3UDEA

Crystal structure of e. coli hppk in complex with bisubstrate analogue inhibitor j1b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
154
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate analogue inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase: New design with improved properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 46
structure length 154
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3udeA00
5ETPA 3KUHA 1TMJA 1IM6A 3HD2A 3UD5A 1EQ0A 1EX8A 1Q0NA 1RU1A 2F63A 1TMMA 2CG8A 1DY3A 2QX0A 3KUGA 1HKAA 3MCMA 4M5HA 2BMBA 1F9HA 3UDEA 5ETVA 1EQMA 3HSJA 3HSGA 3HCXA 5ETRA 3HSZA 1RB0A 1HQ2A 4CRJA 4M5NA 4M5MA 5ETNA 1KBRA 1RTZA 3HSDA 3KUEA 5ETLA 1RU2A 5ETSA 5ETKA 4M5IA 4F7VA 3ILJA 1RAOA 4M5KA 3IP0A 4PZVA 3HT0A 4AD6A 1G4CA 4M5JA 4M5LA 3MCNA 5ETOA 4M5GA 5ETQA 3QBCA 3MCOA 3UDVA 3HD1A 4CYUA 5ETTA 5ETMA 2F65A 3ILLA 4CYUB 3ILIA 3ILOA 4CWBA 1CBKA
chains in the Genus database with same CATH superfamily
4P74A 5HQLA 2CPDA 3KLVA 3QRQA 2F1FA 1SJRA 1UTAA 2EI5A 3AOBA 1RWXB 2XMWA 3CJQA 5J2MB 1EZZB 1EIYB 4PUOA 2GVZA 3R6LB 5D0RA 4JI3F 1U26A 3AXMA 1REGX 1DZ5A 4NA1A 5E3AA 4HTIA 4NE9C 5H9EJ 1UA1A 2FJAB 3IG1B 2Y0SD 3W5XA 2AEFA 1K44A 3MM5B 1IBMJ 4ED5A 1D8ZA 1W25A 4NZ6A 2W7PA 1UCNA 2COLA 3TA0A 4KJIA 1DBDA 4DFMA 1ZS6A 2CQCA 1GMWA 2FGOA 2ZNYA 1VRQC 1FX2A 3O6QA 4LBPA 5K9FA 5DLGA 1U48A 1RCXB 2EFVA 2BRLA 1IR0A 1FXDA 2DEJA 2HBYB 2KJVA 2OPSB 4HH1A 4C0OC 3GIRA 1P9QC 1A6LA 3PG9A 1EP4B 3M2UB 1MROB 4RX6A 2GHWA 3CNQP 2WZ1A 1YJNS 1RTDA 3PXGa 1WHWA 3CCMS 1DQ8A 3GQCA 4HYKA 4W92B 2ZD1A 3M8PB 2DJWA 1JWWA 4H4MA 2CVEA 3HSJA 2PSZA 3FEYB 1SXLA 2EFQA 3VGVA 5K8OA 2LXFA 2VFRA 2AEMA 4ALZA 3UWTA 2LDYA 5A8KB 1P27B 4DR3F 3UCZP 1WG5A 4KPYA 1PGZA 1YJWS 1DQAA 1FDBA 2DT9A 2X1AA 2YKNA 4UOFA 4IQXA 4LVNP 3HKWA 2EK1A 2EVZA 2QLBB 3M2RB 3HHNB 1OQ6A 1TK5A 2DGWA 1Q82T 3G2XA 4NWBA 1IBCB 3CDWA 4CNYA 1TK8A 1B0VA 4ZVPB 2XLKA 2PFFB 2YY3A 3MTJA 4KKOA 3ZTOA 1TL7A 1OMSA 1UZDA 1KONA 3GCXP 1PC5A 5IT4A 2E5LJ 2F63A 3AJ1A 2JFKA 2QTWA 2HIYA 4WPAA 3RAMA 2K7JA 3CPWR 1UA0A 2J8SA 1UEKA 2QMWA 1LNQA 3I0RB 1S9EB 4LUBA 4RW7A 4ZKAA 2FLNA 4CO4A 1NZ8A 3O5TB 4B9SA 2M9KA 4DSJA 1RSCA 3SCKE 1WHXA 1YKWA 4QU6A 1WC0A 4ZA1A 5LSLA 2K3KA 2GS8A 1BD6A 2AYEA 4F67A 4KQZA 2BQ3A 2WBMA 4P52A 3EYZA 4LQ3A 2YNGB 2VONA 3MAHA 3TZZA 3CCES 1QAXA 2H54B 1RKIA 1H2VZ 3IRWP 2VOOA 3R5CA 4AE5A 3MPYA 4EBEA 4FF4A 1SKWA 2KRRA 5IT9U 4IH7A 3H2UB 4KFBB 3KNAA 4IKAA 1SJFA 1KLMA 3BJYA 5KFGA 5L39A 4Z7CA 3F44A 1R6VA 3DDNA 3TJ8A 3V5RA 3HP6A 1ZYQA 4M8LA 2IJFA 2DEIA 3A8EA 1NSQA 2J9CA 3SYZA 2C3UA 3MEEA 1TFYA 4B02A 4M63A 1V3SA 4FXVA 1JNRB 2DNMA 3SSRA 2FB0A 1LW2A 3C6UA 4WK3A 2QO3A 3AA9A 3I31A 3GB0A 2W8KA 4HL9A 1CEZA 3JSRA 1XIQA 2OPPB 3CSKA 2J6SA 4O44A 3CMES 1T8EA 4QQBA 1OWXA 1BQXA 3AB2B 1SL2A 1TKZA 2CQPA 1GNKA 2F9JA 3A1YG 4CH0S 2I38A 3EGZA 1RBOB 5D4OA 4F3MA 4ZCIA 3JYTB 2W8LA 3VVUA 1NUEA 1BQMA 1Q53A 1RDRA 5HVFA 3TZWA 2VG6A 4OJGA 3F73A 2D3OR 5C7PA 2V2QA 3DNCA 2AGQA 4QWCA 3ITHA 2VDIA 1WELA 4K4XA 4TKTA 4WIIA 4CLPA 1DARA 1HNVA 1EQ0A 4P2MA 2MGZA 2RDIA 4L76A 4RNMA 5F8IA 4EYHB 1H72C 4L3NA 1FFWB 1Y7PA 2ZH5A 3BKUA 1X5TA 4TVAB 4F0HA 4FYDA 2QFJA 3W2VB 3MUMP 1NJYA 3TAPA 1H2TZ 3T19A 5ETNA 4R5PA 4ED4A 1QAIA 2P6SA 2WB1D 1R3NA 2C3YA 1UAWA 4NI2B 2LQ9A 3M2RA 4OJ3A 2JWNA 3THPA 4DR7J 4LFBJ 4M5DB 3UDLA 2G2OA 1RT4A 3GZ7A 3CJKA 2KL8A 1S1WB 2W9BB 4XIUA 3DOKA 3GYGA 5F8NA 4F4YA 2DNNA 2HVDA 4K5RA 2ZBIA 4PQAA 3G96A 1HNXF 4DZDA 4F8RA 2IFXA 2LEPA 4HDGA 4WBFA 4U67Q 2X3DA 3A12A 4AT1B 1JLBA 4FYWB 3N79A 2K3IA 1NK7A 2BYCA 4Y2MA 2QSFA 4BDPA 3L95X 2ZZTA 4Y2IA 3R97A 8ATCB 1X0PA 4YEAA 3PEHA 2M8DB 4ED7A 3C16A 1HNWJ 1CQMA 2E5HA 1HNZF 2W4PA 3M2UA 2AJFE 2DXDA 2MSTA 3DXBA 2YNFB 4DR2F 2OPPA 1I5OB 3OTEA 4C11A 2A2DA 1VBYA 2RQ4A 3DRRB 1JXVA 3N01A 1FO1A 4WE1B 4OI1A 5KG0A 1H3DA 2DD8S 3TX8A 3FBCA 2B5JB 3NKYA 5CABA 1SJQA 1SC6A 3WX4A 3DLLQ 2F5GA 1NSPA 4ZVEA 4CP5A 3PACA 4HVZA 5KFEA 2GIFA 4PQUB 3QWUA 4OI2A 2R7SA 4KGXB 4WXOA 1SV5B 3K5OA 1FHTA 5KFRA 3DCAA 5D4NA 2B3TB 4ZJLA 2DGUA 4RJVA 1WTFA 2HS0A 3IBWA 3QSIA 1UVJA 4OI3A 4DCJB 2HHXA 4OHXA 2HFZA 1S6PA 3P96A 4K0KJ 2GMHA 2UXBF 1T9XA 1D9AA 1RAJA 4WK1A 3TWZA 2FGCA 3FMWA 2DGSA 3MMJA 1KOHA 4F36A 2UXBJ 2B56A 1ACMB 2IC3A 2Z2YB 2UXCF 4Y2CA 1XMQJ 4GC7A 3BGUA 4DR3J 2AGOA 1S9EA 1S1TA 4OX8A 1U6BA 3EVWA 2V2ZA 3D6FB 2HHWA 1S1UA 3IGVA 2VG7B 4OZJA 2N3OA 3QRPA 3TQEA 4CT9A 2K2PA 3N9UC 4NLGA 2DO4A 2J7WA 4OYWA 1I1GA 4WP3A 4PWDA 4IRCA 4X4NA 1X4CA 4GO7X 3I9V9 5H9FJ 2GVDA 3C16B 2F8HA 2DCLA 4KV8A 1D9DA 2LEAA 1UW4A 3ISZA 3O8WA 1QAYA 4B9TA 1TZ0A 5AXNA 1IJEB 1VK3A 2G13A 4IRDA 1VISA 1FDAA 4V19X 3CO0P 2WVEA 3HSZA 2HURA 3ETOA 3VAHA 2V9KA 5FLXU 4TNOA 3QT7A 4WFZA 4JP8A 2GJIA 4GKJJ 2HFUA 3D0HE 3Q2TC 1YX2A 1XNQF 2VFUA 1FESA 3D1HA 4I2PB 4NA3A 5A6PA 5E7OB 3W62A 2CDQA 4PG6A 4UUWA 3MFHA 4CO2A 3RGIA 2Y8YA 3EZOA 4OV6A 2HLTA 1UEUA 1HI8A 2ZH8A 4CLSA 2PGCA 4IFVB 4LRDA 2YWEA 2NCKL 4JI1F 4K7QA 3KG1A 4DLEA 2KB2A 4KPCA 3JQMA 3PY8A 2XMVA 1JLCB 2AMCB 2MZQA 4FF3A 2EKYA 3T1HJ 1J5EJ 4WFNQ 3P49B 2GGPA 3OBIA 2HHHF 2OTJS 3EZ5A 3HVWA 2HGNA 4NPOA 2NS1B 3OXLA 5DGAA 3MPDA 1VQLS 4QR2A 5DM7Q 4TYAA 2VG5B 3E3XA 2MYFA 4ELVA 2KFZA 2KT5A 1NHUA 1RHJB 2Q66A 2Z0GA 2BE2B 1YZ6A 2FZCB 4NZ0A 5IQ6A 2XZWA 1S79A 2BJEA 5F9NA 5DG9A 4GO5X 2DNLA 3ZC4A 3ILJA 2ROPA 2D3O1 2HRUA 1XMBA 1Q8IA 2ZM6F 4YOEA 4PG7A 1AW0A 4LRFA 3KOAA 1H73A 4DUZJ 2E1CA 3MCNA 1GX6A 1RT6B 3W5ZA 3BQ0A 4KGKA 2H5JB 2GVZB 2XB2D 1KN6A 3ENQA 2M3DA 1VC6A 5F3TA 4LF1A 2AGPA 3IA0A 1C1BA 3W64A 1YK9A 3PTWA 3MMCA 1K8AT 3ZZTA 1XMOJ 1DFDA 2BJ1A 2OSQA 1R0AA 1VCTA 3H2LA 2XCPA 5KG2A 4JI6F 5U47A 4NLUA 1P6TA 1U1NA 1HYSA 1U0HA 3BO4A 1GXUA 3MEEB 3BEGB 3Q22A 5F8HA 4LF8J 2HNYB 2RQKA 3D2WA 1KTVA 2MMYA 3BGRB 2RT3A 1FFSB 1RACB 2N4DA 2QYCA 3C15A 4ECVA 4WZMA 2BBEA 3PHTA 2CPJA 5I42A 2X51A 1XR5A 2HNYA 2W2PP 2DRDA 4KFBA 4ED0A 4I6WA 4R8UA 2OD4A 2BJ3A 5CA5A 1U0HB 1ZM9A 1YDLA 2MKJA 4CLUA 3G6ES 1RT3B 2DYAA 2C2MB 3NS6A 1B64A 5EUHA 4FVCA 3TVZA 1X5SA 4O3OA 5KFQA 4ELTA 1FVSA 3W9HA 4YDDB 3AJDA 4B3RJ 4CYUB 2GQ2A 2XI3A 2YWKA 3GWCA 3GV8B 3R1LA 1R8PA 1F5BA 2HMIA 3KLIA 1UVKA 2JC1A 3Q8QB 1T9YA 2IAJA 1NEEA 3ZTSA 2R42A 4Z2XA 1HBMB 4MTPA 1Z4UA 3G8QA 3RB6A 5DDPC 5ETVA 1M5PC 3H5SA 1IKXA 3CIZA 2LA6A 4EYIB 2AP6A 1F3VA 1VQPS 1FNMA 4A8QA 1ZM4A 1ULRA 3ISNC 4UZCA 1MNEA 3OVSA 5C2GA 4A8FA 2MZSA 4ZPTR 1C0UB 4ID5B 1QUPA 4A48A 5C5JA 4KT0C 4Y00A 3OTOF 4DV6F 4LF5J 2C2NA 4Y65A 2MGZB 4X4SA 3QJPA 5F9LA 4QWBA 3ILLA 5T7LB 4LF6J 1OY9A 2VV5A 3W8PA 4G1QA 4LSLA 4RW8B 5IWAJ 3FZ2A 3UD5A 3QNWB 2C3PA 4ED1A 6FDRA 3M9NB 3CCQS 2EWHA 3ADAC 1RQ0A 1DY3A 3OXFA 1TAUA 2XCAA 3ZTRA 2E7WA 1S9GA 4IG0A 4OYOA 4BCAA 2VF3A 4ES1A 5DQIA 5GADU 2XSJB 4RPFA 4DOZA 1VGYA 1VQYA 3PHEA 3N6NA 3HHLC 3MTKA 4X4QA 2IJRA 4LSZB 2Q43A 2YTCA 3JQJA 2NUUG 3OTDA 1RAGB 2MY7A 1YSJA 3DLEB 4WFXA 2E9ZA 2D41A 3OFHA 1UETA 2HK2A 2JNJA 1MG7A 3I96A 4C0BA 5A6WA 4OYMA 3K57A 3CIMA 4DSFA 3HX9A 2DR5A 3BQ1A 2IA0A 2UUBJ 1S1TB 2F8EX 2GFFA 1Q1KA 4KAIA 2V50A 3LQVA 3W2WA 4DCOB 1G3OA 3D54A 2XHWA 3FDSA 6AT1B 1X4FA 2BMBA 4BWJA 1HMVB 2KM8B 5J2QB 2MKHA 5J2MA 4ED2A 1Y00A 5ETRA 4ZPBA 1Q4RA 3Q8UA 1DTQA 4CQ1A 4PUOB 2B4VA 5CH7B 5J1PA 3D3BJ 2WSFC 4O3RA 1XR6A 2BEFA 3BDPA 1YVFA 3MECB 1FTCA 4YR3A 5F0UA 1TUGB 3NG8A 5I3UB 3T41A 4J90A 1OSCA 1KR4A 5GVQA 5C24B 1Q95G 1UWBA 4M5JA 3PW4A 1TL3A 1KQSR 2OPRA 5D78A 1VMBA 1PO6A 3UDVA 2KDOA 2NSBA 1Q8LA 1NH7A 3R7SB 1D8YA 3FC9A 4LF5F 2P5VA 4PPDA 2IVFB 5D3GB 1TL1B 3AXKA 3M8QA 4YB1P 1S0NA 1VK8A 4K4VA 3IR7B 2ZJQQ 4KO0B 4TY9A 4YS2A 3JB9k 3EVMA 3MEGB 3SQGB 1PAEX 2YWWA 3IR5B 4ZPVR 2OGUA 1I6JA 4GKKJ 1JJ4A 4LR7A 1FRJA 3CCVS 1LV5A 4BBYA 2M7SA 3C6TB 1T11A 1X4DA 4P75A 5GMDA 4IOCQ 4IUFA 3DGPA 5E3QA 3QO9A 4BHQA 4Z7YA 1WF2A 4YY3F 4LF7F 4KRWA 3UR0A 2CZVC 2BUNA 2JZ5A 1M5OC 2IYIA 2CPFA 3FUYA 2EFOA 3M8YA 2E66A 2HQDA 1HR0F 2DIVA 2UUWA 2XY6A 2Q6CA 2Z30B 3DU5A 4USUA 1LEOA 1KVIA 2J0WA 3VGSA 4DPXA 3HVTB 1OY6A 1ZAWA 4IDKA 5K8NA 1BXNA 1U02A 3CJ0A 1AXQA 2OPQB 1S49A 4K4TA 4KGVB 2BX6A 1RADB 1UVMA 4DPYA 2Z2LA 2DNQA 3B8HA 3C66A 3MMBB 4FNIA 3M8RA 1RAEB 1RA7A 1NKCA 1KS2A 3OFEA 4LIWA 3VHQA 3KLHB 1N5SA 1IBLJ 5KFBA 1CJKA 2AZ3A 3GONA 4DHVA 1CS4A 2E5JA 2GJ2A 2IRUA 2DGVA 3POTA 3PVXA 3IG1A 3ET6A 3SXLA 3RBDA 1AZSB 1HWJA 3EZUA 4DI6A 4KBIA 3RR7A 1MMLA 1M5HA 3VALA 3TJAA 1CJUA 3IRXA 3P8BB 3K5PA 3K59A 1RISA 2MQNA 2CPYA 1WG4A 2VG6B 1N54B 3RU0A 4DR5J 2E1PA 3CEDA 5F8MA 2AW0A 2D3ZA 3DXSX 2DH9A 1UJ4A 2ACYA 2CADA 4ZVRB 1KRPA 1UVLA 4UY85 3L7UA 5EWGA 3TZXA 3EGWB 2O3DA 4O44B 4U7UK 1O0PA 3VF0B 1LXJA 2BM1A 1N34J 2CJYB 2FVCA 3L7PA 4N7TA 2Y1RI 3DC2A 5T41A 1VOMA 1WC4A 1YGYA 4B08A 3LP1B 2R7WA 3G4SS 2KT2A 3V81A 1IKYB 1T02A 1VR6A 3DHWC 1RCOB 4ICLB 1CC7A 3LPYA 3TI0A 2W7OA 3HFVA 3FFIB 3Q86A 1UJ6A 2HFOA 2VDHA 3IS9B 3QAUA 1X8DA 2VB6A 2MLZA 5HL7Q 1B0PA 2K1RA 3T1HF 2QLXA 4NMXA 7FDRA 2ADCA 3GIMA 2HW3A 3PO5A 4OQJA 4LRBA 4EI2A 3G6XA 2ASLA 1KLMB 1KD1T 3PR5B 1A9NB 2V5HG 2AZ1A 4JB8B 1TKDA 4YP3A 2AYBA 3KLGA 1QM9A 2V4JA 4ZPCA 2RS2A 3K2YA 1KC8T 2HZVA 2VA2A 4P10A 2YKQA 2XULA 3EDRB 4OIXA 4A8WA 1BMQB 2BANA 1NLKL 2IJNA 3V6HA 1BC6A 4PAAA 1N5QA 3DLBA 2NZ4A 4TY8A 4PPZA 3U1MA 3AAWB 2C2EA 5ETSA 3ZTPA 3HZEA 2I1RA 1X60A 3NGRA 3SCIE 3DLHA 2BRKA 4LIRA 4X66J 1Q81T 4ED3A 3QSYB 3BO3A 2YX4A 5IV4A 4M5LA 1PIEA 4DPTA 3EVOA 5BJRA 4UT4A 3RRKA 3DYAB 1DLOA 4HHJA 4LBHA 5T14A 2DPIA 3AT1B 1SUQB 3KUHA 3LP0B 3BS9A 1RT7B 3D4JA 1JJHA 2CPXA 5BR8F 3QJLA 2KTQA 4B3TF 1HKAA 1JLAA 2XSJA 3CD6S 3TVYA 4RBVA 1NK0A 3RW6A 1VRUA 3CDAA 3GV7B 2KZMA 1S9GB 3CCZA 2RF2A 3HDSA 4IG0B 4OYZA 3OTCA 4YB7A 4JI1J 1JQGA 2O01C 4C7QA 3OLAA 4K4UA 1RHUB 4YB6A 2ZD1B 1LWFB 3CB4A 2YWHA 3R5GA 3DRPB 4DU8A 5GAEU 3KK1B 1Q86T 4JV2A 4PG5A 2MB0B 3LH2S 2GA7A 4QIGA 4NL5A 1RTJB 5D4PA 1UP1A 4CCHA 3JSMA 2MPUA 4MFBA 2YPYA 2VQFF 5L1JA 4WZQA 2XWXA 2QT7A 1BLUA 2B6AA 4M1KA 4CTAA 2ASYA 4N41A 5D8HB 4Y34A 1EETA 5HANA 5M2UA 2IPOB 3P5BP 3D0GE 3AH6A 3K8WA 3MD3A 2LQJA 2R2SA 3HJVA 1N4LA 2JX2A 1M1HA 2W4CA 5HJXA 5DQGA 3MMAB 2PEHA 3PFOA 1XR7A 3OHAA 4IQMA 2M4MA 2XGQA 5KFOA 4EWTA 4EU0A 2G0IA 4J91A 1ZM3A 1MMDA 2MY8A 2Z56B 1VQ4S 1HARA 2B9XA 1Q79A 1S6PB 2QGFB 3JS9A 1RYRA 3KHRA 3BR8A 3Q8VA 4Q44A 1HBNA 2CAJA 3IBFB 5ETOA 2A1BA 5IC6B 4OHWA 3IC1A 1MU2A 3ZXWA 4NRUA 3LANA 2RUGA 2D7SA 2ZC3A 3W3SA 3MR6A 4DV5F 1RHKB 2D9OA 2L48A 1T3OA 1H7WA 1TKXB 2M5YA 3R5BA 1YBTA 1NKBA 2EEYA 1F60B 4ZVHA 