3UDEA

Crystal structure of e. coli hppk in complex with bisubstrate analogue inhibitor j1b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
154
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Bisubstrate analogue inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase: New design with improved properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 154
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3udeA00
2F63A 2CG8A 1EQMA 1EQ0A 1RB0A 1RTZA 1HQ2A 3UD5A 3HSJA 4CYUB 1EX8A 3HT0A 1RAOA 4CWBA 3HSZA 1TMMA 4M5MA 3HSDA 4M5IA 5ETLA 3ILOA 3HD2A 4M5LA 4M5GA 5ETRA 3HD1A 5ETKA 3MCOA 2F65A 5ETPA 2QX0A 4F7VA 1KBRA 4M5KA 3KUHA 3ILIA 4CRJA 1Q0NA 3HCXA 3MCMA 1DY3A 3HSGA 1G4CA 3KUGA 4M5HA 5ETTA 5ETMA 1HKAA 5ETQA 3QBCA 3UDEA 4AD6A 1RU1A 3IP0A 3ILLA 3ILJA 4CYUA 4M5NA 5ETVA 5ETOA 4PZVA 4M5JA 1IM6A 1CBKA 5ETSA 3UDVA 1RU2A 1F9HA 5ETNA 2BMBA 3MCNA 1TMJA 3KUEA
chains in the Genus database with same CATH superfamily
1PYSB 2A2CA 4F4ZA 3W9IA 2QX0A 4H4KC 1I94F 1KFSA 4HT5A 4RO0A 1U09A 3TVZA 4U7UD 3T9NA 2ASJA 2XBPA 1S6OA 4ED7A 2YKMB 2F40A 3MAAB 4KKOB 4NYPA 2DTJA 1X31C 4MMOA 3SSQA 2DNOA 2IBOA 5CH7B 3O3LA 3MM7A 4NLTA 3W64A 3QAEA 3BYRA 2UUWA 3EZOA 2ZHOA 3LH2S 2JFDA 4U95A 4BS2A 2YQ3A 2VG7A 4OYOA 1REGX 4DPXA 3UD4P 1HBNA 3NGUA 4X65F 3OJUA 4JV0A 1F1BB 1E6VB 1K8AT 3MAHA 2PO4A 2BXJA 2OD4A 3WIVA 1GTHA 5AE3A 3TQ1A 5KFJA 4KGMA 3QPIA 1CS4A 3PX4A 1VHFA 2DEIA 5EHHA 4B3OA 2QLBB 1V3ZA 2RS2A 1D09B 5CYMA 3BJYA 2XNRA 1U1LA 3BDPA 2GHVC 4QWAA 4C97A 2HBYB 2D3OR 2OSQA 2UUTA 4IG3A 1S1UB 4QPXA 5C2CA 1ULRA 3DLHA 2HGLA 1F6TA 3KUEA 2EFPA 2MZTA 5A8WB 2HEKA 5CYJA 3BQ2A 2DGTA 3RB6A 4I7FA 3W8PA 1UWAA 4GRSA 1UCNA 3CO0P 1RU1A 1UPPA 1WTBA 2HHPA 1PBUA 1VQ8S 1W25A 3D28A 3GTYX 2CQ1A 1RHJB 2IM2A 1TUWA 1GT8A 3A13A 2KXHA 4G65A 3PIOQ 4OYWA 4LFCF 1R8HA 1XEZA 2PD1A 2W9BA 2DR8A 2YNFB 2NQPA 1FJEB 3DLKA 1KVKA 3CMES 4QQBA 2MZRA 4DV6J 2ZH8A 2MHNA 2FZCB 1RT1A 1RT2A 4HYKA 1VQYA 3IWLA 3L7OA 4OV1A 1N34F 5IT4A 5J2MA 2H48B 1M5PC 5HI7A 3PTWA 4RBTA 4A8OA 3KG4A 3CJKA 1KHVA 2Q79A 2VUGA 4J37A 2FD2A 2V4QA 2ZH7A 5KFSA 5LXYA 2NPFA 4X62J 2BANA 2KRBA 3CJTA 1U2FA 1U25A 2J9DE 1S79A 4EBEA 4DSEA 1HI0P 3K58A 5D4PA 1XTZA 1RT6B 4K4YA 4P7TA 4AL6A 2KM8C 3PY8A 4RW4B 3IAS9 1O8BA 2MQQA 4ZA1A 5AE1A 2GX8A 3OL6A 2NR0A 1S10A 1JKHA 1VISA 2HRTA 2ZFHA 4Q8FA 4ED0A 4K0KF 3O8WA 2Y0BB 4I2PB 3OL7A 2RRAA 1EKRA 3DLJA 4CH0S 4C48A 2CPJA 2FB0A 5E3RA 4J5OA 1TV6B 3UN5A 2MKKA 3C16A 3MM5B 1RACB 4C8MA 3BN7A 3VAHA 1RHMB 5IQQA 4NEYA 5D0RA 5F8MA 2N82B 1Z2LA 3CJSA 3FZBA 4AFFA 3ZZZA 4A8SA 2AWZA 2DKOB 4DZ6A 2Z4PA 3C46A 4I2QA 3S7RA 4O3OA 2BR0A 3R3TA 5AT1B 2QTWA 3TX8A 2EBGA 2RSQA 2XSJB 1RBLA 2DCLA 2GS8A 3PXGa 3D6TB 3G82B 4ZCLA 3VGUA 4PWDA 1G4CA 4ELVA 3DLGA 2UU9J 4F67A 2BEFA 3TUPA 3P5TL 3TYTA 2ZKTA 4RUCA 1QAXA 1FNMA 1RTJA 5DRKA 4RX6A 3L3CA 5KFVA 4J9MA 4WBFA 3Q2TC 3AH6A 1FWKA 4ILMA 2FC9A 3N0VA 1QM9A 4A8MP 5E7OB 2XS7A 1HQEB 3W66A 4OYAA 2YH0A 5L1IA 1G2EA 2B5JA 4LUBA 2AQ4A 2V8PA 4I6WA 4ZP6A 4F4WA 3M6XA 2CQ2A 1DAXA 3THTA 3QT5A 3LO3A 3TAMA 1VBXA 1I94J 1JLAB 1W2IA 1HWLA 2YVSA 2PGCA 3H8YA 4XO0A 3M1VB 2ZBRA 1W2BR 4RJVA 1FCAA 4LREA 2DHSA 4P9SA 5KG5A 3H25A 4AUKA 3HFVA 4DV3F 1NJYA 3V6KA 5KFPA 1RAGB 1SC1B 3M2UA 4YY3J 1TAQA 2DO0A 2ZVSA 4RNNA 5CCLA 1YJVA 1TELA 5G4DA 2LCWA 1JJ4A 2OIHA 4X65J 1GEHA 1ITPA 2CDQA 5KAKA 5F0WA 3BH7B 2DEJA 2F7VA 4J9VA 3S8SA 4KB7A 2D1CA 1Z1ZA 3AJ1A 2BRKA 1CSJA 4I68A 1L5UA 4FF4A 1NH8A 2ZE2B 1NPKA 2HVZA 2UV8A 2UZAA 3MEKA 3R27A 3KHHA 2P6TA 5E41A 4CLSA 4KH0B 4DL7A 1S6UA 2FJDB 2MJNA 4NYOA 4P75A 2X3DA 3J7ZT 3IR7B 3H59A 3TA0A 1ZA1B 4JI1F 3BDEA 3ENAA 4WJBA 2NPIA 4A47A 4CYUA 3G6ES 2R7XA 1FWPA 1GAOA 2FC8A 3MCNA 5T7LB 1ZA2B 4RU9A 3U7JA 5KFXA 3JTNA 2JDJA 3U1MA 1FEHA 1YHQS 1F5CA 3TR5A 4MFBB 4JI2F 3KHLA 2CNOB 4QR2A 5T41A 4B3RF 4LR8A 4ED4A 2AX0A 3OHBA 3OR1A 1IUJA 2B4UA 2HQFA 3IXQA 4HHUA 1M90T 1AZSB 2BDPA 1IKXB 4A8QA 2LP4A 5IT9U 1SJ4P 5KG2A 4WF9Q 2BM0A 3FRZA 2VODA 2HHWA 1Q95G 2CQGA 2KB2A 5GAGU 5EDWA 4C4WA 2I9SA 2IJFA 4DR2F 2YKMA 1N34J 3NNCA 2VD3A 3QRPA 3MAAA 4KKOA 4F3QA 1FXRA 1M1KT 3CNQP 4ZMMA 4Q45A 4P2FA 3DLLQ 3OTBA 4ED6A 3O6QA 3BSCA 1HWKA 3IRXB 3DDNA 3OXFA 5ETSA 4TQSA 1HR0F 3GU0A 2ZEJA 2E66A 2HVDA 4LT6A 2QEXS 1KNZA 2RU9A 3ELHA 1PJ7A 2LXUA 3ZNUA 1E6VA 3CC4S 5KFZA 5DDQC 2F9DA 3PKMA 2VQEF 1CQNA 2E1AA 3W7BA 1KEKA 1S9EB 4CLFA 4K0KJ 2VASA 3QQCD 2I8EA 4KHMA 2IMOA 2QLJB 2E9ZA 5CD4A 4XDCA 1ZH5A 3HLUA 2XSFA 2ZOMA 3H20A 4F02A 2EFOA 3CJ8A 3OXGA 2OI2A 1UJ4A 2FJWA 4LF5F 1S1UA 1F3FA 1GMWA 3FGVA 3W62A 4ZS6A 5KG4A 2GO8A 3S6EA 2FVRA 5A8WA 5KT6A 2WVEA 4DZDA 1Q1KA 1ZPWX 2CQIA 1SC4B 1YX2A 1CJVB 1LK5A 5IM0B 1BC6A 2Y3YA 3EICA 4OYIA 1FRHA 2XO6A 2W8KA 5AJ3F 3DI6B 4MJKA 5KG1A 2DHXA 3QGHA 2QA1A 1HI1A 1FK9B 1Z2ZA 2JC1A 4DR3F 3AOAA 2DY9A 4LF9F 5KFNA 4NE9C 1IKVB 1YJRA 4KBIA 4USVA 1M5VC 2YKQA 2YNFA 2CJKA 4V19X 3M8PB 3VGSA 5D0EA 2P8IA 4HL9A 2CJBA 3AA8A 4DR5F 4DWIA 1NK4A 3JYTB 3HT0A 4JOUA 3ENWA 1T11A 2C2EA 1WHXA 1QSLA 1UTAA 3H4DA 1YZ6A 2LA4A 2RKIB 5KG6A 2BJ8A 1IM6A 1U1QA 3QIPB 3OLAA 4OHXA 3PEJA 4HR2A 2ZH4A 4HHHA 3AFGA 1EARA 2E29A 3I6PA 2P9GA 1F9HA 2BA9A 3KDNA 3H98A 3C6UB 4RW4A 1RDRA 2GJFA 5L46A 4OZLA 5IWAF 5F8NA 5B0GA 2AGQA 3P4UB 3MD1A 4ES3A 3JXOA 3A1YG 3JAMU 3AD8C 3CEDA 4URGA 1P9YA 3SCIE 2BZ2A 3D66A 4JB8B 1B4SA 1J27A 4I2PA 2OH2A 2A2DA 3RBXA 5JJBA 3AOCA 1TV6A 4DV3J 4X84A 3PRVA 1C0TB 4S0MA 4ANDA 3MM5A 2DHHA 3X3UA 4LJMA 3UCZP 1AFIA 2W1BA 1SJQA 1IBCB 2PT0A 1SBRA 2VKRA 2IDLA 1RHUB 3KXDA 2CADA 3D5MA 1K0TA 2ACYA 3DMJB 3SQOP 3IBFB 3UCUP 5KTQA 2LU2A 4RUHA 1NK7A 3I4HX 3ZZYA 4CH7A 1R8CA 2H4WB 3SBMA 4WXWA 1XR5A 1A7GE 1MMNA 2XSJA 5KT5A 3KOAA 3DC2A 2CNLB 4ECTA 3QLHB 3G82A 5CCMA 4PG7A 1RJJA 2JHEA 5E2QA 4FN5A 4JI1J 2Y1RI 5DDPC 3V4IA 3M9MB 1X4EA 4ECQA 1PSDA 3OFFA 2VPYB 1TL5A 4RR5A 4RW8B 3PW4A 1WEXA 1T94A 3M32B 2M8DB 1AA1B 1HQEA 5ETTA 4JI2J 3HULA 3EUNA 4NRUA 1RGVA 1FXLA 5F8GA 4B3RJ 3MM9B 2ZWOA 4Y2KA 3G8TA 1RAHB 4KAIA 2KT2A 2RQKA 1FJCA 2VOPA 5IC4B 3V6HA 1TVRB 3DRXA 3B4MA 4LF8F 1T9XA 3OV7A 1JLAA 3G9CA 3HSJA 4I6AA 4BLGA 5B0BA 3M1VA 5A2QU 4NCBA 4ED1A 4DR2J 5IOLA 4OI4A 4G3IA 1MMDA 2W7AA 4QW8A 2UVRA 1RU2A 3GCXP 2OEJA 5B0DA 5GMEA 4LF2A 1S99A 1RWPB 2V4JB 3BR8A 3D0HE 2XI2A 3DHXA 2NXJA 1P1TA 2B9YA 4URQU 1HNXF 1HR0J 3UDVA 5JVHQ 4WP3A 4X66F 4F0KA 2AJ1A 2VH7A 4DQQA 1NK8A 1O6XA 2ZZTA 5LJ5Y 4AE5A 5A0YA 2MMYA 4M95A 2CZ9A 2MKSA 4FS1A 2VQEJ 4K7QA 2GC8A 3RB0A 4C8OA 1N52B 3CCZA 2ZE2A 3ZZPA 2WSFC 1VC5A 3D3BJ 4DN0A 2EI5A 4Y65A 3I82A 2DGUA 3MMAB 1T02A 4UT4A 2KFZA 4LF5J 2DGSA 3FK4A 5HO4A 1H98A 2M4MA 3VVUA 3D6HB 5T7LA 3RRKA 5KFOA 3KLEB 4DJBA 5HLFB 4C2MA 3ISNC 4DF8A 1N0VC 2L48A 4ZDNA 2UXCF 2XY6A 2DNKA 4MFBA 3VAGA 2B4VA 4O44B 2CQ4A 1WC6A 3GE9A 5ETMA 4ZVUB 4CLKA 2OGUA 4C6AA 5BR8F 1ROFA 4PWWA 4DR3J 1T9VA 4DFMA 2C2DA 2G1HA 4LF9J 1AZSA 1DJ0A 3Q24A 4NLVA 4P74A 4KGVB 1L3UA 5ETLA 2CJXB 5IZHA 1TKZB 1H2TZ 2VC0A 3SSSA 4F25A 2RHSB 2IIHA 2C42A 4ZN3A 3Q8PB 1LWCA 3HFZB 3ETOA 2VONA 4LF7F 1YRXA 1WD6A 4PRFA 1KOHA 4CLWA 1DLOB 3PRBA 1FRIA 3OT9A 2GQQA 3AJ2A 2X1AA 3NGDA 4ZPTR 4DSIA 4DR6F 3HHLC 3IRXA 2X1FA 2WVCA 1Q0NA 1GK8A 2FJXA 4QW9A 1OYEA 4X4RA 4OHZA 3DOKA 4W4MA 1DQ8A 4PPZA 1GNKA 3PYFA 5I42B 1HNIA 5IWAJ 3LP0B 4QWBA 1R6VA 1OQ3A 1P8GA 1S9EA 4PQUA 4NLYA 5H9FK 4DR4F 1JNZB 1RT5B 2EKNA 3GFXA 4IQMA 2OPSB 2XWYA 4PXCA 3MZIA 4CNZA 4RW7B 3IS9B 3EYZA 4X4PA 3LAKA 3W5XA 3Q0AA 2DNYA 1L3VA 3RG6A 3OJSA 2V2QA 3KLHB 4L3KA 1UW4A 2AHOB 3I5AA 2C3MA 4KRWA 5GAGI 1VRUB 4OYBA 3CJ4A 3DLEB 3ITHB 4WFBQ 5IM0A 2YPYA 3SCKE 4DV0F 3T3FA 2CQCA 5GADU 2JSXA 3DI6A 3O1LA 4M5MA 4YMEA 4J9KA 1Q53A 1FK9A 1WF0A 1D8YA 2HZCA 3FBCA 2G0IA 2QFJA 1H38A 2BJEA 5D4LA 5GVQA 2GFFA 4MAKA 1OPZA 1UVLA 1GMUA 4F4YA 1IKVA 2BM1A 2KRRA 3CUNA 3K5LA 1K47A 3M8PA 5E3QA 1K44A 3SCLE 3MCSA 5U47A 4Y2MA 2IVMA 2OMOA 2NXCA 3GPAA 2KG1A 3ZTOA 4USIA 4CQ1A 2RKIA 3QIPA 2NLWA 3IBCB 4NLOA 3ENVA 2M3DA 1QAYA 5GMKa 1APSA 1V9OA 4N47A 1QDUB 2HFVA 1S0MA 2GIRA 1NO8A 4B3SF 1UVIA 1WC1A 1AB8A 1U47A 3MEDA 2FJVA 4IH7A 4NRTA 3R7BB 4LF8J 1XERA 3C6UA 3ETMA 2FHOB 2J6TA 3UWTA 4ZLNA 3LTOA 4CP5A 4KHRA 2FJBB 4FXWA 1VBYA 2KU7A 1QVGR 2C2OB 4CLPA 2LDIA 4HVZA 2XMMA 2R8IA 3CVKA 1FRMA 5LT5A 4USMA 3R5CA 2W24A 3CC7S 1C0TA 4MYUA 1N6QB 2LXIA 1WORA 2LFVA 1HNXJ 1WDTA 1S1WB 3O44A 2R8HA 1VJQA 2BJ7A 2E1MC 4X66J 1KSPA 3BPSP 1HLWA 5D0HA 4F8RA 4OJ3A 3HK2A 4EU0A 7FD1A 2MKCA 3DMJA 1NCLA 2XZDB 1LNQA 3F41A 3ZZTA 3FCWA 4PAAA 4B08A 1TR0A 3CD5A 2AD9A 2DPIA 1IKYA 1D3WA 3DU6A 3QGPA 4LMZA 3OBIA 2GAGC 3QLHA 3ZXWA 5ITHA 4ED2A 1MG7A 5DDRC 2MKJA 4OZ3A 3GIMA 2Z2YB 4OYXA 3T1YJ 4HTJA 4AXIA 1Q4RA 2I0XA 1MLAA 3CCES 4LFAF 2MY7A 1R8PA 5B0FA 1RSCA 3TI0A 3VVTA 3J7Z5 2UXCJ 2KI2A 3M32A 4FF3A 1HWIA 3K8WA 4JV5F 3KJFB 2MB0B 2E7VA 1GMWD 2CKWA 5I3QA 2JEJA 4USKA 2GHWA 3WC2A 8RUCA 2B0GA 1S9GA 5BR8J 2RF2B 3LWLA 3MM9A 3VQTA 2I38A 2FVSA 4WK1A 1F60B 3UN2A 2RE1A 2JZ5A 2ZH6A 3JQMA 2XY7A 2BKNA 5EWEA 3K2YA 1TVRA 2AYMA 2O5DA 5LOQA 1NJIT 2LLZA 4IOCQ 2YWFA 1YBUA 2WONB 2WB1D 2XZWA 3MUVP 4U67Q 2QE5A 2V4JA 3CCLS 2AMCB 1F5BA 5K9FA 4AXJA 2UVWA 2GMJA 4LR9A 2OP5A 3JSYA 2V68A 3BGRB 3H40A 3QGGA 1FJGF 3MCMA 3HX9A 2WCXA 1FD2A 2XC9A 3ONQA 3RBDA 4MIBA 3J80Y 4DQRA 1PKUA 3QYYA 2VHGA 2HFOA 1N56A 1U1KA 2DH7A 1T7PA 3GIKA 4DR4J 2BJDA 3BSNA 1X4CA 1HBUA 3HJFA 2DNLA 1FKPB 5A8KB 3GV8B 2HMIB 1V5VA 3MMAA 2WBMA 3D3CJ 1HW8A 3Q22A 4FF1A 1ZTWA 2BACA 3G86A 2WVBA 2DIUA 5G0RB 3KLEA 5HLFA 3OFHA 3TJAA 4DQPA 2L3MA 3BBBA 3RTVA 2FPHX 4ZITA 3FBBA 4DV0J 1Y5LB 3FEZA 4O44A 2IJNA 4PXDA 4O4GB 1YG0A 1O51A 4WFAQ 3CDBA 3LGHA 3M30A 5DG7A 3LGNA 3BN4A 4K8RA 5L1KA 2YNHB 2ATLA 4PPDA 1TKZA 2NYIA 4JV2A 2KYZA 4IFYB 1MU2B 4Y0FA 1KLMA 1Q5VA 2EFVA 2R8GA 3DDKA 5HL7Q 2CXEA 2XMKA 3JSBA 2HGNA 2CDRB 3E01A 2MZQA 4DN9A 1WG5A 2ZOGA 5B09A 2ROEA 2RD5C 2DBBA 4LRCA 3CCSS 4NXMF 2MSTA 1IBKF 3A8KA 1WWHA 3D7SB 4HI2A 3IAM9 2FZGB 1TMMA 1KFDA 1M0SA 4FYYB 4B3SJ 2HGMA 1TK5A 2ABYA 4O4RA 4A8FA 4U8VA 1X7VA 1IR0A 1NSQA 2OTJS 1X60A 3AQOA 2CQDA 3LP0A 2IC3B 3OL9A 3FMBA 1V3SA 2OMLA 1VC0A 3P96A 1RT5A 2XS5A 2IRUA 2OPSA 4RW7A 5B0AA 3IS9A 2K8GA 3VZIA 1U1PA 3PR5B 1Q8BA 2CPZA 3KLHA 3Q8YA 4LSLB 4Z7YA 2PEBA 2J7UA 3OUYB 5ETQA 3H42A 4NXNJ 1TL7B 1NB2A 3UPFA 3HVWA 2QLWA 1VRUA 4NLWA 4YQWA 3DLEA 3SXLA 4DUYF 5J1EB 4ER8A 4PWUA 3ITHA 2W4CA 3MPVA 2A6OA 1PYTA 3CIZA 3G87A 2X7IA 1ZM4A 4F26A 3PW0A 4LQ9A 1SV5A 4TY8B 3M9NB 3I0SB 2NXEA 1QVFR 3NWRA 