3UDWA

Crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell immunoreceptor with Ig and ITIM domains
publication title Structure of TIGIT immunoreceptor bound to poliovirus receptor reveals a cell-cell adhesion and signaling mechanism that requires cis-trans receptor clustering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3udwA00
3G04A 3C6LC 4LEOA 5I8EB 4HKJA 3D39B 4H0HB 4EKXA 3TM6A 5HPMB 4NCC2 5AEAA 2XZQH 4Z7QF 3T2NH 2VLKB 3AB0C 3T0EB 1FYHB 5B22A 2VN4A 3FRUB 5T3XL 5C2BL 5IJKC 3JVGC 1AE6L 3FB5A 4R8WH 2DWEA 4LPWA 4MAUH 3WKML 4WJ5A 5E2JA 4IRSA 1OPGH 4Y5YA 4PBXA 1IM3A 3TYGH 8FABB 3RWFB 1HOCB 3I3BA 4XNYH 4LLQB 4UV4L 1U8MB 5IMMB 3VD4A 2UV3A 5B38A 1JTPA 1U3JA 4EDWH 4KTDL 1KELH 5CINL 4RMQA 4UDUA 1U8JB 3NA9H 3FOMA 3GI9H 1MAMH 3EHBC 2C5DC 3JSSA 5EU3B 4RFOL 5MEPB 3U0PB 5JW5B 1F58L 5FO8B 1MWAL 4JFPB 1OWWA 3DX9A 2ADJB 4H0IA 5M94B 1S9WB 2X4OB 5D1QB 2AK1H 1X6NA 2V7NB 4I0PD 5DD5L 2CDGA 1VENA 4QOKB 4NQVA 2BVPB 4N8VG 1A7NL 5DI8A 1MHCA 1MHEA 2FB4H 1YPZF 1U9KA 3F6IA 1A6WH 3FFCA 3ARGD 3O3EA 4JKLA 2OZ4L 3QWQB 1G6RB 3ZO0A 5DRWA 5F1IA 4L3EE 5FK9A 3HLAA 4FXKB 4V1DD 3C2AL 2RGSA 5L2KB 3JV6B 5BW7A 2CR3A 2ZSVA 2APFA 4S1SH 5TGBA 4M6OL 1BX2A 3W0WA 1EO7A 3REVA 1AQKH 4BK4A 1K4CA 3CSGA 3MRRB 4JO1L 3W5MA 1YPZA 1U3HA 1J12A 4XC1L 2Q76A 3LQAL 3LPGA 4JREB 4L8DA 4WEMB 1S3KH 3ARFD 4YWGL 5J1TC 1KCSL 1M7XA 1SMAA 2K3TA 2ZCLH 4BZ1L 4F7EB 2KL6A 5E6IA 4EUPA 1J5OH 1NANH 3GIVB 4PIRF 3QO0B 4PUBL 1VFBA 1PYWA 4HKBB 2HKFL 1YYMH 3QZWB 3IJHB 1F4YH 3V6FB 5SWZE 1XGRA 4W4OA 3RHWK 3I2CH 1XGUA 5BS0B 1IGIL 3LV3B 3RBGA 3GIZH 4F3FA 3SKOB 3SGDI 3ZL4L 2Z91A 1HSBB 1DUZA 2ATPB 2MHAB 2FBOJ 1JGDA 1KCVH 4P57B 3RVVC 3O4LD 4PGJA 5DT1H 1KJ3H 4NN7B 1J0KA 4PJXF 2YD9A 1OD7A 5TH2A 4U6YB 1HYRC 1NEZG 4ERSH 4PLNC 3HC4L 4EIZC 5JHDA 1MF2H 1WVZA 4N0UA 5ANMA 5EZIL 5SWSD 4PS4H 1XMWA 2FSEA 1G0YR 5FO9A 4DGVH 1ZLUH 1Z6JT 5KS9F 4E42A 1RJYA 3U79A 4KKBC 5DJ0B 5JA8B 1WZKA 4JDVB 1HZHL 2G75B 4QHUB 1Q9OB 1NFIB 2LFGA 4NYLA 3WLBB 5IG7A 3QHFL 1IGYA 5ID0B 1XIWB 1H3UA 3VXME 3FB7B 3O9WB 3MJ7A 4LK4A 2J5LC 1T7VA 4P46B 2CK0L 5I1CL 4CMHB 5EIIA 5KS9A 2VDKL 5JO5A 4X5LA 4ZTOL 1QSEB 1P1ZB 1EERB 1F4WL 