCA 1VC6A 2UU9J 2DNKA 2DNOA 1HQUB 4PWWA 1FJGJ 4E8UA 2JEIA 3RBZA 4KE5A 2V8HA 5ETRA 1L3VA 2F7VA 3AQOA 4Y3CA 1WELA 3EPIA 5HVGA 2RQKA 3TYTA 3H5UA 3BSOA 3FCWA 2GIFA 1N8RT 5AE1A 4MT1A 4O4GB 5KG4A 3OSPA 4WFNQ 4USTA 3JTOA 4WIQA 1UETA 1UW9A 1UA0A 2JEGA 5CHCB 4P52A 1VQ9S 3I4HX 3G9CA 2KZZA 2NZ4A 3C16A 1X31C 4ZKAA 4KPYA 2KVQE 4DL5A 2UVVA 3LWLA 3N5FA 4KO0A 3SSRA 3K5LA 2XGQA 1TFWA 2CG4A 4ID5B 5KG2A 2ALZA 2ABYA 1WUUA 3GFZA 3OLAA 1GQEA 4B3TF 3FZ2A 4HYKA 1E6YA 1W2IA 3IS9A 3LA0A 5AJ3J 3OTEA 3OBIA 3VTIA 4PUOB 2W01A 3VF0B 4Y2AA 4QYRA 4DFPA 3BR8A 3U1NA 3WC0A 2BMBA 1T3OA 2ZITA 1UTAA 3I87A 2EPIA 3Q8UA 4YDDB 1MMNA 4J9MA 2EC0A 1NDLA 1D8ZA 4J9QA 4KHRA 3T5KA 1O6XA 3ZC4A 1WACA 4DFMA 5KFIA 1JLEA 1HNVA 2F3JA 1EKRA 5KFSA 3M6XA 2MEWA 5B0AA 3PR4A 2G4BA 1OY9A 2V69A 1HNXF 2HVDA 3OUYB 1VR6A 4DCJB 5IZHA 2JFKA 4C8KA 1MW7A 4FZVA 2FLLA 2YNHB 3W9IA 1YHQS 5BR8J 2HK2A 3OUYA 4G1PA 3G4SS 1NLKL 4HTIA 1ZZFA 3JXOA 4LSNA 4C0OC 3BN7A 2FUG9 5AXMA 2C28A 1HNVB 1ZA2B 2OEMA 4KB7A 2RS8A 5GAEI 4YEAA 4ECVA 3EICA 3QT5A 3R27A 4YDXA 2IBKA 2D9PA 3QLHA 2VBWA 3GB0A 4ID8A 2ZH3A 3I9V9 1LK7A 4UOHA 3T1AA 4OYZA 1SI9A 1Q1KA 2KVIA 2G2YA 1QD1A 4LF8F 3MMJA 2Q79A 3ZZPA 3QRQA 4EBCA 4ILMA 4IO1A 1RXOB 4HHHA 4NLRA 5L9NA 2AGOA 1EETA 4UUXA 3PFOA 4GMKA 1RTJA 3EM1A 3I9ZA 1NJYA 5LL6d 2FGCA 2NUUG 1O0PA 4CIOA 2IM1A 1IR2A 2GIQA 2OMOA 4CLWA 2YKOA 3KK3B 2BQ3A 4ZCLA 3QJJA 4X64F 4R5PA 5F8NA 3BZQA 1HNIA 1IM4A 3A8KA 3GZ7A 3MTJA 4MK7A 1OS5A 4XTTA 4ANEA 1UCNA 2J9CA 2YWHA 3I5CA 4O44A 3EYZA 2E44A 4C48A 2KM8B 3V6HA 4K4SA 2PA8D 4K7QA 3ZZOA 4QR2A 1M1KT 5KFVA 1CBKA 3MOJB 3HD1A 3Q22A 3MM8A 1YJ7A 4ECSA 4O4GA 1Q8BA 3VAMA 2C42A 4XO0A 1TKZB 2U2FA 2M0GB 3OTCA 4XPEA 1TL7A 3HT0A 4J9PA 4K4ZA 2ZWOA 