4L3NA 4KYZA 4IR1A 4Q44A 2BOPA 3I9V9 1S1XB 1VMBA 3M2VB 3BEGB 1VQNS 5C25B 1NJWA 9ATCB 4WCEQ 2GVDB 4P72A 2HLUA 3MPUB 5K5MA 1H7XA 3BGUA 1WELA 2FIUA 3CCQS 1TP7A 2V8DA 3POTA 4LFAJ 2EG1A 5KG3A 3TOQA 3W5ZA 2CQPA 2FLOA 3CCMS 1D9DA 3R1LA 2VFRA 4JV5J 1VK8A 5ETRA 4UY85 2YPZA 3M8SA 2C28A 1UMJA 1M1GA 3R2CJ 1T3OA 3MMBB 2KTQA 2U1AA 2VQFF 2GGPB 2C3PA 4IFVB 1S6PB 1HHTP 3NNHA 3NMAA 1CQMA 4ZHRB 3NXZA 3PW2A 2J6UA 3AXKA 1RTDB 5GADI 1V6HA 2YKPA 1TMJA 4GVBB 3I0RA 5KFKA 4ZVEA 2K3KA 3C15A 4B9LA 4U9RA 1SUQB 3Q83A 1UZDA 1WACA 2VZ9A 3EZUA 1M5HA 3OL8A 1YJTA 3FFIB 4GC6A 3MUTP 4UQGA 1REVB 4O0NA 1N6QA 1JJCB 1SIWB 4YR2A 5D15A 3TAQA 3HVTB 1CC8A 1S1WA 1C4CA 5IFMA 3CD7A 1FJGJ 1YVFA 2V67A 1LEOA 2AJ4A 1LFWA 1OY9A 3V81A 3KNAA 2ROPA 1T9YA 1RWOB 3CPWR 2NZ4A 2O67A 5H9FJ 2V2ZA 3DRRB 3KLFB 2PC6A 2YWKA 4RUBA 1N33J 2J0WA 4FNHA 3BM7A 5I3UA 2CQ3A 3N01A 4K2XA 2VIHA 1FD8A 3OVBA 2MKYA 2MDAA 2BYCA 2DNMA 2XM3A 4B9TA 3L7PA 2HFZA 4F0HA 3HF5A 4ZVSB 2UXDJ 2BQ3A 4JI5F 2MKIA 5K14B 3WDOA 2JNJA 3CMAS 5HQLA 1U8WA 4DI6A 1HD1A 4P2XA 4CLUA 1TL4A 3TO8A 4RW6B 1L3SA 4HH1A 3KK1A 4LQ3A 2B6AB 2F8MA 4A8YA 3HO1A 4OX9F 4PG4A 2CPIA 1RXOB 4ZPBA 5LM7E 1FA0A 5HN0A 3IO1A 2RF2A 4R25A 1Y7PA 4FVMA 2FJEB 4OX6A 1NSKL 1HQUB 1IXKA 2HYIB 4EZ9A 4MIWA 4DR7F 3GR1A 4NLGA 3WC0A 5JMNA 1Z4UA 4RWXA 1FEEA 3EXYA 2AP6A 2QJ3A 2R8JA 5BYRA 2POKA 2LQ9A 1HI8A 1Q86T 4MTPA 1C1CB 2WONA 4C0BA 4DL3A 1ZAVA 1R8BA 4ETXA 2D7SA 1XWLA 4AQYF 5B08A 2RHQB 2E5JA 3L4BC 4CRJA 2CJ9A 2DITA 5EGYA 1IBKJ 4LSZB 3BO2A 2XLKA 1WOPA 3BQ0A 2BVZA 2VFVA 4RWWA 3QAUA 4RNMA 3IR6B 1NXIA 3MM7B 4ZVGA 4N41A 2J0XA 1VK3A 5KG7A 1FI4A 1CPZA 4JUZA 1TKTB 1YRTA 4DV1F 4UW2A 4Q8EA 1WDDA 3OQ2A 1GMVA 4PR6A 2Q3PA 2AEFA 1RB0A 3R2DJ 3SEOA 3H5YA 3P5BP 3NMRA 4ELUA 2VBXA 4IG0B 3MWBA 1NDPA 1KKHA 1GX5A 2C2RA 1SB6A 4U8YA 4K4XA 4KR0B 1H0HB 1I1GA 1OJ4A 3W5YA 2ZJPQ 5A8KA 4QU6A 2HMIA 4B3OB 4UOCA 1NHUA 1PJ5A 2ZDOA 5CYMB 3PZPA 2RT3A 3MR7A 3TJ9A 1WJ9A 2OPQB 4NCAA 1NK5A 3BSOA 4DUYJ 5G0RA 2ZJQQ 4IG3B 2WW4A 4RUAA 2B4OA 4WP9A 1S57A 1QD1A 3MCOA 2GO9A 1WSRA 3W65A 4I7FB 4Q7AA 2ZC4A 2VBZA 1OWXA 4O4GA 1GX6A 2MKHA 5BYQA 4KH1B 1TKXB 2B9XA 3MR2A 4NLRA 4CO4A 3MXHP 4K5RA 2YNHA 5DQHA 4QIWD 2BE9B 2VDHA 4MK8A 3N4WA 4IFYA 1MU2A 2VC1A 2E9TA 3A8JA 4DX6A 1HWUA 3RB3A 1HNZF 3M05A 3LP1A 2H4YB 1RWWB 3J81Y 1U2RA 3SFGA 3PHTA 2J9CA 3KK3B 4R0EA 3DLKB 2XQCA 4DL6A 4Z37A 1YGYA 3QIDA 3TZZA 2KG0A 4YEAA 1RT2B 1B3TA 2OSRA 4CWBA 4EO6A 3WHIA 4J90A 4DG1A 4U96A 4WTOB 3HCXA 5HMWA 1LXJA 3BBFA 2CUYA 1UVJA 4JI0F 1YBAA 4OI2A 3T5LA 4C98A 1T03B 3TA2A 2VQFJ 1RTIB 1TK0A 3CO9A 4CH1A 3RAXA 2XYHB 1FDBA 1G7CB 2IC3A 5E33A 4LVOP 1EQMA 5KFYA 3CXCR 1LQ9A 4HT7A 5EUHA 1SKUB 4EFAC 1JKHB 1IVZA 4I64A 3C6TB 3NLCA 2HS3A 4LSLA 1RHKB 3KMSA 4DSLA 3AOBA 3OUYA 2IA6A 4B9VA 5A8RB 3ENQA 1TL7A 3HD1A 2HSEB 3LWMA 4W90B 1F2HA 1KWMA 2HNZB 4B3MF 1CJUB 2A10A 3VAIA 1K1QA 5F3TA 1WG4A 4CLZA 2HRUA 3Q89A 2EEYA 4DCPB 4P2SA 1NZ8A 3I0SA 1CBKA 1RWVB 4ZIWA 4Z2XA 3SV4A 2H1YA 2R4FA 3UR0A 1S1XA 2PN6A 3B82A 3M2VA 4JI5J 4FKYA 2Y0SD 2ZKUA 1OS5A 4NMXA 1CEZA 2O3DA 2Z2ZA 3EGZA 3PYGA 1NJXA 4DV7F 2FZKB 3UO0A 3NEKA 4IH6A 4CLTA 3M2RB 1Q7LB 3MR5A 4M5KA 3EXCX 3F44A 2YX7A 2VBWA 4KPYA 2BKOA 1RTJB 1JLBB 2P5VA 2XWXA 4O3SA 2CPXA 3M8WA 4OYMA 4ECWA 3GIJA 4FVCA 3C19A 2B5JB 3MMBA 3UFCX 4DR7J 2GGPA 2DD8S 2KZMA 2ZH2A 4IFVA 1S6PA 4IRKA 4ZHRA 4QU7A 1RTDA 3QWPA 1Y11A 2VOOA 5HQ8A 3DU5A 4NZ0A 4GVBA 3TAMB 1R3NA 2HHTA 4ECUA 1Y00A 1SUQA 4F4XA 2MSSA 4OL8A 2D9OA 3M9OB 4AQYJ 2WRMA 5ETKA 3R6LB 1REVA 4DPUA 3RGIA 2QYCA 1OMSA 1FF2A 3HVTA 4YDXA 5H1SV 4IDKB 2MZSA 3QFWA 1HYSA 1TZ0A 2OKQA 2M5YA 4MKYA 1T9UA 2Z56B 1FDAA 5DETA 4DV1J 3ZZUA 1UFWA 2HHSA 1C4AA 3HPOA 3MPDA 3DRRA 3IWXA 5HAOA 1R0BG 4C11B 1UP1A 4M5LA 4OYPA 4DQIA 4L74A 5KFGA 2NZCA 5J1PA 2FGCA 5ETVA 3HHDA 1FHTA 3NGKA 3PO5A 2XO7A 4RNOA 1OY6A 2FY1A 1DQ9A 1EKSA 2R7VA 3H2VE 5K14A 4AT1B 4PG8A 1EAYC 4H4MB 4W92B 3T6JA 4RW6A 4RKUC 2M7SA 4FXVA 2WB4A 3GV7B 3JSMA 3FEYB 2B6AA 2MQNA 2GQ2A 2A1BA 2IM1A 3MTJA 3RB4A 1C2PA 3T5KA 3NS7B 1MWYA 3I9ZA 3TX0A 2HHVA 3OFEA 4ED8A 3V4MA 4ECVA 3HVRA 1UFLA 3ZNJ1 4L6V3 3A3NB 1HQUA 2CRLA 3SCJE 2BUNA 3P45B 5KFHA 5C5JA 2P9EA 3A3OB 2WW8A 4QOTA 1F0XA 5LXRA 2PSZA 5KFQA 1S1VB 2QMWA 2ERRA 3W9HA 1C1CA 2GHPA 3DHWC 2EWHA 3R5JB 3OVSA 3D2WA 2V69A 3CCVS 5LJ3Y 1SI9A 2O01C 1HL6A 1NNDA 1T05B 2L08A 2F63A 1IBLF 3C3LA 1EQ0A 4E8UA 1QUVA 4PEOA 2D3ZA 1VC6A 3HZEA 2XYPB 4JI0J 1ACMB 1JK9B 4DSKA 2N4CA 2UUCF 3CD0A 4LF6F 2MY8A 1TKTA 4BBYA 2AGPA 5DDOC 4LBHA 1VQ6S 1S72S 4DFKA 4X64F 2HBQB 1EZZB 4IG0A 2KM8B 3GIIA 3RJMB 4WPAA 2B9WA 3GQCA 2JH3A 4ECRA 1ELOA 1UETA 3BKTA 2I5JB 1P9QC 4QIFA 3ILLA 1IKWB 2Z57B 2MHEA 2F8EX 3CDEA 5AE2A 2JX2A 2OHDA 1UPMB 1X9WA 2OPQA 3GWCA 1R0AB 2OPPB 1LK7A 4B3MJ 3GJSB 3R6GB 4DFPA 4C3KA 1NM2A 5LMNJ 4IR9A 4UOHA 2AW0A 5FDLB 3CJ2A 4NZ7A 2ZBCA 4CLYA 3UD3P 1TKXA 1CJKB 4OIXA 1H7WA 4LR7A 5DGBA 2Q6CA 5HJXA 2W7OA 2EW9A 3C2PA 2NYHA 2ZZMA 2DNGA 2OPRB 4ED3A 1O5JA 4F3OA 3FC9A 1MWQA 4EYIB 5C24A 3FSIA 1HHSA 1OSDA 5B0CA 4JI3F 3UVJB 4DV7J 3KK3A 3NY0A 4DPOA 5D78A 4QIVA 4DHVA 1KQFB 2B43A 1IQZA 2YBVA 2IVYA 2MPUA 3R1HA 3EX7B 1YIJS 2ZDPA 4C8YA 1YSJA 4WTYA 2AYGA 4V19J 3NOCA 4B3TJ 2EKYA 1FERA 3TUIC 2ZBQA 2CWKA 3N5FA 1QJHA 1FRXA 2R2RA 2V50A 3NCRA 4HHJA 3G71S 1RT7B 4WYWA 1FE0A 2NSCA 3N6MA 2J9DA 1T03A 2JFKA 1RTIA 2DK2A 3VAMA 1B0PA 3CJQA 1JNRB 1HBMB 1NK6A 4RNFA 3MFIA 2Q66A 1N4LA 5CZVA 1X4DA 3GJQB 3NAHA 1DZ5A 1RHRB 2XB2D 4USWA 2QLXA 2E5GA 1R8AA 1I6JA 3C6TA 5HBMA 2DXEA 3K59A 1D0EA 2ASLA 1IR1A 3UR3C 4RU2A 5A8RA 1WKKA 1VRTB 1JQGA 5KOWA 2PI5A 1TUVA 3N28A 4G6VB 1VBKA 4O3PA 3K0JA 2HNZA 1CJUA 2DXDA 3PFOA 1PGZA 1FKAF 4ALZA 1L3TA 4K4WA 1FT8A 4K4UA 1VQPS 2ADBA 3NGRA 3K5NA 2H5JB 2MQLA 2B8PA 2ALZA 2FLNA 2KJVA 3VF0B 2PA3A 3HSDA 4NA2A 4ERDA 1S6QA 1U7LA 1QAIA 2W4DA 3EDQB 1W7WA 2GA7A 1GFWB 3W2WA 2DRBA 4ECYA 4OLPA 4F50A 4A4JA 1XBWA 4B9MA 1G6BA 2WOMB 4IO9Q 2JRSA 3GIRA 1BLUA 3M2RA 3V4IB 4TU7A 1M5KC 2EC0A 1JLBA 4USHA 1IN0A 3MEEA 3QBCA 5KT7A 1TL1B 3LUYA 5IC6B 2Y8YA 2XMTA 1Y9OA 3JB9k 1OY8A 4I69A 3R97A 3GJTB 2QV6A 1SPBP 3GG1A 4USJC 3AODA 4FYDA 3MTKA 3IR5B 3BPDA 3IP0A 4YB7A 4BCAA 1JX4A 4X2BA 1BQNB 3DOMB 1WF2A 4CO3A 1XMQF 3GSIA 1GXUA 2DIVA 1AROP 1VQ7S 2AKWB 2HZVA 4H4KA 3TVYA 2PFFB 2V63A 4ID8A 1MNEA 1T8EA 5FIIA 3ZC4A 4LF1A 1NKBA 3MECB 4YR0A 2RUGA 2KXFA 4N7TA 2FY8A 3OTCA 5B0EA 2F1FA 1WKJA 4IDKA 1OSCA 1HKAA 2KHCA 2M88A 3KFWX 5L38A 2WZ1A 3MAQA 1MW7A 2YX1A 1VCTA 3P6YC 2EXUA 2UUCJ 1VIXA 2VU5A 5KFAA 5K8NA 3M8YA 4WKRA 4LF6J 2XMWA 2KH9A 4JV1A 1S7HA 5ADZA 1U2CA 4ID5B 3R7NB 4CNYA 5A0YB 3J7YU 1MN7A 2MQOA 3VGTA 4X64J 4C11A 5MLCV 2QA4G 1JXVA 2LYVA 2RILA 1YITS 4J91A 5H9EK 3CJ0A 4K59A 2IBKA 4ANCA 4NLUA 3M4XA 1X0PA 3CGIA 1JIHA 2M52A 1RP5A 4NMLA 1FNXH 3WX8A 1Q8IA 1H74A 4KT0C 2NCKL 2V9WA 3QJJA 1BY9A 5CABA 3A8IA 4DPYA 5EN1A 4H4MA 4QPTA 4M5IA 1S1TB 1SC3B 3BS9A 1U0SA 4R8UB 2IMWP 3KMQA 3G2XA 4OQJA 2XGPA 1U1RA 1JB0C 2A18A 3BSAA 3BBCA 3NRBA 2CYYA 2MJUA 2C3OA 2ZM6F 4M5DB 3I5CA 1S9FA 5JXSA 4L76A 4FYWB 3KK2B 2CPHA 1RADB 2GAHC 3EDRB 3BF4A 3OVAA 3S1TA 5KFFA 4LFCJ 1U6FA 2CNKB 1S49A 4KV8A 1YJUA 4JI6F 4JI3J 1S1VA 3IA0A 2B9EA 5C7PA 2Y9HA 1Q16B 4NL5A 2F9JA 2GJ2A 1UA1A 4OJ1A 1LWCB 2GMHA 1AYEA 1T05A 1H2UX 5L8RC 2IHR1 5F8JA 4L75A 3UW1A 2R9LA 5LSOA 2ZWPA 4J9PA 1DTTB 1X4HA 3W8GA 4P2MA 4ZN1A 5FJ4A 4Y2CA 1TKDA 4WFZA 1GH8A 3IWNC 3HXMA 1URRA 4QCLA 3DOKB 5DS7A 4FNIA 2AZ1A 2VF3A 1HNIB 1K0VA 1IJEB 2K7JA 2BBEA 4N8OA 2MEWA 1N5SA 4PQUB 2KJWA 4QR1A 2I5JA 4MT1A 3VHQA 2N3OA 2HAIA 1IKWA 2XS2A 4K4VA 2LVWA 3DCAA 3IMQJ 1RI7A 3K17A 1VFJA 4WZQA 3GR0A 4DUTA 2L9NA 3L95X 1R0AA 2OPPA 2XMJA 4UQTA 3AD9C 4DR1F 1AT1B 3CCRS 3W3SA 2AX1A 1HWJA 2Z2LA 3D1HA 1N8RT 5FDLA 3NKYA 1FRKA 3U1LA 4ZVOB 4ZVRB 1ZZNA 1CJKA 4TKTA 3DGPA 1BXNA 1WHYA 3HMJG 1UVKA 2OPRA 3NGSA 4DBQA 3DLBA 3UD5A 1G1XA 2CA9A 1LXNA 3NL0A 3LAMA 5EWFA 3WBZA 3AJDA 3UVJA 3GZ7A 3RRHA 4U6PA 2G2ZA 4K4SA 1PYOB 4CM2A 3HVAA 2DH8A 2DNQA 3RUBL 2JLFA 3A8EA 2WSCC 4JI7F 1Q78A 4C8NA 2DXFA 3CTRA 2Z8QA 3T9ZA 2HQCA 3MF5A 1IWAA 2NXUA 2Z58B 1RT7A 1Q5YA 4I4BA 2VFTA 3ADAC 5I3PA 4C9DA 2BKPA 3AHPA 2EPIA 1PG5B 1RAAB 4EGLA 4IUFA 2DHGA 1HBMA 2QFIA 3R7SB 2IPOB 4L73A 2A0FB 3MEDB 1XMQJ 3X1LB 3OTDA 2H5IB 1NH7A 2D74B 2HVEA 5I4MA 2D41A 3VAFA 2IVFB 2LXFA 3UCGA 4OJHA 3FCHA 3MHYA 2B7BB 3PJ9A 2X3GA 1X9SA 4E0DA 1VRTA 2PA8D 2AJQA 4ZP7A 1WC0A 3N5BA 2DH9A 2QRRA 4DV2F 1F2GA 4KHPF 4KFBA 4I0WA 3D54A 1X0FA 1RT3B 3PX6A 2B4PA 2RQ4A 1YJWS 2WVDA 5D4NA 2V0NA 4CO5A 2DGVA 1ZAWA 2DY1A 6AT1B 2ZOFA 5J2NB 4YB5A 1UL3A 3MMCB 4MK9A 5KT4A 1TU0B 5E3AA 5IS2A 5CYQB 1IKYB 3UN3A 2QA2A 4TY9A 1LFPA 2EFNA 3RZAA 2IM3A 3TRGA 3ZZOA 2BJ9A 1HNWF 1B99A 4DXLA 1RKIA 1QLNA 3ISZA 1H73A 2WOMA 3M6VA 2IRXA 2AF6A 2E5LF 2N7CA 1J5OB 5DLFA 2ZM6J 2XGQA 1K9MT 4F4AA 4UTGA 1BQXA 1TL1A 3RW6A 5KFTA 2C3YA 2BW7A 2R2UA 1E6YB 3W61A 4WXOA 3TJ8A 3LP2B 1S9GB 1S0OA 3PEHA 1WC5A 1H6KX 3TEGA 4DCJB 1FESA 3IGNA 2BE7D 1Y3JA 1BQNA 4JI6J 3RYLA 3N6LA 2QG9B 3DOMA 2N3LA 4DSFA 1KD1T 4WIIA 2MYFA 2HFSA 3BKFA 4LVNP 4U7CA 1X4BA 5F8LA 2L41A 2R3VA 2Z2MA 2J8AA 1IM4A 1TL3A 1ICEB 3FZ2A 3MECA 2ZBIA 1Y4ZB 1RABB 2HHUA 4ITSA 1WNEA 3Q8QB 2XCAA 4C8ZA 1DRZA 3FCVA 2RQCA 4DU7A 1X5TA 2HLTA 3HZGA 1K1SA 2DT9A 3HHLB 5KFLA 2BJ1A 3CW2C 4ZVPB 2LQ5A 4DUZF 4C3LA 3EGWB 2ATCB 3BV8A 1IWGA 3GFZA 4ID5A 3K57A 2W8LA 1MWZA 1RQ0A 5F3ZA 1IR2A 4DLEA 2A6MA 3KYLA 1HPZB 2VFSA 4NLDA 1UEKA 4LF4F 3DM2B 1N5YA 1HBUB 4ZLLA 4UZBA 2XTJP 1NUEA 1QAJA 2KFYA 1N88A 3PG9A 1S1TA 3LA0A 1DARA 1W26A 1NPPA 2MLYA 4R8UA 3KJVB 4HDGA 4RW9B 4DR1J 2HHHF 4OHVA 4J9QA 4C7QA 2M0GB 4C3MA 5HMXA 1JLQB 2KN4A 5DG8A 1CLFA 4E2FB 4M5DA 2F5GA 4IRDA 1YJNS 4OX7A 4YY3F 3J7A1 3KK2A 5AJ3J 1DTQB 1BUXA 3M8QA 3FKBA 1B7YB 3T1HF 4LRFA 4DV4F 4J9UE 2DR5A 1XR6A 2NSBA 3H2LA 3M30B 4A8XA 1LKZA 2IYIA 3QGIA 4TYBA 2CAJA 5AXNA 1KLMB 3E51A 1SJ3P 2CPEA 2EBEA 4OI3A 4MIAA 5FLXY 4DR5J 4DMZA 3J7YI 1S76D 4P10A 3HP6A 4O3QA 4C0OC 4DPWA 3E01B 1YK9A 4JI7J 2VJVA 3G8SA 2Y1IA 4C8KA 2AEJA 4KY3A 3RBZA 3E3XA 3HJVA 1DTTA 2ZBPA 5HP1B 1GTEA 3M8ZA 4IYQA 1WC4A 3EWGA 3FSYA 2G0JA 3FNNA 1UEVA 2QGFB 2BMBA 3D6MB 2BW2A 2HFUA 3N79A 3VALA 3PX0A 4HEA9 1U8SA 1JJHA 2I2YA 3PYDA 2DNPA 3UDCA 3P3DA 5J1NA 3I5BA 2DR7A 1SH2A 3QJLA 5D3GB 1S7IA 3JQJA 1SJ1A 1QSYA 4DV2J 4KHPJ 3L7UA 1VR6A 1JXLA 5KFUA 1DBDA 3HM9A 3HDSA 2CPDA 4R0JA 1XN9A 1LWXA 3JTPA 3MI7X 1JWWA 1KDNA 2UP1A 1RA7A 2OEKA 4MKVA 3ZTPA 2VICA 4DL5A 4ZPDA 