2PDAA 1SC4B 4TLRA 2IY5B 2G0JA 4ICLA 2HHSA 4YHHF 3T6BA 3SFGA 3PW0A 3MOZA 1S97A 3AFGA 1TELA 3M4XA 1FRKA 3CUNA 1WKKA 1TV6A 1EQMA 5C42A 3U1NA 5DG8A 2EKNA 3HXMA 2UVRA 2OD6A 3HF5A 3TZYA 3LTOA 2BR0A 2ZE2B 2A2CA 4RW4B 1HFEL 2HNDB 5AXLA 2GO9A 2ILYA 5AJ3J 3QZ8A 1FDNA 5CQGA 1U47A 3R5AA 4UOGA 1WOSA 1RT5B 4DFKA 1BWEA 3MM8A 4A8YA 1S48A 1N6QA 1R27B 3GJTB 2XSFA 4C48A 3M8SA 3EX7B 5IT0A 3MGJA 3IN5A 5IS2A 3BBFA 3DRSB 1JLBB 1IJFB 2P9CA 2FHJA 1FD8A 3AY0A 3C8YA 3GYXB 4ED8A 1NJZA 1N56A 1YI2S 2HEKA 1S9FA 2CJQA 3AA8A 3KHHA 3CJ5A 3M6UA 3NOCA 4DS4A 2UVWA 2VFVA 4RNHA 4B3TJ 1TMJA 3D1QA 1T7PA 4E2FB 2PFDA 1KDNA 2K06A 3SCLE 2IVYA 1HW9A 1VJWA 2BE2A 4NCGB 4N56A 4FPRA 2A0FB 1YJTA 5KFYA 1ZETA 1Y0HA 2IRXA 2DR7A 4KB7A 3MMBA 1PBAA 2PO4A 4R25A 2KHDA 3F56A 2ZKUA 3HFZB 4H4OA 2EG1A 5D0HA 5DZ7A 4AXIA 2XQCA 1C1CA 4LF9F 2Q6BA 4OZ5A 5IV3A 3JSMB 3BSAA 1VQ5S 2HFNA 2HHHJ 2GO8A 3TW0A 2YKMB 3MUTP 3TO8A 2P9GA 3D6MB 4B9LA 4MKVA 3PKMA 3W8GA 3W66A 2JEFA 3K5NA 4B9MA 2IIHA 4GKKF 5LXYA 3Q8YA 4EK2A 2ZH1A 3CJSA 2VPYB 4OX7A 2Z2MA 3CJ3A 5K8PA 1U6FA 2ZHOA 2L08A 3NMRA 2YQ0A 2UUTA 4H4KC 2LP4A 2VOPA 1FRXA 1O8BA 2CPZA 1PJ6A 1R0BG 2LQ5A 2XYPB 1TKTA 3I55S 4A8SA 3D6TB 2VQEF 3NBPA 2H5IB 3DFEA 4MIBA 4B9UA 3P3DA 2JRSA 3LP0A 1WUUA 1RT5A 3DKDA 4K0KF 2OAUA 2IVMA 1JX4A 2FZKB 2UUCJ 4ZCLA 3P6YC 4J9LA 2UUAF 3PRVA 2ZE2A 4RW4A 4UW2A 3I6PA 4AUKA 1YITS 1L3TA 5J2PB 5D3GA 2OELA 2O66A 3FCVA 4ITSA 5HMWA 2XTJP 2P6TA 2QEXS 2QL9B 3DOLB 3HHKA 2HYIB 3I5BA 3QJJA 4MKYA 4U7UD 2MQQA 1AROP 2OUGA 1TL3B 3HK2A 1NH8A 1UWAA 2W7AA 1IXKA 4K5SA 4ZP7A 4PABA 5F8LA 4RW9B 2J7UA 3GTYX 1SQGA 1EJ7L 3PZPA 3P5TL 4Y2AA 4ZPDA 1U8SA 4WYWA 3M1VA 1GX5A 1XTZA 4F4WA 1X9MA 1YWXA 1RYSA 4LF4J 5EN1A 1AFJA 3FBBA 1HMVA 1U49A 1X9SA 1YG0A 1V6HA 3EICA 4KC5A 1NM2A 4B3SF 3KJNB 3CWJA 2RQCA 2Y1JA 3ENWA 1VS3A 4OMFG 3FGVA 4I64A 4WWSA 3OSNA 1L3SA 2WBRA 3CJRA 3CVKA 3FEXB 3H42A 2DNOA 1UFLA 2QFIA 4RWWA 5CHCB 3V4MA 3G8SA 4WFAQ 2KM8C 1P1LA 1IBKF 4N8OA 3PRBA 2DRBA 4LJMA 1YRUA 1PILA 2I8EA 1QSLA 2H4YB 2B5JA 5G4DA 4OL8A 4PXCA 3FVYA 2ABYA 2C42A 4I67A 4F0KA 2HSEB 4DV0J 1QTMA 4WTOB 2XLIA 3G86A 3PW2A 2BOAA 3KFWX 5F41A 1J5EF 2FHOB 1AFIA 4ANEA 1Z2ZA 5E3CA 2V4RA 2KXFA 1SKSA 3L4BC 3HMJG 1K9MT 1TK0A 3CT9A 5HAOA 3KK3B 2YWGA 5KG3A 1RTZA 1NDCA 3DLGA 3HHDA 2FVSA 1O5JA 1WF1A 1NPPA 5KFNA 2FDNA 4FYYB 4A47A 5G0RA 4YQWA 4RW8A 2NZCA 4DQQA 1JIHA 1S10A 1EARA 1LWCB 3FCHA 2DH7A 3HT0A 4DMZA 3OFFA 2W25A 3BGFA 2Y1IA 3CMAS 1QSSA 4DL5A 3R2DJ 2V0NA 2PC6A 1F9FA 1RT7A 4P72A 1U1PA 1FNXH 2RD5C 3TEHB 4YN3B 4DZ6A 1FNOA 3TVKA 3GU0A 3MR7A 1ELOA 2BE7D 1S7IA 3HD2A 2RB7A 4NEYA 2MDAA 4PXBA 4R5PB 3CC4S 4OZNA 3EM1A 2L41A 2RILA 3UQSA 1K47A 4DS5A 2KYZA 4Y2KA 1HHSA 2DHAA 3SEOA 1LKZA 1VBXA 1HBMA 4FS1A 2B4PA 2R8HA 4ZHRB 5GMKa 2XMAA 1SKUB 2DY1A 1HNVB 2VUGA 2XYHB 2GX8A 3HVTA 4HHUA 4V19J 1FEHA 2HMIB 1LWXA 1EB0A 5LJ5Y 4IRKA 1JK9B 4RU2A 1IKWB 1WC6A 1N6QB 2FYXA 4DN0A 3OLBA 1ZPWX 2VASA 3QFHA 5FIIA 2DHHA 2HWTA 2LLZA 3BGLA 3AD7C 2DXEA 2HBQB 3MM7B 4EO6A 3MAQA 1E6VA 2DNHA 2EG2A 5DRKA 2DB1A 3U27A 4RUHA 1KTQA 1PCAA 1RT1A 3BR9A 5A0YB 5B08A 5HN0A 3K5MA 3W60A 2O5DA 5RUBA 4IFYA 4A8OA 4M5HA 5C25A 1S7HA 5JJBA 1K1SA 1M5KC 3OTBA 3R9LA 2ZH3A 2AJQA 2NXNA 4IOAQ 2C2OB 3VVTA 1TL1A 3M8QB 3LWLA 3E51A 3H5UA 4DR1J 2VL1A 3FEZA 4P2FA 3MI7X 4PYDA 2JEJA 3GCWP 4DR6F 4O4GA 1HD0A 2KYXA 5B09A 5HVHA 5HLFB 5JVGQ 5C25B 2CYYA 5HI7A 2FVRA 4DU7A 5KOXA 4ERDA 2HHPA 2FZGB 2CG4A 2SXLA 2YWFA 2QA2A 3ZZYA 1T3NA 1C4AA 2PEBA 3BSOA 4C3LA 4CI0B 1T9WA 4KHPJ 1CG2A 2CNOB 4DN9A 1QAJA 4NXNJ 3OD2A 1AUDA 1TR0A 3RTVA 2A18A 4RZRA 4C3MA 2I9SA 2CQBA 2WB4A 4P2XA 3MXHP 1RWMB 5B0GA 3PW5A 4QYZK 4WU2A 2HHVA 2W2NP 2AQ4A 2D9PA 2OFGX 3LPEA 1O6XA 2HLUA 4YR2A 3NP5A 1WJ9A 2LKZA 3E01B 4ZIVA 3M9OB 1MSWD 4ETZA 3BM7A 4OYXA 4OX6A 1S1XB 5FDLA 1TL7B 1CJKB 4BWMA 3ZNJ1 5KG7A 3EMTA 2VZ9A 2ZKTA 3KHLA 2LEBA 2AX0A 3UCUP 4LT6A 2KZZA 3BSNA 1KVJA 2W2OP 1Q5VA 1ZAXA 4KY3A 4DR5F 2CQ2A 3LAKA 1RBLA 1WKLA 3IM8A 4NOHA 3C46A 3ZZZA 2GV1A 1RI7A 3FQKA 1H6KX 3OT9A 4I2QB 4DQPA 2R7QA 4JI3J 1U1QA 2OP5A 4HDHA 1Q8BA 4IDKB 2VKZG 2V2VA 3CDEA 4ECQA 5AT1B 3WIUA 5L9NA 1FKPA 1VRTA 4LR8A 5BYRA 4DXLA 4OX9J 2PE8A 2J5AA 4CO3A 1Y9OA 2GQCA 2RKIB 3VGUA 3W9JA 3CJ2A 3T1YF 2A10A 1KQKA 3FJ2A 2W9CA 3TR5A 3M8PA 2CWKA 3MM8B 2PI5A 1CLFA 3K0JA 3CD5A 4NA2A 4C9DA 5KOWA 2MKCA 4CLWA 4TU8A 1CQNA 1EKSA 3FQLA 3LW5C 1JLEA 4O3SA 2UXDJ 2LVWA 1UJ5A 4I56A 2ACMA 2C22A 4OZ3A 1NK5A 3KKFA 1S4EA 1FKOA 1GTHA 5BYSA 3W61A 1JLFB 1YJ7A 1D3WA 3A8IA 3UI3A 2ASDA 4M95A 4D3HA 4ZMMA 3ZTQA 2A3JA 4J9MA 2WOMA 4X4UA 5E3RA 2AU0A 2Z57B 1FF2A 5CCMA 3DHXA 4OLOA 2ZOMA 4QIFA 5HSPA 1T03A 5A8WB 2B9WA 2V94A 3KDNA 3BPDA 3O3LA 3R1HA 3O2IA 4PCQA 5C24A 3IAS9 4N8NA 3QMQA 5DLFA 1HQEA 4I0WA 3KLGB 2C28A 2CPIA 1W26A 2HWHA 2EFNA 4NZ7A 1MWYA 1WDTA 3FBEA 3I32A 3R8YA 3D9BA 2F40A 1NO8A 1FJEB 2MLYA 2K1RB 4E0DA 2DXFA 1AT1B 5KFAA 3IS9A 3NLCA 2ZBQA 3W2WB 1FRMA 3B4DA 3BYPA 3RRGA 1NJXA 3HULA 3MUVP 4WJBA 4NCBA 1JLFA 3ILIA 2GAHC 4AL7A 2CRLA 4JV5F 1PC4A 1WI8A 1Z2LA 3UVJB 4U6PA 4EO8A 4LVOP 3KWMA 4X4PA 4PG8A 4IO9Q 2RDDA 5KT6A 3CO9A 4DQIA 1HHQA 3R27A 1JJ2R 3UR3C 2I2YA 4UOHA 5J2PA 1E6YB 2YNHB 1VLOA 2QRRA 1F9HA 3PX0A 1KEKA 2VPXB 2AX1A 3FMBA 3TA2A 3K17A 3WZ0A 3VAIA 2RJZA 4DPOA 1R7IA 2Q1LA 4XPEA 4FKYA 1R0AB 2HRYA 4B3SJ 3MMCB 3SI8A 2P2CB 2JC0A 3L7OA 4LF4F 1VJQA 3DRXA 2HVZA 3CF5Q 1RAOA 3ENVA 4K2JA 2QMUB 1RWPB 1DTTA 1UFWA 3ELHA 4NLOA 2PI4A 4PZVA 4NMLA 4YFUA 1MW7A 1PAUB 2YVSA 4LSNB 2W2QP 3WHIA 4XPCA 2H48B 2PIIA 2ZITA 4DR2J 4JI4F 2CPEA 3MCOA 5KG4A 4KGMA 2ZHAA 1RT4B 2HQ3A 2Z2ZA 5HP1A 4KR0B 1U1OA 3SQOP 3ZZPA 1GXLA 2LYVA 4Q5VA 5C2CA 1KKHA 1WEZA 2YKOA 3M05A 2DCUB 2IMOA 5GAEI 2KG0A 1SC3B 4HACB 2VG5A 1GFWB 4OFZA 2D74B 1IKVB 3GILA 2V69A 2ILZA 4LF8F 4IH6A 2X1FA 1RABB 2OPQA 2EK6A 3HVRA 1QTNB 3BYRA 4PXDA 1WG1A 2JHEA 2KN4A 3LA0A 3S7RA 4ATNA 3CCSS 1PJ7A 2J76E 2JLFA 3IM9A 4TY8B 5GAHU 1YIJS 2MSSA 4Y28C 1WORA 2YKPA 3QYYA 1GMVA 4OJ1A 2NYIA 4P9SA 1G2EA 2IA6A 4DR6J 1S57A 2APOA 1IUJA 2CIMA 2ROGA 3HPOA 4DQRA 4G1IA 4NLQA 4DV5J 4DWIA 4JV1A 3JYTA 4UQGA 1XN9A 2N4CA 3TYTA 3UCGA 3HZGA 4LMZA 3NS7B 2RHSB 2QSWA 2M52A 1V3ZA 2F65A 4HHHA 2E5GA 3HI9A 3NRBA 5MLCV 2BDPA 4DV1F 3A8JA 5D77A 3SCJE 4FBTA 2F4VF 1UFKA 1U09A 1S6QB 1V5VA 3BBCA 5ADZA 3H90A 2G9OA 1N32J 4FN5A 2GJFA 4HI2A 3ZFVA 4CZCA 2WTFA 1E6YA 3RJMB 1IBLF 4G3IA 1NK9A 4JYAJ 2C1EB 1ROFA 1HPZA 2YXLA 5C42B 4ECYA 1N0UA 3HHLA 5I42B 2VPWB 1N36F 3I9ZA 1R0CB 2XO6A 3OL6A 1XBWA 3CTRA 2J9EA 3K8VA 3V81B 5E2QA 4FXDA 2V34A 4X84A 2EFGA 4USTA 3X3UA 2HKEA 5A0YA 1TFWA 3NCQA 1QSYA 2G0CA 3MZIA 4ZVQB 2FJEB 1FWPA 3HVAA 2R2RA 1TKXA 1U1RA 3CCLS 2WW8A 1Y10A 1RTHA 2YNIB 3IMQJ 1HNIA 4PG4A 2ROEA 1DTQB 2KHCA 2HPUA 2MHEA 3B82A 1W2IA 3DOMB 1LQ9A 2VU5A 1L3KA 4LF2A 5KFCA 5D15A 1CJUB 3IRXB 2QX0A 1H74A 3OQ2A 1SQEA 4C8MA 3M6WA 4RW6B 2J6TA 1NB2A 4GKJF 3HSGA 1YBUA 2CQHA 5ITHA 5CZVA 2VQFJ 3I0RA 1YRTA 4RW7B 1N52B 1M1KT 2POKA 3BN7A 4I69A 3MMAA 3KUEA 3W5YA 2OHDA 2UV8G 3A13A 4F7VA 2AT1B 4AXJA 3GPAA 2HHQA 5EX0A 2WOMB 2ZOGA 1SIWB 3VZHA 3QAEA 2C2RA 2PN6A 2HRTA 4F0MA 1CPZA 3NS5A 2B6AB 1R31A 4CTAB 1FK9A 4K4WA 2F4VJ 3N5FA 5ETMA 4C11B 1V9OA 3J7YU 1Y3JA 1RJJA 2IHR1 4KHRA 2HBZB 5A8RA 3TARA 2W4DA 1JLCA 3NL0A 1LWEB 3ZZ0A 2J6UA 4G6VB 3W63A 4DV1J 3QZ7A 4KGZB 3DDKA 2W9CB 4ILLA 2V8DA 2CQ0A 1KHVA 4B3OA 3DLGB 4QW8A 3IR6B 2RKIA 3QPIA 2QLJB 5I3QA 1H2UX 1U2RA 2RHQB 3TJ9A 4DG1B 4CLTA 3EPGA 1LWEA 2LMIA 3BH6B 2V2KA 1ZOTA 1RWWB 2ZBRA 5LM7E 4XO0A 4I2QA 1S0MA 2C3MA 6FD1A 5HMXA 1F9EB 3IWNC 1WHYA 4FYXB 4G65A 2CZ9A 1HWIA 3JTNA 2MJNA 5DO2A 4X64J 1Y5LB 2RU9A 4CWBA 2KI2A 1VHFA 2XY7A 2JLEA 4QWEA 1AUSL 5AE3A 4DL4A 4JI6J 2AWZA 1FX4A 3E01A 3TAQA 1ZAVA 2NYHA 5KT5A 2E7XA 1BE4A 2XO7A 3H7HB 2N82B 3OR1B 4RW6A 3KLIB 9RUBA 1XNRF 1LOUA 1RXOB 1KQGB 3MECA 2XMMA 1RHRB 1GEHA 1QDUB 1VLYA 3WDOA 4C6AA 2U1AA 2W9AA 3V6DB 2L9DA 3OFGA 2XYGB 3M1VB 4RR5A 3T1AA 1NB7A 3MPVA 4J9VA 4OYBA 4UOCA 5KT4A 2FY1A 3FNNA 5AJ3F 2D3UA 1VQ7S 4CLZA 4TLQA 1S72S 2DNPA 3RBZA 1IM4A 1C0TA 2JL9A 2FJDB 2R3VA 2YX1A 3H5XA 2JJ4D 8AT1B 3T5HA 5L38A 2V8GA 4C8YA 5DQHA 3MM6A 3KK2A 3N6LA 2XZDB 4JI2J 3ENAA 4ZS6A 1R43A 2PMHA 4F2SA 1LW2B 3C6UB 4MAKA 1S5ZA 4DV4J 4PQUA 2FLPA 5KFWA 2M88A 4IO1A 3JTPA 3LP2B 3GJSB 4IH5A 4D3GA 2B4OA 1KNZA 3KG0A 3DMJA 2AJ4A 3MR2A 2HAIA 1X9WA 4ZLPA 2V63A 2R7RA 1RB0A 3JSBA 3VR1A 1WEXA 2VFTA 3NBPB 2RH3A 5J2NB 4NRTA 2YNFA 3B78A 3VV2B 3SDEA 3IBCB 3CGIA 3S6EA 4X4RA 2J8AA 4KTQA 1S1VB 4WU3A 1S77D 3IXQA 3KJFB 4OJHA 1OQ3A 1SC1B 4JV0A 2ZHBA 4DSLA 2FLOA 4L73A 4UY8T 3DLKB 2ZFHA 3FZBA 1NCLA 1QY7A 1WOOA 3QGHA 4QBUA 5BXIA 4U8YA 4O0NA 2MKIA 2KH9A 1J5OB 1FXLA 3WX8A 5T7LA 1KOOA 3KLFA 3PRDA 4FF1A 4CLYA 4WF9Q 1UW9A 1G6BA 3AB4B 2MZRA 3CE8A 1S59A 2WRMA 4L72B 3CJKB 4WCEQ 3Q8RB 2Q79A 2WVBA 1IR2A 4M5DA 5DJBA 4ZLLA 1SH0A 4DLGA 3VQSA 3H98A 2GGPB 4U96A 4M5NA 2FHJD 2ZZMA 1KBRA 5A2QU 2FHMA 1S0OA 2FIUA 4A8MP 2GZOA 5AXKA 4M5KA 2H5EA 4EMDA 3OW2R 5FD1A 2BE9B 4I7FB 4KH1B 4Q8FA 3TP2A 4CO1A 4EZ6A 1QVGR 3VZIA 1CJTB 4UZBA 1HQUA 3THTA 1OIAA 2DHXA 2MQLA 4CT8A 2NQPA 1DTTB 3MDFA 2RQMA 2FD2A 3CMQA 4IOBA 3UO0A 1F2GA 1KP6A 2CJXB 4USWA 1KLNA 2E9RX 2DO0A 1BQMB 3UFCX 5L1LA 1OJ4A 2HQIA 5KFFA 1REVA 4KV8B 2XC9A 4B3RF 2ZDPA 2HZAA 3DGPB 4ZLJA 3HCXA 1NXIA 4GVBA 1FXRA 3D68A 4MYUA 1XC9A 4ZP8A 2WVDA 2LXIA 1D1UA 5L8RC 3SZ2A 5J2NA 2OPSA 5HBMA 1NZAA 4USIA 2VBZA 5K20B 4IYQA 2MKYA 1S1UB 2BABA 3BGRA 3C15B 2RNEA 4KO0A 4C98A 1W2BR 1JXLA 2DNGA 3SV3A 1NJWA 4B17A 3WQPA 3VAFA 1HYSB 2DNKA 3GE9A 2CNNB 2LQ8A 3RR8A 2VICA 4QU7A 3PDNA 3Q83A 2MQMA 4JI8J 1I3OB 3NWGA 1BWVA 3MWBA 4ILMA 3KG4A 5E41A 2AYGA 3C14B 2MLXA 4QWDA 2IMWP 4LFCF 3ICLA 1QVFR 2HVIA 4KHPF 2AF6A 2KJWA 3RRHA 1RA6A 2BA9A 2QJ3A 3QRRA 1HQEB 2YH0A 1GMUA 1C4CA 2XG8A 4L6V3 2HHUA 1JB0C 1N33J 2CKWA 4USVA 3CCJS 4QYZJ 1CJVB 1Y5NB 2GMLA 2OEMA 4TXSA 3KMSA 1SV5A 3Q2SC 2CJAA 5IFMA 2V68A 1NHKL 3Q89A 4B3MJ 3R5JB 4UTGA 4C8ZA 1UPPA 4LREA 4DSIA 1Y5IB 4YUDA 2LFVA 4KSEB 2R4FA 2G2YA 2H51B 1F1BB 5AE1A 3HD1A 5LMNJ 3HHLB 5A76A 3NMAA 3CJTA 1RTJA 2R8IA 3RB0A 4ELUA 3QGGA 3KHGA 4YHHJ 4P71A 2IBKA 1DAXA 3UN2A 1RWOB 2QA4G 2B51A 3NAHA 4IFVA 5L9XA 4QIWD 3MPWA 4QYRA 2LXUA 4ECWA 1NK4A 1N36J 4F02A 1AYEA 5DETA 1AA1B 3MAAA 3J81U 4YMEA 4F25A 3B54A 2XGPA 2RF2B 4PRFA 3MEDB 2J9DE 3OUYB 1X31C 2J0XA 2KO1A 4J9RA 4DR4J 1FI4A 2Z58B 1HQUB 1O51A 2VC1A 4BC7A 1NK6A 1JXEA 1S1WA 4FZVA 2F9DA 3PYGA 4HEA9 2VJVA 1Q7LB 