2EFNA 4FVMA 3IO1A 2VZ9A 3CO0P 4LRDA 2DIVA 3DYAA 1NKEA 1QAIA 4NLXA 2DNNA 2VPWB 4CLYA 2N82B 3MEGB 3QZ8A 3MPWA 4B3MJ 1ZBTA 3NGDA 4CM0A 1GTEA 4DN0A 4R8UB 1NB2A 1VRQC 4CO2A 4CLPA 4NI2B 4OFZA 4Z2XA 2XY7A 1H7XA 2MKIA 1KRPA 5CCMA 3PIOQ 1YZ6A 3D68A 3TZZA 4F4XA 4WFBQ 3RRHA 3UW1A 4PG7A 4JV0A 1RQ0A 3GSDA 4WXOA 3T6JA 2I1RA 5AE2A 5KOXA 3NWRA 1LXNA
chains in the Genus database with same CATH topology
1XK8A 1KQKA 3L09A 4O4RA 1S6QA 2AF6A 4RW9A 3MR5A 1U1MA 2UV8G 1I6JA 1E6VB 3BGFA 4I69A 1HYSB 2AJQA 1FRHA 3HVTB 2FGOA 4PXBA 5AXLA 3T5LA 1K9MT 1AFIA 1C4CA 1HWJA 1WEZA 5FDLA 2BACA 2AGPA 3MUTP 2M88A 3MD3A 4RKUC 2LECA 4RNFA 1R8HA 1SJFA 3DOKB 1DARA 2COLA 4OJ3A 3M6WA 5KAKA 2E1MC 3NNAA 1M5PC 4ZPAA 2CJBA 2KRRA 1RT5A 3NRBA 2X1FA 2CPFA 3IFEA 2XGPA 2OJ3A 1SV5A 2YX7A 4LIRA 1XBWA 3EZ5A 2HW3A 2F9JA 3OFGA 3Q8QB 1VHFA 4HTJA 4MJKA 3CF5Q 4A48A 3PX0A 1QSSA 4QIWD 2PC6A 2YNGA 3DLEB 4ZPVR 3CCTA 1S9GB 2DJWA 3IBWA 4CCHA 5D3GA 3AJ1A 5IS2A 3TOQA 2JLGA 3CVKA 3H8YA 2XCPA 2HLUA 3PHEA 3N6NA 3SXLA 2KTQA 2IAJA 2V9KA 1FF2A 3I0SB 5F41A 3TP2A 5F9LA 3MEEB 2VG7B 4RNHA 3CULA 1IR0A 5DDPC 3EPGA 4OI0A 4BDPA 3NBPB 2DO4A 4OMFG 4NCGB 1TV6A 3UR0A 3JSYA 1S4FA 4NZ7A 2LEPA 3E8OA 5GAGU 4WCEQ 4YFUA 2W9BA 3CCWA 4MKYA 1FKOA 2VD3A 2IHR1 5E7OB 1LW2A 2JVOA 2JVRA 3G8SA 2YVSA 2BQUA 4Q8EA 1CQMA 2KO1A 1FD2A 4J9LA 5DM6Q 2ZBCA 4OX8A 2DCUB 5KT7A 1SKWA 2R2RA 3MEGA 1Y7PA 5J1EB 4RUAA 1HI1A 4NLTA 2AJ4A 4LVOP 1Z4UA 3EX7B 3W2VA 5M2PA 3MMAA 1UEUA 2B6AB 1DLOB 3FSIA 4ZP8A 3OFFA 3LO3A 3K8VA 1GXUA 1V9OA 4OHWA 2D74B 5HN0A 2QV6A 4UW2A 2ADCA 5EWFA 1KQFB 3U1MA 3Q23A 1S49A 4KTQA 4DR5F 1JJ2R 5FIIA 1NZAA 2E1RA 3HM9A 1Y5NB 3TARA 3J7YU 4LFAF 4JBCA 3KMQA 3D54A 4W92B 4GKKF 1RDRA 2DHXA 2CIMA 