5H9EJ 4ZPVR 4R5PB 1ZETA 3VCDA 2JEGA 1SV5B 1SH3A 4NI2B 1X5PA 3OTOF 3QT8A 3H0PA 3RR8A 1KQGB 3M6WA 1YZ7A 1HNWJ 3EM1A 2YKOA 1C0UB 3VAJA 1NAQA 4W98A 2IA0A 3BH6B 2K3IA 3QT6A 4AYBD 3F73A 2LA6A 2E5LJ 2HQIA 3V6JA 4Y2AA 1RWMB 3SMZA 3POTB 4RBUA 3NBPB 3U27A 2LU1A 4J9LA 1S97A 1SCJB 3ZTSA 4ED5A 5BJRA 3NP5A 3B6BA 4LIRA 3BREA 4DSJA 5KFWA 2CWXA 2PFDA 2HVIA 2BABA 1NPRA 4YFUA 3QWUA 3Q8RB 2MGZB 4JYAF 1VQ5S 3DRSB 1U24A 1FFGB 1UW9A 4TVAB 1JLFB 2J76E 3K7RA 1VLOA 2KT3A 3KDOA 2W9AA 5IV4A 3P49B 3I0RB 2MZJA 4M63A 4P6QA 3SIPB 2XG8A 5KFMA 3C15B 1N5QA 4JI8F 3I55S 4M5JA 1NRKA 2C3UA 2W25A 3J80U 4C0HA 3EPIA 3B78A 3C8YA 4O23A 4HH0A 4MK7A 1KBRA 3CD6S 4KC5A 2V2VA 1RT3A 1NK9A 4HI1A 3PRDA 1R43A 4DUZJ 3QFHA 1N54B 4IH5A 4DU8A 2DNNA 1RBAA 3V81B 1T9WA 4GVLA 2CG4A 3CIMA 4IO1A 2XMUA 4U7UK 1NK0A 1FFWB 3TZYA 5J2NA 3Q2SC 4Q0BB 2W4PA 3MMCA 2JLGA 1PJ6A 2WK4A 4ICLA 2QMUB 4UOFA 1KTVA 3CJ5A 2FLLA 1NKEA 5I3UB 1TQLA 5CYQA 4LF4J 5DZ6A 2FHMA 1V3RA 4TYAA 4ECXA 4EK2A 1LWEB 4ZCIA 2QIFA 2HKEA 4LBIA 3WIUA 5SUHA 1UEUA 2HHHJ 3J81j 4K50A 2RNEA 1J5OA 5KFEA 1DFDA 3JTOA 1XJWB 2OD6A 2UUBF 3KK1B 2HVHA 2P2CB 1E6YA 3QO9B 1VQLS 1U26A 1RWKB 4B9SA 3LP2A 3TWZA 1DY3A 3KUGA 3GFYA 3T1HJ 4DV4J 1X4AA 4J9SA 2N4DA 4DQSA 3QT7A 2J8SA 5F41A 1VDHA 3GJRB 2ZNZA 5D8HB 4ZLJA 3PKYA 3PYEA 2HURA 2YQ1A 4UUXA 1GXTA 3C14A 4A8WA 2OO4A 4LF7J 4ZPWR 2NUHA 3PHEA 2LEPA 3BGLA 4ELTA 4N77A 3N6NA 1VOMA 1SJFA 3ILOA 3IG1B 4XK8C 2A3JA 4WK3A 5KT3A 2XY5A 1S4FA 3DXBA 2ADCA 1RYRA 2E1PA 4DR6J 4HTIA 1N48A 1LWFA 4CTAB 5F8IA 1FWLA 2E1CA 2ZJRQ 3HHLA 2CNNB 3FRYA 3DOLB 3LANA 1UA0A 2V34A 1PIEA 3CULA 4X4OA 2DNZA 2DGQA 1ZZFA 2CZVC 2ZD1B 1PAEX 2JC0A 4NASA 1HPZA 1QTMA 3GMGA 5DM6Q 2QSFA 2R2SA 1OO0B 4TXSA 3DM2A 4EUVA 3E2EA 2LECA 1N36F 4OFZA 4Q2LA 1UJ6A 2RUSA 2LQJA 2W9CB 2HBZB 3THVA 4EI2A 3KJVA 4IOBA 4PXEA 4RW9A 1SQEA 3FUYA 1BGXT 2QL7B 2BQUA 5DQGA 1JLQA 2OFGX 4GO7X 5B7WA 2IM0A 1XQIA 2ZH1A 1H3DA 4P73A 4ZVQB 1VQ4S 2ACMA 2HNYB 1F9FA 3PACA 4V1Ak 5BYSA 2ZUGA 2MQ8A 1DTQA 2DNHA 1BQMB 4PQAA 2MQPA 3OTOJ 4DX7A 3VAKA 3EPGA 4DL0C 2QO3A 1QY7A 3EMTA 2CPYA 3CC2S 3UNGC 3FBEA 2AEMA 2C1EB 4LRAA 3T5HA 1YJ9S 2FHJA 4FZVA 5KOXA 3LP1B 5LSRA 1FFSB 3KLGB 3T5JA 2PMHA 1VQSA 3CCWA 2FGOA 2RMLA 4UOGA 3H90A 2K1RB 4FF2A 5ETPA 2AIRB 1S0VA 4X4SA 5HP1A 2RAQA 1Q8LA 4DG1B 1A6LA 2ZITA 3O2IA 2NREA 1I3OB 3GLJA 3MURP 4FBUA 1YDLA 1BE4A 5HVFA 1R7IA 1I5OB 2R42A 4JYAJ 1O0PA 2VFUA 4ZVHA 2FLPA 3I96A 3G96A 3CMQA 4NCGB 5E0OA 1P1LA 2X1GA 1N5TA 3IM8A 2RU3A 2QMXA 3UDLA 1HFEL 2R7WA 4WFNQ 1CULB 4N76A 1KHWA 5J2QB 3HHEA 1KOOA 4JI8J 2H54B 3SV3A 1PAUB 3J7AN 1ZOTA 5D3GA 2GVZB 2W2OP 3QSIA 2ALYB 1U6ZA 4K4ZA 3A3PB 4ECZA 4OZ5A 3FQLA 3D67A 4NX9A 5MAOA 3IN5A 2F3JA 2OFHX 3MM6B 2NXNA 1H72C 3B4DA 1U49A 3TP2A 3RBEA 2XMAA 5IT9Y 1FTCA 2RS8A 5JVGQ 3TA1A 2FUG9 2ASDA 2CJYB 4CO1A 1UAWA 1S48A 3EE3A 3T1AA 4NLQA 2DJWA 3ZTRA 3SSRA 4R5PA 5E3CA 3FBFA 4ZK7M 1M5SA 1RLDA 1V5IB 4LRBA 4NI2A 2YKNB 1TFYA 3EJMA 1RT6A 4N5SA 4I1TA 2UVUA 5D6GA 1R0CB 5AXLA 3EVMA 3TANA 1HBOB 4NLPA 1A0OB 1C0UA 1X4GA 4M5NA 3PDNA 1U1NA 4NWBA 4A8KA 1RYSA 4DF4A 2PDAA 4TU9A 2LKZA 3NBPA 2UUBJ 1HMVB 4AL5A 4N8NA 1T0TV 1D9FA 1SH0A 3TVKA 4CDIA 1R89A 2B8QA 1YTYA 3NCPA 1JJ2R 2GQCA 2CZ4A 3CDAA 3R9LA 2R7TA 2XNQA 1RCXB 4CZCA 2MGZA 2BJ3A 2QSWA 3MR6A 3DRSA 3HFKA 4LSNB 4URSA 4CO2A 2IJRA 1JLFA 2QYGA 3CJ3A 2HQGA 1VYAA 5KFIA 2EG2A 4WFXA 2VPWB 3OR2B 3EZ5A 3TAPA 1HD0A 3F0NA 3GCWP 4Y3CA 1YKWA 3R5BA 2YKAA 3EGNA 3TNVA 4DPTA 3BB5A 4XDDA 2QLFB 4PCQA 2G0CA 4UY8T 5HATA 4ECSA 3OLBA 2CJAA 1IJFB 1GQEA 4ZP9A 2R7SA 4OX8A 4F2SA 1PILA 1HYSB 2JEFA 4TNOA 4NLSA 2UXBF 1DQAA 4OMFG 1NHVA 4Q0BA 3V6DB 2M2BA 3HHNB 4RPFA 4F3MA 3WZ0A 1KQSR 1NSAA 4NLXA 1SKRA 2ZVIA 2YX4A 3GILA 2V9KA 4ZCMA 1N36J 1S12A 1YBTA 3SI8A 3AXMA 3LALA 1RT4B 1LWEA 3KLVA 2VL1A 2DISA 3QRQA 1KR4A 3BO4A 1LW2B 3NCQA 4TN2A 4WKYA 1WOSA 5SZTA 2F4VF 1XMBA 2GW8A 1NKCA 4F36A 1KN6A 4FYXB 1YI2S 2GV1A 3JSMB 2B56A 4F7VA 2HW3A 2XULA 3MFHA 2R7RA 4M5HA 4FXDA 2AT1B 3QO9A 1U6BA 5ETOA 3DYAB 2W2MP 3JAMY 3J81U 4EEYA 4DS4A 4PG6A 3HT3A 4C8LA 4GKKF 3DRPB 4M94A 4G1IA 3GP9A 2X51A 5DJBA 2J7WA 3FEXB 1HA1A 4HKQA 1SQFA 1B7FA 1RWUA 3TW0A 3V2UC 1RHQB 2HWTA 4CCHA 2P9CA 1QTNB 2GJIA 3SDEB 3DXSX 4OZJA 1HIYA 3AQPA 3IG1A 2XHCA 1RTHB 3SYZA 3M6UA 6FDRA 2D69A 3T1YF 2G2YA 2QL5B 4NXMJ 1RBOB 2HZAA 3SQGB 3PIPQ 3PW5A 3NWGA 4CTAA 3D68A 1FTRA 3MPYA 2Z30B 3R5AA 2CQHA 2FQQB 5F9LA 3DOLA 5CZXA 1SVDA 1UVNA 2FVQA 4WYLA 3L09A 2ZH5A 4FKXA 1EIYB 3LGMA 2ZD1A 4TLQA 4Y6IA 2XEXA 2HBRB 2OJ3A 2LQBA 1IKXA 3IRWP 3G8QA 1LV5A 4QBUA 2BQRA 2GIFA 4KJIA 4IQXA 3QJPA 3TARA 2COLA 4KO0B 1B0VA 5RUBA 3NNAA 2W9CA 2EFQA 4MKBA 5CHCB 5LL6d 1X4FA 2E7WA 2BV3A 3RAQA 2HPUA 3ILJA 2D3O1 4WE1B 1M1HA 4CM0A 4ZCKA 4NOHA 1XR7A 4CIOA 3VR1A 2CG8A 5THWA 2HNYA 1NBEB 3HSZA 1EHWA 2KZZA 1ZM9A 1T3NA 2N7YA 3EVWA 1NZAA 4DV5F 5A2QY 1Q81T 1BQMA 2DB1A 1X5OA 4JI4F 5T14A 2J5AA 3EGVA 1RK8A 2APOA 1B64A 2VDIA 3GFHA 4YUDA 2YQ0A 3K5OA 1WKLA 1HHQA 2KHDA 1ZBTA 1MN9A 4M1KA 2HAFA 1RAEB 4M8LA 1X9MA 5CD4H 3ICLA 2YWHA 2XMVA 5C24B 2XLJA 3KLGA 2ZH9A 1VQOS 1R6YA 4OJGA 4XTTA 2RVJA 4IOAQ 3DN9A 3D1OA 1VRQC 3ZZRA 2XYGB 2VPZB 3NG8A 4ETZA 7AT1B 2K1RA 1RTZA 3MR3A 1VQKS 1TTHB 3MMJA 3JQKA 2E7XA 1HW9A 1SQGA 3HKWA 1CJVA 4EMDA 4ZP8A 3S01A 4FS2A 1CJTB 4EBDA 3KKFA 1F3VA 4ENOA 1KLNA 3ISND 3TZWA 2F4FA 4M5GA 5L1JA 4NCGA 3TZXA 3CDWA 3AD7C 1S77D 2MQMA 2FJAB 3O5TB 3PCOB 5E5NA 4HACB 3Q8SB 3MGJA 4ATNA 4P7VA 1RE1B 1CULA 5J2QA 3VZHA 3CWJA 4TU8A 1NU4A 1A9NB 3R5GA 2GVZA 3JYTA 1KVIA 5HBMB 2VA2A 2J7KA 2V94A 1OYDA 2PIIA 1UFKA 2V6AA 4XPEA 4XPCA 4X4NA 5LMUF 1ZYQA 3KLIB 4OYZA 3MM6A 3HD2A 2VG6B 3KHGA 4KE5A 2HNDB 1FE4A 4B17A 2AYEA 2R7OA 5EX0A 2AV5A 2JWNA 3KJQB 1R31A 5KG0A 2UXBJ 4AL7A 4RZRA 1IQTA 2XHWA 2H65B 3C66A 1BHNA 3HHLD 3G6YA 2KXNB 5CA5A 1URNA 2YKNA 1LOUA 5DZ7A 2WAQD 3CB4A 1B70B 3D4JA 2XLIA 2UUAF 4FYVB 4MYTA 1HBOA 2PE8A 5M2PA 4AD6A 1S6QB 4YN3B 1VJWA 3FSXA 4OLOA 3EVOA 1RUSA 1XMOF 2F4VJ 3W2WB 1NDKA 3H5SA 2CVEA 1XNQF 4KPCA 4P71A 4DEZA 1HMVA 3KJNB 1MSWD 3RRGA 2ILZA 2AU0A 3CF5Q 1VBZA 4OX9J 1WOOA 2DVIA 3KWMA 4NXNF 3PM9A 4ILRA 3MEEB 4USTA 2P6SA 4K4TA 3GYGA 4KSEB 3B54A 1ZTTA 4GKKJ 4WU3A 4X4QA 3ULHA 3KG1A 3OSPA 2C2ZB 4LSNA 4UF4A 2HRYA 5KT2A 4F2RA 1OQ6A 2BE2B 2C22A 2NUUG 3OR2A 1AFJA 2KVIA 2DRDA 5HQMA 4OZ0A 3GYXB 2H51B 3JS9A 2XCPA 5HJYA 3PV8A 2R8KA 4BDPA 3OD2A 1YRUA 1RZMA 4KIAA 2YWEA 4EYHB 1Y3KA 2FHJD 3Q23A 2YY3A 4Y2IA 3GSDA 3IBWA 2BOAA 1S59A 4RW8A 1EETB 3OTEA 3JSRA 2ZUAA 2L9WA 3HI9A 2QZ8A 1WTFA 4JBCA 2YH1A 4A46A 1Q82T 1KC8T 3CCUS 3UDEA 5IV3A 4XAKA 2M9KA 2EK1A 3BKUA 2MLXA 3V6DA 3PFEA 2JVOA 1NEEA 2ZH3A 4K5SA 2HQ3A 3BO3A 2LEAA 2YNIB 2XZTB 5GAEU 2ASYA 2CQ0A 2VKZG 2IY5B 1UWBB 1RT4A 4OHYA 1TFWA 5HROB 2MXYA 1NSPA 2M70A 4KQZA 1LW2A 4PYAA 1YQHA 4KGZB 4YB1P 3ET6B 4YP3A 2RIJA 1AXQA 3KNGA 3OFGA 3SZ2A 3T41A 3DYAA 4DV5J 4BWMA 2VBYA 2YTCA 3W2VB 4JI4J 1KP6A 1TAUA 1EJ7L 5C2GA 1ZPVA 3VGVA 3DRPA 3RW7A 1D1UA 2GMLA 1U0HB 1Q79A 4X4VA 1N33F 3BGFA 2HS4A 2B7CB 1JLEB 3GONA 4OZNA 1UVMA 1HNZJ 4KV8B 1WEYA 5IT0A 3PR4A 3Q86A 3SDEA 2HK2A 1WEZA 3TUJC 3W60A 4OZ1A 2VA3A 1TUGB 2UXDF 1RTHA 1WF1A 4QYRA 4B02A 3FDSA 3IC1A 2ZZNA 3RU0A 4X4UA 3MM8B 2LEBA 3SQGA 1WSVA 2ROGA 1FVQA 2YWWA 3U1NA 4D3GA 4PKDB 3PNIA 2HIYA 3CE8A 4ZPCA 2FHKA 1XNRF 3DDIA 1YLXA 4QYZK 1SL0A 4BHQA 1ZS6A 1TK8A 1NMEB 4O0IA 3D9BA 1J5EF 4KO0A 2YNGB 1X8DA 4IKAA 3LOUA 5DLGA 5K20B 5A6PA 4NZ6A 4LBPA 4G1PA 2IAJB 2UV8G 5LMUJ 1LW0B 5CXTA 1SIZA 2V4RA 3HKZD 4EWTA 2G2OA 3I87A 4WE1A 4FDFA 5F0UA 1DLOA 3Q8UA 3AB2B 5DQIA 2E5IA 3D0GE 2LQ8A 3AAWB 3TUZC 2OTLS 4F0MA 5L1LA 3RAMA 4I56A 1XIQA 4QIEA 1YWXA 4D3HA 2W2PP 5J2PB 4EZ6A 1FJ7A 4E98A 1AUSL 4QWCA 3D1QA 3DGPB 5I42A 4OI1A 3AA9A 3DGVA 2UUAJ 4Y00A 1XK8A 5AXMA 2G13A 1MROB 3P8BB 2RB7A 1S4EA 5D4OA 1IBMF 4GKJF 1U4BA 3M8RA 3T19A 1XMOJ 2J9EA 5KFBA 2E9RX 5K8OA 4MH8A 1XNQJ 2EC2A 2W2QP 2W01A 1WHWA 5DGAA 4LFBF 1CC7A 4EO8A 2IFXA 2GNKA 2IDEA 2K7KA 3K5PA 3A4TA 3UI3A 2HWIA 2YWGA 2WSEC 1VGYA 1FDDA 5C42B 5KFDA 4FBTA 3MEGB 1NDLA 1WC3A 3E8OA 1CJTA 2W7PA 1VS3A 1EP4B 4H4OB 5BXIA 3BQ1A 2VG5B 4BC7A 3NOGA 1ZAXA 1G3OA 5M2UA 1T9TA 1Q7YT 2HWHA 2HHQA 1WHVA 1PC4A 2AJ0A 4UZCA 4HACA 1NDCA 4GMKA 4GO5X 3F56A 3N9UC 1U1OA 1XC9A 1U02A 2M8HA 4NA1A 1AW0A 1FKOB 1N32F 2GCFA 2QL9B 3PW7A 3KLIA 5ETNA 2DO4A 4HLBA 3TQEA 2VG6A 2HNDA 2RDJA 4KFBB 4PYDA 2DR6A 1NJZA 2UVVA 2D9PA 4DOZA 2HIQA 3ILIA 4RNHA 2FVPA 2KFNA 2U2FA 1I51B 4O3RA 4ZIVA 4XIUA 1J2VA 2HK3A 4ANEA 4QZVB 2FTRA 2V8HA 5DM7Q 3BGOP 1JMTA 1NB7A 3UNYA 3OPKA 4KGKA 4FP9A 1OIAA 4DL2A 1FX2A 3MOZA 4OZ2A 3W63A 1QUPA 1SL2A 5GAHU 1SXLA 2CJQA 1BMQB 3G6VA 2G4BA 4NA3A 4WP8A 2QT7A 2AJ2A 2RRNA 2F8HA 3THPA 2B3TB 3OXLA 4WZMA 1JLGB 1HNVB 2DGWA 4WIQA 1EX8A 1YJ7A 2YXLA 4QWDA 1U45A 2VPXB 3I31A 3ZTQA 4LIWA 2RJZA 2CVIA 4NYZA 5HMYA 5L9XA 2R7UA 2PMZD 4O3NA 4ZLPA 4X4TA 2DCUB 3QRRA 1WG1A 2OUGA 3QZ8A 3IFEA 1KVJA 3FVYA 2FDNA 4CI0B 2BE2A 1FRLA 4EBCA 3QATA 2C2NA 5DO2A 1RA6A 5JUMA 3VTIA 4DS5A 3R5DA 4DX5A 5CAAA 4YB6A 4G1QB 1AUDA 3KTQA 3QMQA 1QE1B 1JLCB 2AZ3A 1TL3B 5HSPA 1IBLJ 2OEMA 4OI0A 1U1MA 3VQSA 2JLEA 4Z7CA 2Q1LA 1EETA 2OLWA 2ZHBA 3G4SS 4B9NA 3NS6A 3CSKA 1KONA 3GB0A 1RISA 4QIGA 1S0NA 2DR9A 5KFCA 3LF0A 5F8HA 3MPWA 2O1PA 3DRYA 1XNRJ 4PUOB 1C1BB 2DYAA 2YNIA 4RLEA 4YHHF 2ZC3A 1J5EJ 4P52A 5HVHA 5IXUA 1R27B 4QJVA 2J0QD 5A6WA 2ILYA 1UWBA 3LPYA 5HROA 2KDOA 2GZOA 1N5YB 2KO1A 4OHWA 1P27B 4H54A 2DHAA 3I4PA 3ET6A 1Q8KA 3IGVA 3I32A 1QSSA 4WU2A 2D3UA 3MD3A 3T6BA 3AB4B 3PJXA 3UE2A 2J0SD 4WFYA 3A12A 4N56A 3QZ7A 3OSNA 3BGRA 2GIQA 2KKHA 2JJ4D 3W2VA 2FYXA 3H4BA 3CCJS 4QWEA 1NHKL 3H5XA 2VG7B 5HANA 1BWEA 3AT1B 3M8QB 4Y28C 2OELA 1U0HA 2DPJA 1HBNB 3FJ2A 2KL8A 2MZ1A 1JLEA 3CCTA 1N5VA 1IBMJ 3UQSA 4GKJJ 1F5AA 1VIOA 1U48A 3KUHA 2K06A 5F9NA 2XI3A 3MOJB 3GYNA 4ZVFA 1ZM2A 1FKPA 4PZVA 1UKUA 1CS4B 1Y10A 4J7CA 5EX3A 1VQ9S 1FO1A 4YDDB 2Y1LB 2OAUA 5GAEI 4LFBJ 1D8ZA 3G6XA 2AJFE 3HSGA 2Q6BA 3MM8A 3CT9A 3QNWB 4GC7A 4Y34A 2NS1B 2HG4A 4IRCA 2RH3A 1SJRA 1N0UA 2G9OA 2V2KA 3KHRA 3KG0A 2E1RA 2HQDA 4JP8A 1WI8A 1DURA 4YS2A 2QC3A 4YR3A 4B9UA 3K8VA 1MMLA 3CJRA 1Y0HA 4OV6A 3M7VA 2DGOA 5L39A 3FMWA 1RLCL 1VHIA 2WVFA 4PG5A 4TLRA 2R7QA 1F9EB 5D77A 1WUUA 4QR0A 3PJWA 3OHAA 2Q43A 2VB6A 4ZVTB 3D0IE 3BR9A 1PO6A 1K73T 2YNGA 4K2JA 4DFJA 2W9BB 1H2VZ 1HARA 2RDIA 1N32J 4J9RA 2IAJA 4ZOSA 3QSYB 1LW0A 4HDHA 1RT1B 2X1BA 2JOQA 3ZO7A 1Y5IB 3IM9A 3W1YC 4CT8A 3HHKA 4L72B 