3WIVA 1HL6A 5KFZA 3OVBA 4DR4F 3D6HB 1ZTWA 2DBBA 1UZHA 2RIJA 3BB5A 4L75A 4EBDA 2DGQA 5B0CA 1YTYA 5IXUA 1MROA 4H4KA 2NR0A 1Y11A 3FKBA 4ANDA 2XNRA 3EXYA 1TVRB 4RUAA 2V8VA 3W1YC 3SIPB 1YZ7A 2VBYA 3GFYA 4ID5A 3K89A 4MK7A 2VHGA 1RWUA 4F4XA 4H4OB 5B0EA 4MIWA 3MHYA 3LGMA 3N28A 4IG3A 3SFUA 4DX5A 4OI4A 3DDIA 4WXWA 2HWIA 4CM2A 1QD1A 4NXMF 4AFFA 2V6AA 2RRBA 3ITHB 4ZVUB 1X4EA 1SI9A 2OEKA 2F7VA 3IGNA 2OMOA 4C8KA 3C3LA 2GIQA 3EGVA 4W4MA 4B3MF 2Z4PA 1M1GA 1Y4ZB 2LQBA 4JI8F 5DS7A 2Y3YA 3CJ8A 5GAGU 2R7VA 2I5JB 2ZVIA 1UEVA 1U45A 4JI5J 3DRSA 3N5BA 1QJHA 4NEZA 3A3OB 5KG6A 4DUZF 2ZNZA 4EEYA 1IWGA 4X65F 4J9QA 4ANCA 5KFJA 3GIJA 2KT3A 4F04B 3DMJB 3LAMA 2PA8D 3N6MA 4R0JA 4RBUA 2VH7A 3JAMU 4R8UB 4O4RA 1M5VC 5SZTA 4KE5A 3TUPA 4F50A 1S99A 3SMZA 4DJBA 4AYBD 2JH3A 4WE1A 4H54A 4TN2A 2B9EA 3UVJA 1GK8A 4IFYB 5FLXY 2DGOA 1IN0A 2RRNA 1RAFB 2OH2A 1SB6A 1RT1B 3L3CA 2BJ7A 4MIAA 1UVIA 1FJGJ 1E6VB 2MQ8A 2E1RA 4CNZA 3IP0A 3K58A 1YQHA 2XZTB 3NOGA 4RBTA 2EFPA 2EW9A 2YNGA 1NDPA 2B8QA 3OHBA 4J9KA 3W9IA 2OO4A 2BQRA 1MU2B 1YLXA 1I94F 2FVPA 1I51B 4I6AA 3RG6A 5M2RA 4U7CA 1B3TA 5IC4B 3ILOA 1HIYA 3BO2A 5L1IA 1CBKA 4NLTA 4WP8A 4E98A 3PIOQ 5KFTA 5IZHA 1IM6A 3TUJC 3D7SB 4ZVTB 2R8KA 3GSIA 4TYBA 1TL4A 4JI2F 5HATA 3Q24A 5SUHA 3KJVA 5KT3A 4QR0A 4LFAF 3V4IB 2KFNA 3Q8PB 5CZXA 4LRAA 1RE1B 4P7VA 4XAKA 4QIVA 4U8VA 2QL7B 4ZCMA 1DQ9A 2DGTA 3M6VA 4A4JA 4M5MA 5THWA 3HKZD 3HSDA 4MK8A 5F8GA 2RU3A 3H20A 4ZVOB 4RNFA 3BV8A 4NLWA 3T9ZA 3J7A1 4I6YA 3NNHA 1C2PA 4FKXA 3GG0A 3ETMA 1RKJA 1IQZA 3L09A 3BBBA 3QBCA 2G4BA 3M7VA 2ZH9A 1P8GA 3PCOB 1ZH5A 1HR0J 5H9EK 2JOQA 2QLWA 1NSKL 1FCAA 1PSDA 1RLDA 3D5MA 1BQNB 1H98A 1RT2A 3JQKA 3MCSA 3TUIC 1WSVA 2QZ8A 1VHIA 2RRAA 5E5NA 5AE2A 1VQKS 3UPFA 4B9VA 4X2BA 3M2VB 4DSKA 3UN5A 1SJ4P 3FCWA 4ED6A 3J7AN 2BXJA 2E29A 3CCTA 1F5CA 4JYAF 5CYQB 2YX7A 2DRAA 1JLAB 1OPZA 2MEWA 5JXSA 4WFYA 5B0DA 2GHVC 4X62F 2H1YA 4C97A 2CQDA 1GT8A 3ONQA 3QFWA 2MXYA 2XMKA 2NPFA 5H1SV 2FLLA 2R8JA 1HBOB 3THVA 4K4ZA 2ZWPA 1DLOB 1SPBP 2BW2A 3DYAA 3J81j 4ECRA 5HROB 4O3NA 2L9NA 4DV2J 2OFHX 1U1MA 2RUSA 3I4HX 2VG7A 4DL7A 5AXMA 4G1PA 1ZPVA 3MM6B 3MR3A 3F0NA 3KK2B 1UWBB 3KYLA 2J0QD 3GYNA 5CYMA 2DIUA 2N7YA 4OYIA 1S12A 1N5TA 1UPMB 3A3NB 1B70B 3L9ZA 5LSRA 1BUXA 2UU9J 1VBKA 4J37A 4P73A 5J1EB 1YJ9S 1R8AA 2L3MA 3MF5A 2NREA 1HI0P 1MN9A 4JI0F 3NGSA 5LMUF 2CQ4A 1N5YB 1HNIB 1RTHB 2FC8A 1CJVA 2YNIA 3V6DA 1YRXA 4TQSA 2OSRA 3MM9B 2DY9A 1LW0A 5LXRA 5H9FK 1WTBA 2V8HA 4CLFA 3FK4A 4GC6A 1SJ3P 2ALYB 4ZVGA 1N32F 1D09B 2CQ1A 2BJ8A 3C14A 4EZ9A 3G9CA 1XWLA 4F26A 2ATCB 2JSXA 5A8WA 5F8JA 1SH2A 2WSCC 3AQPA 2BW7A 3DOLA 3E8OA 2AIRB 4P7TA 4USMA 4P6QA 4ZDNA 3PIPQ 4URSA 5CCLA 5LOQA 2KKHA 1LFWA 1URRA 2UV8A 3FFIA 2VIHA 2UUAJ 3MFIA 1X5PA 4NLDA 5IM0A 1Q78A 2FY8A 3I87A 1U2CA 3NGDA 4LFCJ 3TOQA 3M6XA 1MN7A 1U8WA 4I1TA 4DFPA 3DRRA 2Y1LB 2ERRA 1S6QA 2QV6A 2YKNB 4NASA 5LL6d 5HBMB 5I4MA 5LJ3Y 4K4YA 1RTDB 3J7Z5 4F4KA 4A8KA 2GAGC 4XDDA 3TQ1A 2HBRB 1J2VA 2DKOB 2VFSA 5KT7A 4GMKA 1VBZA 5CYQA 5DZ6A 3EWGA 5I3PA 5CAAA 1R8CA 2E1MC 3VGTA 3EDQB 3HLUA 1H7XA 2GQQA 2CUYA 2XBPA 4ETXA 3OJUA 4ECUA 1KSPA 4B3OB 4H4MB 2YH1A 1FFGB 3HM9A 1TQLA 4X4OA 2OIHA 2B7BB 1X4BA 1HLWA 1BY9A 2M70A 3FBFA 3TA1A 2HVHA 3RYLA 3HHEA 2ZUAA 4FDFA 4WKYA 1FEEA 1CJTA 2W9BA 4DQSA 3X1LB 3DM2A 4C8LA 3SSQA 1FVQA 3TX0A 3G87A 2UUBF 3PFEA 1CS4B 1CC8A 1NDKA 1RGVA 3VQTA 2FTRA 4ZLNA 3M30A 4ES2A 4F4ZA 1ZZNA 2KXHA 4NLYA 4DCPB 4E8UA 5EGYA 5KG5A 4FPIA 2CNKB 3M30B 2G2ZA 5DM6Q 4RNOA 2VBXA 3V4IA 3K7RA 4DL6A 1X0FA 3KJVB 3KJQB 1MWQA 1WWHA 2FJWA 4FNHA 1S76D 2RSQA 3RAQA 1G1XA 2IAJB 2UP1A 3NNAA 2E7VA 1SQFA 3KLFB 2KG1A 3CCRS 3UDCA 2N7CA 1J5OA 4IR1A 4CYUA 1XK8A 1IQTA 3BQ2A 3DOMA 3DLKA 1VIXA 1LXNA 1HD1A 1N48A 1HHTP 5KFXA 1FT8A 1X5OA 2WW4A 2GC8A 2CJ9A 2UXDF 1NPRA 2D69A 4LQ9A 1D9FA 1TKZB 2FUG9 1EX8A 1Q0NA 1RU1A 3BSCA 3JAMY 2XNQA 2YNHA 2R2TA 2ADBA 4ZIWA 2BOPA 4K8RA 3OV7A 2HHTA 4DR1F 2Y9HA 4ZK7M 4FP9A 3KLEA 3CJ4A 3QLHB 3T1YJ 1SL1A 1F6TA 4O4GB 4ID8A 5HLFA 4NLPA 2GMJA 4RKUC 3GSDA 1SIZA 1F2HA 3TAMA 2CWXA 4USHA 5IWAF 3DI6A 2MJUA 1IBMF 2N3LA 1S4FA 3FSYA 2ZH4A 2ZDOA 4LBIA 2XI2A 5FJ4A 2KVIA 3QQCD 4BS2A 3BGOP 3US5A 1RAAB 1NHVA 1TU0B 2W2MP 2CJBA 5IOLA 5KFDA 2G1HA 3ZZUA 3OL7A 3GIKA 4NLXA 1U4BA 1LW0B 2VJUA 1HWKA 2AJ1A 4FXWA 3IWLA 2ZH7A 1HW8A 1FERA 2CPHA 2W1BA 2VPZB 2WHOA 2QMXA 2ZJRQ 1EKRA 5E33A 3IWXA 2H65B 1N33F 1FE0A 1B7FA 3OR1A 3C19A 3QT6A 1ZTTA 1DURA 5CYMB 2AD9A 4K59A 4BC9A 1U25A 1A7GE 4ZVSB 4OZ1A 3H4BA 2R7OA 5KFIA 2B7CB 2ZC4A 1OYDA 3VCDA 1QE1A 2DNYA 2WONB 4Q2LA 4KKOB 2HQCA 4XTTA 1I94J 4AQYF 3GJRB 5DDQC 3DLEA 1RAIB 2CVIA 2IM1A 4NX9A 2OTLS 3OVAA 3PO4A 3OXGA 1HBOA 3M9MB 2NXUA 3ZNUA 3KK1A 1LWFA 4PYAA 2CJKA 2WVFA 2DPJA 3DU6A 2W01A 5KFPA 1XNQJ 1K0TA 2V8PA 3KUGA 5L1KA 3CCWA 1FKPB 1VRTB 2BKNA 4ER8A 4LSNA 3MOJB 5A8KA 2PD1A 3MEDA 5LSOA 3OUYA 1FTRA 3B4MA 2RMLA 5G0RB 3V2UC 4CRJA 2F3JA 2EBGA 3NEKA 3M32A 5B0BA 4NYZA 4ECXA 1GTEA 4UQTA 4Q8EA 1FJCA 3KXDA 4B9NA 3KK3A 4CH1A 3PEJA 2B43A 1T9TA 1XQIA 5L46A 5HVGA 2V9WA 2HZCA 5J1NA 4PWUA 1WKJA 4DUYF 1PBUA 1HBUA 4I68A 3NCPA 2DNRA 3GIIA 3PW7A 1KVKA 1C1CB 2KVQE 3S1TA 2MHNA 2EC2A 2WAQD 2MQPA 5EDWA 1NKEA 4JI7F 1UKUA 3MPUB 4BLGA 4DUYJ 3OJSA 1VQ6S 4NYOA 2J0SD 5D0EA 1U0SA 1WSRA 1JLQA 3O44A 4N77A 3H0PA 1TTHB 2YPZA 2P9EA 1Q16B 1U1KA 2YKAA 2IC3B 4URQU 2XS7A 3R2CJ 5D0GA 7FD1A 3FRYA 1CULB 2WK4A 3GMGA 3MM5A 1B99A 2QG9B 2ZWOA 4OYPA 4USKA 3TNVA 2BQUA 4JI5F 1HQ2A 2B0GA 4Q7AA 1RTIB 3GFZA 4OHZA 3GP9A 4XDCA 4M5IA 2FC9A 4JBCA 3H2VE 2FJBB 3GG1A 1TP7A 3V6KA 1OY8A 2HS4A 2AKWB 2HGMA 3BZQA 2IM2A 3LWMA 2MKKA 3KTQA 4LF6F 5K5MA 2XEXA 1T05B 5B0FA 2DH8A 2LU2A 3D0IE 3ZZRA 2MQOA 1RT3A 3KDOA 4QZVB 2CA9A 4YDXA 1ITPA 1K0VA 2BACA 1U1LA 1ZZFA 2OKQA 4XK8C 5KFLA 4A8XA 3QWPA 2ALZA 2F4FA 5HO4A 4NXNF 3H40A 2E5IA 4MT1A 1FJGF 2GIRA 3SBMA 3QATA 4PWWA 2AJ0A 3F41A 4U9RA 4DV7F 2IYGA 2QA4S 3AOAA 4JUZA 1FWKA 1T9VA 1VIOA 1WC3A 4OX9F 4DDFA 3TRGA 4X4TA 4MJKA 5EWFA 4FBUA 3J80U 3I0SB 4DR7F 2QYGA 4LFBF 1WD6A 4W98A 1SH3A 2E44A 4AD6A 7AT1B 2RDJA 4X4VA 1C1BB 5KFSA 2XLJA 4W90B 2R2UA 4NLSA 5EX3A 1SJ1A 4HKQA 2FJVA 1NU4A 4K2XA 5F3ZA 5A2QY 1LK7A 4DL2A 3B6BA 4K4SA 2K8GA 3GFXA 1U2FA 2BKPA 3BF4A 1JKHB 1GAOA 2MZTA 2R9LA 1S6UA 4EFAC 3RB4A 2XMJA 3TEGA 4OLPA 3LGHA 2U2FA 5HJYA 2YKMA 3T5JA 1JLQB 1TAQA 1P9YA 1NPKA 2C2ZB 2H3EB 2BV3A 2H9ZA 2AJ2A 1BHNA 3O1LA 1S1XA 3JXOA 5FDLB 5DG7A 1L3VA 3OL8A 4MFBB 3AOCA 1VQSA 1UL3A 2GNKA 3HFKA 3RZAA 3ZO7A 3Q23A 4DV4F 2AHOB 1FDDA 2I0XA 2HQGA 1J27A 3P45B 4NCGA 3EUNA 2D1CA 2X1BA 3D28A 5F0WA 1IVZA 2IDLA 4QPXA 2AYMA 5HP1B 1K1QA 2K7KA 2VC0A 3NWRA 4FVMA 1VQ8S 3VAKA 4MH8A 4ES3A 2HFSA 1VRUB 2DK2A 1YBAA 5K14B 1R8HA 1S6OA 3RBEA 1N8RT 4PEOA 4DX8H 1KQFB 3MURP 3VAJA 2UUCF 2QN6B 3R3TA 3WC0A 4UUXA 1WC1A 4WTYA 3U02A 3G71S 3SQGA 1SUQA 4HI1A 3H59A 4RUBA 3TANA 2QC3A 3MR5A 1RUSA 2QIFA 3GFHA 5E0OA 4O3QA 2HNDA 1WF0A 2HK3A 1TL5A 4CO0A 2C2DA 1XMQF 4YB5A 1XMOF 2ZEJA 3QIPB 4WKRA 3A3PB 1P1TA 4MMOA 2V4QA 1NAQA 2IM3A 4OYAA 4X64F 1L3UA 3M8ZA 4EGLA 3FSIA 2DR8A 5JMNA 2JEGA 2IRYA 1N0VC 3BN4A 4PXEA 5I3UA 2RS8A 1OSDA 2NPIA 1WDDA 3MM7A 3V6JA 1KHWA 3H5YA 3PJWA 5GAHI 2BANB 3MCMA 3QT5A 2JVOA 1T94A 3EJMA 2XS2A 4DEZA 4DX6A 3UDEA 2HAFA 1HWUA 1HBNB 1MMNA 2QLFB 2UVVA 1W7WA 3H8YA 4ZOSA 2F8MA 4RO0A 3PYFA 3MD1A 4ZPWR 2KFYA 4OI6A 4FF2A 3K5LA 3I5CA 3PR4A 4ECTA 1JNZB 3GJQB 4Z37A 2Q3PA 1F3FA 2XS5A 3CULA 3CC7S 4Y0FA 1FA0A 1T9UA 3SSSA 1R8BA 4HT7A 5HQ8A 1WNEA 2BZ2A 4O3PA 4EBCA 4NXMJ 1S0VA 5D4LA 5K8MA 3LOUA 1HNZJ 4C8OA 1M0SA 3PJXA 1Q8KA 2CFXA 3R5DA 4J9PA 2ASJA 1EETB 2R7TA 3BDEA 4F4AA 5ETPA 5KFMA 3G6YA 3LP1A 4RWXA 4AL5A 3KLEB 4HH0A 1JLEB 1VFJA 2DHSA 1HBUB 1TMMA 1TKTB 3G82A 3EPIA 3GR1A 4GVBB 5K14A 3OR2B 4ZCKA 3H25A 4IR9A 1LWCA 4DG1A 1REVB 4F3QA 2B9YA 3HT3A 1IR1A 3M8WA 3A8KA 5CYJA 3OTOJ 4DV6J 2DNZA 1X4GA 3M32B 3PYEA 3EE3A 2KXNB 1BQNA 1RT2B 4WFBQ 5KG1A 2E1AA 4J9UE 2PMZD 4ZJOA 3N0VA 4ZPAA 4DPWA 4M5GA 1EP4A 3DOKB 1AZSA 4ZP9A 1VC0A 1KFSA 5A8RB 3ET6B 4OHYA 1KFDA 2MTLA 4RNNA 2ZJPQ 2QA1A 5E3PA 1ZM2A 1C0UA 4N76A 1GH8A 1FK9B 1NBEB 2C3OA 1FRLA 4PKDB 3UE2A 1JLGA 5HMZA 2GW8A 4Q45A 4N5SA 4FYVB 2XWYA 2BJDA 2UXCJ 1NJIT 1F5AA 4QW9A 2VBWA 3OSPA 1DHMA 2A6OA 1RHMB 4NLRA 1FJ7A 2WONA 1IKXB 9ATCB 2I6WA 1D0EA 3LGNA 1RWVB 2XMUA 5GAGI 3PJ9A 4DV7J 3I82A 1JJCB 3J7YI 1OO0B 1TUWA 3CC2S 1WOPA 1Q7YT 2KRBA 2P8IA 2E5LF 3UN3A 5JUMA 3VAMA 1GMWD 1GXTA 3EXCX 1FE4A 1V3RA 3JTOA 1YJRA 4K50A 1L5UA 2HGLA 1XNRJ 5CD4H 2CQIA 4ZP6A 4J9OA 3NY0A 3QO9B 2ZH2A 1S1VA 1WHVA 2FQQB 4CO5A 4RU9A 1FRIA 3C6TA 3NNCA 4ECSA 2UZAA 4KHMA 2FJXA 4Q0BB 2HFVA 4GRSA 2M2BA 2ZBCA 2WSEC 1M5SA 1TV6B 4WYLA 3D66A 1SKRA 2OI2A 2PMWA 1XJWB 2A6MA 3CD7A 3RBXA 1N5VA 2PA3A 1X7VA 3W7BA 3TUZC 2MZ1A 2ZH6A 5JVHQ 1MWZA 1HPZB 2X1GA 3FRZA 2M8HA 4F2RA 2G1DA 2X3GA 2LDIA 1HNWF 3U7JA 5CXTA 3TAMB 4LFAJ 1PKUA 4LRCA 4DV3J 1IKYA 4URGA 1T05A 2ZM6J 3J80Y 3CW2C 4R0EA 2OLWA 2FPHX 5HK4A 5KFHA 4JI7J 2I5JA 4RUCA 3QT8A 1ZA1B 5DDOC 5DGBA 1C0TB 1YJVA 1WC5A 4C3KA 4CLLA 4LR9A 4OV1A 4DL3A 2IBOA 3UD3P 2ZUGA 4M94A 3UW1A 2VQEJ 4N47A 1IKWA 1H0HB 5DDRC 1NRKA 2ZVSA 1CULA 1HI1A 2CNLB 3ULHA 1DJ0A 4DUTA 4OZLA 5J1EA 5KFKA 4X66F 4CH7A 3G6VA 3BKFA 5IT9Y 3IFEA 3BKTA 3DLJA 4DPUA 4NCAA 4Q43A 4ZHRA 5GMEA 4FS2A 4Y3CA 4AQYJ 2LU1A 2VD3A 1V5IB 3VTIA 5D6GA 2CQ3A 3GLJA 2OEJA 1ICEB 3DGVA 4DF4A 4QCLA 1EHWA 2BKOA 1IKVA 3PX4A 2EPIA 1TVRA 4DBQA 5IQQA 4V1Ak 3KLHA 2RAQA 4OZ2A 4PR6A 2OJ3A 4CLKA 3G8TA 2JEIA 5ETQA 5LMNF 4RL1A 3DRPA 1JLGB 1T95A 1IWAA 3UNYA 2DR6A 2B4UA 3DRYA 1X4HA 3BREA 4O23A 5BYQA 4AL6A 3PKYA 1DRZA 4DSEA 2FVQA 2R8GA 2M0GB 1KWMA 4I2PA 8RUCA 3CXCR 1BGXT 3DN9A 4QPTA 2AV5A 2HG4A 4QR1A 4ENOA 4EUVA 4J9NA 1SL0A 1WACA 5KFVA 1VC5A 3H4DA 2DVIA 3NAIA 1SVDA 4DL0C 1H38A 4JI0J 1YHQS 3D3CJ 1VDHA 3BH7B 4L74A 3I0SA 4C8NA 4G1QB 3I4PA 4LSLB 1N34F 1QUVA 2UU9F 2Y8WA 3HO1A 2QE5A 1HA1A 2GVDB 1RU2A 3OR2A 5ETLA 3AD9C 3PX6A 4KH0B 1SBRA 3G82B 3PNIA 2CDRB 1RAHB 4Q2MA 3Q0AA 3T5KA 3J7ZT 4TU9A 2ZBPA 4CDIA 1MLAA 5GADI 1QE1B 3P4UB 5MAOA 3MEGA 2XHCA 4DX7A 1NMEB 4WIQA 2XMTA 1ZA2B 5ETTA 3NXZA 1EAYC 4QJVA 5IM0B 1UMJA 2WCXA 3CDBA 3FSXA 1RWKB 2XM3A 4MYTA 1NK8A 2YQ3A 1LFPA 5BR8J 2XY5A 3LF0A 1OPIA 2OPRB 4LF9J 4X62J 2BJ9A 2GCFA 1AB8A 1FRHA 3LUYA 4JOUA 2DTJA 2DHGA 1RBAA 1F0XA 3NGKA 2V4JB 2NXJA 4NLVA 3D1OA 1U24A 2JDJA 2MKSA 4O0IA 3KMQA 3OPKA 1RK8A 4MK9A 4YR0A 2AEJA 1R89A 2W24A 2ATLA 1FD2A 1RTIA 3RAXA 3OL9A 3LALA 