4B3OB 2AJFE 4RW7B 4ELUA 3I6PA 1REVA 4HHJA 4B17A 5HROB 3Q8PB 1R8BA 1X4DA 5DO2A 3PX6A 4LF6F 3ITHB 1SIZA 1N6QA 3SQGA 3JSRA 3JB9k 1YJ9S 2PI5A 3BQ2A 1F0XA 2VFUA 3I55S 4HH1A 4RW8B 1U1PA 2JEJA 2IM2A 3CGIA 2Y1JA 2BR0A 1CSJA 3E51A 3HT3A 1P9QC 1S9FA 2MJUA 4RW8A 1ZPVA 2QMWA 4DF4A 2ERRA 1N5TA 4DSIA 1Z1ZA 3M2VB 4RNOA 1N0VC 3TUIC 3W2WB 3G71S 5F8MA 1OO0B 2MKSA 3F41A 1C0UB 5K8MA 2EFGA 3KG0A 5CXTA 4KFBA 2AJ1A 4KKOB 2YNHA 2G13A 4F4YA 3SZ2A 4QU6A 1U8SA 5CZVA 2J6UA 4NXNF 1DBDA 1H7WA 3CDAA 4IG3B 3MR3A 3BDPA 5T14A 4ED3A 1JIHA 4JV5F 2BZ2A 3CDWA 2DH7A 2X1BA 2HHHF 1VBYA 4Y34A 4EU0A 3M9OB 1HI8A 5CD4H 2RIJA 2RE1A 1DTQA 3N9UC 3O6QA 4DUZF 2MGZA 4BCAA 4F3QA 1R0AA 5DGBA 4LVNP 5DM7Q 1HMVA 1D9DA 5FJ4A 3KLGB 2KM8C 3I4PA 3RR7A 2YNIB 2MY8A 1URNA 1V3SA 2FHJD 4URQU 4JI4F 1KVJA 1OWXA 2YWEA 3VAFA 2VFRA 1TQLA 4KO0B 3RW7A 1B64A 1JXLA 4NOHA 1N32F 3RBEA 1NK9A 1GNKA 2JLFA 4FVCA 3KLHA 1LW2B 3LQVA 1WHYA 4IRKA 3B82A 3CJ0A 3KYLA 1VQNS 3TNVA 3ULHA 3CE8A 2QA1A 1X5OA 2JZ5A 5KFEA 3BGRA 3MFHA 3GIMA 2E1CA 2HMIB 2BRKA 5L9XA 2N7CA 2VKZG 4ED0A 3MEEA 1M90T 2F8MA 4RNMA 4A8MP 1YGYA 2E1AA 2KHCA 2Q43A 1ZTWA 2IJFA 4GO5X 2FLOA 3WC2A 4TN2A 1EP4B 4U6PA 1VIXA 1JLFA 3KHGA 2YNGB 2KG1A 3CCLS 1D9AA 2QYCA 3FFIA 1UJ4A 3HZGA 3QYYA 1YJWS 2R2UA 3PO5A 2LXUA 2OAUA 2XSJA 4CTAB 4EFAC 2N4DA 3MURP 3MFIA 1RT3B 4C7QA 5J1NA 5B0BA 4TLRA 1FXDA 4H4OA 2YH0A 4IRDA 3BEGB 3K5PA 2R8KA 4KHPF 3ZZZA 3MR2A 4K4WA 4BBYA 2QA2A 5EUHA 2LMIA 1X9WA 1IKYB 1RK8A 3M8PA 2IYGA 4MFBB 1S0NA 5HQ8A 4C98A 1TKTA 3FDSA 2B9WA 2LKZA 2DO0A 5CYQB 4HKQA 4WFXA 5HMXA 3DMJB 4RNNA 3EXYA 4DLGA 2HNDA 2JHEA 2L9WA 3CMAS 3D1QA 1R8AA 4KV8B 3RZAA 1HYSA 1OPZA 3FRZA 3ZZUA 3CCJS 3W3SA 2DNHA 2GGPB 5E2QA 1Q81T 2CJAA 1H0HB 4Q2LA 