7FDRA 5J2MB 1KRPA 3CJKB 2K2PA 3W9JA 2ZNYA 3NAIA 2PI4A 4ES1A 1UJ5A 3CDUA 4NPOA 3WQPA 4RL1A 4PXBA 2EVZA 1HQ2A 5J2PA 3VWSA 2KVQE 2HS0A 2I1RA 2BANB 2LDYA 2DGXA 1KTQA 4DL4A 3LW5C 1MROA 2BX6A 2JL9A 1CG2A 3ZZ0A 4UUWA 2V5HG 2QN6B 1SL1A 4BC9A 1DHMA 1RWXB 1SKSA 2VV5A 5FD1A 2BRLA 2I6WA 4A48A 1BD6A 1RAIB 2CQBA 2KT5A 2L9DA 2RRBA 2WBRA 3TEHB 5HVGA 1FVSA 1FDNA 4FPIA 2MTLA 2EK6A 2F65A 3FQKA 3WX4A 5C42A 3C16B 2Y8WA 5J1EA 4PABA 4ZJQA 1FRJA 4OI6A 3MEGA 1WI6A 1PCAA 3Q8VA 2O66A 3I56S 5A76A 2DRAA 3K5MA 5LMNF 3NS5A 3LPEA 1EP4A 2H9ZA 1RAFB 1SC6A 2C2KB 1B0TA 4H4OA 4F04B 5HMZA 2VG5A 1RWNB 2QA4S 2KYXA 1Y5NB 4I6YA 4TY8A 4ZJOA 1JXEA 1ZM3A 1FXDA 4J9OA 4RBVA 5KFRA 4ILLA 4I2QB 2R2TA 5M2RA 4DDFA 5C25A 9RUBA 4Q43A 2GVDA 2AGOA 4TQRA 3PVXA 1RKJA 1NLKL 3PO4A 1P6TA 2JVRA 4PWDB 1SKWA 2DNRA 1FKOA 3DLGB 2V8VA 4DV6F 4Q2MA 3K89A 2LMIA 4J9NA 4YOEA 2AYBA 2Y1JA 4CLLA 2FVCA 4B3TF 4QYZJ 5HK4A 4ES2A 1T95A 2E5HA 5DG9A 1RCOB 2G1DA 3H5UA 4ZKAA 4FPRA 2MLZA 3U02A 5K8MA 5L9NA 4X62F 4YHHJ 3MUMP 4ICLB 2C2MB 4Q5VA 3BYPA 3SFUA 2H5EA 1FNOA 2W2NP 4CO0A 1EB0A 5LSLA 1D9AA 4USUA 4LRDA 2H3EB 3FFIA 1JLGA 1HNVA 1VI7A 2HFNA 3BZQA 1PBAA 4BWJA 5K8PA 5AXKA 2WTFA 4KTQA 2IRYA 3H2UB 1GXLA 3AY0A 4WWSA 3V5RA 5EWGA 3M2UB 4F4KA 5FLXU 2PEHA 2J6SA 1X5SA 3H7HB 2CFXA 4I67A 3MDFA 2CPFA 3R8YA 3KLFA 2B51A 2RQMA 2RDDA 1VQMS 3ZFVA 4NEZA 3GG0A 2V8GA 4DX8H 3B8HA 5E3PA 3OW2R 5GMDA 1BWVA 3DFEA 2VJUA 1OPIA 1PC5A 3C14B 2ZHAA 6FD1A 4G1QA 5D0GA 4CT9A 1QE1A 1JLCA 3GV5B 4KGXB 8AT1B 1KQKA 2E44A 2Z0GA 2UU9F 3NGTA 5GAHI 2SXLA 1S5ZA 4ZPAA 4CYUB 2IYGA 1L3KA 4DLGA 3D6FB 3DNCA 1LWFB 3RR7A 4ZJLA 1KS2A 4MKAA 5CQGA 8ATCB 2HHXA 3LQVA 1FX4A 1RAOA 3VV2B 4PUOA 3US5A 1C1BA 1UZHA 2PMWA 4DCOB 2JEIA 1VLYA 2CIMA 3L9ZA 2EFGA 2WHOA 3OR1B 1RAJA 1CVJA 5IQ6A 3DKDA 1M5OC
chains in the Genus database with same CATH topology
2F63A 2CG8A 1EQMA 1EQ0A 1RB0A 1RTZA 1HQ2A 3UD5A 3HSJA 4CYUB 1EX8A 3HT0A 1RAOA 4CWBA 3HSZA 1TMMA 4M5MA 3HSDA 4M5IA 5ETLA 3ILOA 3HD2A 4M5LA 4M5GA 5ETRA 3HD1A 5ETKA 3MCOA 2F65A 5ETPA 2QX0A 4F7VA 1KBRA 4M5KA 3KUHA 3ILIA 4CRJA 1Q0NA 3HCXA 3MCMA 1DY3A 3HSGA 1G4CA 3KUGA 4M5HA 5ETTA 5ETMA 1HKAA 5ETQA 3QBCA 3UDEA 4AD6A 1RU1A 3IP0A 3ILLA 3ILJA 4CYUA 4M5NA 5ETVA 5ETOA 4PZVA 4M5JA 1IM6A 1CBKA 5ETSA 3UDVA 1RU2A 1F9HA 5ETNA 2BMBA 3MCNA 1TMJA 3KUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F63 A;  2CG8 A;  1EQM A;  1EQ0 A;  1RB0 A;  1RTZ A;  1HQ2 A;  3UD5 A;  3HSJ A;  4CYU B;  1EX8 A;  3HT0 A;  1RAO A;  4CWB A;  3HSZ A;  1TMM A;  4M5M A;  3HSD A;  4M5I A;  5ETL A;  3ILO A;  3HD2 A;  4M5L A;  4M5G A;  5ETR A;  3HD1 A;  5ETK A;  3MCO A;  2F65 A;  5ETP A;  2QX0 A;  4F7V A;  1KBR A;  4M5K A;  3KUH A;  3ILI A;  4CRJ A;  1Q0N A;  3HCX A;  3MCM A;  1DY3 A;  3HSG A;  1G4C A;  3KUG A;  4M5H A;  5ETT A;  5ETM A;  1HKA A;  5ETQ A;  3QBC A;  3UDE A;  4AD6 A;  1RU1 A;  3IP0 A;  3ILL A;  3ILJ A;  4CYU A;  4M5N A;  5ETV A;  5ETO A;  4PZV A;  4M5J A;  1IM6 A;  1CBK A;  5ETS A;  3UDV A;  1RU2 A;  1F9H A;  5ETN A;  2BMB A;  3MCN A;  1TMJ A;  3KUE A; 
#chains in the Genus database with same CATH topology
 1PYS B;  2A2C A;  4F4Z A;  3W9I A;  2QX0 A;  4H4K C;  1I94 F;  1KFS A;  4HT5 A;  4RO0 A;  1U09 A;  3TVZ A;  4U7U D;  3T9N A;  2ASJ A;  2XBP A;  1S6O A;  4ED7 A;  2YKM B;  2F40 A;  3MAA B;  4KKO B;  4NYP A;  2DTJ A;  1X31 C;  4MMO A;  3SSQ A;  2DNO A;  2IBO A;  5CH7 B;  3O3L A;  3MM7 A;  4NLT A;  3W64 A;  3QAE A;  3BYR A;  2UUW A;  3EZO A;  2ZHO A;  3LH2 S;  2JFD A;  4U95 A;  4BS2 A;  2YQ3 A;  2VG7 A;  4OYO A;  1REG X;  4DPX A;  3UD4 P;  1HBN A;  3NGU A;  4X65 F;  3OJU A;  4JV0 A;  1F1B B;  1E6V B;  1K8A T;  3MAH A;  2PO4 A;  2BXJ A;  2OD4 A;  3WIV A;  1GTH A;  5AE3 A;  3TQ1 A;  5KFJ A;  4KGM A;  3QPI A;  1CS4 A;  3PX4 A;  1VHF A;  2DEI A;  5EHH A;  4B3O A;  2QLB B;  1V3Z A;  2RS2 A;  1D09 B;  5CYM A;  3BJY A;  2XNR A;  1U1L A;  3BDP A;  2GHV C;  4QWA A;  4C97 A;  2HBY B;  2D3O R;  2OSQ A;  2UUT A;  4IG3 A;  1S1U B;  4QPX A;  5C2C A;  1ULR A;  3DLH A;  2HGL A;  1F6T A;  3KUE A;  2EFP A;  2MZT A;  5A8W B;  2HEK A;  5CYJ A;  3BQ2 A;  2DGT A;  3RB6 A;  4I7F A;  3W8P A;  1UWA A;  4GRS A;  1UCN A;  3CO0 P;  1RU1 A;  1UPP A;  1WTB A;  2HHP A;  1PBU A;  1VQ8 S;  1W25 A;  3D28 A;  3GTY X;  2CQ1 A;  1RHJ B;  2IM2 A;  1TUW A;  1GT8 A;  3A13 A;  2KXH A;  4G65 A;  3PIO Q;  4OYW A;  4LFC F;  1R8H A;  1XEZ A;  2PD1 A;  2W9B A;  2DR8 A;  2YNF B;  2NQP A;  1FJE B;  3DLK A;  1KVK A;  3CME S;  4QQB A;  2MZR A;  4DV6 J;  2ZH8 A;  2MHN A;  2FZC B;  1RT1 A;  1RT2 A;  4HYK A;  1VQY A;  3IWL A;  3L7O A;  4OV1 A;  1N34 F;  5IT4 A;  5J2M A;  2H48 B;  1M5P C;  5HI7 A;  3PTW A;  4RBT A;  4A8O A;  3KG4 A;  3CJK A;  1KHV A;  2Q79 A;  2VUG A;  4J37 A;  2FD2 A;  2V4Q A;  2ZH7 A;  5KFS A;  5LXY A;  2NPF A;  4X62 J;  2BAN A;  2KRB A;  3CJT A;  1U2F A;  1U25 A;  2J9D E;  1S79 A;  4EBE A;  4DSE A;  1HI0 P;  3K58 A;  5D4P A;  1XTZ A;  1RT6 B;  4K4Y A;  4P7T A;  4AL6 A;  2KM8 C;  3PY8 A;  4RW4 B;  3IAS 9;  1O8B A;  2MQQ A;  4ZA1 A;  5AE1 A;  2GX8 A;  3OL6 A;  2NR0 A;  1S10 A;  1JKH A;  1VIS A;  2HRT A;  2ZFH A;  4Q8F A;  4ED0 A;  4K0K F;  3O8W A;  2Y0B B;  4I2P B;  3OL7 A;  2RRA A;  1EKR A;  3DLJ A;  4CH0 S;  4C48 A;  2CPJ A;  2FB0 A;  5E3R A;  4J5O A;  1TV6 B;  3UN5 A;  2MKK A;  3C16 A;  3MM5 B;  1RAC B;  4C8M A;  3BN7 A;  3VAH A;  1RHM B;  5IQQ A;  4NEY A;  5D0R A;  5F8M A;  2N82 B;  1Z2L A;  3CJS A;  3FZB A;  4AFF A;  3ZZZ A;  4A8S A;  2AWZ A;  2DKO B;  4DZ6 A;  2Z4P A;  3C46 A;  4I2Q A;  3S7R A;  4O3O A;  2BR0 A;  3R3T A;  5AT1 B;  2QTW A;  3TX8 A;  2EBG A;  2RSQ A;  2XSJ B;  1RBL A;  2DCL A;  2GS8 A;  3PXG a;  3D6T B;  3G82 B;  4ZCL A;  3VGU A;  4PWD A;  1G4C A;  4ELV A;  3DLG A;  2UU9 J;  4F67 A;  2BEF A;  3TUP A;  3P5T L;  3TYT A;  2ZKT A;  4RUC A;  1QAX A;  1FNM A;  1RTJ A;  5DRK A;  4RX6 A;  3L3C A;  5KFV A;  4J9M A;  4WBF A;  3Q2T C;  3AH6 A;  1FWK A;  4ILM A;  2FC9 A;  3N0V A;  1QM9 A;  4A8M P;  5E7O B;  2XS7 A;  1HQE B;  3W66 A;  4OYA A;  2YH0 A;  5L1I A;  1G2E A;  2B5J A;  4LUB A;  2AQ4 A;  2V8P A;  4I6W A;  4ZP6 A;  4F4W A;  3M6X A;  2CQ2 A;  1DAX A;  3THT A;  3QT5 A;  3LO3 A;  3TAM A;  1VBX A;  1I94 J;  1JLA B;  1W2I A;  1HWL A;  2YVS A;  2PGC A;  3H8Y A;  4XO0 A;  3M1V B;  2ZBR A;  1W2B R;  4RJV A;  1FCA A;  4LRE A;  2DHS A;  4P9S A;  5KG5 A;  3H25 A;  4AUK A;  3HFV A;  4DV3 F;  1NJY A;  3V6K A;  5KFP A;  1RAG B;  1SC1 B;  3M2U A;  4YY3 J;  1TAQ A;  2DO0 A;  2ZVS A;  4RNN A;  5CCL A;  1YJV A;  1TEL A;  5G4D A;  2LCW A;  1JJ4 A;  2OIH A;  4X65 J;  1GEH A;  1ITP A;  2CDQ A;  5KAK A;  5F0W A;  3BH7 B;  2DEJ A;  2F7V A;  4J9V A;  3S8S A;  4KB7 A;  2D1C A;  1Z1Z A;  3AJ1 A;  2BRK A;  1CSJ A;  4I68 A;  1L5U A;  4FF4 A;  1NH8 A;  2ZE2 B;  1NPK A;  2HVZ A;  2UV8 A;  2UZA A;  3MEK A;  3R27 A;  3KHH A;  2P6T A;  5E41 A;  4CLS A;  4KH0 B;  4DL7 A;  1S6U A;  2FJD B;  2MJN A;  4NYO A;  4P75 A;  2X3D A;  3J7Z T;  3IR7 B;  3H59 A;  3TA0 A;  1ZA1 B;  4JI1 F;  3BDE A;  3ENA A;  4WJB A;  2NPI A;  4A47 A;  4CYU A;  3G6E S;  2R7X A;  1FWP A;  1GAO A;  2FC8 A;  3MCN A;  5T7L B;  1ZA2 B;  4RU9 A;  3U7J A;  5KFX A;  3JTN A;  2JDJ A;  3U1M A;  1FEH A;  1YHQ S;  1F5C A;  3TR5 A;  4MFB B;  4JI2 F;  3KHL A;  2CNO B;  4QR2 A;  5T41 A;  4B3R F;  4LR8 A;  4ED4 A;  2AX0 A;  3OHB A;  3OR1 A;  1IUJ A;  2B4U A;  2HQF A;  3IXQ A;  4HHU A;  1M90 T;  1AZS B;  2BDP A;  1IKX B;  4A8Q A;  2LP4 A;  5IT9 U;  1SJ4 P;  5KG2 A;  4WF9 Q;  2BM0 A;  3FRZ A;  2VOD A;  2HHW A;  1Q95 G;  2CQG A;  2KB2 A;  5GAG U;  5EDW A;  4C4W A;  2I9S A;  2IJF A;  4DR2 F;  2YKM A;  1N34 J;  3NNC A;  2VD3 A;  3QRP A;  3MAA A;  4KKO A;  4F3Q A;  1FXR A;  1M1K T;  3CNQ P;  4ZMM A;  4Q45 A;  4P2F A;  3DLL Q;  3OTB A;  4ED6 A;  3O6Q A;  3BSC A;  1HWK A;  3IRX B;  3DDN A;  3OXF A;  5ETS A;  4TQS A;  1HR0 F;  3GU0 A;  2ZEJ A;  2E66 A;  2HVD A;  4LT6 A;  2QEX S;  1KNZ A;  2RU9 A;  3ELH A;  1PJ7 A;  2LXU A;  3ZNU A;  1E6V A;  3CC4 S;  5KFZ A;  5DDQ C;  2F9D A;  3PKM A;  2VQE F;  1CQN A;  2E1A A;  3W7B A;  1KEK A;  1S9E B;  4CLF A;  4K0K J;  2VAS A;  3QQC D;  2I8E A;  4KHM A;  2IMO A;  2QLJ B;  2E9Z A;  5CD4 A;  4XDC A;  1ZH5 A;  3HLU A;  2XSF A;  2ZOM A;  3H20 A;  4F02 A;  2EFO A;  3CJ8 A;  3OXG A;  2OI2 A;  1UJ4 A;  2FJW A;  4LF5 F;  1S1U A;  1F3F A;  1GMW A;  3FGV A;  3W62 A;  4ZS6 A;  5KG4 A;  2GO8 A;  3S6E A;  2FVR A;  5A8W A;  5KT6 A;  2WVE A;  4DZD A;  1Q1K A;  1ZPW X;  2CQI A;  1SC4 B;  1YX2 A;  1CJV B;  1LK5 A;  5IM0 B;  1BC6 A;  2Y3Y A;  3EIC A;  4OYI A;  1FRH A;  2XO6 A;  2W8K A;  5AJ3 F;  3DI6 B;  4MJK A;  5KG1 A;  2DHX A;  3QGH A;  2QA1 A;  1HI1 A;  1FK9 B;  1Z2Z A;  2JC1 A;  4DR3 F;  3AOA A;  2DY9 A;  4LF9 F;  5KFN A;  4NE9 C;  1IKV B;  1YJR A;  4KBI A;  4USV A;  1M5V C;  2YKQ A;  2YNF A;  2CJK A;  4V19 X;  3M8P B;  3VGS A;  5D0E A;  2P8I A;  4HL9 A;  2CJB A;  3AA8 A;  4DR5 F;  4DWI A;  1NK4 A;  3JYT B;  3HT0 A;  4JOU A;  3ENW A;  1T11 A;  2C2E A;  1WHX A;  1QSL A;  1UTA A;  3H4D A;  1YZ6 A;  2LA4 A;  2RKI B;  5KG6 A;  2BJ8 A;  1IM6 A;  1U1Q A;  3QIP B;  3OLA A;  4OHX A;  3PEJ A;  4HR2 A;  2ZH4 A;  4HHH A;  3AFG A;  1EAR A;  2E29 A;  3I6P A;  2P9G A;  1F9H A;  2BA9 A;  3KDN A;  3H98 A;  3C6U B;  4RW4 A;  1RDR A;  2GJF A;  5L46 A;  4OZL A;  5IWA F;  5F8N A;  5B0G A;  2AGQ A;  3P4U B;  3MD1 A;  4ES3 A;  3JXO A;  3A1Y G;  3JAM U;  3AD8 C;  3CED A;  4URG A;  1P9Y A;  3SCI E;  2BZ2 A;  3D66 A;  4JB8 B;  1B4S A;  1J27 A;  4I2P A;  2OH2 A;  2A2D A;  3RBX A;  5JJB A;  3AOC A;  1TV6 A;  4DV3 J;  4X84 A;  3PRV A;  1C0T B;  4S0M A;  4AND A;  3MM5 A;  2DHH A;  3X3U A;  4LJM A;  3UCZ P;  1AFI A;  2W1B A;  1SJQ A;  1IBC B;  2PT0 A;  1SBR A;  2VKR A;  2IDL A;  1RHU B;  3KXD A;  2CAD A;  3D5M A;  1K0T A;  2ACY A;  3DMJ B;  3SQO P;  3IBF B;  3UCU P;  5KTQ A;  2LU2 A;  4RUH A;  1NK7 A;  3I4H X;  3ZZY A;  4CH7 A;  1R8C A;  2H4W B;  3SBM A;  4WXW A;  1XR5 A;  1A7G E;  1MMN A;  2XSJ A;  5KT5 A;  3KOA A;  3DC2 A;  2CNL B;  4ECT A;  3QLH B;  3G82 A;  5CCM A;  4PG7 A;  1RJJ A;  2JHE A;  5E2Q A;  4FN5 A;  4JI1 J;  2Y1R I;  5DDP C;  3V4I A;  3M9M B;  1X4E A;  4ECQ A;  1PSD A;  3OFF A;  2VPY B;  