1T03B 1N5YA 3QGIA 5J2QA 4P2SA 2CXEA 4USJC 3VAGA 5CD4A 3PM9A 4I4BA 4GVLA 2BM0A 2CQGA 3C2PA 5KAKA 1PYTA 4RW9A 1LK5A 1PG5B 1VQOS 1M90T 4C0HA 4ZJQA 3CDUA 4TU7A 1VQ9S 1FKOB 3IO1A 1Q5YA 2IM0A 1FWLA 3S01A 1TUVA 2X7IA 3RUBL 1X4AA 3A4TA 3QIPA 2LCWA 3NGUA 1CSJA 1GQEA 1Y3KA 2DISA 2JFDA 2CG8A 2JVRA 4ILRA 4X65J 3GV5B 3UNGC 5EWEA 5HROA 3J81Y 2E9TA 4TQRA 4OHVA 2O1PA 1XEZA 2PT0A 1NDLA 5LMUJ 3WC2A 2YQ1A 4U95A 2O67A 3AJ2A 2NXEA 2BVZA 3W65A 1UVNA 1N88A 2IDEA 3AD8C 3CD0A 4OZ0A 4S0MA 4JI4J 3UD4P 4J5OA 4KIAA 1U6ZA 4ZN3A 4QIEA 3T6JA 2Z8QA 3NGTA 4J7CA 2VKRA 3R6GB 3I56S 3T3FA 1K73T 1WEYA 4MKAA 1APSA 1RT6A 3HHLD 1G4CA 3LO3A 4QOTA 2NLWA 5KTQA 2HVEA 4HR2A 1NNDA 3M2VA 2HNZA 4RLEA 3QIDA 4HTJA 5B0AA 2J9DA 3EGNA 4I7FA 5B7WA 1VQMS 3POTB 1HWLA 2NUHA 1URNA 4NI2A 2ZOFA 3SV4A 2L9WA 4WP9A 1RWNB 1T0TV 1G7CB 4DV0F 3I5AA 4UF4A 4IG3B 3AODA 2HS3A 3CCUS 2NSCA 2RVJA 2DGXA 2C2KB 2EXUA 2V67A 4CM0A 2VA3A 2CZ4A 2QL5B 3WBZA 1JMTA 2KU7A 2MZJA 3W2VA 4ECZA 1SCJB 1CVJA 1ZBTA 3QGPA 2VODA 4ZITA 4ZN1A 1A0OB 3DM2B 1PYOB 4C2MA 2LECA 3PV8A 4F3OA 3S8SA 4HACA 1VYAA 1IBKJ 2H4WB 1B0TA 5EHHA 3E2EA 3R7BB 3AHPA 4DFJA 2EBEA 1WI6A 1B7YB 5KT2A 4DV3F 1JKHA 3ISND 1NSAA 2HNZB 5KFUA 1B4SA 5HMYA 2OMLA 4MKBA 2EC0A 3RB3A 1PJ5A 2NXCA 3JSYA 3MEKA 4C4WA 5M2PA 4HT5A 2LA4A 2ZZNA 3SDEB 3RW7A 2HIQA 1R6YA 1RP5A 2J7KA 2YBVA 2DITA 3IAM9 4L3KA 4NYPA 1RHQB 3MAAB 2UVUA 3BPSP 4YY3J 3VWSA 1RZMA 3GR0A 2WVCA 3R7NB 5HQMA 4CIOA 3Q8SB 4HLBA 4QWAA 4A46A 2RE1A 3DI6B 4ZVFA 2HQFA 3KNGA 3ZZOA 3D67A 4PWDB 2JLGA 2B8PA 5LT5A 3PYDA 3LP2A 2DR9A 1QLNA 2Y0BB 2FHKA 1VI7A 1PYSB 5ETKA 3U1LA 1VQNS 1RLCL 4J9SA 3HJFA 3N4WA 2R7UA 3QLHA 1YJUA 2R7XA 4Y6IA 3T9NA 4DF8A 4LF7J 4OI0A 4Q0BA 1U7LA 1HNXJ 4JV5J 4DV2F 4KYZA 1OS5A 3T5LA 1OYEA 1XERA 3MM9A 2GHPA 1FKAF 1Z1ZA 3NCRA 3AQOA
chains in the Genus database with same CATH topology
5ETPA 3KUHA 1TMJA 1IM6A 3HD2A 3UD5A 1EQ0A 1EX8A 1Q0NA 1RU1A 2F63A 1TMMA 2CG8A 1DY3A 2QX0A 3KUGA 1HKAA 3MCMA 4M5HA 2BMBA 1F9HA 3UDEA 5ETVA 1EQMA 3HSJA 3HSGA 3HCXA 5ETRA 3HSZA 1RB0A 1HQ2A 4CRJA 4M5NA 4M5MA 5ETNA 1KBRA 1RTZA 3HSDA 3KUEA 5ETLA 1RU2A 5ETSA 5ETKA 4M5IA 4F7VA 3ILJA 1RAOA 4M5KA 3IP0A 4PZVA 3HT0A 4AD6A 1G4CA 4M5JA 4M5LA 3MCNA 5ETOA 4M5GA 5ETQA 3QBCA 3MCOA 3UDVA 3HD1A 4CYUA 5ETTA 5ETMA 2F65A 3ILLA 4CYUB 3ILIA 3ILOA 4CWBA 1CBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETP A;  3KUH A;  1TMJ A;  1IM6 A;  3HD2 A;  3UD5 A;  1EQ0 A;  1EX8 A;  1Q0N A;  1RU1 A;  2F63 A;  1TMM A;  2CG8 A;  1DY3 A;  2QX0 A;  3KUG A;  1HKA A;  3MCM A;  4M5H A;  2BMB A;  1F9H A;  3UDE A;  5ETV A;  1EQM A;  3HSJ A;  3HSG A;  3HCX A;  5ETR A;  3HSZ A;  1RB0 A;  1HQ2 A;  4CRJ A;  4M5N A;  4M5M A;  5ETN A;  1KBR A;  1RTZ A;  3HSD A;  3KUE A;  5ETL A;  1RU2 A;  5ETS A;  5ETK A;  4M5I A;  4F7V A;  3ILJ A;  1RAO A;  4M5K A;  3IP0 A;  4PZV A;  3HT0 A;  4AD6 A;  1G4C A;  4M5J A;  4M5L A;  3MCN A;  5ETO A;  4M5G A;  5ETQ A;  3QBC A;  3MCO A;  3UDV A;  3HD1 A;  4CYU A;  5ETT A;  5ETM A;  2F65 A;  3ILL A;  4CYU B;  3ILI A;  3ILO A;  4CWB A;  1CBK A; 
#chains in the Genus database with same CATH topology
 4P74 A;  5HQL A;  2CPD A;  3KLV A;  3QRQ A;  2F1F A;  1SJR A;  1UTA A;  2EI5 A;  3AOB A;  1RWX B;  2XMW A;  3CJQ A;  5J2M B;  1EZZ B;  1EIY B;  4PUO A;  2GVZ A;  3R6L B;  5D0R A;  4JI3 F;  1U26 A;  3AXM A;  1REG X;  1DZ5 A;  4NA1 A;  5E3A A;  4HTI A;  4NE9 C;  5H9E J;  1UA1 A;  2FJA B;  3IG1 B;  2Y0S D;  3W5X A;  2AEF A;  1K44 A;  3MM5 B;  1IBM J;  4ED5 A;  1D8Z A;  1W25 A;  4NZ6 A;  2W7P A;  1UCN A;  2COL A;  3TA0 A;  4KJI A;  1DBD A;  4DFM A;  1ZS6 A;  2CQC A;  1GMW A;  2FGO A;  2ZNY A;  1VRQ C;  1FX2 A;  3O6Q A;  4LBP A;  5K9F A;  5DLG A;  1U48 A;  1RCX B;  2EFV A;  2BRL A;  1IR0 A;  1FXD A;  2DEJ A;  2HBY B;  2KJV A;  2OPS B;  4HH1 A;  4C0O C;  3GIR A;  1P9Q C;  1A6L A;  3PG9 A;  1EP4 B;  3M2U B;  1MRO B;  4RX6 A;  2GHW A;  3CNQ P;  2WZ1 A;  1YJN S;  1RTD A;  3PXG a;  1WHW A;  3CCM S;  1DQ8 A;  3GQC A;  4HYK A;  4W92 B;  2ZD1 A;  3M8P B;  2DJW A;  1JWW A;  4H4M A;  2CVE A;  3HSJ A;  2PSZ A;  3FEY B;  1SXL A;  2EFQ A;  3VGV A;  5K8O A;  2LXF A;  2VFR A;  2AEM A;  4ALZ A;  3UWT A;  2LDY A;  5A8K B;  1P27 B;  4DR3 F;  3UCZ P;  1WG5 A;  4KPY A;  1PGZ A;  1YJW S;  1DQA A;  1FDB A;  2DT9 A;  2X1A A;  2YKN A;  4UOF A;  4IQX A;  4LVN P;  3HKW A;  2EK1 A;  2EVZ A;  2QLB B;  3M2R B;  3HHN B;  1OQ6 A;  1TK5 A;  2DGW A;  1Q82 T;  3G2X A;  4NWB A;  1IBC B;  3CDW A;  4CNY A;  1TK8 A;  1B0V A;  4ZVP B;  2XLK A;  2PFF B;  2YY3 A;  3MTJ A;  4KKO A;  3ZTO A;  1TL7 A;  1OMS A;  1UZD A;  1KON A;  3GCX P;  1PC5 A;  5IT4 A;  2E5L J;  2F63 A;  3AJ1 A;  2JFK A;  2QTW A;  2HIY A;  4WPA A;  3RAM A;  2K7J A;  3CPW R;  1UA0 A;  2J8S A;  1UEK A;  2QMW A;  1LNQ A;  3I0R B;  1S9E B;  4LUB A;  4RW7 A;  4ZKA A;  2FLN A;  4CO4 A;  1NZ8 A;  3O5T B;  4B9S A;  2M9K A;  4DSJ A;  1RSC A;  3SCK E;  1WHX A;  1YKW A;  4QU6 A;  1WC0 A;  4ZA1 A;  5LSL A;  2K3K A;  2GS8 A;  1BD6 A;  2AYE A;  4F67 A;  4KQZ A;  2BQ3 A;  2WBM A;  4P52 A;  3EYZ A;  4LQ3 A;  2YNG B;  2VON A;  3MAH A;  3TZZ A;  3CCE S;  1QAX A;  2H54 B;  1RKI A;  1H2V Z;  3IRW P;  2VOO A;  3R5C A;  4AE5 A;  3MPY A;  4EBE A;  4FF4 A;  1SKW A;  2KRR A;  5IT9 U;  4IH7 A;  3H2U B;  4KFB B;  3KNA A;  4IKA A;  1SJF A;  1KLM A;  3BJY A;  5KFG A;  5L39 A;  4Z7C A;  3F44 A;  1R6V A;  3DDN A;  3TJ8 A;  3V5R A;  3HP6 A;  1ZYQ A;  4M8L A;  2IJF A;  2DEI A;  3A8E A;  1NSQ A;  2J9C A;  3SYZ A;  2C3U A;  3MEE A;  1TFY A;  4B02 A;  4M63 A;  1V3S A;  4FXV A;  1JNR B;  2DNM A;  3SSR A;  2FB0 A;  1LW2 A;  3C6U A;  4WK3 A;  2QO3 A;  3AA9 A;  3I31 A;  3GB0 A;  2W8K A;  4HL9 A;  1CEZ A;  3JSR A;  1XIQ A;  2OPP B;  3CSK A;  2J6S A;  4O44 A;  3CME S;  1T8E A;  4QQB A;  1OWX A;  1BQX A;  3AB2 B;  1SL2 A;  1TKZ A;  2CQP A;  1GNK A;  2F9J A;  3A1Y G;  4CH0 S;  2I38 A;  3EGZ A;  1RBO B;  5D4O A;  4F3M A;  4ZCI A;  3JYT B;  2W8L A;  3VVU A;  1NUE A;  1BQM A;  1Q53 A;  1RDR A;  5HVF A;  3TZW A;  2VG6 A;  4OJG A;  3F73 A;  2D3O R;  5C7P A;  2V2Q A;  3DNC A;  2AGQ A;  4QWC A;  3ITH A;  2VDI A;  1WEL A;  4K4X A;  4TKT A;  4WII A;  4CLP A;  1DAR A;  1HNV A;  1EQ0 A;  4P2M A;  2MGZ A;  2RDI A;  4L76 A;  4RNM A;  5F8I A;  4EYH B;  1H72 C;  4L3N A;  1FFW B;  1Y7P A;  2ZH5 A;  3BKU A;  1X5T A;  4TVA B;  4F0H A;  4FYD A;  2QFJ A;  3W2V B;  3MUM P;  1NJY A;  3TAP A;  1H2T Z;  3T19 A;  5ETN A;  4R5P A;  4ED4 A;  1QAI A;  2P6S A;  2WB1 D;  1R3N A;  2C3Y A;  1UAW A;  4NI2 B;  2LQ9 A;  3M2R A;  4OJ3 A;  2JWN A;  3THP A;  4DR7 J;  4LFB J;  4M5D B;  3UDL A;  2G2O A;  1RT4 A;  3GZ7 A;  3CJK A;  2KL8 A;  1S1W B;  2W9B B;  4XIU A;  3DOK A;  3GYG A;  5F8N A;  4F4Y A;  2DNN A;  2HVD A;  4K5R A;  2ZBI A;  4PQA A;  3G96 A;  1HNX F;  4DZD A;  4F8R A;  2IFX A;  2LEP A;  4HDG A;  4WBF A;  4U67 Q;  2X3D A;  3A12 A;  4AT1 B;  1JLB A;  4FYW B;  3N79 A;  2K3I A;  1NK7 A;  2BYC A;  4Y2M A;  2QSF A;  4BDP A;  3L95 X;  2ZZT A;  4Y2I A;  3R97 A;  8ATC B;  1X0P A;  4YEA A;  3PEH A;  2M8D B;  4ED7 A;  3C16 A;  1HNW J;  1CQM A;  2E5H A;  1HNZ F;  2W4P A;  3M2U A;  2AJF E;  2DXD A;  2MST A;  3DXB A;  2YNF B;  4DR2 F;  2OPP A;  1I5O B;  3OTE A;  4C11 A;  2A2D A;  1VBY A;  2RQ4 A;  3DRR B;  1JXV A;  3N01 A;  1FO1 A;  4WE1 B;  4OI1 A;  5KG0 A;  1H3D A;  2DD8 S;  3TX8 A;  3FBC A;  2B5J B;  3NKY A;  5CAB A;  1SJQ A;  1SC6 A;  3WX4 A;  3DLL Q;  2F5G A;  1NSP A;  4ZVE A;  4CP5 A;  3PAC A;  4HVZ A;  5KFE A;  2GIF A;  4PQU B;  3QWU A;  4OI2 A;  2R7S A;  4KGX B;  4WXO A;  1SV5 B;  3K5O A;  1FHT A;  5KFR A;  3DCA A;  5D4N A;  2B3T B;  4ZJL A;  2DGU A;  4RJV A;  1WTF A;  2HS0 A;  3IBW A;  3QSI A;  1UVJ A;  4OI3 A;  4DCJ B;  2HHX A;  4OHX A;  2HFZ A;  1S6P A;  3P96 A;  4K0K J;  2GMH A;  2UXB F;  1T9X A;  1D9A A;  1RAJ A;  4WK1 A;  3TWZ A;  2FGC A;  3FMW A;  2DGS A;  3MMJ A;  1KOH A;  4F36 A;  2UXB J;  2B56 A;  1ACM B;  2IC3 A;  2Z2Y B;  2UXC F;  4Y2C A;  1XMQ J;  4GC7 A;  3BGU A;  4DR3 J;  2AGO A;  1S9E A;  1S1T A;  4OX8 A;  1U6B A;  3EVW A;  2V2Z A;  3D6F B;  2HHW A;  1S1U A;  3IGV A;  2VG7 B;  4OZJ A;  2N3O A;  3QRP A;  3TQE A;  4CT9 A;  2K2P A;  3N9U C;  4NLG A;  2DO4 A;  2J7W A;  4OYW A;  1I1G A;  4WP3 A;  4PWD A;  4IRC A;  4X4N A;  1X4C A;  4GO7 X;  3I9V 9;  5H9F J;  2GVD A;  3C16 B;  2F8H A;  2DCL A;  4KV8 A;  1D9D A;  2LEA A;  1UW4 A;  3ISZ A;  3O8W A;  1QAY A;  4B9T A;  1TZ0 A;  5AXN A;  1IJE B;  1VK3 A;  2G13 A;  4IRD A;  1VIS A;  1FDA A;  4V19 X;  3CO0 P;  2WVE A;  3HSZ A;  2HUR A;  3ETO A;  3VAH A;  2V9K A;  5FLX U;  4TNO A;  3QT7 A;  4WFZ A;  4JP8 A;  2GJI A;  4GKJ J;  2HFU A;  3D0H E;  3Q2T C;  1YX2 A;  1XNQ F;  2VFU A;  1FES A;  3D1H A;  4I2P B;  4NA3 A;  5A6P A;  5E7O B;  3W62 A;  2CDQ A;  4PG6 A;  4UUW A;  3MFH A;  4CO2 A;  3RGI A;  2Y8Y A;  3EZO A;  4OV6 A;  2HLT A;  1UEU A;  1HI8 A;  2ZH8 A;  4CLS A;  2PGC A;  4IFV B;  4LRD A;  2YWE A;  2NCK L;  4JI1 F;  4K7Q A;  3KG1 A;  4DLE A;  2KB2 A;  4KPC A;  3JQM A;  3PY8 A;  2XMV A;  1JLC B;  2AMC B;  2MZQ A;  4FF3 A;  2EKY A;  3T1H J;  1J5E J;  4WFN Q;  3P49 B;  2GGP A;  3OBI A;  2HHH F;  2OTJ S;  3EZ5 A;  3HVW A;  2HGN A;  4NPO A;  2NS1 B;  3OXL A;  5DGA A;  3MPD A;  1VQL S;  4QR2 A;  5DM7 Q;  4TYA A;  2VG5 B;  3E3X A;  2MYF A;  4ELV A;  2KFZ A;  2KT5 A;  1NHU A;  1RHJ B;  2Q66 A;  2Z0G A;  2BE2 B;  1YZ6 A;  2FZC B;  4NZ0 A;  5IQ6 A;  2XZW A;  1S79 A;  2BJE A;  5F9N A;  5DG9 A;  4GO5 X;  2DNL A;  3ZC4 A;  3ILJ A;  2ROP A;  2D3O 1;  2HRU A;  1XMB A;  1Q8I A;  2ZM6 F;  4YOE A;  4PG7 A;  1AW0 A;  4LRF A;  3KOA A;  1H73 A;  4DUZ J;  2E1C A;  3MCN A;  1GX6 A;  1RT6 B;  3W5Z A;  3BQ0 A;  4KGK A;  2H5J B;  2GVZ B;  2XB2 D;  1KN6 A;  3ENQ A;  2M3D A;  1VC6 A;  5F3T A;  4LF1 A;  2AGP A;  3IA0 A;  1C1B A;  3W64 A;  1YK9 A;  3PTW A;  3MMC A;  1K8A T;  3ZZT A;  1XMO J;  1DFD A;  2BJ1 A;  2OSQ A;  1R0A A;  1VCT A;  3H2L A;  2XCP A;  5KG2 A;  4JI6 F;  5U47 A;  4NLU A;  1P6T A;  1U1N A;  1HYS A;  1U0H A;  3BO4 A;  1GXU A;  3MEE B;  3BEG B;  3Q22 A;  5F8H A;  4LF8 J;  2HNY B;  2RQK A;  3D2W A;  1KTV A;  2MMY A;  3BGR B;  2RT3 A;  1FFS B;  1RAC B;  2N4D A;  2QYC A;  3C15 A;  4ECV A;  4WZM A;  2BBE