4L72B 3KTQA 3V6JA 3M2RB 2D41A 4XAKA 3B4DA 4H4OB 2EBGA 4ZPWR 4K2XA 4CNZA 1S79A 4TY8A 4P7TA 2XSJB 4KGKA 1PC4A 2ILZA 1AROP 4BWJA 4QBUA 2KFNA 1S48A 2XNRA 3HO1A 1GXTA 2QRRA 2BE2A 2JJ4D 2ZH8A 2PMZD 4R8UA 2GQCA 4O3OA 2OD4A 3LALA 2ZZMA 1NO8A 1ZETA 1NB7A 4LF9F 3HKWA 4C8LA 4ETZA 3MMCA 1IBLF 1W25A 2O66A 1KFDA 2JC0A 1WHWA 2CQGA 3PX4A 4NL5A 2ZDOA 2LU2A 4ZHRA 2YWKA 1HNIB 3VQTA 3DLKB 2PI4A 2ZD1B 3GILA 1X4GA 5LSLA 2MZ1A 3PV8A 1JK9B 1A6LA 3ZZTA 1RTHB 3VR1A 2IC3B 1NJZA 4DMZA 2HS4A 2V8GA 1T05A 1R8CA 1JKHB 2DHGA 3M6UA 4ALZA 2IYIA 2F8HA 3HI9A 1VQYA 1XTZA 4IUFA 2C3UA 1KONA 2YY3A 5D8HB 1TR0A 2MHEA 4X4VA 3QGHA 3TA1A 3BO4A 4ED5A 4MIWA 4DUYF 4NLSA 4OI3A 2N3OA 5B08A 2HVIA 5I4MA 1C0UA 4TQSA 3I32A 1WG4A 2NXUA 5KFWA 4Y2KA 3M2VA 2EG2A 2O1PA 3MPVA 5T41A 3DLHA 1FDDA 2WOMB 1H6KX 1NK8A 4DJBA 2VODA 4ED6A 5KT5A 1FRLA 3LP2B 2EFPA 4NLPA 3TI0A 4Q44A 5I42A 5IT9Y 3J7ZT 2W4DA 3E3XA 4LQ3A 1JKHA 5L1JA 3C6TB 1RWUA 5D6GA 5A2QY 2CQ4A 5LL6d 2A2DA 3TX8A 3ITHA 2MSSA 1CQNA 2VV5A 3IG1B 3SV3A 4B3TF 1B0VA 1NHVA 1D3WA 2DNQA 5EX0A 4RW7A 4IQMA 4IG0B 2YKNA 1TP7A 3G6YA 2RMLA 3VAIA 2MZSA 4FNIA 3OFHA 3ZZRA 2CJ9A 5KG7A 1RT1A 1IKXA 4B9MA 4AYBD 4ZCMA 1TVRA 4M95A 6FD1A 1IBKF 3RAQA 1D0EA 2W7PA 3PVXA 2IFXA 2E9ZA 1HHTP 3TUZC 2QSWA 5F8LA 4DV0F 2EK6A 2AD9A 1UW4A 2HNYB 4OZLA 5JXSA 4USIA 2BXJA 3D0GE 4X4UA 2KFYA 1S6OA 2PIIA 3W2VB 2CQPA 1OQ6A 3PJXA 3SI8A 3OPKA 3DCAA 1FVSA 3NCRA 2XMUA 3BO3A 1C1CB 3QO9B 2B9YA 1HQUA 3D1OA 3N6MA 5C25B 3NCQA 2D9OA 3TUJC 3VAGA 1O5JA 3TA2A 1P1TA 2WHOA 3K2YA 5A0YA 5GAGI 4IH6A 4MTPA 3T9ZA 3BJYA 1QJHA 2XWYA 4HT7A 2BUNA 3UD4P 2XNQA 1FKOB 4WJBA 4Z37A 2NSBA 2YNFA 1U1KA 3M9MB 2ZH5A 2VL1A 3IN5A 1T7PA 4PQUB 1QSYA 3UDCA 1N56A 1K1SA 1TKDA 2Q6BA <