1TL5 A;  4RR5 A;  4RW8 B;  3PW4 A;  1WEX A;  1T94 A;  3M32 B;  2M8D B;  1AA1 B;  1HQE A;  5ETT A;  4JI2 J;  3HUL A;  3EUN A;  4NRU A;  1RGV A;  1FXL A;  5F8G A;  4B3R J;  3MM9 B;  2ZWO A;  4Y2K A;  3G8T A;  1RAH B;  4KAI A;  2KT2 A;  2RQK A;  1FJC A;  2VOP A;  5IC4 B;  3V6H A;  1TVR B;  3DRX A;  3B4M A;  4LF8 F;  1T9X A;  3OV7 A;  1JLA A;  3G9C A;  3HSJ A;  4I6A A;  4BLG A;  5B0B A;  3M1V A;  5A2Q U;  4NCB A;  4ED1 A;  4DR2 J;  5IOL A;  4OI4 A;  4G3I A;  1MMD A;  2W7A A;  4QW8 A;  2UVR A;  1RU2 A;  3GCX P;  2OEJ A;  5B0D A;  5GME A;  4LF2 A;  1S99 A;  1RWP B;  2V4J B;  3BR8 A;  3D0H E;  2XI2 A;  3DHX A;  2NXJ A;  1P1T A;  2B9Y A;  4URQ U;  1HNX F;  1HR0 J;  3UDV A;  5JVH Q;  4WP3 A;  4X66 F;  4F0K A;  2AJ1 A;  2VH7 A;  4DQQ A;  1NK8 A;  1O6X A;  2ZZT A;  5LJ5 Y;  4AE5 A;  5A0Y A;  2MMY A;  4M95 A;  2CZ9 A;  2MKS A;  4FS1 A;  2VQE J;  4K7Q A;  2GC8 A;  3RB0 A;  4C8O A;  1N52 B;  3CCZ A;  2ZE2 A;  3ZZP A;  2WSF C;  1VC5 A;  3D3B J;  4DN0 A;  2EI5 A;  4Y65 A;  3I82 A;  2DGU A;  3MMA B;  1T02 A;  4UT4 A;  2KFZ A;  4LF5 J;  2DGS A;  3FK4 A;  5HO4 A;  1H98 A;  2M4M A;  3VVU A;  3D6H B;  5T7L A;  3RRK A;  5KFO A;  3KLE B;  4DJB A;  5HLF B;  4C2M A;  3ISN C;  4DF8 A;  1N0V C;  2L48 A;  4ZDN A;  2UXC F;  2XY6 A;  2DNK A;  4MFB A;  3VAG A;  2B4V A;  4O44 B;  2CQ4 A;  1WC6 A;  3GE9 A;  5ETM A;  4ZVU B;  4CLK A;  2OGU A;  4C6A A;  5BR8 F;  1ROF A;  4PWW A;  4DR3 J;  1T9V A;  4DFM A;  2C2D A;  2G1H A;  4LF9 J;  1AZS A;  1DJ0 A;  3Q24 A;  4NLV A;  4P74 A;  4KGV B;  1L3U A;  5ETL A;  2CJX B;  5IZH A;  1TKZ B;  1H2T Z;  2VC0 A;  3SSS A;  4F25 A;  2RHS B;  2IIH A;  2C42 A;  4ZN3 A;  3Q8P B;  1LWC A;  3HFZ B;  3ETO A;  2VON A;  4LF7 F;  1YRX A;  1WD6 A;  4PRF A;  1KOH A;  4CLW A;  1DLO B;  3PRB A;  1FRI A;  3OT9 A;  2GQQ A;  3AJ2 A;  2X1A A;  3NGD A;  4ZPT R;  4DSI A;  4DR6 F;  3HHL C;  3IRX A;  2X1F A;  2WVC A;  1Q0N A;  1GK8 A;  2FJX A;  4QW9 A;  1OYE A;  4X4R A;  4OHZ A;  3DOK A;  4W4M A;  1DQ8 A;  4PPZ A;  1GNK A;  3PYF A;  5I42 B;  1HNI A;  5IWA J;  3LP0 B;  4QWB A;  1R6V A;  1OQ3 A;  1P8G A;  1S9E A;  4PQU A;  4NLY A;  5H9F K;  4DR4 F;  1JNZ B;  1RT5 B;  2EKN A;  3GFX A;  4IQM A;  2OPS B;  2XWY A;  4PXC A;  3MZI A;  4CNZ A;  4RW7 B;  3IS9 B;  3EYZ A;  4X4P A;  3LAK A;  3W5X A;  3Q0A A;  2DNY A;  1L3V A;  3RG6 A;  3OJS A;  2V2Q A;  3KLH B;  4L3K A;  1UW4 A;  2AHO B;  3I5A A;  2C3M A;  4KRW A;  5GAG I;  1VRU B;  4OYB A;  3CJ4 A;  3DLE B;  3ITH B;  4WFB Q;  5IM0 A;  2YPY A;  3SCK E;  4DV0 F;  3T3F A;  2CQC A;  5GAD U;  2JSX A;  3DI6 A;  3O1L A;  4M5M A;  4YME A;  4J9K A;  1Q53 A;  1FK9 A;  1WF0 A;  1D8Y A;  2HZC A;  3FBC A;  2G0I A;  2QFJ A;  1H38 A;  2BJE A;  5D4L A;  5GVQ A;  2GFF A;  4MAK A;  1OPZ A;  1UVL A;  1GMU A;  4F4Y A;  1IKV A;  2BM1 A;  2KRR A;  3CUN A;  3K5L A;  1K47 A;  3M8P A;  5E3Q A;  1K44 A;  3SCL E;  3MCS A;  5U47 A;  4Y2M A;  2IVM A;  2OMO A;  2NXC A;  3GPA A;  2KG1 A;  3ZTO A;  4USI A;  4CQ1 A;  2RKI A;  3QIP A;  2NLW A;  3IBC B;  4NLO A;  3ENV A;  2M3D A;  1QAY A;  5GMK a;  1APS A;  1V9O A;  4N47 A;  1QDU B;  2HFV A;  1S0M A;  2GIR A;  1NO8 A;  4B3S F;  1UVI A;  1WC1 A;  1AB8 A;  1U47 A;  3MED A;  2FJV A;  4IH7 A;  4NRT A;  3R7B B;  4LF8 J;  1XER A;  3C6U A;  3ETM A;  2FHO B;  2J6T A;  3UWT A;  4ZLN A;  3LTO A;  4CP5 A;  4KHR A;  2FJB B;  4FXW A;  1VBY A;  2KU7 A;  1QVG R;  2C2O B;  4CLP A;  2LDI A;  4HVZ A;  2XMM A;  2R8I A;  3CVK A;  1FRM A;  5LT5 A;  4USM A;  3R5C A;  2W24 A;  3CC7 S;  1C0T A;  4MYU A;  1N6Q B;  2LXI A;  1WOR A;  2LFV A;  1HNX J;  1WDT A;  1S1W B;  3O44 A;  2R8H A;  1VJQ A;  2BJ7 A;  2E1M C;  4X66 J;  1KSP A;  3BPS P;  1HLW A;  5D0H A;  4F8R A;  4OJ3 A;  3HK2 A;  4EU0 A;  7FD1 A;  2MKC A;  3DMJ A;  1NCL A;  2XZD B;  1LNQ A;  3F41 A;  3ZZT A;  3FCW A;  4PAA A;  4B08 A;  1TR0 A;  3CD5 A;  2AD9 A;  2DPI A;  1IKY A;  1D3W A;  3DU6 A;  3QGP A;  4LMZ A;  3OBI A;  2GAG C;  3QLH A;  3ZXW A;  5ITH A;  4ED2 A;  1MG7 A;  5DDR C;  2MKJ A;  4OZ3 A;  3GIM A;  2Z2Y B;  4OYX A;  3T1Y J;  4HTJ A;  4AXI A;  1Q4R A;  2I0X A;  1MLA A;  3CCE S;  4LFA F;  2MY7 A;  1R8P A;  5B0F A;  1RSC A;  3TI0 A;  3VVT A;  3J7Z 5;  2UXC J;  2KI2 A;  3M32 A;  4FF3 A;  1HWI A;  3K8W A;  4JV5 F;  3KJF B;  2MB0 B;  2E7V A;  1GMW D;  2CKW A;  5I3Q A;  2JEJ A;  4USK A;  2GHW A;  3WC2 A;  8RUC A;  2B0G A;  1S9G A;  5BR8 J;  2RF2 B;  3LWL A;  3MM9 A;  3VQT A;  2I38 A;  2FVS A;  4WK1 A;  1F60 B;  3UN2 A;  2RE1 A;  2JZ5 A;  2ZH6 A;  3JQM A;  2XY7 A;  2BKN A;  5EWE A;  3K2Y A;  1TVR A;  2AYM A;  2O5D A;  5LOQ A;  1NJI T;  2LLZ A;  4IOC Q;  2YWF A;  1YBU A;  2WON B;  2WB1 D;  2XZW A;  3MUV P;  4U67 Q;  2QE5 A;  2V4J A;  3CCL S;  2AMC B;  1F5B A;  5K9F A;  4AXJ A;  2UVW A;  2GMJ A;  4LR9 A;  2OP5 A;  3JSY A;  2V68 A;  3BGR B;  3H40 A;  3QGG A;  1FJG F;  3MCM A;  3HX9 A;  2WCX A;  1FD2 A;  2XC9 A;  3ONQ A;  3RBD A;  4MIB A;  3J80 Y;  4DQR A;  1PKU A;  3QYY A;  2VHG A;  2HFO A;  1N56 A;  1U1K A;  2DH7 A;  1T7P A;  3GIK A;  4DR4 J;  2BJD A;  3BSN A;  1X4C A;  1HBU A;  3HJF A;  2DNL A;  1FKP B;  5A8K B;  3GV8 B;  2HMI B;  1V5V A;  3MMA A;  2WBM A;  3D3C J;  1HW8 A;  3Q22 A;  4FF1 A;  1ZTW A;  2BAC A;  3G86 A;  2WVB A;  2DIU A;  5G0R B;  3KLE A;  5HLF A;  3OFH A;  3TJA A;  4DQP A;  2L3M A;  3BBB A;  3RTV A;  2FPH X;  4ZIT A;  3FBB A;  4DV0 J;  1Y5L B;  3FEZ A;  4O44 A;  2IJN A;  4PXD A;  4O4G B;  1YG0 A;  1O51 A;  4WFA Q;  3CDB A;  3LGH A;  3M30 A;  5DG7 A;  3LGN A;  3BN4 A;  4K8R A;  5L1K A;  2YNH B;  2ATL A;  4PPD A;  1TKZ A;  2NYI A;  4JV2 A;  2KYZ A;  4IFY B;  1MU2 B;  4Y0F A;  1KLM A;  1Q5V A;  2EFV A;  2R8G A;  3DDK A;  5HL7 Q;  2CXE A;  2XMK A;  3JSB A;  2HGN A;  2CDR B;  3E01 A;  2MZQ A;  4DN9 A;  1WG5 A;  2ZOG A;  5B09 A;  2ROE A;  2RD5 C;  2DBB A;  4LRC A;  3CCS S;  4NXM F;  2MST A;  1IBK F;  3A8K A;  1WWH A;  3D7S B;  4HI2 A;  3IAM 9;  2FZG B;  1TMM A;  1KFD A;  1M0S A;  4FYY B;  4B3S J;  2HGM A;  1TK5 A;  2ABY A;  4O4R A;  4A8F A;  4U8V A;  1X7V A;  1IR0 A;  1NSQ A;  2OTJ S;  1X60 A;  3AQO A;  2CQD A;  3LP0 A;  2IC3 B;  3OL9 A;  3FMB A;  1V3S A;  2OML A;  1VC0 A;  3P96 A;  1RT5 A;  2XS5 A;  2IRU A;  2OPS A;  4RW7 A;  5B0A A;  3IS9 A;  2K8G A;  3VZI A;  1U1P A;  3PR5 B;  1Q8B A;  2CPZ A;  3KLH A;  3Q8Y A;  4LSL B;  4Z7Y A;  2PEB A;  2J7U A;  3OUY B;  5ETQ A;  3H42 A;  4NXN J;  1TL7 B;  1NB2 A;  3UPF A;  3HVW A;  2QLW A;  1VRU A;  4NLW A;  4YQW A;  3DLE A;  3SXL A;  4DUY F;  5J1E B;  4ER8 A;  4PWU A;  3ITH A;  2W4C A;  3MPV A;  2A6O A;  1PYT A;  3CIZ A;  3G87 A;  2X7I A;  1ZM4 A;  4F26 A;  3PW0 A;  4LQ9 A;  1SV5 A;  4TY8 B;  3M9N B;  3I0S B;  2NXE A;  1QVF R;  3NWR A;  4L3N A;  4KYZ A;  4IR1 A;  4Q44 A;  2BOP A;  3I9V 9;  1S1X B;  1VMB A;  3M2V B;  3BEG B;  1VQN S;  5C25 B;  1NJW A;  9ATC B;  4WCE Q;  2GVD B;  4P72 A;  2HLU A;  3MPU B;  5K5M A;  1H7X A;  3BGU A;  1WEL A;  2FIU A;  3CCQ S;  1TP7 A;  2V8D A;  3POT A;  4LFA J;  2EG1 A;  5KG3 A;  3TOQ A;  3W5Z A;  2CQP A;  2FLO A;  3CCM S;  1D9D A;  3R1L A;  2VFR A;  4JV5 J;  1VK8 A;  5ETR A;  4UY8 5;  2YPZ A;  3M8S A;  2C28 A;  1UMJ A;  1M1G A;  3R2C J;  1T3O A;  3MMB B;  2KTQ A;  2U1A A;  2VQF F;  2GGP B;  2C3P A;  4IFV B;  1S6P B;  1HHT P;  3NNH A;  3NMA A;  1CQM A;  4ZHR B;  3NXZ A;  3PW2 A;  2J6U A;  3AXK A;  1RTD B;  5GAD I;  1V6H A;  2YKP A;  1TMJ A;  4GVB B;  3I0R A;  5KFK A;  4ZVE A;  2K3K A;  3C15 A;  4B9L A;  4U9R A;  1SUQ B;  3Q83 A;  1UZD A;  1WAC A;  2VZ9 A;  3EZU A;  1M5H A;  3OL8 A;  1YJT A;  3FFI B;  4GC6 A;  3MUT P;  4UQG A;  1REV B;  4O0N A;  1N6Q A;  1JJC B;  1SIW B;  4YR2 A;  5D15 A;  3TAQ A;  3HVT B;  1CC8 A;  1S1W A;  1C4C A;  5IFM A;  3CD7 A;  1FJG J;  1YVF A;  2V67 A;  1LEO A;  2AJ4 A;  1LFW A;  1OY9 A;  3V81 A;  3KNA A;  2ROP A;  1T9Y A;  1RWO B;  3CPW R;  2NZ4 A;  2O67 A;  5H9F J;  2V2Z A;  3DRR B;  3KLF B;  2PC6 A;  2YWK A;  4RUB A;  1N33 J;  2J0W A;  4FNH A;  3BM7 A;  5I3U A;  2CQ3 A;  3N01 A;  4K2X A;  2VIH A;  1FD8 A;  3OVB A;  2MKY A;  2MDA A;  2BYC A;  2DNM A;  2XM3 A;  4B9T A;  3L7P A;  2HFZ A;  4F0H A;  3HF5 A;  4ZVS B;  2UXD J;  2BQ3 A;  4JI5 F;  2MKI A;  5K14 B;  3WDO A;  2JNJ A;  3CMA S;  5HQL A;  1U8W A;  4DI6 A;  1HD1 A;  4P2X A;  4CLU A;  1TL4 A;  3TO8 A;  4RW6 B;  1L3S A;  4HH1 A;  3KK1 A;  4LQ3 A;  2B6A B;  2F8M A;  4A8Y A;  3HO1 A;  4OX9 F;  4PG4 A;  2CPI A;  1RXO B;  4ZPB A;  5LM7 E;  1FA0 A;  5HN0 A;  3IO1 A;  2RF2 A;  4R25 A;  1Y7P A;  4FVM A;  2FJE B;  4OX6 A;  1NSK L;  1HQU B;  1IXK A;  2HYI B;  4EZ9 A;  4MIW A;  4DR7 F;  3GR1 A;  4NLG A;  3WC0 A;  5JMN A;  1Z4U A;  4RWX A;  1FEE A;  3EXY A;  2AP6 A;  2QJ3 A;  2R8J A;  5BYR A;  2POK A;  2LQ9 A;  1HI8 A;  1Q86 T;  4MTP A;  1C1C B;  2WON A;  4C0B A;  4DL3 A;  1ZAV A;  1R8B A;  4ETX A;  2D7S A;  1XWL A;  4AQY F;  5B08 A;  2RHQ B;  2E5J A;  3L4B C;  4CRJ A;  2CJ9 A;  2DIT A;  5EGY A;  1IBK J;  4LSZ B;  3BO2 A;  2XLK A;  1WOP A;  3BQ0 A;  2BVZ A;  2VFV A;  4RWW A;  3QAU A;  4RNM A;  3IR6 B;  1NXI A;  3MM7 B;  4ZVG A;  4N41 A;  2J0X A;  1VK3 A;  5KG7 A;  1FI4 A;  1CPZ A;  4JUZ A;  1TKT B;  1YRT A;  4DV1 F;  4UW2 A;  4Q8E A;  1WDD A;  3OQ2 A;  1GMV A;  4PR6 A;  2Q3P A;  2AEF A;  1RB0 A;  3R2D J;  3SEO A;  3H5Y A;  3P5B P;  3NMR A;  4ELU A;  2VBX A;  4IG0 B;  3MWB A;  1NDP A;  1KKH A;  1GX5 A;  2C2R A;  1SB6 A;  4U8Y A;  4K4X A;  4KR0 B;  1H0H B;  1I1G A;  1OJ4 A;  3W5Y A;  2ZJP Q;  5A8K A;  4QU6 A;  2HMI A;  4B3O B;  4UOC A;  1NHU A;  1PJ5 A;  2ZDO A;  5CYM B;  3PZP A;  2RT3 A;  3MR7 A;  3TJ9 A;  1WJ9 A;  2OPQ B;  4NCA A;  1NK5 A;  3BSO A;  4DUY J;  5G0R A;  2ZJQ Q;  4IG3 B;  2WW4 A;  4RUA A;  2B4O A;  4WP9 A;  1S57 A;  1QD1 A;  3MCO A;  2GO9 A;  1WSR A;  3W65 A;  4I7F B;  4Q7A A;  2ZC4 A;  2VBZ A;  1OWX A;  4O4G A;  1GX6 A;  2MKH A;  5BYQ A;  4KH1 B;  1TKX B;  2B9X A;  3MR2 A;  4NLR A;  4CO4 A;  3MXH P;  4K5R A;  2YNH A;  5DQH A;  4QIW D;  2BE9 B;  2VDH A;  4MK8 A;  3N4W A;  4IFY A;  1MU2 A;  2VC1 A;  2E9T A;  3A8J A;  4DX6 A;  1HWU A;  3RB3 A;  1HNZ F;  3M05 A;  3LP1 A;  2H4Y B;  1RWW B;  3J81 Y;  1U2R A;  3SFG A;  3PHT A;  2J9C A;  3KK3 B;  4R0E