A;  3PHT A;  2CPJ A;  5I42 A;  2X51 A;  1XR5 A;  2HNY A;  2W2P P;  2DRD A;  4KFB A;  4ED0 A;  4I6W A;  4R8U A;  2OD4 A;  2BJ3 A;  5CA5 A;  1U0H B;  1ZM9 A;  1YDL A;  2MKJ A;  4CLU A;  3G6E S;  1RT3 B;  2DYA A;  2C2M B;  3NS6 A;  1B64 A;  5EUH A;  4FVC A;  3TVZ A;  1X5S A;  4O3O A;  5KFQ A;  4ELT A;  1FVS A;  3W9H A;  4YDD B;  3AJD A;  4B3R J;  4CYU B;  2GQ2 A;  2XI3 A;  2YWK A;  3GWC A;  3GV8 B;  3R1L A;  1R8P A;  1F5B A;  2HMI A;  3KLI A;  1UVK A;  2JC1 A;  3Q8Q B;  1T9Y A;  2IAJ A;  1NEE A;  3ZTS A;  2R42 A;  4Z2X A;  1HBM B;  4MTP A;  1Z4U A;  3G8Q A;  3RB6 A;  5DDP C;  5ETV A;  1M5P C;  3H5S A;  1IKX A;  3CIZ A;  2LA6 A;  4EYI B;  2AP6 A;  1F3V A;  1VQP S;  1FNM A;  4A8Q A;  1ZM4 A;  1ULR A;  3ISN C;  4UZC A;  1MNE A;  3OVS A;  5C2G A;  4A8F A;  2MZS A;  4ZPT R;  1C0U B;  4ID5 B;  1QUP A;  4A48 A;  5C5J A;  4KT0 C;  4Y00 A;  3OTO F;  4DV6 F;  4LF5 J;  2C2N A;  4Y65 A;  2MGZ B;  4X4S A;  3QJP A;  5F9L A;  4QWB A;  3ILL A;  5T7L B;  4LF6 J;  1OY9 A;  2VV5 A;  3W8P A;  4G1Q A;  4LSL A;  4RW8 B;  5IWA J;  3FZ2 A;  3UD5 A;  3QNW B;  2C3P A;  4ED1 A;  6FDR A;  3M9N B;  3CCQ S;  2EWH A;  3ADA C;  1RQ0 A;  1DY3 A;  3OXF A;  1TAU A;  2XCA A;  3ZTR A;  2E7W A;  1S9G A;  4IG0 A;  4OYO A;  4BCA A;  2VF3 A;  4ES1 A;  5DQI A;  5GAD U;  2XSJ B;  4RPF A;  4DOZ A;  1VGY A;  1VQY A;  3PHE A;  3N6N A;  3HHL C;  3MTK A;  4X4Q A;  2IJR A;  4LSZ B;  2Q43 A;  2YTC A;  3JQJ A;  2NUU G;  3OTD A;  1RAG B;  2MY7 A;  1YSJ A;  3DLE B;  4WFX A;  2E9Z A;  2D41 A;  3OFH A;  1UET A;  2HK2 A;  2JNJ A;  1MG7 A;  3I96 A;  4C0B A;  5A6W A;  4OYM A;  3K57 A;  3CIM A;  4DSF A;  3HX9 A;  2DR5 A;  3BQ1 A;  2IA0 A;  2UUB J;  1S1T B;  2F8E X;  2GFF A;  1Q1K A;  4KAI A;  2V50 A;  3LQV A;  3W2W A;  4DCO B;  1G3O A;  3D54 A;  2XHW A;  3FDS A;  6AT1 B;  1X4F A;  2BMB A;  4BWJ A;  1HMV B;  2KM8 B;  5J2Q B;  2MKH A;  5J2M A;  4ED2 A;  1Y00 A;  5ETR A;  4ZPB A;  1Q4R A;  3Q8U A;  1DTQ A;  4CQ1 A;  4PUO B;  2B4V A;  5CH7 B;  5J1P A;  3D3B J;  2WSF C;  4O3R A;  1XR6 A;  2BEF A;  3BDP A;  1YVF A;  3MEC B;  1FTC A;  4YR3 A;  5F0U A;  1TUG B;  3NG8 A;  5I3U B;  3T41 A;  4J90 A;  1OSC A;  1KR4 A;  5GVQ A;  5C24 B;  1Q95 G;  1UWB A;  4M5J A;  3PW4 A;  1TL3 A;  1KQS R;  2OPR A;  5D78 A;  1VMB A;  1PO6 A;  3UDV A;  2KDO A;  2NSB A;  1Q8L A;  1NH7 A;  3R7S B;  1D8Y A;  3FC9 A;  4LF5 F;  2P5V A;  4PPD A;  2IVF B;  5D3G B;  1TL1 B;  3AXK A;  3M8Q A;  4YB1 P;  1S0N A;  1VK8 A;  4K4V A;  3IR7 B;  2ZJQ Q;  4KO0 B;  4TY9 A;  4YS2 A;  3JB9 k;  3EVM A;  3MEG B;  3SQG B;  1PAE X;  2YWW A;  3IR5 B;  4ZPV R;  2OGU A;  1I6J A;  4GKK J;  1JJ4 A;  4LR7 A;  1FRJ A;  3CCV S;  1LV5 A;  4BBY A;  2M7S A;  3C6T B;  1T11 A;  1X4D A;  4P75 A;  5GMD A;  4IOC Q;  4IUF A;  3DGP A;  5E3Q A;  3QO9 A;  4BHQ A;  4Z7Y A;  1WF2 A;  4YY3 F;  4LF7 F;  4KRW A;  3UR0 A;  2CZV C;  2BUN A;  2JZ5 A;  1M5O C;  2IYI A;  2CPF A;  3FUY A;  2EFO A;  3M8Y A;  2E66 A;  2HQD A;  1HR0 F;  2DIV A;  2UUW A;  2XY6 A;  2Q6C A;  2Z30 B;  3DU5 A;  4USU A;  1LEO A;  1KVI A;  2J0W A;  3VGS A;  4DPX A;  3HVT B;  1OY6 A;  1ZAW A;  4IDK A;  5K8N A;  1BXN A;  1U02 A;  3CJ0 A;  1AXQ A;  2OPQ B;  1S49 A;  4K4T A;  4KGV B;  2BX6 A;  1RAD B;  1UVM A;  4DPY A;  2Z2L A;  2DNQ A;  3B8H A;  3C66 A;  3MMB B;  4FNI A;  3M8R A;  1RAE B;  1RA7 A;  1NKC A;  1KS2 A;  3OFE A;  4LIW A;  3VHQ A;  3KLH B;  1N5S A;  1IBL J;  5KFB A;  1CJK A;  2AZ3 A;  3GON A;  4DHV A;  1CS4 A;  2E5J A;  2GJ2 A;  2IRU A;  2DGV A;  3POT A;  3PVX A;  3IG1 A;  3ET6 A;  3SXL A;  3RBD A;  1AZS B;  1HWJ A;  3EZU A;  4DI6 A;  4KBI A;  3RR7 A;  1MML A;  1M5H A;  3VAL A;  3TJA A;  1CJU A;  3IRX A;  3P8B B;  3K5P A;  3K59 A;  1RIS A;  2MQN A;  2CPY A;  1WG4 A;  2VG6 B;  1N54 B;  3RU0 A;  4DR5 J;  2E1P A;  3CED A;  5F8M A;  2AW0 A;  2D3Z A;  3DXS X;  2DH9 A;  1UJ4 A;  2ACY A;  2CAD A;  4ZVR B;  1KRP A;  1UVL A;  4UY8 5;  3L7U A;  5EWG A;  3TZX A;  3EGW B;  2O3D A;  4O44 B;  4U7U K;  1O0P A;  3VF0 B;  1LXJ A;  2BM1 A;  1N34 J;  2CJY B;  2FVC A;  3L7P A;  4N7T A;  2Y1R I;  3DC2 A;  5T41 A;  1VOM A;  1WC4 A;  1YGY A;  4B08 A;  3LP1 B;  2R7W A;  3G4S S;  2KT2 A;  3V81 A;  1IKY B;  1T02 A;  1VR6 A;  3DHW C;  1RCO B;  4ICL B;  1CC7 A;  3LPY A;  3TI0 A;  2W7O A;  3HFV A;  3FFI B;  3Q86 A;  1UJ6 A;  2HFO A;  2VDH A;  3IS9 B;  3QAU A;  1X8D A;  2VB6 A;  2MLZ A;  5HL7 Q;  1B0P A;  2K1R A;  3T1H F;  2QLX A;  4NMX A;  7FDR A;  2ADC A;  3GIM A;  2HW3 A;  3PO5 A;  4OQJ A;  4LRB A;  4EI2 A;  3G6X A;  2ASL A;  1KLM B;  1KD1 T;  3PR5 B;  1A9N B;  2V5H G;  2AZ1 A;  4JB8 B;  1TKD A;  4YP3 A;  2AYB A;  3KLG A;  1QM9 A;  2V4J A;  4ZPC A;  2RS2 A;  3K2Y A;  1KC8 T;  2HZV A;  2VA2 A;  4P10 A;  2YKQ A;  2XUL A;  3EDR B;  4OIX A;  4A8W A;  1BMQ B;  2BAN A;  1NLK L;  2IJN A;  3V6H A;  1BC6 A;  4PAA A;  1N5Q A;  3DLB A;  2NZ4 A;  4TY8 A;  4PPZ A;  3U1M A;  3AAW B;  2C2E A;  5ETS A;  3ZTP A;  3HZE A;  2I1R A;  1X60 A;  3NGR A;  3SCI E;  3DLH A;  2BRK A;  4LIR A;  4X66 J;  1Q81 T;  4ED3 A;  3QSY B;  3BO3 A;  2YX4 A;  5IV4 A;  4M5L A;  1PIE A;  4DPT A;  3EVO A;  5BJR A;  4UT4 A;  3RRK A;  3DYA B;  1DLO A;  4HHJ A;  4LBH A;  5T14 A;  2DPI A;  3AT1 B;  1SUQ B;  3KUH A;  3LP0 B;  3BS9 A;  1RT7 B;  3D4J A;  1JJH A;  2CPX A;  5BR8 F;  3QJL A;  2KTQ A;  4B3T F;  1HKA A;  1JLA A;  2XSJ A;  3CD6 S;  3TVY A;  4RBV A;  1NK0 A;  3RW6 A;  1VRU A;  3CDA A;  3GV7 B;  2KZM A;  1S9G B;  3CCZ A;  2RF2 A;  3HDS A;  4IG0 B;  4OYZ A;  3OTC A;  4YB7 A;  4JI1 J;  1JQG A;  2O01 C;  4C7Q A;  3OLA A;  4K4U A;  1RHU B;  4YB6 A;  2ZD1 B;  1LWF B;  3CB4 A;  2YWH A;  3R5G A;  3DRP B;  4DU8 A;  5GAE U;  3KK1 B;  1Q86 T;  4JV2 A;  4PG5 A;  2MB0 B;  3LH2 S;  2GA7 A;  4QIG A;  4NL5 A;  1RTJ B;  5D4P A;  1UP1 A;  4CCH A;  3JSM A;  2MPU A;  4MFB A;  2YPY A;  2VQF F;  5L1J A;  4WZQ A;  2XWX A;  2QT7 A;  1BLU A;  2B6A A;  4M1K A;  4CTA A;  2ASY A;  4N41 A;  5D8H B;  4Y34 A;  1EET A;  5HAN A;  5M2U A;  2IPO B;  3P5B P;  3D0G E;  3AH6 A;  3K8W A;  3MD3 A;  2LQJ A;  2R2S A;  3HJV A;  1N4L A;  2JX2 A;  1M1H A;  2W4C A;  5HJX A;  5DQG A;  3MMA B;  2PEH A;  3PFO A;  1XR7 A;  3OHA A;  4IQM A;  2M4M A;  2XGQ A;  5KFO A;  4EWT A;  4EU0 A;  2G0I A;  4J91 A;  1ZM3 A;  1MMD A;  2MY8 A;  2Z56 B;  1VQ4 S;  1HAR A;  2B9X A;  1Q79 A;  1S6P B;  2QGF B;  3JS9 A;  1RYR A;  3KHR A;  3BR8 A;  3Q8V A;  4Q44 A;  1HBN A;  2CAJ A;  3IBF B;  5ETO A;  2A1B A;  5IC6 B;  4OHW A;  3IC1 A;  1MU2 A;  3ZXW A;  4NRU A;  3LAN A;  2RUG A;  2D7S A;  2ZC3 A;  3W3S A;  3MR6 A;  4DV5 F;  1RHK B;  2D9O A;  2L48 A;  1T3O A;  1H7W A;  1TKX B;  2M5Y A;  3R5B A;  1YBT A;  1NKB A;  2EEY A;  1F60 B;  4ZVH A;  2PDA A;  1SC4 B;  4TLR A;  2IY5 B;  2G0J A;  4ICL A;  2HHS A;  4YHH F;  3T6B A;  3SFG A;  3PW0 A;  3MOZ A;  1S97 A;  3AFG A;  1TEL A;  3M4X A;  1FRK A;  3CUN A;  1WKK A;  1TV6 A;  1EQM A;  5C42 A;  3U1N A;  5DG8 A;  2EKN A;  3HXM A;  2UVR A;  2OD6 A;  3HF5 A;  3TZY A;  3LTO A;  2BR0 A;  2ZE2 B;  2A2C A;  4RW4 B;  1HFE L;  2HND B;  5AXL A;  2GO9 A;  2ILY A;  5AJ3 J;  3QZ8 A;  1FDN A;  5CQG A;  1U47 A;  3R5A A;  4UOG A;  1WOS A;  1RT5 B;  4DFK A;  1BWE A;  3MM8 A;  4A8Y A;  1S48 A;  1N6Q A;  1R27 B;  3GJT B;  2XSF A;  4C48 A;  3M8S A;  3EX7 B;  5IT0 A;  3MGJ A;  3IN5 A;  5IS2 A;  3BBF A;  3DRS B;  1JLB B;  1IJF B;  2P9C A;  2FHJ A;  1FD8 A;  3AY0 A;  3C8Y A;  3GYX B;  4ED8 A;  1NJZ A;  1N56 A;  1YI2 S;  2HEK A;  1S9F A;  2CJQ A;  3AA8 A;  3KHH A;  3CJ5 A;  3M6U A;  3NOC A;  4DS4 A;  2UVW A;  2VFV A;  4RNH A;  4B3T J;  1TMJ A;  3D1Q A;  1T7P A;  4E2F B;  2PFD A;  1KDN A;  2K06 A;  3SCL E;  2IVY A;  1HW9 A;  1VJW A;  2BE2 A;  4NCG B;  4N56 A;  4FPR A;  2A0F B;  1YJT A;  5KFY A;  1ZET A;  1Y0H A;  2IRX A;  2DR7 A;  4KB7 A;  3MMB A;  1PBA A;  2PO4 A;  4R25 A;  2KHD A;  3F56 A;  2ZKU A;  3HFZ B;  4H4O A;  2EG1 A;  5D0H A;  5DZ7 A;  4AXI A;  2XQC A;  1C1C A;  4LF9 F;  2Q6B A;  4OZ5 A;  5IV3 A;  3JSM B;  3BSA A;  1VQ5 S;  2HFN A;  2HHH J;  2GO8 A;  3TW0 A;  2YKM B;  3MUT P;  3TO8 A;  2P9G A;  3D6M B;  4B9L A;  4MKV A;  3PKM A;  3W8G A;  3W66 A;  2JEF A;  3K5N A;  4B9M A;  2IIH A;  4GKK F;  5LXY A;  3Q8Y A;  4EK2 A;  2ZH1 A;  3CJS A;  2VPY B;  4OX7 A;  2Z2M A;  3CJ3 A;  5K8P A;  1U6F A;  2ZHO A;  2L08 A;  3NMR A;  2YQ0 A;  2UUT A;  4H4K C;  2LP4 A;  2VOP A;  1FRX A;  1O8B A;  2CPZ A;  1PJ6 A;  1R0B G;  2LQ5 A;  2XYP B;  1TKT A;  3I55 S;  4A8S A;  3D6T B;  2VQE F;  3NBP A;  2H5I B;  3DFE A;  4MIB A;  4B9U A;  3P3D A;  2JRS A;  3LP0 A;  1WUU A;  1RT5 A;  3DKD A;  4K0K F;  2OAU A;  2IVM A;  1JX4 A;  2FZK B;  2UUC J;  4ZCL A;  3P6Y C;  4J9L A;  2UUA F;  3PRV A;  2ZE2 A;  4RW4 A;  4UW2 A;  3I6P A;  4AUK A;  1YIT S;  1L3T A;  5J2P B;  5D3G A;  2OEL A;  2O66 A;  3FCV A;  4ITS A;  5HMW A;  2XTJ P;  2P6T A;  2QEX S;  2QL9 B;  3DOL B;  3HHK A;  2HYI B;  3I5B A;  3QJJ A;  4MKY A;  4U7U D;  2MQQ A;  1ARO P;  2OUG A;  1TL3 B;  3HK2 A;  1NH8 A;  1UWA A;  2W7A A;  1IXK A;  4K5S A;  4ZP7 A;  4PAB A;  5F8L A;  4RW9 B;  2J7U A;  3GTY X;  1SQG A;  1EJ7 L;  3PZP A;  3P5T L;  4Y2A A;  4ZPD A;  1U8S A;  4WYW A;  3M1V A;  1GX5 A;  1XTZ A;  4F4W A;  1X9M A;  1YWX A;  1RYS A;  4LF4 J;  5EN1 A;  1AFJ A;  3FBB A;  1HMV A;  1U49 A;  1X9S A;  1YG0 A;  1V6H A;  3EIC A;  4KC5 A;  1NM2 A;  4B3S F;  3KJN B;  3CWJ A;  2RQC A;  2Y1J A;  3ENW A;  1VS3 A;  4OMF G;  3FGV A;  4I64 A;  4WWS A;  3OSN A;  1L3S A;  2WBR A;  3CJR A;  3CVK A;  3FEX B;  3H42 A;  2DNO A;  1UFL A;  2QFI A;  4RWW A;  5CHC B;  3V4M A;  3G8S A;  4WFA Q;  2KM8 C;  1P1L A;  1IBK F;  4N8O A;  3PRB A;  2DRB A;  4LJM A;  1YRU A;  1PIL A;  2I8E A;  1QSL A;  2H4Y B;  2B5J A;  5G4D A;  4OL8 A;  4PXC A;  3FVY A;  2ABY A;  2C42 A;  4I67 A;  4F0K A;  2HSE B;  4DV0 J;  1QTM A;  4WTO B;  2XLI A;  3G86 A;  3PW2 A;  2BOA A;  3KFW X;  5F41 A;  1J5E F;  2FHO B;  1AFI A;  4ANE A;  1Z2Z A;  5E3C A;  2V4R A;  2KXF A;  1SKS A;  3L4B C;  3HMJ G;  1K9M T;  1TK0 A;  3CT9 A;  5HAO A;  3KK3 B;  2YWG A;  5KG3 A;  1RTZ A;  1NDC A;  3DLG A;  3HHD A;  2FVS A;  1O5J A;  1WF1 A;  1NPP A;  5KFN A;  2FDN A;  4FYY B;  4A47 A;  5G0R A;  4YQW A;  4RW8 A;  2NZC A;  4DQQ A;  1JIH A;  1S10 A;  1EAR A;  1LWC B;  3FCH A;  2DH7 A;  3HT0 A;  4DMZ A;  3OFF A;  2W25 A;  3BGF A;  2Y1I A;  3CMA S;  1QSS A;  4DL5 A;  3R2D J;  2V0N A;  2PC6 A;  1F9F A;  1RT7 A;  4P72 A;  1U1P A;  1FNX H;  2RD5 C;  3TEH B;  4YN3 B;  4DZ6 A;  1FNO A;  3TVK A;  3GU0 A;  3MR7 A;  1ELO A;  2BE7 D;  1S7I A;  3HD2 A;  2RB7 A;  4NEY A;  2MDA A;  4PXB A;  4R5P B;  3CC4 S;  4OZN A;  3EM1 A;  2L41 A;  2RIL A;  3UQS A;  1K47 A;  4DS5 A;  2KYZ A;  4Y2K A;  1HHS A;  2DHA A;  3SEO A;  1LKZ A;  1VBX A;  1HBM A;  4FS1 A;  2B4P A;  2R8H A;  4ZHR B;  5GMK a;  2XMA A;  1SKU B;  2DY1 A;  1HNV B;  2VUG A;  2XYH B;  2GX8 A;  3HVT A;  4HHU A;  4V19 J;  1FEH A;  2HMI B;  1LWX A;  1EB0 A;  5LJ5 Y;  4IRK A;  1JK9 B;  4RU2 A;  1IKW B;  1WC6 A;  1N6Q B;  2FYX A;  4DN0 A;  3OLB A;  1ZPW X;  2VAS A;  3QFH A;  5FII A;  2DHH A;  2HWT A;  2LLZ A;  3BGL A;  3AD7 C;  2DXE A;  2HBQ B;  3MM7 B;  4EO6 A;  3MAQ A;  1E6V A;  2DNH A;  2EG2 A;  5DRK A;  2DB1 A;  3U27 A;  4RUH A;  1KTQ A;  1PCA A;  1RT1 A;  3BR9 A;  5A0Y B;  5B08 A;  5HN0 A;  3K5M A;  3W60 A;  2O5D A;  5RUB A;  4IFY A;  4A8O A;  4M5H A;  5C25 A;  1S7H A;  5JJB A;  1K1S A;  1M5K C;  3OTB A;  3R9L A;  2ZH3 A;  2AJQ A;  2NXN A;  4IOA Q;  2C2O B;  3VVT A;  1TL1 A;  3M8Q B;  3LWL A;  3E51 A;  3H5U A;  4DR1 J;  2VL1 A;  3FEZ A;  4P2F A;  3MI7 X;  4PYD A;  2JEJ A;  3GCW P;  4DR6 F;  4O4G A;  1HD0 A;  2KYX A;  5B09 A;  5HVH A;  5HLF B;  5JVG Q;  5C25 B;  2CYY A;  5HI7 A;  2FVR A;  4DU7 A;  5KOX A;  4ERD A;  2HHP A;  2FZG B;  2CG4 A;  2SXL A;  2YWF A;  2QA2 A;  3ZZY A;  1T3N A;  1C4A A;  2PEB A;  3BSO A;  4C3L A;  4CI0 B;  1T9W A;  4KHP J;  1CG2 A;  2CNO B;  4DN9 A;  1QAJ A;  4NXN J;  3OD2 A;  1AUD A;  1TR0 A;  3RTV A;  2A18 A;  4RZR A;  4C3M A;  2I9S A;  2CQB A;  2WB4 A;  4P2X A;  3MXH P;  1RWM B;  5B0G A;  3PW5 A;  4QYZ K;  4WU2 A;  2HHV A;  2W2N P;  2AQ4 A;  2D9P A;  2OFG X;  3LPE A;  1O6X A;  2HLU A;  4YR2 A;  3NP5 A;  1WJ9 A;  2LKZ A;  3E01 B;  4ZIV A;  3M9O B;  1MSW D;  4ETZ A;  3BM7 A;  4OYX A;  4OX6 A;  1S1X B;  5FDL A;  1TL7 B;  1CJK B;  4BWM A;  3ZNJ 1;  5KG7 A;  3EMT A;  2VZ9 A;  2ZKT A;  3KHL A;  2LEB A;  2AX0 A;  3UCU P;  4LT6 A;  2KZZ A;  3BSN A;  1KVJ A;  2W2O P;  1Q5V A;  1ZAX A;  4KY3 A;  4DR5 F;  2CQ2 A;  3LAK A;  1RBL A;  1WKL A;  3IM8 A;  4NOH A;  3C46 A;  3ZZZ A;  2GV1 A;  1RI7 A;  3FQK A;  1H6K X;  3OT9 A;  4I2Q B;  4DQP A;  2R7Q A;  4JI3 J;  1U1Q A;  2OP5 A;  4HDH A;  1Q8B A;  4IDK B;  2VKZ G;  2V2V A;  3CDE A;  4ECQ A;  5AT1 B;  3WIU A;  5L9N A;  1FKP A;  1VRT A;  4LR8 A;  5BYR A;  4DXL A;  4OX9 J;  2PE8 A;  2J5A A;  4CO3 A;  1Y9O A;  2GQC A;  2RKI B;  3VGU A;  3W9J A;  3CJ2 A;  3T1Y F;  2A10 A;  1KQK A;  3FJ2 A;  2W9C A;  3TR5 A;  3M8P A;  2CWK A;  3MM8 B;  2PI5 A;  1CLF A;  3K0J A;  3CD5 A;  4NA2 A;  4C9D A;  5KOW A;  2MKC A;  4CLW A;  4TU8 A;  1CQN A;  1EKS A;  3FQL A;  3LW5 C;  1JLE A;  4O3S A;  2UXD J;  2LVW A;  1UJ5 A;  4I56 A;  2ACM A;  2C22 A;  4OZ3 A;  1NK5 A;  3KKF A;  1S4E A;  1FKO A;  1GTH A;  5BYS A;  3W61 A;  1JLF B;  1YJ7 A;  1D3W A;  3A8I A;  3UI3 A;  2ASD A;  4M95 A;  4D3H A;  4ZMM A;  3ZTQ A;  2A3J A;  4J9M A;  2WOM A;  4X4U A;  5E3R A;  2AU0 A;  2Z57 B;  1FF2 A;  5CCM A;  3DHX A;  4OLO A;  2ZOM A;  4QIF A;  5HSP A;  1T03 A;  5A8W B;  2B9W A;  2V94 A;  3KDN A;  3BPD A;  3O3L A;  3R1H A;  3O2I A;  4PCQ A;  5C24 A;  3IAS 9;  4N8N A;  3QMQ A;  5DLF A;  1HQE A;  4I0W A;  3KLG B;  2C28 A;  2CPI A;  1W26 A;  2HWH A;  2EFN A;  4NZ7 A;  1MWY A;  1WDT A;  3FBE A;  3I32 A;  3R8Y A;  3D9B A;  2F40 A;  1NO8 A;  1FJE B;  2MLY A;  2K1R B;  4E0D A;  2DXF A;  1AT1 B;  5KFA A;  3IS9 A;  3NLC A;  2ZBQ A;  3W2W B;  1FRM A;  3B4D A;  3BYP A;  3RRG A;  1NJX A;  3HUL A;  3MUV P;  4WJB A;  4NCB A;  1JLF A;  3ILI A;  2GAH C;  4AL7 A;  2CRL A;  4JV5 F;  1PC4 A;  1WI8 A;  1Z2L A;  3UVJ B;  4U6P A;  4EO8 A;  4LVO P;  3KWM A;  4X4P A;  4PG8 A;  4IO9 Q;  2RDD A;  5KT6 A;  3CO9 A;  4DQI A;  1HHQ A;  3R27 A;  1JJ2 R;  3UR3 C;  2I2Y A;  4UOH A;  5J2P A;  1E6Y B;  2YNH B;  1VLO A;  2QRR A;  1F9H A;  3PX0 A;  1KEK A;  2VPX B;  2AX1 A;  3FMB A;  3TA2 A;  3K17 A;  3WZ0 A;  3VAI A;  2RJZ A;  4DPO A;  1R7I A;  2Q1L A;  4XPE A;  4FKY A;  1R0A B;  2HRY A;  4B3S J;  3MMC B;  3SI8 A;  2P2C B;  2JC0 A;  3L7O A;  4LF4 F;  1VJQ A;  3DRX A;  2HVZ A;  3CF5 Q;  1RAO A;  3ENV A;  4K2J A;  2QMU B;  1RWP B;  1DTT A;  1UFW A;  3ELH A;  4NLO A;  2PI4 A;  4PZV A;  4NML A;  4YFU A;  1MW7 A;  1PAU B;  2YVS A;  4LSN B;  2W2Q P;  3WHI A;  4XPC A;  2H48 B;  2PII A;  2ZIT A;  4DR2 J;  4JI4 F;  2CPE A;  3MCO A;  5KG4 A;  4KGM A;  2ZHA A;  1RT4 B;  2HQ3 A;  2Z2Z A;  5HP1 A;  4KR0 B;  1U1O A;  3SQO P;  3ZZP A;  1GXL A;  2LYV A;  4Q5V A;  5C2C A;  1KKH A;  1WEZ A;  2YKO A;  3M05 A;  2DCU B;  2IMO A;  5GAE I;  2KG0 A;  1SC3 B;  4HAC B;  2VG5 A;  1GFW B;  4OFZ A;  2D74 B;  1IKV B;  3GIL A;  2V69 A;  2ILZ A;  4LF8 F;  4IH6 A;  2X1F A;  1RAB B;  2OPQ A;  2EK6 A;  3HVR A;  1QTN B;  3BYR A;  4PXD A;  1WG1 A;  2JHE A;  2KN4 A;  3LA0 A;  3S7R A;  4ATN A;  3CCS S;  1PJ7 A;  2J76 E;  2JLF A;  3IM9 A;  4TY8 B;  5GAH U;  1YIJ S;  2MSS A;  4Y28 C;  1WOR A;  2YKP A;  3QYY A;  1GMV A;  4OJ1 A;  2NYI A;  4P9S A;  1G2E A;  2IA6 A;  4DR6 J;  1S57 A;  2APO A;  1IUJ A;  2CIM A;  2ROG A;  3HPO A;  4DQR A;  4G1I A;  4NLQ A;  4DV5 J;  4DWI A;  4JV1 A;  3JYT A;  4UQG A;  1XN9 A;  2N4C A;  3TYT A;  3UCG A;  3HZG A;  4LMZ A;  3NS7 B;  2RHS B;  2QSW A;  2M52 A;  1V3Z A;  2F65 A;  4HHH A;  2E5G A;  3HI9 A;  3NRB A;  5MLC V;  2BDP A;  4DV1 F;  3A8J A;  5D77 A;  3SCJ E;  4FBT A;  2F4V F;  1UFK A;  1U09 A;  1S6Q B;  1V5V A;  3BBC A;  5ADZ A;  3H90 A;  2G9O A;  1N32 J;  4FN5 A;  2GJF A;  4HI2 A;  3ZFV A;  4CZC A;  2WTF A;  1E6Y A;  3RJM B;  1IBL F;  4G3I A;  1NK9 A;  4JYA J;  2C1E B;  1ROF A;  1HPZ A;  2YXL A;  5C42 B;  4ECY A;  1N0U A;  3HHL A;  5I42 B;  2VPW B;  1N36 F;  3I9Z A;  1R0C B;  2XO6 A;  3OL6 A;  1XBW A;  3CTR A;  2J9E A;  3K8V A;  3V81 B;  5E2Q A;  4FXD A;  2V34 A;  4X84 A;  2EFG A;  4UST A;  3X3U A;  2HKE A;  5A0Y A;  1TFW A;  3NCQ A;  1QSY A;  2G0C A;  3MZI A;  4ZVQ B;  2FJE B;  1FWP A;  3HVA A;  2R2R A;  1TKX A;  1U1R A;  3CCL S;  2WW8 A;  1Y10 A;  1RTH A;  2YNI B;  3IMQ J;  1HNI A;  4PG4 A;  2ROE A;  1DTQ B;  2KHC A;  2HPU A;  2MHE A;  3B82 A;  1W2I A;  3DOM B;  1LQ9 A;  2VU5 A;  1L3K A;  4LF2 A;  5KFC A;  5D15 A;  1CJU B;  3IRX B;  2QX0 A;  1H74 A;  3OQ2 A;  1SQE A;  4C8M A;  3M6W A;  4RW6 B;  2J6T A;  1NB2 A;  4GKJ F;  3HSG A;  1YBU A;  2CQH A;  5ITH A;  5CZV A;  2VQF J;  3I0R A;  1YRT A;  4RW7 B;  1N52 B;  1M1K T;  2POK A;  3BN7 A;  4I69 A;  3MMA A;  3KUE A;  3W5Y A;  2OHD A;  2UV8 G;  3A13 A;  4F7V A;  2AT1 B;  4AXJ A;  3GPA A;  2HHQ A;  5EX0 A;  2WOM B;  2ZOG A;  1SIW B;  3VZH A;  3QAE A;  2C2R A;  2PN6 A;  2HRT A;  4F0M A;  1CPZ A;  3NS5 A;  2B6A B;  1R31 A;  4CTA B;  1FK9 A;  4K4W A;  2F4V J;  3N5F A;  5ETM A;  4C11 B;  1V9O A;  3J7Y U;  1Y3J A;  1RJJ A;  2IHR 1;  4KHR A;  2HBZ B;  5A8R A;  3TAR A;  2W4D A;  1JLC A;  3NL0 A;  1LWE B;  3ZZ0 A;  2J6U A;  4G6V B;  3W63 A;  4DV1 J;  3QZ7 A;  4KGZ B;  3DDK A;  2W9C B;  4ILL A;  2V8D A;  2CQ0 A;  1KHV A;  4B3O A;  3DLG B;  4QW8 A;  3IR6 B;  2RKI A;  3QPI A;  2QLJ B;  5I3Q A;  1H2U X;  1U2R A;  2RHQ B;  3TJ9 A;  4DG1 B;  4CLT A;  3EPG A;  1LWE A;  2LMI A;  3BH6 B;  2V2K A;  1ZOT A;  1RWW B;  2ZBR A;  5LM7 E;  4XO0 A;  4I2Q A;  1S0M A;  2C3M A;  6FD1 A;  5HMX A;  1F9E B;  3IWN C;  1WHY A;  4FYX B;  4G65 A;  2CZ9 A;  1HWI A;  3JTN A;  2MJN A;  5DO2 A;  4X64 J;  1Y5L B;  2RU9 A;  4CWB A;  2KI2 A;  1VHF A;  2XY7 A;  2JLE A;  4QWE A;  1AUS L;  5AE3 A;  4DL4 A;  4JI6 J;  2AWZ A;  1FX4 A;  3E01 A;  3TAQ A;  1ZAV A;  2NYH A;  5KT5 A;  2E7X A;  1BE4 A;  2XO7 A;  3H7H B;  2N82 B;  3OR1 B;  4RW6 A;  3KLI B;  9RUB A;  1XNR F;  1LOU A;  1RXO B;  1KQG B;  3MEC A;  2XMM A;  1RHR B;  1GEH A;  1QDU B;  1VLY A;  3WDO A;  4C6A A;  2U1A A;  2W9A A;  3V6D B;  2L9D A;  3OFG A;  2XYG B;  3M1V B;  4RR5 A;  3T1A A;  1NB7 A;  3MPV A;  4J9V A;  4OYB A;  4UOC A;  5KT4 A;  2FY1 A;  3FNN A;  5AJ3 F;  2D3U A;  1VQ7 S;  4CLZ A;  4TLQ A;  1S72 S;  2DNP A;  3RBZ A;  1IM4 A;  1C0T A;  2JL9 A;  2FJD B;  2R3V A;  2YX1 A;  3H5X A;  2JJ4 D;  8AT1 B;  3T5H A;  5L38 A;  2V8G A;  4C8Y A;  5DQH A;  3MM6 A;  3KK2 A;  3N6L A;  2XZD B;  4JI2 J;  3ENA A;  4ZS6 A;  1R43 A;  2PMH A;  4F2S A;  1LW2 B;  3C6U B;  4MAK A;  1S5Z A;  4DV4 J;  4PQU A;  2FLP A;  5KFW A;  2M88 A;  4IO1 A;  3JTP A;  3LP2 B;  3GJS B;  4IH5 A;  4D3G A;  2B4O A;  1KNZ A;  3KG0 A;  3DMJ A;  2AJ4 A;  3MR2 A;  2HAI A;  1X9W A;  4ZLP A;  2V63 A;  2R7R A;  1RB0 A;  3JSB A;  3VR1 A;  1WEX A;  2VFT A;  3NBP B;  2RH3 A;  5J2N B;  4NRT A;  2YNF A;  3B78 A;  3VV2 B;  3SDE A;  3IBC B;  3CGI A;  3S6E A;  4X4R A;  2J8A A;  4KTQ A;  1S1V B;  4WU3 A;  1S77 D;  3IXQ A;  3KJF B;  4OJH A;  1OQ3 A;  1SC1 B;  4JV0 A;  2ZHB A;  4DSL A;  2FLO A;  4L73 A;  4UY8 T;  3DLK B;  2ZFH A;  3FZB A;  1NCL A;  1QY7 A;  1WOO A;  3QGH A;  4QBU A;  5BXI A;  4U8Y A;  4O0N A;  2MKI A;  2KH9 A;  1J5O B;  1FXL A;  3WX8 A;  5T7L A;  1KOO A;  3KLF A;  3PRD A;  4FF1 A;  4CLY A;  4WF9 Q;  1UW9 A;  1G6B A;  3AB4 B;  2MZR A;  3CE8 A;  1S59 A;  2WRM A;  4L72 B;  3CJK B;  4WCE Q;  3Q8R B;  2Q79 A;  2WVB A;  1IR2 A;  4M5D A;  5DJB A;  4ZLL A;  1SH0 A;  4DLG A;  3VQS A;  3H98 A;  2GGP B;  4U96 A;  4M5N A;  2FHJ D;  2ZZM A;  1KBR A;  5A2Q U;  2FHM A;  1S0O A;  2FIU A;  4A8M P;  2GZO A;  5AXK A;  4M5K A;  2H5E A;  4EMD A;  3OW2 R;  5FD1 A;  2BE9 B;  4I7F B;  4KH1 B;  4Q8F A;  3TP2 A;  4CO1 A;  4EZ6 A;  1QVG R;  3VZI A;  1CJT B;  4UZB A;  1HQU A;  3THT A;  1OIA A;  2DHX A;  2MQL A;  4CT8 A;  2NQP A;  1DTT B;  3MDF A;  2RQM A;  2FD2 A;  3CMQ A;  4IOB A;  3UO0 A;  1F2G A;  1KP6 A;  2CJX B;  4USW A;  1KLN A;  2E9R X;  2DO0 A;  1BQM B;  3UFC X;  5L1L A;  1OJ4 A;  2HQI A;  5KFF A;  1REV A;  4KV8 B;  2XC9 A;  4B3R F;  2ZDP A;  2HZA A;  3DGP B;  4ZLJ A;  3HCX A;  1NXI A;  4GVB A;  1FXR A;  3D68 A;  4MYU A;  1XC9 A;  4ZP8 A;  2WVD A;  2LXI A;  1D1U A;  5L8R C;  3SZ2 A;  5J2N A;  2OPS A;  5HBM A;  1NZA A;  4USI A;  2VBZ A;  5K20 B;  4IYQ A;  2MKY A;  1S1U B;  2BAB A;  3BGR A;  3C15 B;  2RNE A;  4KO0 A;  4C98 A;  1W2B R;  1JXL A;  2DNG A;  3SV3 A;  1NJW A;  4B17 A;  3WQP A;  3VAF A;  1HYS B;  2DNK A;  3GE9 A;  2CNN B;  2LQ8 A;  3RR8 A;  2VIC A;  4QU7 A;  3PDN A;  3Q83 A;  2MQM A;  4JI8 J;  1I3O B;  3NWG A;  1BWV A;  3MWB A;  4ILM A;  3KG4 A;  5E41 A;  2AYG A;  3C14 B;  2MLX A;  4QWD A;  2IMW P;  4LFC F;  3ICL A;  1QVF R;  2HVI A;  4KHP F;  2AF6 A;  2KJW A;  3RRH A;  1RA6 A;  2BA9 A;  2QJ3 A;  3QRR A;  1HQE B;  2YH0 A;  1GMU A;  1C4C A;  2XG8 A;  4L6V 3;  2HHU A;  1JB0 C;  1N33 J;  2CKW A;  4USV A;  3CCJ S;  4QYZ J;  1CJV B;  1Y5N B;  2GML A;  2OEM A;  4TXS A;  3KMS A;  1SV5 A;  3Q2S C;  2CJA A;  5IFM A;  2V68 A;  1NHK L;  3Q89 A;  4B3M J;  3R5J B;  4UTG A;  4C8Z A;  1UPP A;  4LRE A;  4DSI A;  1Y5I B;  4YUD A;  2LFV A;  4KSE B;  2R4F A;  2G2Y A;  2H51 B;  1F1B B;  5AE1 A;  3HD1 A;  5LMN J;  3HHL B;  5A76 A;  3NMA A;  3CJT A;  1RTJ A;  2R8I A;  3RB0 A;  4ELU A;  3QGG A;  3KHG A;  4YHH J;  4P71 A;  2IBK A;  1DAX A;  3UN2 A;  1RWO B;  2QA4 G;  2B51 A;  3NAH A;  4IFV A;  5L9X A;  4QIW D;  3MPW A;  4QYR A;  2LXU A;  4ECW A;  1NK4 A;  1N36 J;  4F02 A;  1AYE A;  5DET A;  1AA1 B;  3MAA A;  3J81 U;  4YME A;  4F25 A;  3B54 A;  2XGP A;  2RF2 B;  4PRF A;  3MED B;  2J9D E;  3OUY B;  1X31 C;  2J0X A;  2KO1 A;  4J9R A;  4DR4 J;  1FI4 A;  2Z58 B;  1HQU B;  1O51 A;  2VC1 A;  4BC7 A;  1NK6 A;  1JXE A;  1S1W A;  4FZV A;  2F9D A;  3PYG A;  4HEA 9;  2VJV A;  1Q7L B;  3WIV A;  1HL6 A;  5KFZ A;  3OVB A;  4DR4 F;  3D6H B;  1ZTW A;  2DBB A;  1UZH A;  2RIJ A;  3BB5 A;  4L75 A;  4EBD A;  2DGQ A;  5B0C A;  1YTY A;  5IXU A;  1MRO A;  4H4K A;  2NR0 A;  1Y11 A;  3FKB A;  4AND A;  2XNR A;  3EXY A;  1TVR B;  4RUA A;  2V8V A;  3W1Y C;  3SIP B;  1YZ7 A;  2VBY A;  3GFY A;  4ID5 A;  3K89 A;  4MK7 A;  2VHG A;  1RWU A;  4F4X A;  4H4O B;  5B0E A;  4MIW A;  3MHY A;  3LGM A;  3N28 A;  4IG3 A;  3SFU A;  4DX5 A;  4OI4 A;  3DDI A;  4WXW A;  2HWI A;  4CM2 A;  1QD1 A;  4NXM F;  4AFF A;  2V6A A;  2RRB A;  3ITH B;  4ZVU B;  1X4E A;  1SI9 A;  2OEK A;  2F7V A;  3IGN A;  2OMO A;  4C8K A;  3C3L A;  2GIQ A;  3EGV A;  4W4M A;  4B3M F;  2Z4P A;  1M1G A;  1Y4Z B;  2LQB A;  4JI8 F;  5DS7 A;  2Y3Y A;  3CJ8 A;  5GAG U;  2R7V A;  2I5J B;  2ZVI A;  1UEV A;  1U45 A;  4JI5 J;  3DRS A;  3N5B A;  1QJH A;  4NEZ A;  3A3O B;  5KG6 A;  4DUZ F;  2ZNZ A;  4EEY A;  1IWG A;  4X65 F;  4J9Q A;  4ANC A;  5KFJ A;  3GIJ A;  2KT3 A;  4F04 B;  3DMJ B;  3LAM A;  2PA8 D;  3N6M A;  4R0J A;  4RBU A;  2VH7 A;  3JAM U;  4R8U B;  4O4R A;  1M5V C;  5SZT A;  4KE5 A;  3TUP A;  4F50 A;  1S99 A;  3SMZ A;  4DJB A;  4AYB D;  2JH3 A;  4WE1 A;  4H54 A;  4TN2 A;  2B9E A;  3UVJ A;  1GK8 A;  4IFY B;  5FLX Y;  2DGO A;  1IN0 A;  2RRN A;  1RAF B;  2OH2 A;  1SB6 A;  1RT1 B;  3L3C A;  2BJ7 A;  4MIA A;  1UVI A;  1FJG J;  1E6V B;  2MQ8 A;  2E1R A;  4CNZ A;  3IP0 A;  3K58 A;  1YQH A;  2XZT B;  3NOG A;  4RBT A;  2EFP A;  2EW9 A;  2YNG A;  1NDP A;  2B8Q A;  3OHB A;  4J9K A;  3W9I A;  2OO4 A;  2BQR A;  1MU2 B;  1YLX A;  1I94 F;  2FVP A;  1I51 B;  4I6A A;  3RG6 A;  5M2R A;  4U7C A;  1B3T A;  5IC4 B;  3ILO A;  1HIY A;  3BO2 A;  5L1I A;  1CBK A;  4NLT A;  4WP8 A;  4E98 A;  3PIO Q;  5KFT A;  5IZH A;  1IM6 A;  3TUJ C;  3D7S B;  4ZVT B;  2R8K A;  3GSI A;  4TYB A;  1TL4 A;  4JI2 F;  5HAT A;  3Q24 A;  5SUH A;  3KJV A;  5KT3 A;  4QR0 A;  4LFA F;  3V4I B;  2KFN A;  3Q8P B;  5CZX A;  4LRA A;  1RE1 B;  4P7V A;  4XAK A;  4QIV A;  4U8V A;  2QL7 B;  4ZCM A;  1DQ9 A;  2DGT A;  3M6V A;  4A4J A;  4M5M A;  5THW A;  3HKZ D;  3HSD A;  4MK8 A;  5F8G A;  2RU3 A;  3H20 A;  4ZVO B;  4RNF A;  3BV8 A;  4NLW A;  3T9Z A;  3J7A 1;  4I6Y A;  3NNH A;  1C2P A;  4FKX A;  3GG0 A;  3ETM A;  1RKJ A;  1IQZ A;  3L09 A;  3BBB A;  3QBC A;  2G4B A;  3M7V A;  2ZH9 A;  1P8G A;  3PCO B;  1ZH5 A;  1HR0 J;  5H9E K;  2JOQ A;  2QLW A;  1NSK L;  1FCA A;  1PSD A;  1RLD A;  3D5M A;  1BQN B;  1H98 A;  1RT2 A;  3JQK A;  3MCS A;  3TUI C;  1WSV A;  2QZ8 A;  1VHI A;  2RRA A;  5E5N A;  5AE2 A;  1VQK S;  3UPF A;  4B9V A;  4X2B A;  3M2V B;  4DSK A;  3UN5 A;  1SJ4 P;  3FCW A;  4ED6 A;  3J7A N;  2BXJ A;  2E29 A;  3CCT A;  1F5C A;  4JYA F;  5CYQ B;  2YX7 A;  2DRA A;  1JLA B;  1OPZ A;  2MEW A;  5JXS A;  4WFY A;  5B0D A;  2GHV C;  4X62 F;  2H1Y A;  4C97 A;  2CQD A;  1GT8 A;  3ONQ A;  3QFW A;  2MXY A;  2XMK A;  2NPF A;  5H1S V;  2FLL A;  2R8J A;  1HBO B;  3THV A;  4K4Z A;  2ZWP A;  1DLO B;  1SPB P;  2BW2 A;  3DYA A;  3J81 j;  4ECR A;  5HRO B;  4O3N A;  2L9N A;  4DV2 J;  2OFH X;  1U1M A;  2RUS A;  3I4H X;  2VG7 A;  4DL7 A;  5AXM A;  4G1P A;  1ZPV A;  3MM6 B;  3MR3 A;  3F0N A;  3KK2 B;  1UWB B;  3KYL A;  2J0Q D;  3GYN A;  5CYM A;  2DIU A;  2N7Y A;  4OYI A;  1S12 A;  1N5T A;  1UPM B;  3A3N B;  1B70 B;  3L9Z A;  5LSR A;  1BUX A;  2UU9 J;  1VBK A;  4J37 A;  4P73 A;  5J1E B;  1YJ9 S;  1R8A A;  2L3M A;  3MF5 A;  2NRE A;  1HI0 P;  1MN9 A;  4JI0 F;  3NGS A;  5LMU F;  2CQ4 A;  1N5Y B;  1HNI B;  1RTH B;  2FC8 A;  1CJV A;  2YNI A;  3V6D A;  1YRX A;  4TQS A;  2OSR A;  3MM9 B;  2DY9 A;  1LW0 A;  5LXR A;  5H9F K;  1WTB A;  2V8H A;  4CLF A;  3FK4 A;  4GC6 A;  1SJ3 P;  2ALY B;  4ZVG A;  1N32 F;  1D09 B;  2CQ1 A;  2BJ8 A;  3C14 A;  4EZ9 A;  3G9C A;  1XWL A;  4F26 A;  2ATC B;  2JSX A;  5A8W A;  5F8J A;  1SH2 A;  2WSC C;  3AQP A;  2BW7 A;  3DOL A;  3E8O A;  2AIR B;  4P7T A;  4USM A;  4P6Q A;  4ZDN A;  3PIP Q;  4URS A;  5CCL A;  5LOQ A;  2KKH A;  1LFW A;  1URR A;  2UV8 A;  3FFI A;  2VIH A;  2UUA J;  3MFI A;  1X5P A;  4NLD A;  5IM0 A;  1Q78 A;  2FY8 A;  3I87 A;  1U2C A;  3NGD A;  4LFC J;  3TOQ A;  3M6X A;  1MN7 A;  1U8W A;  4I1T A;  4DFP A;  3DRR A;  2Y1L B;  2ERR A;  1S6Q A;  2QV6 A;  2YKN B;  4NAS A;  5LL6 d;  5HBM B;  5I4M A;  5LJ3 Y;  4K4Y A;  1RTD B;  3J7Z 5;  4F4K A;  4A8K A;  2GAG C;  4XDD A;  3TQ1 A;  2HBR B;  1J2V A;  2DKO B;  2VFS A;  5KT7 A;  4GMK A;  1VBZ A;  5CYQ A;  5DZ6 A;  3EWG A;  5I3P A;  5CAA A;  1R8C A;  2E1M C;  3VGT A;  3EDQ B;  3HLU A;  1H7X A;  2GQQ A;  2CUY A;  2XBP A;  4ETX A;  3OJU A;  4ECU A;  1KSP A;  4B3O B;  4H4M B;  2YH1 A;  1FFG B;  3HM9 A;  1TQL A;  4X4O A;  2OIH A;  2B7B B;  1X4B A;  1HLW A;  1BY9 A;  2M70 A;  3FBF A;  3TA1 A;  2HVH A;  3RYL A;  3HHE A;  2ZUA A;  4FDF A;  4WKY A;  1FEE A;  1CJT A;  2W9B A;  4DQS A;  3X1L B;  3DM2 A;  4C8L A;  3SSQ A;  1FVQ A;  3TX0 A;  3G87 A;  2UUB F;  3PFE A;  1CS4 B;  1CC8 A;  1NDK A;  1RGV A;  3VQT A;  2FTR A;  4ZLN A;  3M30 A;  4ES2 A;  4F4Z A;  1ZZN A;  2KXH A;  4NLY A;  4DCP B;  4E8U A;  5EGY A;  5KG5 A;  4FPI A;  2CNK B;  3M30 B;  2G2Z A;  5DM6 Q;  4RNO A;  2VBX A;  3V4I A;  3K7R A;  4DL6 A;  1X0F A;  3KJV B;  3KJQ B;  1MWQ A;  1WWH A;  2FJW A;  4FNH A;  1S76 D;  2RSQ A;  3RAQ A;  1G1X A;  2IAJ B;  2UP1 A;  3NNA A;  2E7V A;  1SQF A;  3KLF B;  2KG1 A;  3CCR S;  3UDC A;  2N7C A;  1J5O A;  4IR1 A;  4CYU A;  1XK8 A;  1IQT A;  3BQ2 A;  3DOM A;  3DLK A;  1VIX A;  1LXN A;  1HD1 A;  1N48 A;  1HHT P;  5KFX A;  1FT8 A;  1X5O A;  2WW4 A;  2GC8 A;  2CJ9 A;  2UXD F;  1NPR A;  2D69 A;  4LQ9 A;  1D9F A;  1TKZ B;  2FUG 9;  1EX8 A;  1Q0N A;  1RU1 A;  3BSC A;  3JAM Y;  2XNQ A;  2YNH A;  2R2T A;  2ADB A;  4ZIW A;  2BOP A;  4K8R A;  3OV7 A;  2HHT A;  4DR1 F;  2Y9H A;  4ZK7 M;  4FP9 A;  3KLE A;  3CJ4 A;  3QLH B;  3T1Y J;  1SL1 A;  1F6T A;  4O4G B;  4ID8 A;  5HLF A;  4NLP A;  2GMJ A;  4RKU C;  3GSD A;  1SIZ A;  1F2H A;  3TAM A;  2CWX A;  4USH A;  5IWA F;  3DI6 A;  2MJU A;  1IBM F;  2N3L A;  1S4F A;  3FSY A;  2ZH4 A;  2ZDO A;  4LBI A;  2XI2 A;  5FJ4 A;  2KVI A;  3QQC D;  4BS2 A;  3BGO P;  3US5 A;  1RAA B;  1NHV A;  1TU0 B;  2W2M P;  2CJB A;  5IOL A;  5KFD A;  2G1H A;  3ZZU A;  3OL7 A;  3GIK A;  4NLX A;  1U4B A;  1LW0 B;  2VJU A;  1HWK A;  2AJ1 A;  4FXW A;  3IWL A;  2ZH7 A;  1HW8 A;  1FER A;  2CPH A;  2W1B A;  2VPZ B;  2WHO A;  2QMX A;  2ZJR Q;  1EKR A;  5E33 A;  3IWX A;  2H65 B;  1N33 F;  1FE0 A;  1B7F A;  3OR1 A;  3C19 A;  3QT6 A;  1ZTT A;  1DUR A;  5CYM B;  2AD9 A;  4K59 A;  4BC9 A;  1U25 A;  1A7G E;  4ZVS B;  4OZ1 A;  3H4B A;  2R7O A;  5KFI A;  2B7C B;  2ZC4 A;  1OYD A;  3VCD A;  1QE1 A;  2DNY A;  2WON B;  4Q2L A;  4KKO B;  2HQC A;  4XTT A;  1I94 J;  4AQY F;  3GJR B;  5DDQ C;  3DLE A;  1RAI B;  2CVI A;  2IM1 A;  4NX9 A;  2OTL S;  3OVA A;  3PO4 A;  3OXG A;  1HBO A;  3M9M B;  2NXU A;  3ZNU A;  3KK1 A;  1LWF A;  4PYA A;  2CJK A;  2WVF A;  2DPJ A;  3DU6 A;  2W01 A;  5KFP A;  1XNQ J;  1K0T A;  2V8P A;  3KUG A;  5L1K A;  3CCW A;  1FKP B;  1VRT B;  2BKN A;  4ER8 A;  4LSN A;  3MOJ B;  5A8K A;  2PD1 A;  3MED A;  5LSO A;  3OUY A;  1FTR A;  3B4M A;  2RML A;  5G0R B;  3V2U C;  4CRJ A;  2F3J A;  2EBG A;  3NEK A;  3M32 A;  5B0B A;  4NYZ A;  4ECX A;  1GTE A;  4UQT A;  4Q8E A;  1FJC A;  3KXD A;  4B9N A;  3KK3 A;  4CH1 A;  3PEJ A;  2B43 A;  1T9T A;  1XQI A;  5L46 A;  5HVG A;  2V9W A;  2HZC A;  5J1N A;  4PWU A;  1WKJ A;  4DUY F;  1PBU A;  1HBU A;  4I68 A;  3NCP A;  2DNR A;  3GII A;  3PW7 A;  1KVK A;  1C1C B;  2KVQ E;  3S1T A;  2MHN A;  2EC2 A;  2WAQ D;  2MQP A;  5EDW A;  1NKE A;  4JI7 F;  1UKU A;  3MPU B;  4BLG A;  4DUY J;  3OJS A;  1VQ6 S;  4NYO A;  2J0S D;  5D0E A;  1U0S A;  1WSR A;  1JLQ A;  3O44 A;  4N77 A;  3H0P A;  1TTH B;  2YPZ A;  2P9E A;  1Q16 B;  1U1K A;  2YKA A;  2IC3 B;  4URQ U;  2XS7 A;  3R2C J;  5D0G A;  7FD1 A;  3FRY A;  1CUL B;  2WK4 A;  3GMG A;  3MM5 A;  1B99 A;  2QG9 B;  2ZWO A;  4OYP A;  4USK A;  3TNV A;  2BQU A;  4JI5 F;  1HQ2 A;  2B0G A;  4Q7A A;  1RTI B;  3GFZ A;  4OHZ A;  3GP9 A;  4XDC A;  4M5I A;  2FC9 A;  4JBC A;  3H2V E;  2FJB B;  3GG1 A;  1TP7 A;  3V6K A;  1OY8 A;  2HS4 A;  2AKW B;  2HGM A;  3BZQ A;  2IM2 A;  3LWM A;  2MKK A;  3KTQ A;  4LF6 F;  5K5M A;  2XEX A;  1T05 B;  5B0F A;  2DH8 A;  2LU2 A;  3D0I E;  3ZZR A;  2MQO A;  1RT3 A;  3KDO A;  4QZV B;  2CA9 A;  4YDX A;  1ITP A;  1K0V A;  2BAC A;  1U1L A;  1ZZF A;  2OKQ A;  4XK8 C;  5KFL A;  4A8X A;  3QWP A;  2ALZ A;  2F4F A;  5HO4 A;  4NXN F;  3H40 A;  2E5I A;  4MT1 A;  1FJG F;  2GIR A;  3SBM