3H9SA 4NKIL 2C3VB 3QHZH 4P4RA 4ODXA 2XWTA 4WHYH 2EKSA 4PV9A 4XVUD 3BPLB 3LEXA 3T4AA 1RVFL 5IF0A 1XR9B 5LBSL 1ND0A 5E2UH 1MFDH 1BF2A 2ICWA 4M93B 3WS6A 2HJFB 3DARA 4LASL 3NGBC 5F9WC 3U7YH 4JANB 1YEDA 2CRIA 2BVYA 1ZGLP 3PWVB 1OGTB 5D71L 1TQCC 3PWPD 4QXTA 2PYFA 1F3JB 3AS3A 5EA0L 3VDBA 1T1YA 2EH7L 3HNSH 2E7BA 4E9LA 1FNEB 2DQFB 3MRGB 1T0PB 1YEJH 3NCBB 5BJTA 1H3XA 4OLZL 4R9HA 4ZG1A 3ZYOA 4ZUVB 3MRBA 1K3IA 1B0RB 3H9HB 5H94B 4QHNA 4Y4KB 3QUMA 2KH2B 2OMBA 1UJ3B 2CKBA 1GC1C 1BQSA 3PABA 1NH6A 3SGEH 4I4WA 1LO5A 1U8HA 3BEVA 3RWJB 3NZ8B 2HAZA 2P24B 1RZGA 3FAXA 1T89C 1LNUB 4RGOH 3ARBD 5IHZB 4XPBL 3RTQA 2QADB 4PJIF 4PJ5B 4BH8A 4OZFG 3LS5L 3KS0J 1F02I 1DVFC 4OZIF 3SDDC 1LEGB 1XR8A 1M1SA 3D2UD 3SDYH 1ZHKA 3ILQC 3VCLB 4ZQKA 4OF6A 4OF0A 3U30C 1MJUL 3MSPA 2DQHH 5FYLL 2X70B 3BW9A 1VPOL 2ZUVA 1DQQB 1CE6A 1HINH 2IGFL 5E5MB 4IRZH 1K2DA 2IH1B 3RUGE 5C0BD 4U0RC 3EDKA 2XN9D 4R3SB 4PJIA 1IGFH 4JVUA 2E7MA 3DI3B 4OUOA 2D0FA 5F88A 5DK0B 4OZIA 4S1RL 1PVHA 4POZC 3KLAA 2PXYC 1X44A 4P4KA 1KJMB 2FATL 3RL1A 2Y6SC 4Y0GA 4U7SA 1BBJA 4C58B 2Y36L 3QI9C 4G9DB 5D1XB 4LBEA 4PJBF 1KJ2H 3IFOA 5HYSB 2HTLD 5T3XH 4RRPG 3RWHB 1AE6H 2A6DB 4JY6A 4U0QB 2JJWA 3P9LB 4N9OB 1SYVA 4GFTB 4Z78A 3WKMH 4LVNB 2LTQB 3LH2H 1KIQA 1W72H 3STLA 4RZCB 5LCVL 3IU3B 4CW1A 1ZVSB 3MXWH 5DHVA 1T0MB 3V8CA 3ZTJH 3TN0B 4K3GA 2ZZUT 1SYSA 5CJBA 3DX6A 1U8PB 3ELAT 5MENE 2H45A 2L0DA 4PJBA 3C60B 4KTDH 1ADQA 5DJXA 2P8MA 4F7TB 1T1ZA 1T80A 4OCXL 3BGFB 5CINH 4NO2B 1BFSA 3P30L 3CH1A 4PJ9C 2NLJB 5F1NB 3WUWG 3CFIC 2BJMH 2HKHH 4GRLD 1NCAH 3PDOB 4IRSC 2W60B 5ICXB 5KANI 4RFOH 3QNXB 5F7KC 4PJ7B 5KZCB 4ZODA 4K94H 2MNUA 1RU9L 1MWAH 4GKZA 3LSOA 4S2SB 4X9FA 4UIKL 4OV6F 1BFOB 5HI3D 2IAMD 2NY4B 5DD5H 2UWEE 4D9RD 4XB7A 3WIFB 3ZE2E 1WTLA 3VGHA 3HZYB 3L6FB 1A7NH 5IMKA 4IMLA 4RIRB 2W91A 4NKOA 5CEXB 3KLHD 4MNHA 4Z7WF 4Y16D 1OW0C 1S7TB 3WDJA 1SM3L 4BUGA 1WLHA 4YO0B 3TBYA 2YD2A 2Y72A 5E6YA 1F4AA 1OP3K 4Y4HD 3TNNA 4I0CC 1F8TL 5D2LE 5FYKD 3LOWA 2G60L 3VFGH 4B53A 4F58L 3QH3B 2FEEI 5I2IA 2EDNA 1FNSL 4JRXA 4BQCA 5A2FA 2AK4B 4XC1H 3MBXL 3LQAH 4YWGH 1KCSH 5DD3L 4BZ1H 1MCPL 2V5YA 3NIGF 4JFXB 4CU7A 1DBAL 3BKYL 4MNGA 3FMGH 5BW7C 