A;  3DLK B;  2XQC A;  4DL6 A;  4Z37 A;  1YGY A;  3QID A;  3TZZ A;  2KG0 A;  4YEA A;  1RT2 B;  1B3T A;  2OSR A;  4CWB A;  4EO6 A;  3WHI A;  4J90 A;  4DG1 A;  4U96 A;  4WTO B;  3HCX A;  5HMW A;  1LXJ A;  3BBF A;  2CUY A;  1UVJ A;  4JI0 F;  1YBA A;  4OI2 A;  3T5L A;  4C98 A;  1T03 B;  3TA2 A;  2VQF J;  1RTI B;  1TK0 A;  3CO9 A;  4CH1 A;  3RAX A;  2XYH B;  1FDB A;  1G7C B;  2IC3 A;  5E33 A;  4LVO P;  1EQM A;  5KFY A;  3CXC R;  1LQ9 A;  4HT7 A;  5EUH A;  1SKU B;  4EFA C;  1JKH B;  1IVZ A;  4I64 A;  3C6T B;  3NLC A;  2HS3 A;  4LSL A;  1RHK B;  3KMS A;  4DSL A;  3AOB A;  3OUY A;  2IA6 A;  4B9V A;  5A8R B;  3ENQ A;  1TL7 A;  3HD1 A;  2HSE B;  3LWM A;  4W90 B;  1F2H A;  1KWM A;  2HNZ B;  4B3M F;  1CJU B;  2A10 A;  3VAI A;  1K1Q A;  5F3T A;  1WG4 A;  4CLZ A;  2HRU A;  3Q89 A;  2EEY A;  4DCP B;  4P2S A;  1NZ8 A;  3I0S A;  1CBK A;  1RWV B;  4ZIW A;  4Z2X A;  3SV4 A;  2H1Y A;  2R4F A;  3UR0 A;  1S1X A;  2PN6 A;  3B82 A;  3M2V A;  4JI5 J;  4FKY A;  2Y0S D;  2ZKU A;  1OS5 A;  4NMX A;  1CEZ A;  2O3D A;  2Z2Z A;  3EGZ A;  3PYG A;  1NJX A;  4DV7 F;  2FZK B;  3UO0 A;  3NEK A;  4IH6 A;  4CLT A;  3M2R B;  1Q7L B;  3MR5 A;  4M5K A;  3EXC X;  3F44 A;  2YX7 A;  2VBW A;  4KPY A;  2BKO A;  1RTJ B;  1JLB B;  2P5V A;  2XWX A;  4O3S A;  2CPX A;  3M8W A;  4OYM A;  4ECW A;  3GIJ A;  4FVC A;  3C19 A;  2B5J B;  3MMB A;  3UFC X;  4DR7 J;  2GGP A;  2DD8 S;  2KZM A;  2ZH2 A;  4IFV A;  1S6P A;  4IRK A;  4ZHR A;  4QU7 A;  1RTD A;  3QWP A;  1Y11 A;  2VOO A;  5HQ8 A;  3DU5 A;  4NZ0 A;  4GVB A;  3TAM B;  1R3N A;  2HHT A;  4ECU A;  1Y00 A;  1SUQ A;  4F4X A;  2MSS A;  4OL8 A;  2D9O A;  3M9O B;  4AQY J;  2WRM A;  5ETK A;  3R6L B;  1REV A;  4DPU A;  3RGI A;  2QYC A;  1OMS A;  1FF2 A;  3HVT A;  4YDX A;  5H1S V;  4IDK B;  2MZS A;  3QFW A;  1HYS A;  1TZ0 A;  2OKQ A;  2M5Y A;  4MKY A;  1T9U A;  2Z56 B;  1FDA A;  5DET A;  4DV1 J;  3ZZU A;  1UFW A;  2HHS A;  1C4A A;  3HPO A;  3MPD A;  3DRR A;  3IWX A;  5HAO A;  1R0B G;  4C11 B;  1UP1 A;  4M5L A;  4OYP A;  4DQI A;  4L74 A;  5KFG A;  2NZC A;  5J1P A;  2FGC A;  5ETV A;  3HHD A;  1FHT A;  3NGK A;  3PO5 A;  2XO7 A;  4RNO A;  1OY6 A;  2FY1 A;  1DQ9 A;  1EKS A;  2R7V A;  3H2V E;  5K14 A;  4AT1 B;  4PG8 A;  1EAY C;  4H4M B;  4W92 B;  3T6J A;  4RW6 A;  4RKU C;  2M7S A;  4FXV A;  2WB4 A;  3GV7 B;  3JSM A;  3FEY B;  2B6A A;  2MQN A;  2GQ2 A;  2A1B A;  2IM1 A;  3MTJ A;  3RB4 A;  1C2P A;  3T5K A;  3NS7 B;  1MWY A;  3I9Z A;  3TX0 A;  2HHV A;  3OFE A;  4ED8 A;  3V4M A;  4ECV A;  3HVR A;  1UFL A;  3ZNJ 1;  4L6V 3;  3A3N B;  1HQU A;  2CRL A;  3SCJ E;  2BUN A;  3P45 B;  5KFH A;  5C5J A;  2P9E A;  3A3O B;  2WW8 A;  4QOT A;  1F0X A;  5LXR A;  2PSZ A;  5KFQ A;  1S1V B;  2QMW A;  2ERR A;  3W9H A;  1C1C A;  2GHP A;  3DHW C;  2EWH A;  3R5J B;  3OVS A;  3D2W A;  2V69 A;  3CCV S;  5LJ3 Y;  1SI9 A;  2O01 C;  1HL6 A;  1NND A;  1T05 B;  2L08 A;  2F63 A;  1IBL F;  3C3L A;  1EQ0 A;  4E8U A;  1QUV A;  4PEO A;  2D3Z A;  1VC6 A;  3HZE A;  2XYP B;  4JI0 J;  1ACM B;  1JK9 B;  4DSK A;  2N4C A;  2UUC F;  3CD0 A;  4LF6 F;  2MY8 A;  1TKT A;  4BBY A;  2AGP A;  5DDO C;  4LBH A;  1VQ6 S;  1S72 S;  4DFK A;  4X64 F;  2HBQ B;  1EZZ B;  4IG0 A;  2KM8 B;  3GII A;  3RJM B;  4WPA A;  2B9W A;  3GQC A;  2JH3 A;  4ECR A;  1ELO A;  1UET A;  3BKT A;  2I5J B;  1P9Q C;  4QIF A;  3ILL A;  1IKW B;  2Z57 B;  2MHE A;  2F8E X;  3CDE A;  5AE2 A;  2JX2 A;  2OHD A;  1UPM B;  1X9W A;  2OPQ A;  3GWC A;  1R0A B;  2OPP B;  1LK7 A;  4B3M J;  3GJS B;  3R6G B;  4DFP A;  4C3K A;  1NM2 A;  5LMN J;  4IR9 A;  4UOH A;  2AW0 A;  5FDL B;  3CJ2 A;  4NZ7 A;  2ZBC A;  4CLY A;  3UD3 P;  1TKX A;  1CJK B;  4OIX A;  1H7W A;  4LR7 A;  5DGB A;  2Q6C A;  5HJX A;  2W7O A;  2EW9 A;  3C2P A;  2NYH A;  2ZZM A;  2DNG A;  2OPR B;  4ED3 A;  1O5J A;  4F3O A;  3FC9 A;  1MWQ A;  4EYI B;  5C24 A;  3FSI A;  1HHS A;  1OSD A;  5B0C A;  4JI3 F;  3UVJ B;  4DV7 J;  3KK3 A;  3NY0 A;  4DPO A;  5D78 A;  4QIV A;  4DHV A;  1KQF B;  2B43 A;  1IQZ A;  2YBV A;  2IVY A;  2MPU A;  3R1H A;  3EX7 B;  1YIJ S;  2ZDP A;  4C8Y A;  1YSJ A;  4WTY A;  2AYG A;  4V19 J;  3NOC A;  4B3T J;  2EKY A;  1FER A;  3TUI C;  2ZBQ A;  2CWK A;  3N5F A;  1QJH A;  1FRX A;  2R2R A;  2V50 A;  3NCR A;  4HHJ A;  3G71 S;  1RT7 B;  4WYW A;  1FE0 A;  2NSC A;  3N6M A;  2J9D A;  1T03 A;  2JFK A;  1RTI A;  2DK2 A;  3VAM A;  1B0P A;  3CJQ A;  1JNR B;  1HBM B;  1NK6 A;  4RNF A;  3MFI A;  2Q66 A;  1N4L A;  5CZV A;  1X4D A;  3GJQ B;  3NAH A;  1DZ5 A;  1RHR B;  2XB2 D;  4USW A;  2QLX A;  2E5G A;  1R8A A;  1I6J A;  3C6T A;  5HBM A;  2DXE A;  3K59 A;  1D0E A;  2ASL A;  1IR1 A;  3UR3 C;  4RU2 A;  5A8R A;  1WKK A;  1VRT B;  1JQG A;  5KOW A;  2PI5 A;  1TUV A;  3N28 A;  4G6V B;  1VBK A;  4O3P A;  3K0J A;  2HNZ A;  1CJU A;  2DXD A;  3PFO A;  1PGZ A;  1FKA F;  4ALZ A;  1L3T A;  4K4W A;  1FT8 A;  4K4U A;  1VQP S;  2ADB A;  3NGR A;  3K5N A;  2H5J B;  2MQL A;  2B8P A;  2ALZ A;  2FLN A;  2KJV A;  3VF0 B;  2PA3 A;  3HSD A;  4NA2 A;  4ERD A;  1S6Q A;  1U7L A;  1QAI A;  2W4D A;  3EDQ B;  1W7W A;  2GA7 A;  1GFW B;  3W2W A;  2DRB A;  4ECY A;  4OLP A;  4F50 A;  4A4J A;  1XBW A;  4B9M A;  1G6B A;  2WOM B;  4IO9 Q;  2JRS A;  3GIR A;  1BLU A;  3M2R A;  3V4I B;  4TU7 A;  1M5K C;  2EC0 A;  1JLB A;  4USH A;  1IN0 A;  3MEE A;  3QBC A;  5KT7 A;  1TL1 B;  3LUY A;  5IC6 B;  2Y8Y A;  2XMT A;  1Y9O A;  3JB9 k;  1OY8 A;  4I69 A;  3R97 A;  3GJT B;  2QV6 A;  1SPB P;  3GG1 A;  4USJ C;  3AOD A;  4FYD A;  3MTK A;  3IR5 B;  3BPD A;  3IP0 A;  4YB7 A;  4BCA A;  1JX4 A;  4X2B A;  1BQN B;  3DOM B;  1WF2 A;  4CO3 A;  1XMQ F;  3GSI A;  1GXU A;  2DIV A;  1ARO P;  1VQ7 S;  2AKW B;  2HZV A;  4H4K A;  3TVY A;  2PFF B;  2V63 A;  4ID8 A;  1MNE A;  1T8E A;  5FII A;  3ZC4 A;  4LF1 A;  1NKB A;  3MEC B;  4YR0 A;  2RUG A;  2KXF A;  4N7T A;  2FY8 A;  3OTC A;  5B0E A;  2F1F A;  1WKJ A;  4IDK A;  1OSC A;  1HKA A;  2KHC A;  2M88 A;  3KFW X;  5L38 A;  2WZ1 A;  3MAQ A;  1MW7 A;  2YX1 A;  1VCT A;  3P6Y C;  2EXU A;  2UUC J;  1VIX A;  2VU5 A;  5KFA A;  5K8N A;  3M8Y A;  4WKR A;  4LF6 J;  2XMW A;  2KH9 A;  4JV1 A;  1S7H A;  5ADZ A;  1U2C A;  4ID5 B;  3R7N B;  4CNY A;  5A0Y B;  3J7Y U;  1MN7 A;  2MQO A;  3VGT A;  4X64 J;  4C11 A;  5MLC V;  2QA4 G;  1JXV A;  2LYV A;  2RIL A;  1YIT S;  4J91 A;  5H9E K;  3CJ0 A;  4K59 A;  2IBK A;  4ANC A;  4NLU A;  3M4X A;  1X0P A;  3CGI A;  1JIH A;  2M52 A;  1RP5 A;  4NML A;  1FNX H;  3WX8 A;  1Q8I A;  1H74 A;  4KT0 C;  2NCK L;  2V9W A;  3QJJ A;  1BY9 A;  5CAB A;  3A8I A;  4DPY A;  5EN1 A;  4H4M A;  4QPT A;  4M5I A;  1S1T B;  1SC3 B;  3BS9 A;  1U0S A;  4R8U B;  2IMW P;  3KMQ A;  3G2X A;  4OQJ A;  2XGP A;  1U1R A;  1JB0 C;  2A18 A;  3BSA A;  3BBC A;  3NRB A;  2CYY A;  2MJU A;  2C3O A;  2ZM6 F;  4M5D B;  3I5C A;  1S9F A;  5JXS A;  4L76 A;  4FYW B;  3KK2 B;  2CPH A;  1RAD B;  2GAH C;  3EDR B;  3BF4 A;  3OVA A;  3S1T A;  5KFF A;  4LFC J;  1U6F A;  2CNK B;  1S49 A;  4KV8 A;  1YJU A;  4JI6 F;  4JI3 J;  1S1V A;  3IA0 A;  2B9E A;  5C7P A;  2Y9H A;  1Q16 B;  4NL5 A;  2F9J A;  2GJ2 A;  1UA1 A;  4OJ1 A;  1LWC B;  2GMH A;  1AYE A;  1T05 A;  1H2U X;  5L8R C;  2IHR 1;  5F8J A;  4L75 A;  3UW1 A;  2R9L A;  5LSO A;  2ZWP A;  4J9P A;  1DTT B;  1X4H A;  3W8G A;  4P2M A;  4ZN1 A;  5FJ4 A;  4Y2C A;  1TKD A;  4WFZ A;  1GH8 A;  3IWN C;  3HXM A;  1URR A;  4QCL A;  3DOK B;  5DS7 A;  4FNI A;  2AZ1 A;  2VF3 A;  1HNI B;  1K0V A;  1IJE B;  2K7J A;  2BBE A;  4N8O A;  2MEW A;  1N5S A;  4PQU B;  2KJW A;  4QR1 A;  2I5J A;  4MT1 A;  3VHQ A;  2N3O A;  2HAI A;  1IKW A;  2XS2 A;  4K4V A;  2LVW A;  3DCA A;  3IMQ J;  1RI7 A;  3K17 A;  1VFJ A;  4WZQ A;  3GR0 A;  4DUT A;  2L9N A;  3L95 X;  1R0A A;  2OPP A;  2XMJ A;  4UQT A;  3AD9 C;  4DR1 F;  1AT1 B;  3CCR S;  3W3S A;  2AX1 A;  1HWJ A;  2Z2L A;  3D1H A;  1N8R T;  5FDL A;  3NKY A;  1FRK A;  3U1L A;  4ZVO B;  4ZVR B;  1ZZN A;  1CJK A;  4TKT A;  3DGP A;  1BXN A;  1WHY A;  3HMJ G;  1UVK A;  2OPR A;  3NGS A;  4DBQ A;  3DLB A;  3UD5 A;  1G1X A;  2CA9 A;  1LXN A;  3NL0 A;  3LAM A;  5EWF A;  3WBZ A;  3AJD A;  3UVJ A;  3GZ7 A;  3RRH A;  4U6P A;  2G2Z A;  4K4S A;  1PYO B;  4CM2 A;  3HVA A;  2DH8 A;  2DNQ A;  3RUB L;  2JLF A;  3A8E A;  2WSC C;  4JI7 F;  1Q78 A;  4C8N A;  2DXF A;  3CTR A;  2Z8Q A;  3T9Z A;  2HQC A;  3MF5 A;  1IWA A;  2NXU A;  2Z58 B;  1RT7 A;  1Q5Y A;  4I4B A;  2VFT A;  3ADA C;  5I3P A;  4C9D A;  2BKP A;  3AHP A;  2EPI A;  1PG5 B;  1RAA B;  4EGL A;  4IUF A;  2DHG A;  1HBM A;  2QFI A;  3R7S B;  2IPO B;  4L73 A;  2A0F B;  3MED B;  1XMQ J;  3X1L B;  3OTD A;  2H5I B;  1NH7 A;  2D74 B;  2HVE A;  5I4M A;  2D41 A;  3VAF A;  2IVF B;  2LXF A;  3UCG A;  4OJH A;  3FCH A;  3MHY A;  2B7B B;  3PJ9 A;  2X3G A;  1X9S A;  4E0D A;  1VRT A;  2PA8 D;  2AJQ A;  4ZP7 A;  1WC0 A;  3N5B A;  2DH9 A;  2QRR A;  4DV2 F;  1F2G A;  4KHP F;  4KFB A;  4I0W A;  3D54 A;  1X0F A;  1RT3 B;  3PX6 A;  2B4P A;  2RQ4 A;  1YJW S;  2WVD A;  5D4N A;  2V0N A;  4CO5 A;  2DGV A;  1ZAW A;  2DY1 A;  6AT1 B;  2ZOF A;  5J2N B;  4YB5 A;  1UL3 A;  3MMC B;  4MK9 A;  5KT4 A;  1TU0 B;  5E3A A;  5IS2 A;  5CYQ B;  1IKY B;  3UN3 A;  2QA2 A;  4TY9 A;  1LFP A;  2EFN A;  3RZA A;  2IM3 A;  3TRG A;  3ZZO A;  2BJ9 A;  1HNW F;  1B99 A;  4DXL A;  1RKI A;  1QLN A;  3ISZ A;  1H73 A;  2WOM A;  3M6V A;  2IRX A;  2AF6 A;  2E5L F;  2N7C A;  1J5O B;  5DLF A;  2ZM6 J;  2XGQ A;  1K9M T;  4F4A A;  4UTG A;  1BQX A;  1TL1 A;  3RW6 A;  5KFT A;  2C3Y A;  2BW7 A;  2R2U A;  1E6Y B;  3W61 A;  4WXO A;  3TJ8 A;  3LP2 B;  1S9G B;  1S0O A;  3PEH A;  1WC5 A;  1H6K X;  3TEG A;  4DCJ B;  1FES A;  3IGN A;  2BE7 D;  1Y3J A;  1BQN A;  4JI6 J;  3RYL A;  3N6L A;  2QG9 B;  3DOM A;  2N3L A;  4DSF A;  1KD1 T;  4WII A;  2MYF A;  2HFS A;  3BKF A;  4LVN P;  4U7C A;  1X4B A;  5F8L A;  2L41 A;  2R3V A;  2Z2M A;  2J8A A;  1IM4 A;  1TL3 A;  1ICE B;  3FZ2 A;  3MEC A;  2ZBI A;  1Y4Z B;  1RAB B;  2HHU A;  4ITS A;  1WNE A;  3Q8Q B;  2XCA A;  4C8Z A;  1DRZ A;  3FCV A;  2RQC A;  4DU7 A;  1X5T A;  2HLT A;  3HZG A;  1K1S A;  2DT9 A;  3HHL B;  5KFL A;  2BJ1 A;  3CW2 C;  4ZVP B;  2LQ5 A;  4DUZ F;  4C3L A;  3EGW B;  2ATC B;  3BV8 A;  1IWG A;  3GFZ A;  4ID5 A;  3K57 A;  2W8L A;  1MWZ A;  1RQ0 A;  5F3Z A;  1IR2 A;  4DLE A;  2A6M A;  3KYL A;  1HPZ B;  2VFS A;  4NLD A;  1UEK A;  4LF4 F;  3DM2 B;  1N5Y A;  1HBU B;  4ZLL A;  4UZB A;  2XTJ P;  1NUE A;  1QAJ A;  2KFY A;  1N88 A;  3PG9 A;  1S1T A;  3LA0 A;  1DAR A;  1W26 A;  1NPP A;  2MLY A;  4R8U A;  3KJV B;  4HDG A;  4RW9 B;  4DR1 J;  2HHH F;  4OHV A;  4J9Q A;  4C7Q A;  2M0G B;  4C3M A;  5HMX A;  1JLQ B;  2KN4 A;  5DG8 A;  1CLF A;  4E2F B;  4M5D A;  2F5G A;  4IRD A;  1YJN S;  4OX7 A;  4YY3 F;  3J7A 1;  3KK2 A;  5AJ3 J;  1DTQ B;  1BUX A;  3M8Q A;  3FKB A;  1B7Y B;  3T1H F;  4LRF A;  4DV4 F;  4J9U E;  2DR5 A;  1XR6 A;  2NSB A;  3H2L A;  3M30 B;  4A8X A;  1LKZ A;  2IYI A;  3QGI A;  4TYB A;  2CAJ A;  5AXN A;  1KLM B;  3E51 A;  1SJ3 P;  2CPE A;  2EBE A;  4OI3 A;  4MIA A;  5FLX Y;  4DR5 J;  4DMZ A;  3J7Y I;  1S76 D;  4P10 A;  3HP6 A;  4O3Q A;  4C0O C;  4DPW A;  3E01 B;  1YK9 A;  4JI7 J;  2VJV A;  3G8S A;  2Y1I A;  4C8K A;  2AEJ A;  4KY3 A;  3RBZ A;  3E3X A;  3HJV A;  1DTT A;  2ZBP A;  5HP1 B;  1GTE A;  3M8Z A;  4IYQ A;  1WC4 A;  3EWG A;  3FSY A;  2G0J A;  3FNN A;  1UEV A;  2QGF B;  2BMB A;  3D6M B;  2BW2 A;  2HFU A;  3N79 A;  3VAL A;  3PX0 A;  4HEA 9;  1U8S A;  1JJH A;  2I2Y A;  3PYD A;  2DNP A;  3UDC A;  3P3D A;  5J1N A;  3I5B A;  2DR7 A;  1SH2 A;  3QJL A;  5D3G B;  1S7I A;  3JQJ A;  1SJ1 A;  1QSY A;  4DV2 J;  4KHP J;  3L7U A;  1VR6 A;  1JXL A;  5KFU A;  1DBD A;  3HM9 A;  3HDS A;  2CPD A;  4R0J A;  1XN9 A;  1LWX A;  3JTP A;  3MI7 X;  1JWW A;  1KDN A;  2UP1 A;  1RA7 A;  2OEK A;  4MKV A;  3ZTP A;  2VIC A;  4DL5 A;  4ZPD A;  5H9E J;  4ZPV R;  4R5P B;  1ZET A;  3VCD A;  2JEG A;  1SV5 B;  1SH3 A;  4NI2 B;  1X5P A;  3OTO F;  3QT8 A;  3H0P A;  3RR8 A;  1KQG B;  3M6W A;  1YZ7 A;  1HNW J;  3EM1 A;  2YKO A;  1C0U B;  3VAJ A;  1NAQ A;  4W98 A;  2IA0 A;  3BH6 B;  2K3I A;  3QT6 A;  4AYB D;  3F73 A;  2LA6 A;  2E5L J;  2HQI A;  3V6J A;  4Y2A A;  1RWM B;  3SMZ A;  3POT B;  4RBU A;  3NBP B;  3U27 A;  2LU1 A;  4J9L A;  1S97 A;  1SCJ B;  3ZTS A;  4ED5 A;  5BJR A;  3NP5 A;  3B6B A;  4LIR A;  3BRE A;  4DSJ A;  5KFW A;  2CWX A;  2PFD A;  2HVI A;  2BAB A;  1NPR A;  4YFU A;  3QWU A;  3Q8R B;  2MGZ B;  4JYA F;  1VQ5 S;  3DRS B;  1U24 A;  1FFG B;  1UW9 A;  4TVA B;  1JLF B;  2J76 E;  3K7R A;  1VLO A;  2KT3 A;  3KDO A;  2W9A A;  5IV4 A;  3P49 B;  3I0R B;  2MZJ A;  4M63 A;  4P6Q A;  3SIP B;  2XG8 A;  5KFM A;  3C15 B;  1N5Q A;  4JI8 F;  3I55 S;  4M5J A;  1NRK A;  2C3U A;  2W25 A;  3J80 U;  4C0H A;  3EPI A;  3B78 A;  3C8Y A;  4O23 A;  4HH0 A;  4MK7 A;  1KBR A;  3CD6 S;  4KC5 A;  2V2V A;  1RT3 A;  1NK9 A;  4HI1 A;  3PRD A;  1R43 A;  4DUZ J;  3QFH A;  1N54 B;  4IH5 A;  4DU8 A;  2DNN A;  1RBA A;  3V81 B;  1T9W A;  4GVL A;  2CG4 A;  3CIM A;  4IO1 A;  2XMU A;  4U7U K;  1NK0 A;  1FFW B;  3TZY A;  5J2N A;  3Q2S C;  4Q0B B;  2W4P A;  3MMC A;  2JLG A;  1PJ6 A;  2WK4 A;  4ICL A;  2QMU B;  4UOF A;  1KTV A;  3CJ5 A;  2FLL A;  1NKE A;  5I3U B;  1TQL A;  5CYQ A;  4LF4 J;  5DZ6 A;  2FHM A;  1V3R A;  4TYA A;  4ECX A;  4EK2 A;  1LWE B;  4ZCI A;  2QIF A;  2HKE A;  4LBI A;  3WIU A;  5SUH A;  1UEU A;  2HHH J;  3J81 j;  4K50 A;  2RNE A;  1J5O A;  5KFE A;  1DFD A;  3JTO A;  1XJW B;  2OD6 A;  2UUB F;  3KK1 B;  2HVH A;  2P2C B;  1E6Y A;  3QO9 B;  1VQL S;  1U26 A;  1RWK B;  4B9S A;  3LP2 A;  3TWZ A;  1DY3 A;  3KUG A;  3GFY A;  3T1H J;  4DV4 J;  1X4A A;  4J9S A;  2N4D A;  4DQS A;  3QT7 A;  2J8S A;  5F41 A;  1VDH A;  3GJR B;  2ZNZ A;  5D8H B;  4ZLJ A;  3PKY A;  3PYE A;  2HUR A;  2YQ1 A;  4UUX A;  1GXT A;  3C14 A;  4A8W A;  2OO4 A;  4LF7 J;  4ZPW R;  2NUH A;  3PHE A;  2LEP A;  3BGL A;  4ELT A;  4N77 A;  3N6N A;  1VOM A;  1SJF A;  3ILO A;  3IG1 B;  4XK8 C;  2A3J A;  4WK3 A;  5KT3 A;  2XY5 A;  1S4F A;  3DXB A;  2ADC A;  1RYR A;  2E1P A;  4DR6 J;  4HTI A;  1N48 A;  1LWF A;  4CTA B;  5F8I A;  1FWL A;  2E1C A;  2ZJR Q;  3HHL A;  2CNN B;  3FRY A;  3DOL B;  3LAN A;  1UA0 A;  2V34 A;  1PIE A;  3CUL A;  4X4O A;  2DNZ A;  2DGQ A;  1ZZF A;  2CZV C;  2ZD1 B;  1PAE X;  2JC0 A;  4NAS A;  1HPZ A;  1QTM A;  3GMG A;  5DM6 Q;  2QSF A;  2R2S A;  1OO0 B;  4TXS A;  3DM2 A;  4EUV A;  3E2E A;  2LEC A;  1N36 F;  4OFZ A;  4Q2L A;  1UJ6 A;  2RUS A;  2LQJ A;  2W9C B;  2HBZ B;  3THV A;  4EI2 A;  3KJV A;  4IOB A;  4PXE A;  4RW9 A;  1SQE A;  3FUY A;  1BGX T;  2QL7 B;  2BQU A;  5DQG A;  1JLQ A;  2OFG X;  4GO7 X;  5B7W A;  2IM0 A;  1XQI A;  2ZH1 A;  1H3D A;  4P73 A;  4ZVQ B;  1VQ4 S;  2ACM A;  2HNY B;  1F9F A;  3PAC A;  4V1A k;  5BYS A;  2ZUG A;  2MQ8 A;  1DTQ A;  2DNH A;  1BQM B;  4PQA A;  2MQP A;  3OTO J;  4DX7 A;  3VAK A;  3EPG A;  4DL0 C;  2QO3 A;  1QY7 A;  3EMT A;  2CPY A;  3CC2 S;  3UNG C;  3FBE A;  2AEM A;  2C1E B;  4LRA A;  3T5H A;  1YJ9 S;  2FHJ A;  4FZV A;  5KOX A;  3LP1 B;  5LSR A;  1FFS B;  3KLG B;  3T5J A;  2PMH A;  1VQS A;  3CCW A;  2FGO A;  2RML A;  4UOG A;  3H90 A;  2K1R B;  4FF2 A;  5ETP A;  2AIR B;  1S0V A;  4X4S A;  5HP1 A;  2RAQ A;  1Q8L A;  4DG1 B;  1A6L A;  2ZIT A;  3O2I A;  2NRE A;  1I3O B;  3GLJ A;  3MUR P;  4FBU A;  1YDL A;  1BE4 A;  5HVF A;  1R7I A;  1I5O B;  2R42 A;  4JYA J;  1O0P A;  2VFU A;  4ZVH A;  2FLP A;  3I96 A;  3G96 A;  3CMQ A;  4NCG B;  5E0O A;  1P1L A;  2X1G A;  1N5T A;  3IM8 A;  2RU3 A;  2QMX A;  3UDL A;  1HFE L;  2R7W A;  4WFN Q;  1CUL B;  4N76 A;  1KHW A;  5J2Q B;  3HHE A;  1KOO A;  4JI8 J;  2H54 B;  3SV3 A;  1PAU B;  3J7A N;  1ZOT A;  5D3G A;  2GVZ B;  2W2O P;  3QSI A;  2ALY B;  1U6Z A;  4K4Z A;  3A3P B;  4ECZ A;  4OZ5 A;  3FQL A;  3D67 A;  4NX9 A;  5MAO A;  3IN5 A;  2F3J A;  2OFH X;  3MM6 B;  2NXN A;  1H72 C;  3B4D A;  1U49 A;  3TP2 A;  3RBE A;  2XMA A;  5IT9 Y;  1FTC A;  2RS8 A;  5JVG Q;  3TA1 A;  2FUG 9;  2ASD A;  2CJY B;  4CO1 A;  1UAW A;  1S48 A;  3EE3 A;  3T1A A;  4NLQ A;  2DJW A;  3ZTR A;  3SSR A;  4R5P A;  5E3C A;  3FBF A;  4ZK7 M;  1M5S A;  1RLD A;  1V5I B;  4LRB A;  4NI2 A;  2YKN B;  1TFY A;  3EJM A;  1RT6 A;  4N5S A;  4I1T A;  2UVU A;  5D6G A;  1R0C B;  5AXL A;  3EVM A;  3TAN A;  1HBO B;  4NLP A;  1A0O B;  1C0U A;  1X4G A;  4M5N A;  3PDN A;  1U1N A;  4NWB A;  4A8K A;  1RYS A;  4DF4 A;  2PDA A;  4TU9 A;  2LKZ A;  3NBP A;  2UUB J;  1HMV B;  4AL5 A;  4N8N A;  1T0T V;  1D9F A;  1SH0 A;  3TVK A;  4CDI A;  1R89 A;  2B8Q A;  1YTY A;  3NCP A;  1JJ2 R;  2GQC A;  2CZ4 A;  3CDA A;  3R9L A;  2R7T A;  2XNQ A;  1RCX B;  4CZC A;  2MGZ A;  2BJ3 A;  2QSW A;  3MR6 A;  3DRS A;  3HFK A;  4LSN B;  4URS A;  4CO2 A;  2IJR A;  1JLF A;  2QYG A;  3CJ3 A;  2HQG A;  1VYA A;  5KFI A;  2EG2 A;  4WFX A;  2VPW B;  3OR2 B;  3EZ5 A;  3TAP A;  1HD0 A;  3F0N A;  3GCW P;  4Y3C A;  1YKW A;  3R5B A;  2YKA A;  3EGN A;  3TNV A;  4DPT A;  3BB5 A;  4XDD A;  2QLF B;  4PCQ A;  2G0C A;  4UY8 T;  5HAT A;  4ECS A;  3OLB A;  2CJA A;  1IJF B;  1GQE A;  4ZP9 A;  2R7S A;  4OX8 A;  4F2S A;  1PIL A;  1HYS B;  2JEF A;  4TNO A;  4NLS A;  2UXB F;  1DQA A;  4OMF G;  1NHV A;  4Q0B A;  3V6D B;  2M2B A;  3HHN B;  4RPF A;  4F3M A;  3WZ0 A;  1KQS R;  1NSA A;  4NLX A;  1SKR A;  2ZVI A;  2YX4 A;  3GIL A;  2V9K A;  4ZCM A;  1N36 J;  1S12 A;  1YBT A;  3SI8 A;  3AXM A;  3LAL A;  1RT4 B;  1LWE A;  3KLV A;  2VL1 A;  2DIS A;  3QRQ A;  1KR4 A;  3BO4 A;  1LW2 B;  3NCQ A;  4TN2 A;  4WKY A;  1WOS A;  5SZT A;  2F4V F;  1XMB A;  2GW8 A;  1NKC A;  4F36 A;  1KN6 A;  4FYX B;  1YI2 S;  2GV1 A;  3JSM B;  2B56 A;  4F7V A;  2HW3 A;  2XUL A;  3MFH A;  2R7R A;  4M5H A;  4FXD A;  2AT1 B;  3QO9 A;  1U6B A;  5ETO A;  3DYA B;  2W2M P;  3JAM Y;  3J81 U;  4EEY A;  4DS4 A;  4PG6 A;  3HT3 A;  4C8L A;  4GKK F;  3DRP B;  4M94 A;  4G1I A;  3GP9 A;  2X51 A;  5DJB A;  2J7W A;  3FEX B;  1HA1 A;  4HKQ A;  1SQF A;  1B7F A;  1RWU A;  3TW0 A;  3V2U C;  1RHQ B;  2HWT A;  4CCH A;  2P9C A;  1QTN B;  2GJI A;  3SDE B;  3DXS X;  4OZJ A;  1HIY A;  3AQP A;  3IG1 A;  2XHC A;  1RTH B;  3SYZ A;  3M6U A;  6FDR A;  2D69 A;  3T1Y F;  2G2Y A;  2QL5 B;  4NXM J;  1RBO B;  2HZA A;  3SQG B;  3PIP Q;  3PW5 A;  3NWG A;  4CTA A;  3D68 A;  1FTR A;  3MPY A;  2Z30 B;  3R5A A;  2CQH A;  2FQQ B;  5F9L A;  3DOL A;  5CZX A;  1SVD A;  1UVN A;  2FVQ A;  4WYL A;  3L09 A;  2ZH5 A;  4FKX A;  1EIY B;  3LGM A;  2ZD1 A;  4TLQ A;  4Y6I A;  2XEX A;  2HBR B;  2OJ3 A;  2LQB A;  1IKX A;  3IRW P;  3G8Q A;  1LV5 A;  4QBU A;  2BQR A;  2GIF A;  4KJI A;  4IQX A;  3QJP A;  3TAR A;  2COL A;  4KO0 B;  1B0V A;  5RUB A;  3NNA A;  2W9C A;  2EFQ A;  4MKB A;  5CHC B;  5LL6 d;  1X4F A;  2E7W A;  2BV3 A;  3RAQ A;  2HPU A;  3ILJ A;  2D3O 1;  4WE1 B;  1M1H A;  4CM0 A;  4ZCK A;  4NOH A;  1XR7 A;  4CIO A;  3VR1 A;  2CG8 A;  5THW A;  2HNY A;  1NBE B;  3HSZ A;  1EHW A;  2KZZ A;  1ZM9 A;  1T3N A;  2N7Y A;  3EVW A;  1NZA A;  4DV5 F;  5A2Q Y;  1Q81 T;  1BQM A;  2DB1 A;  1X5O A;  4JI4 F;  5T14 A;  2J5A A;  3EGV A;  1RK8 A;  2APO A;  1B64 A;  2VDI A;  3GFH A;  4YUD A;  2YQ0 A;  3K5O A;  1WKL A;  1HHQ A;  2KHD A;  1ZBT A;  1MN9 A;  4M1K A;  2HAF A;  1RAE B;  4M8L A;  1X9M A;  5CD4 H;  3ICL A;  2YWH A;  2XMV A;  5C24 B;  2XLJ A;  3KLG A;  2ZH9 A;  1VQO S;  1R6Y A;  4OJG A;  4XTT A;  2RVJ A;  4IOA Q;  3DN9 A;  3D1O A;  1VRQ C;  3ZZR A;  2XYG B;  2VPZ B;  3NG8 A;  4ETZ A;  7AT1 B;  2K1R A;  1RTZ A;  3MR3 A;  1VQK S;  1TTH B;  3MMJ A;  3JQK A;  2E7X A;  1HW9 A;  1SQG A;  3HKW A;  1CJV A;  4EMD A;  4ZP8 A;  3S01 A;  4FS2 A;  1CJT B;  4EBD A;  3KKF A;  1F3V A;  4ENO A;  1KLN A;  3ISN D;  3TZW A;  2F4F A;  4M5G A;  5L1J A;  4NCG A;  3TZX A;  3CDW A;  3AD7 C;  1S77 D;  2MQM A;  2FJA B;  3O5T B;  3PCO B;  5E5N A;  4HAC B;  3Q8S B;  3MGJ A;  4ATN A;  4P7V A;  1RE1 B;  1CUL A;  5J2Q A;  3VZH A;  3CWJ A;  4TU8 A;  1NU4 A;  1A9N B;  3R5G A;  2GVZ A;  3JYT A;  1KVI A;  5HBM B;  2VA2 A;  2J7K A;  2V94 A;  1OYD A;  2PII A;  1UFK A;  2V6A A;  4XPE A;  4XPC A;  4X4N A;  5LMU F;  1ZYQ A;  3KLI B;  4OYZ A;  3MM6 A;  3HD2 A;  2VG6 B;  3KHG A;  4KE5 A;  2HND B;  1FE4 A;  4B17 A;  2AYE A;  2R7O A;  5EX0 A;  2AV5 A;  2JWN A;  3KJQ B;  1R31 A;  5KG0 A;  2UXB J;  4AL7 A;  4RZR A;  1IQT A;  2XHW A;  2H65 B;  3C66 A;  1BHN A;  3HHL D;  3G6Y A;  2KXN B;  5CA5 A;  1URN A;  2YKN A;  1LOU A;  5DZ7 A;  2WAQ D;  3CB4 A;  1B70 B;  3D4J A;  2XLI A;  2UUA F;  4FYV B;  4MYT A;  1HBO A;  2PE8 A;  5M2P A;  4AD6 A;  1S6Q B;  4YN3 B;  1VJW A;  3FSX A;  4OLO A;  3EVO A;  1RUS A;  1XMO F;  2F4V J;  3W2W B;  1NDK A;  3H5S A;  2CVE A;  1XNQ F;  4KPC A;  4P71 A;  4DEZ A;  1HMV A;  3KJN B;  1MSW D;  3RRG A;  2ILZ A;  2AU0 A;  3CF5 Q;  1VBZ A;  4OX9 J;  1WOO A;  2DVI A;  3KWM A;  4NXN F;  3PM9 A;  4ILR A;  3MEE B;  4UST A;  2P6S A;  4K4T A;  3GYG A;  4KSE B;  3B54 A;  1ZTT A;  4GKK J;  4WU3 A;  4X4Q A;  3ULH A;  3KG1 A;  3OSP A;  2C2Z B;  4LSN A;  4UF4 A;  2HRY A;  5KT2 A;  4F2R A;  1OQ6 A;  2BE2 B;  2C22 A;  2NUU G;  3OR2 A;  1AFJ A;  2KVI A;  2DRD A;  5HQM A;  4OZ0 A;  3GYX B;  2H51 B;  3JS9 A;  2XCP A;  5HJY A;  3PV8 A;  2R8K A;  4BDP A;  3OD2 A;  1YRU A;  1RZM A;  4KIA A;  2YWE A;  4EYH B;  1Y3K A;  2FHJ D;  3Q23 A;  2YY3 A;  4Y2I A;  3GSD A;  3IBW A;  2BOA A;  1S59 A;  4RW8 A;  1EET B;  3OTE A;  3JSR A;  2ZUA A;  2L9W A;  3HI9 A;  2QZ8 A;  1WTF A;  4JBC A;  2YH1 A;  4A46 A;  1Q82 T;  1KC8 T;  3CCU S;  3UDE A;  5IV3 A;  4XAK A;  2M9K A;  2EK1 A;  3BKU A;  2MLX A;  3V6D A;  3PFE A;  2JVO A;  1NEE A;  2ZH3 A;  4K5S A;  2HQ3 A;  3BO3 A;  2LEA A;  2YNI B;  2XZT B;  5GAE U;  2ASY A;  2CQ0 A;  2VKZ G;  2IY5 B;  1UWB B;  1RT4 A;  4OHY A;  1TFW A;  5HRO B;  2MXY A;  1NSP A;  2M70 A;  4KQZ A;  1LW2 A;  4PYA A;  1YQH A;  4KGZ B;  4YB1 P;  3ET6 B;  4YP3 A;  2RIJ A;  1AXQ A;  3KNG A;  3OFG A;  3SZ2 A;  3T41 A;  3DYA A;  4DV5 J;  4BWM A;  2VBY A;  2YTC A;  3W2V B;  4JI4 J;  1KP6 A;  1TAU A;  1EJ7 L;  5C2G A;  1ZPV A;  3VGV A;  3DRP A;  3RW7 A;  1D1U A;  2GML A;  1U0H B;  1Q79 A;  4X4V A;  1N33 F;  3BGF A;  2HS4 A;  2B7C B;  1JLE B;  3GON A;  4OZN A;  1UVM A;  1HNZ J;  4KV8 B;  1WEY A;  5IT0 A;  3PR4 A;  3Q86 A;  3SDE A;  2HK2 A;  1WEZ A;  3TUJ C;  3W60 A;  4OZ1 A;  2VA3 A;  1TUG B;  2UXD F;  1RTH A;  1WF1 A;  4QYR A;  4B02 A;  3FDS A;  3IC1 A;  2ZZN A;  3RU0 A;  4X4U A;  3MM8 B;  2LEB A;  3SQG A;  1WSV A;  2ROG A;  1FVQ A;  2YWW A;  3U1N A;  4D3G A;  4PKD B;  3PNI A;  2HIY A;  3CE8 A;  4ZPC A;  2FHK A;  1XNR F;  3DDI A;  1YLX A;  4QYZ K;  1SL0 A;  4BHQ A;  1ZS6 A;  1TK8 A;  1NME B;  4O0I A;  3D9B A;  1J5E F;  4KO0 A;  2YNG B;  1X8D A;  4IKA A;  3LOU A;  5DLG A;  5K20 B;  5A6P A;  4NZ6 A;  4LBP A;  4G1P A;  2IAJ B;  2UV8 G;  5LMU J;  1LW0 B;  5CXT A;  1SIZ A;  2V4R A;  3HKZ D;  4EWT A;  2G2O A;  3I87 A;  4WE1 A;  4FDF A;  5F0U A;  1DLO A;  3Q8U A;  3AB2 B;  5DQI A;  2E5I A;  3D0G E;  2LQ8 A;  3AAW B;  3TUZ C;  2OTL S;  4F0M A;  5L1L A;  3RAM A;  4I56 A;  1XIQ A;  4QIE A;  1YWX A;  4D3H A;  2W2P P;  5J2P B;  4EZ6 A;  1FJ7 A;  4E98 A;  1AUS L;  4QWC A;  3D1Q A;  3DGP B;  5I42 A;  4OI1 A;  3AA9 A;  3DGV A;  2UUA J;  4Y00 A;  1XK8 A;  5AXM A;  2G13 A;  1MRO B;  3P8B B;  2RB7 A;  1S4E A;  5D4O A;  1IBM F;  4GKJ F;  1U4B A;  3M8R A;  3T19 A;  1XMO J;  2J9E A;  5KFB A;  2E9R X;  5K8O A;  4MH8 A;  1XNQ J;  2EC2 A;  2W2Q P;  2W01 A;  1WHW A;  5DGA A;  4LFB F;  1CC7 A;  4EO8 A;  2IFX A;  2GNK A;  2IDE A;  2K7K A;  3K5P A;  3A4T A;  3UI3 A;  2HWI A;  2YWG A;  2WSE C;  1VGY A;  1FDD A;  5C42 B;  5KFD A;  4FBT A;  3MEG B;  1NDL A;  1WC3 A;  3E8O A;  1CJT A;  2W7P A;  1VS3 A;  1EP4 B;  4H4O B;  5BXI A;  3BQ1 A;  2VG5 B;  4BC7 A;  3NOG A;  1ZAX A;  1G3O A;  5M2U A;  1T9T A;  1Q7Y T;  2HWH A;  2HHQ A;  1WHV A;  1PC4 A;  2AJ0 A;  4UZC A;  4HAC A;  1NDC A;  4GMK A;  4GO5 X;  3F56 A;  3N9U C;  1U1O A;  1XC9 A;  1U02 A;  2M8H A;  4NA1 A;  1AW0 A;  1FKO B;  1N32 F;  2GCF A;  2QL9 B;  3PW7 A;  3KLI A;  5ETN A;  2DO4 A;  4HLB A;  3TQE A;  2VG6 A;  2HND A;  2RDJ A;  4KFB B;  4PYD A;  2DR6 A;  1NJZ A;  2UVV A;  2D9P A;  4DOZ A;  2HIQ A;  3ILI A;  4RNH A;  2FVP A;  2KFN A;  2U2F A;  1I51 B;  4O3R A;  4ZIV A;  4XIU A;  1J2V A;  2HK3 A;  4ANE A;  4QZV B;  2FTR A;  2V8H A;  5DM7 Q;  3BGO P;  1JMT A;  1NB7 A;  3UNY A;  3OPK A;  4KGK A;  4FP9 A;  1OIA A;  4DL2 A;  1FX2 A;  3MOZ A;  4OZ2 A;  3W63 A;  1QUP A;  1SL2 A;  5GAH U;  1SXL A;  2CJQ A;  1BMQ B;  3G6V A;  2G4B A;  4NA3 A;  4WP8 A;  2QT7 A;  2AJ2 A;  2RRN A;  2F8H A;  3THP A;  2B3T B;  3OXL A;  4WZM A;  1JLG B;  1HNV B;  2DGW A;  4WIQ A;  1EX8 A;  1YJ7 A;  2YXL A;  4QWD A;  1U45 A;  2VPX B;  3I31 A;  3ZTQ A;  4LIW A;  2RJZ A;  2CVI A;  4NYZ A;  5HMY A;  5L9X A;  2R7U A;  2PMZ D;  4O3N A;  4ZLP A;  4X4T A;  2DCU B;  3QRR A;  1WG1 A;  2OUG A;  3QZ8 A;  3IFE A;  1KVJ A;  3FVY A;  2FDN A;  4CI0 B;  2BE2 A;  1FRL A;  4EBC A;  3QAT A;  2C2N A;  5DO2 A;  1RA6 A;  5JUM A;  3VTI A;  4DS5 A;  3R5D A;  4DX5 A;  5CAA A;  4YB6 A;  4G1Q B;  1AUD A;  3KTQ A;  3QMQ A;  1QE1 B;  1JLC B;  2AZ3 A;  1TL3 B;  5HSP A;  1IBL J;  2OEM A;  4OI0 A;  1U1M A;  3VQS A;  2JLE A;  4Z7C A;  2Q1L A;  1EET A;  2OLW A;  2ZHB A;  3G4S S;  4B9N A;  3NS6 A;  3CSK A;  1KON A;  3GB0 A;  1RIS A;  4QIG A;  1S0N A;  2DR9 A;  5KFC A;  3LF0 A;  5F8H A;  3MPW A;  2O1P A;  3DRY A;  1XNR J;  4PUO B;  1C1B B;  2DYA A;  2YNI A;  4RLE A;  4YHH F;  2ZC3 A;  1J5E J;  4P52 A;  5HVH A;  5IXU A;  1R27 B;  4QJV A;  2J0Q D;  5A6W A;  2ILY A;  1UWB A;  3LPY A;  5HRO A;  2KDO A;  2GZO A;  1N5Y B;  2KO1 A;  4OHW A;  1P27 B;  4H54 A;  2DHA A;  3I4P A;  3ET6 A;  1Q8K A;  3IGV A;  3I32 A;  1QSS A;  4WU2 A;  2D3U A;  3MD3 A;  3T6B A;  3AB4 B;  3PJX A;  3UE2 A;  2J0S D;  4WFY A;  3A12 A;  4N56 A;  3QZ7 A;  3OSN A;  3BGR A;  2GIQ A;  2KKH A;  2JJ4 D;  3W2V A;  2FYX A;  3H4B A;  3CCJ S;  4QWE A;  1NHK L;  3H5X A;  2VG7 B;  5HAN A;  1BWE A;  3AT1 B;  3M8Q B;  4Y28 C;  2OEL A;  1U0H A;  2DPJ A;  1HBN B;  3FJ2 A;  2KL8 A;  2MZ1 A;  1JLE A;  3CCT A;  1N5V A;  1IBM J;  3UQS A;  4GKJ J;  1F5A A;  1VIO A;  1U48 A;  3KUH A;  2K06 A;  5F9N A;  2XI3 A;  3MOJ B;  3GYN A;  4ZVF A;  1ZM2 A;  1FKP A;  4PZV A;  1UKU A;  1CS4 B;  1Y10 A;  4J7C A;  5EX3 A;  1VQ9 S;  1FO1 A;  4YDD B;  2Y1L B;  2OAU A;  5GAE I;  4LFB J;  1D8Z A;  3G6X A;  2AJF E;  3HSG A;  2Q6B A;  3MM8 A;  3CT9 A;  3QNW B;  4GC7 A;  4Y34 A;  2NS1 B;  2HG4 A;  4IRC A;  2RH3 A;  1SJR A;  1N0U A;  2G9O A;  2V2K A;  3KHR A;  3KG0 A;  2E1R A;  2HQD A;  4JP8 A;  1WI8 A;  1DUR A;  4YS2 A;  2QC3 A;  4YR3 A;  4B9U A;  3K8V A;  1MML A;  3CJR A;  1Y0H A;  4OV6 A;  3M7V A;  2DGO A;  5L39 A;  3FMW A;  1RLC L;  1VHI A;  2WVF A;  4PG5 A;  4TLR A;  2R7Q A;  1F9E B;  5D77 A;  1WUU A;  4QR0 A;  3PJW A;  3OHA A;  2Q43 A;  2VB6 A;  4ZVT B;  3D0I E;  3BR9 A;  1PO6 A;  1K73 T;  2YNG A;  4K2J A;  4DFJ A;  2W9B B;  1H2V Z;  1HAR A;  2RDI A;  1N32 J;  4J9R A;  2IAJ A;  4ZOS A;  3QSY B;  1LW0 A;  4HDH A;  1RT1 B;  2X1B A;  2JOQ A;  3ZO7 A;  1Y5I B;  3IM9 A;  3W1Y C;  4CT8 A;  3HHK A;  4L72 B;  7FDR A;  5J2M B;  1KRP A;  3CJK B;  2K2P A;  3W9J A;  2ZNY A;  3NAI A;  2PI4 A;  4ES1 A;  1UJ5 A;  3CDU A;  4NPO A;  3WQP A;  4RL1 A;  4PXB A;  2EVZ A;  1HQ2 A;  5J2P A;  3VWS A;  2KVQ E;  2HS0 A;  2I1R A;  2BAN B;  2LDY A;  2DGX A;  1KTQ A;  4DL4 A;  3LW5 C;  1MRO A;  2BX6 A;  2JL9 A;  1CG2 A;  3ZZ0 A;  4UUW A;  2V5H G;  2QN6 B;  1SL1 A;  4BC9 A;  1DHM A;  1RWX B;  1SKS A;  2VV5 A;  5FD1 A;  2BRL A;  2I6W A;  4A48 A;  1BD6 A;  1RAI B;  2CQB A;  2KT5 A;  2L9D A;  2RRB A;  2WBR A;  3TEH B;  5HVG A;  1FVS A;  1FDN A;  4FPI A;  2MTL A;  2EK6 A;  2F65 A;  3FQK A;  3WX4 A;  5C42 A;  3C16 B;  2Y8W A;  5J1E A;  4PAB A;  4ZJQ A;  1FRJ A;  4OI6 A;  3MEG A;  1WI6 A;  1PCA A;  3Q8V A;  2O66 A;  3I56 S;  5A76 A;  2DRA A;  3K5M A;  5LMN F;  3NS5 A;  3LPE A;  1EP4 A;  2H9Z A;  1RAF B;  1SC6 A;  2C2K B;  1B0T A;  4H4O A;  4F04 B;  5HMZ A;  2VG5 A;  1RWN B;  2QA4 S;  2KYX A;  1Y5N B;  4I6Y A;  4TY8 A;  4ZJO A;  1JXE A;  1ZM3 A;  1FXD A;  4J9O A;  4RBV A;  5KFR A;  4ILL A;  4I2Q B;  2R2T A;  5M2R A;  4DDF A;  5C25 A;  9RUB A;  4Q43 A;  2GVD A;  2AGO A;  4TQR A;  3PVX A;  1RKJ A;  1NLK L;  3PO4 A;  1P6T A;  2JVR A;  4PWD B;  1SKW A;  2DNR A;  1FKO A;  3DLG B;  2V8V A;  4DV6 F;  4Q2M A;  3K89 A;  2LMI A;  4J9N A;  4YOE A;  2AYB A;  2Y1J A;  4CLL A;  2FVC A;  4B3T F;  4QYZ J;  5HK4 A;  4ES2 A;  1T95 A;  2E5H A;  5DG9 A;  1RCO B;  2G1D A;  3H5U A;  4ZKA A;  4FPR A;  2MLZ A;  3U02 A;  5K8M A;  5L9N A;  4X62 F;  4YHH J;  3MUM P;  4ICL B;  2C2M B;  4Q5V A;  3BYP A;  3SFU A;  2H5E A;  1FNO A;  2W2N P;  4CO0 A;  1EB0 A;  5LSL A;  1D9A A;  4USU A;  4LRD A;  2H3E B;  3FFI A;  1JLG A;  1HNV A;  1VI7 A;  2HFN A;  3BZQ A;  1PBA A;  4BWJ A;  5K8P A;  5AXK A;  2WTF A;  4KTQ A;  2IRY A;  3H2U B;  1GXL A;  3AY0 A;  4WWS A;  3V5R A;  5EWG A;  3M2U B;  4F4K A;  5FLX U;  2PEH A;  2J6S A;  1X5S A;  3H7H B;  2CFX A;  4I67 A;  3MDF A;  2CPF A;  3R8Y A;  3KLF A;  2B51 A;  2RQM A;  2RDD A;  1VQM S;  3ZFV A;  4NEZ A;  3GG0 A;  2V8G A;  4DX8 H;  3B8H A;  5E3P A;  3OW2 R;  5GMD A;  1BWV A;  3DFE A;  2VJU A;  1OPI A;  1PC5 A;  3C14 B;  2ZHA A;  6FD1 A;  4G1Q A;  5D0G A;  4CT9 A;  1QE1 A;  1JLC A;  3GV5 B;  4KGX B;  8AT1 B;  1KQK A;  2E44 A;  2Z0G A;  2UU9 F;  3NGT A;  5GAH I;  2SXL A;  1S5Z A;  4ZPA A;  4CYU B;  2IYG A;  1L3K A;  4DLG A;  3D6F B;  3DNC A;  1LWF B;  3RR7 A;  4ZJL A;  1KS2 A;  4MKA A;  5CQG A;  8ATC B;  2HHX A;  3LQV A;  1FX4 A;  1RAO A;  3VV2 B;  4PUO A;  3US5 A;  1C1B A;  1UZH A;  2PMW A;  4DCO B;  2JEI A;  1VLY A;  2CIM A;  3L9Z A;  2EFG A;  2WHO A;  3OR1 B;  1RAJ A;  1CVJ A;  5IQ6 A;  3DKD A;  1M5O C; 
#chains in the Genus database with same CATH homology
 2F63 A;  2CG8 A;  1EQM A;  1EQ0 A;  1RB0 A;  1RTZ A;  1HQ2 A;  3UD5 A;  3HSJ A;  4CYU B;  1EX8 A;  3HT0 A;  1RAO A;  4CWB A;  3HSZ A;  1TMM A;  4M5M A;  3HSD A;  4M5I A;  5ETL A;  3ILO A;  3HD2 A;  4M5L A;  4M5G A;  5ETR A;  3HD1 A;  5ETK A;  3MCO A;  2F65 A;  5ETP A;  2QX0 A;  4F7V A;  1KBR A;  4M5K A;  3KUH A;  3ILI A;  4CRJ A;  1Q0N A;  3HCX A;  3MCM A;  1DY3 A;  3HSG A;  1G4C A;  3KUG A;  4M5H A;  5ETT A;  5ETM A;  1HKA A;  5ETQ A;  3QBC A;  3UDE A;  4AD6 A;  1RU1 A;  3IP0 A;  3ILL A;  3ILJ A;  4CYU A;  4M5N A;  5ETV A;  5ETO A;  4PZV A;  4M5J A;  1IM6 A;  1CBK A;  5ETS A;  3UDV A;  1RU2 A;  1F9H A;  5ETN A;  2BMB A;  3MCN A;  1TMJ A;  3KUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...