A;  3QAT A;  4PWW A;  2AJ0 A;  3F41 A;  4U9R A;  4DV7 F;  2IYG A;  2QA4 S;  3AOA A;  4JUZ A;  1FWK A;  1T9V A;  1VIO A;  1WC3 A;  4OX9 F;  4DDF A;  3TRG A;  4X4T A;  4MJK A;  5EWF A;  4FBU A;  3J80 U;  3I0S B;  4DR7 F;  2QYG A;  4LFB F;  1WD6 A;  4W98 A;  1SH3 A;  2E44 A;  4AD6 A;  7AT1 B;  2RDJ A;  4X4V A;  1C1B B;  5KFS A;  2XLJ A;  4W90 B;  2R2U A;  4NLS A;  5EX3 A;  1SJ1 A;  4HKQ A;  2FJV A;  1NU4 A;  4K2X A;  5F3Z A;  5A2Q Y;  1LK7 A;  4DL2 A;  3B6B A;  4K4S A;  2K8G A;  3GFX A;  1U2F A;  2BKP A;  3BF4 A;  1JKH B;  1GAO A;  2MZT A;  2R9L A;  1S6U A;  4EFA C;  3RB4 A;  2XMJ A;  3TEG A;  4OLP A;  3LGH A;  2U2F A;  5HJY A;  2YKM A;  3T5J A;  1JLQ B;  1TAQ A;  1P9Y A;  1NPK A;  2C2Z B;  2H3E B;  2BV3 A;  2H9Z A;  2AJ2 A;  1BHN A;  3O1L A;  1S1X A;  3JXO A;  5FDL B;  5DG7 A;  1L3V A;  3OL8 A;  4MFB B;  3AOC A;  1VQS A;  1UL3 A;  2GNK A;  3HFK A;  3RZA A;  3ZO7 A;  3Q23 A;  4DV4 F;  2AHO B;  1FDD A;  2I0X A;  2HQG A;  1J27 A;  3P45 B;  4NCG A;  3EUN A;  2D1C A;  2X1B A;  3D28 A;  5F0W A;  1IVZ A;  2IDL A;  4QPX A;  2AYM A;  5HP1 B;  1K1Q A;  2K7K A;  2VC0 A;  3NWR A;  4FVM A;  1VQ8 S;  3VAK A;  4MH8 A;  4ES3 A;  2HFS A;  1VRU B;  2DK2 A;  1YBA A;  5K14 B;  1R8H A;  1S6O A;  3RBE A;  1N8R T;  4PEO A;  4DX8 H;  1KQF B;  3MUR P;  3VAJ A;  2UUC F;  2QN6 B;  3R3T A;  3WC0 A;  4UUX A;  1WC1 A;  4WTY A;  3U02 A;  3G71 S;  3SQG A;  1SUQ A;  4HI1 A;  3H59 A;  4RUB A;  3TAN A;  2QC3 A;  3MR5 A;  1RUS A;  2QIF A;  3GFH A;  5E0O A;  4O3Q A;  2HND A;  1WF0 A;  2HK3 A;  1TL5 A;  4CO0 A;  2C2D A;  1XMQ F;  4YB5 A;  1XMO F;  2ZEJ A;  3QIP B;  4WKR A;  3A3P B;  1P1T A;  4MMO A;  2V4Q A;  1NAQ A;  2IM3 A;  4OYA A;  4X64 F;  1L3U A;  3M8Z A;  4EGL A;  3FSI A;  2DR8 A;  5JMN A;  2JEG A;  2IRY A;  1N0V C;  3BN4 A;  4PXE A;  5I3U A;  2RS8 A;  1OSD A;  2NPI A;  1WDD A;  3MM7 A;  3V6J A;  1KHW A;  3H5Y A;  3PJW A;  5GAH I;  2BAN B;  3MCM A;  3QT5 A;  2JVO A;  1T94 A;  3EJM A;  2XS2 A;  4DEZ A;  4DX6 A;  3UDE A;  2HAF A;  1HWU A;  1HBN B;  1MMN A;  2QLF B;  2UVV A;  1W7W A;  3H8Y A;  4ZOS A;  2F8M A;  4RO0 A;  3PYF A;  3MD1 A;  4ZPW R;  2KFY A;  4OI6 A;  4FF2 A;  3K5L A;  3I5C A;  3PR4 A;  4ECT A;  1JNZ B;  3GJQ B;  4Z37 A;  2Q3P A;  1F3F A;  2XS5 A;  3CUL A;  3CC7 S;  4Y0F A;  1FA0 A;  1T9U A;  3SSS A;  1R8B A;  4HT7 A;  5HQ8 A;  1WNE A;  2BZ2 A;  4O3P A;  4EBC A;  4NXM J;  1S0V A;  5D4L A;  5K8M A;  3LOU A;  1HNZ J;  4C8O A;  1M0S A;  3PJX A;  1Q8K A;  2CFX A;  3R5D A;  4J9P A;  2ASJ A;  1EET B;  2R7T A;  3BDE A;  4F4A A;  5ETP A;  5KFM A;  3G6Y A;  3LP1 A;  4RWX A;  4AL5 A;  3KLE B;  4HH0 A;  1JLE B;  1VFJ A;  2DHS A;  1HBU B;  1TMM A;  1TKT B;  3G82 A;  3EPI A;  3GR1 A;  4GVB B;  5K14 A;  3OR2 B;  4ZCK A;  3H25 A;  4IR9 A;  1LWC A;  4DG1 A;  1REV B;  4F3Q A;  2B9Y A;  3HT3 A;  1IR1 A;  3M8W A;  3A8K A;  5CYJ A;  3OTO J;  4DV6 J;  2DNZ A;  1X4G A;  3M32 B;  3PYE A;  3EE3 A;  2KXN B;  1BQN A;  1RT2 B;  4WFB Q;  5KG1 A;  2E1A A;  4J9U E;  2PMZ D;  4ZJO A;  3N0V A;  4ZPA A;  4DPW A;  4M5G A;  1EP4 A;  3DOK B;  1AZS A;  4ZP9 A;  1VC0 A;  1KFS A;  5A8R B;  3ET6 B;  4OHY A;  1KFD A;  2MTL A;  4RNN A;  2ZJP Q;  2QA1 A;  5E3P A;  1ZM2 A;  1C0U A;  4N76 A;  1GH8 A;  1FK9 B;  1NBE B;  2C3O A;  1FRL A;  4PKD B;  3UE2 A;  1JLG A;  5HMZ A;  2GW8 A;  4Q45 A;  4N5S A;  4FYV B;  2XWY A;  2BJD A;  2UXC J;  1NJI T;  1F5A A;  4QW9 A;  2VBW A;  3OSP A;  1DHM A;  2A6O A;  1RHM B;  4NLR A;  1FJ7 A;  2WON A;  1IKX B;  9ATC B;  2I6W A;  1D0E A;  3LGN A;  1RWV B;  2XMU A;  5GAG I;  3PJ9 A;  4DV7 J;  3I82 A;  1JJC B;  3J7Y I;  1OO0 B;  1TUW A;  3CC2 S;  1WOP A;  1Q7Y T;  2KRB A;  2P8I A;  2E5L F;  3UN3 A;  5JUM A;  3VAM A;  1GMW D;  1GXT A;  3EXC X;  1FE4 A;  1V3R A;  3JTO A;  1YJR A;  4K50 A;  1L5U A;  2HGL A;  1XNR J;  5CD4 H;  2CQI A;  4ZP6 A;  4J9O A;  3NY0 A;  3QO9 B;  2ZH2 A;  1S1V A;  1WHV A;  2FQQ B;  4CO5 A;  4RU9 A;  1FRI A;  3C6T A;  3NNC A;  4ECS A;  2UZA A;  4KHM A;  2FJX A;  4Q0B B;  2HFV A;  4GRS A;  2M2B A;  2ZBC A;  2WSE C;  1M5S A;  1TV6 B;  4WYL A;  3D66 A;  1SKR A;  2OI2 A;  2PMW A;  1XJW B;  2A6M A;  3CD7 A;  3RBX A;  1N5V A;  2PA3 A;  1X7V A;  3W7B A;  3TUZ C;  2MZ1 A;  2ZH6 A;  5JVH Q;  1MWZ A;  1HPZ B;  2X1G A;  3FRZ A;  2M8H A;  4F2R A;  2G1D A;  2X3G A;  2LDI A;  1HNW F;  3U7J A;  5CXT A;  3TAM B;  4LFA J;  1PKU A;  4LRC A;  4DV3 J;  1IKY A;  4URG A;  1T05 A;  2ZM6 J;  3J80 Y;  3CW2 C;  4R0E A;  2OLW A;  2FPH X;  5HK4 A;  5KFH A;  4JI7 J;  2I5J A;  4RUC A;  3QT8 A;  1ZA1 B;  5DDO C;  5DGB A;  1C0T B;  1YJV A;  1WC5 A;  4C3K A;  4CLL A;  4LR9 A;  4OV1 A;  4DL3 A;  2IBO A;  3UD3 P;  2ZUG A;  4M94 A;  3UW1 A;  2VQE J;  4N47 A;  1IKW A;  1H0H B;  5DDR C;  1NRK A;  2ZVS A;  1CUL A;  1HI1 A;  2CNL B;  3ULH A;  1DJ0 A;  4DUT A;  4OZL A;  5J1E A;  5KFK A;  4X66 F;  4CH7 A;  3G6V A;  3BKF A;  5IT9 Y;  3IFE A;  3BKT A;  3DLJ A;  4DPU A;  4NCA A;  4Q43 A;  4ZHR A;  5GME A;  4FS2 A;  4Y3C A;  4AQY J;  2LU1 A;  2VD3 A;  1V5I B;  3VTI A;  5D6G A;  2CQ3 A;  3GLJ A;  2OEJ A;  1ICE B;  3DGV A;  4DF4 A;  4QCL A;  1EHW A;  2BKO A;  1IKV A;  3PX4 A;  2EPI A;  1TVR A;  4DBQ A;  5IQQ A;  4V1A k;  3KLH A;  2RAQ A;  4OZ2 A;  4PR6 A;  2OJ3 A;  4CLK A;  3G8T A;  2JEI A;  5ETQ A;  5LMN F;  4RL1 A;  3DRP A;  1JLG B;  1T95 A;  1IWA A;  3UNY A;  2DR6 A;  2B4U A;  3DRY A;  1X4H A;  3BRE A;  4O23 A;  5BYQ A;  4AL6 A;  3PKY A;  1DRZ A;  4DSE A;  2FVQ A;  2R8G A;  2M0G B;  1KWM A;  4I2P A;  8RUC A;  3CXC R;  1BGX T;  3DN9 A;  4QPT A;  2AV5 A;  2HG4 A;  4QR1 A;  4ENO A;  4EUV A;  4J9N A;  1SL0 A;  1WAC A;  5KFV A;  1VC5 A;  3H4D A;  2DVI A;  3NAI A;  1SVD A;  4DL0 C;  1H38 A;  4JI0 J;  1YHQ S;  3D3C J;  1VDH A;  3BH7 B;  4L74 A;  3I0S A;  4C8N A;  4G1Q B;  3I4P A;  4LSL B;  1N34 F;  1QUV A;  2UU9 F;  2Y8W A;  3HO1 A;  2QE5 A;  1HA1 A;  2GVD B;  1RU2 A;  3OR2 A;  5ETL A;  3AD9 C;  3PX6 A;  4KH0 B;  1SBR A;  3G82 B;  3PNI A;  2CDR B;  1RAH B;  4Q2M A;  3Q0A A;  3T5K A;  3J7Z T;  4TU9 A;  2ZBP A;  4CDI A;  1MLA A;  5GAD I;  1QE1 B;  3P4U B;  5MAO A;  3MEG A;  2XHC A;  4DX7 A;  1NME B;  4WIQ A;  2XMT A;  1ZA2 B;  5ETT A;  3NXZ A;  1EAY C;  4QJV A;  5IM0 B;  1UMJ A;  2WCX A;  3CDB A;  3FSX A;  1RWK B;  2XM3 A;  4MYT A;  1NK8 A;  2YQ3 A;  1LFP A;  5BR8 J;  2XY5 A;  3LF0 A;  1OPI A;  2OPR B;  4LF9 J;  4X62 J;  2BJ9 A;  2GCF A;  1AB8 A;  1FRH A;  3LUY A;  4JOU A;  2DTJ A;  2DHG A;  1RBA A;  1F0X A;  3NGK A;  2V4J B;  2NXJ A;  4NLV A;  3D1O A;  1U24 A;  2JDJ A;  2MKS A;  4O0I A;  3KMQ A;  3OPK A;  1RK8 A;  4MK9 A;  4YR0 A;  2AEJ A;  1R89 A;  2W24 A;  2ATL A;  1FD2 A;  1RTI A;  3RAX A;  3OL9 A;  3LAL A;  1T03 B;  1N5Y A;  3QGI A;  5J2Q A;  4P2S A;  2CXE A;  4USJ C;  3VAG A;  5CD4 A;  3PM9 A;  4I4B A;  4GVL A;  2BM0 A;  2CQG A;  3C2P A;  5KAK A;  1PYT A;  4RW9 A;  1LK5 A;  1PG5 B;  1VQO S;  1M90 T;  4C0H A;  4ZJQ A;  3CDU A;  4TU7 A;  1VQ9 S;  1FKO B;  3IO1 A;  1Q5Y A;  2IM0 A;  1FWL A;  3S01 A;  1TUV A;  2X7I A;  3RUB L;  1X4A A;  3A4T A;  3QIP A;  2LCW A;  3NGU A;  1CSJ A;  1GQE A;  1Y3K A;  2DIS A;  2JFD A;  2CG8 A;  2JVR A;  4ILR A;  4X65 J;  3GV5 B;  3UNG C;  5EWE A;  5HRO A;  3J81 Y;  2E9T A;  4TQR A;  4OHV A;  2O1P A;  1XEZ A;  2PT0 A;  1NDL A;  5LMU J;  3WC2 A;  2YQ1 A;  4U95 A;  2O67 A;  3AJ2 A;  2NXE A;  2BVZ A;  3W65 A;  1UVN A;  1N88 A;  2IDE A;  3AD8 C;  3CD0 A;  4OZ0 A;  4S0M A;  4JI4 J;  3UD4 P;  4J5O A;  4KIA A;  1U6Z A;  4ZN3 A;  4QIE A;  3T6J A;  2Z8Q A;  3NGT A;  4J7C A;  2VKR A;  3R6G B;  3I56 S;  3T3F A;  1K73 T;  1WEY A;  4MKA A;  1APS A;  1RT6 A;  3HHL D;  1G4C A;  3LO3 A;  4QOT A;  2NLW A;  5KTQ A;  2HVE A;  4HR2 A;  1NND A;  3M2V A;  2HNZ A;  4RLE A;  3QID A;  4HTJ A;  5B0A A;  2J9D A;  3EGN A;  4I7F A;  5B7W A;  1VQM S;  3POT B;  1HWL A;  2NUH A;  1URN A;  4NI2 A;  2ZOF A;  3SV4 A;  2L9W A;  4WP9 A;  1RWN B;  1T0T V;  1G7C B;  4DV0 F;  3I5A A;  4UF4 A;  4IG3 B;  3AOD A;  2HS3 A;  3CCU S;  2NSC A;  2RVJ A;  2DGX A;  2C2K B;  2EXU A;  2V67 A;  4CM0 A;  2VA3 A;  2CZ4 A;  2QL5 B;  3WBZ A;  1JMT A;  2KU7 A;  2MZJ A;  3W2V A;  4ECZ A;  1SCJ B;  1CVJ A;  1ZBT A;  3QGP A;  2VOD A;  4ZIT A;  4ZN1 A;  1A0O B;  3DM2 B;  1PYO B;  4C2M A;  2LEC A;  3PV8 A;  4F3O A;  3S8S A;  4HAC A;  1VYA A;  1IBK J;  2H4W B;  1B0T A;  5EHH A;  3E2E A;  3R7B B;  3AHP A;  4DFJ A;  2EBE A;  1WI6 A;  1B7Y B;  5KT2 A;  4DV3 F;  1JKH A;  3ISN D;  1NSA A;  2HNZ B;  5KFU A;  1B4S A;  5HMY A;  2OML A;  4MKB A;  2EC0 A;  3RB3 A;  1PJ5 A;  2NXC A;  3JSY A;  3MEK A;  4C4W A;  5M2P A;  4HT5 A;  2LA4 A;  2ZZN A;  3SDE B;  3RW7 A;  2HIQ A;  1R6Y A;  1RP5 A;  2J7K A;  2YBV A;  2DIT A;  3IAM 9;  4L3K A;  4NYP A;  1RHQ B;  3MAA B;  2UVU A;  3BPS P;  4YY3 J;  3VWS A;  1RZM A;  3GR0 A;  2WVC A;  3R7N B;  5HQM A;  4CIO A;  3Q8S B;  4HLB A;  4QWA A;  4A46 A;  2RE1 A;  3DI6 B;  4ZVF A;  2HQF A;  3KNG A;  3ZZO A;  3D67 A;  4PWD B;  2JLG A;  2B8P A;  5LT5 A;  3PYD A;  3LP2 A;  2DR9 A;  1QLN A;  2Y0B B;  2FHK A;  1VI7 A;  1PYS B;  5ETK A;  3U1L A;  1VQN S;  1RLC L;  4J9S A;  3HJF A;  3N4W A;  2R7U A;  3QLH A;  1YJU A;  2R7X A;  4Y6I A;  3T9N A;  4DF8 A;  4LF7 J;  4OI0 A;  4Q0B A;  1U7L A;  1HNX J;  4JV5 J;  4DV2 F;  4KYZ A;  1OS5 A;  3T5L A;  1OYE A;  1XER A;  3MM9 A;  2GHP A;  1FKA F;  1Z1Z A;  3NCR A;  3AQO A; 
#chains in the Genus database with same CATH homology
 5ETP A;  3KUH A;  1TMJ A;  1IM6 A;  3HD2 A;  3UD5 A;  1EQ0 A;  1EX8 A;  1Q0N A;  1RU1 A;  2F63 A;  1TMM A;  2CG8 A;  1DY3 A;  2QX0 A;  3KUG A;  1HKA A;  3MCM A;  4M5H A;  2BMB A;  1F9H A;  3UDE A;  5ETV A;  1EQM A;  3HSJ A;  3HSG A;  3HCX A;  5ETR A;  3HSZ A;  1RB0 A;  1HQ2 A;  4CRJ A;  4M5N A;  4M5M A;  5ETN A;  1KBR A;  1RTZ A;  3HSD A;  3KUE A;  5ETL A;  1RU2 A;  5ETS A;  5ETK A;  4M5I A;  4F7V A;  3ILJ A;  1RAO A;  4M5K A;  3IP0 A;  4PZV A;  3HT0 A;  4AD6 A;  1G4C A;  4M5J A;  4M5L A;  3MCN A;  5ETO A;  4M5G A;  5ETQ A;  3QBC A;  3MCO A;  3UDV A;  3HD1 A;  4CYU A;  5ETT A;  5ETM A;  2F65 A;  3ILL A;  4CYU B;  3ILI A;  3ILO A;  4CWB A;  1CBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...