4HLJA 1Z5LA 5FUCC 3PXHA 3CFJB 3SY0B 4MYWB 2GK2A 1SJHB 4KQ4H 1MFNA 3DXAE 5J89A 1M7IB 5DA4A 1TETH 1A0QH 1F3DH 4N5ED 5T5NG 5DD6A 3FONB 2XNAB 3ETBF 1N59A 2IPTH 4G80A 2P43B 1JGVL 3ZL4H 1Q1JL 5GRWA 5E00B 3RNKB 5E6IC 3ZT7A 2YR3A 1VKXB 4LLUA 3E3QE 1CGUA 4XNUL 2AJUL 3LKRB 5CZKA 1P7QD 4JN1L 3B2VL 1NPUA 3AVEA 1HWGB 4RAUB 4KK9D 5FYJE 2AXGA 3SPVB 2DLTA 4L8SA 3SKMB 4HIXL 3VD7A 1SBSL 4L4VB 1A1MA 4P5TC 4ZNEA 5DDHA 5EZIH 1G7HA 5ALBL 3CVHB 4WFEE 5GRXG 4BK5A 3DV4B 5HYJE 4WI7A 1C5BL 4MJ5B 2R23A 4XNMA 5F9OH 1FJ1B 3TIEA 1RIVH 3H6JA 1WISA 3KNBA 3WDIA 5I1HL 1JF1A 3QUYB 2P5WB 3QHFH 3MX0A 3CX5J 4QXUL 3BWUC 3L95A 3KDMB 4ZSOE 3QIUA 3VH8G 1HQRB 3ARWA 2VLJA 4JRYE 3OB8A 1CD0A 4PLJD 3QWRD 2R39A 2CK0H 5K9KA 2HT2D 3O4OB 4Y1AA 2VDKH 1L7IL 4FQPA 1NJ9B 2OL3A 3HCVB 1ZT1B 4ZTOH 5I19L 3PWLA 5C0JB 1U3ZA 4XAKE 3VRLF 1F4WH 1MFAL 1B0WA 4NKIH 4RNRB 1TTUA 2YWYA 2CQVA 1FO0A 1RVFH 1BJ8A 1T1WA 2XXCB 3IDIB 5LBSH 5B3JE 3C5JB 4YC2C 3V5DA 4GOSA 1GHFH 2JJSA 4LRIA 4LASH 1R24B 3JWOL 4YZFF 4ZPTA 2IANE 5F8QC 5EWIH 2BNUA 5IBUG 4PRPD 4HWZB 4AQOA 1B6UA 1RZKH 3D0VA 5EA0H 3LKNA 3WE6A 2EH7H 1ZA6B 4MCYA 5JDSB 2DRUA 2F74A 1FHGA 4OLZH 5C07E 1YMHA 1G9EA 3QPQD 4P2OB 1FVEA 3BGAA 5FDWA 4LSSH 3SJVA 3WS6C 3LRGA 4JKWA 4I0KA 3ARDC 1VGKA 3BOVA 2VQUA 4HJJH 5IEHA 2FEDC 2E27L 3S4SB 3UPAA 5DLML 3HFML 3OX8A 4YHNA 1PGRB 1T4KA 3IDXL 4S1QL 3KPSD 5F9JB 2W1NA 1B0GB 2ZNWA 4YDVB 4EI6B 3KYOA 3LS5H 2WK2A 1JNHA 1I75A 5F70A 5IUSA 2JJTC 3L7EA 5BZWB 1EUTA 1QACA 4G9FD 5T1KD 3BPOC 3BUTA 1UKTA 3QQ3A 3BH9A 3O81A 2BSSB 1G7LA 1U8IB 5FYLH 3WS3A 1VPOH 3W11C 1RK0A 2IGFH 4MD0B 2A74A 3Q3GB 1N5AA 5EFIA 2NX5E 2RJMA 3RZCC 4M8QA 2XRAL 1QSFD 1I7UB 4OFVA 4WO4C 1NGXA 3GSRB 4S1RH 1S7XA 4FZ8L 4MLSA 2BVQA 4ETQB 5DK2B 1AHWC 3QXAB 2XG4A 4NNPL 5F7WC 1CU4L 4NQDB 4GS7B 3HRPA 2RCSL 5HHPA 1A1OA 3T04D 3L3DB 4J8RB 1CDHA 1KPRA 2F53E 5BZDB 1CFSB 3O45A 3QIWC 2CLVA 3E6HB 4X99A 5LCVH 4D0BB 3DUUA 4NPYA 1F97A 5IHBA 5DEGA 1ORQA 4MAYA 2X4PA 3LKOB 2CMRH 5IIEA 4TVSa 5L2KD 1BLNA 5E4EB 2I9TB 2IFGA 4OCXH 3BYTA 3S37X 3OMZA 1FAIH 5D72H 3P30H 4NUGL 4XVTH 2APXA 4AJ0A 2FHCA 5ESQB 3UBXA 2BNRB 1CGXA 3OKKA 4P23C 4N0FA 3WV0A 1HHGA 3TFKD 3HC0B 2V5TA 1RU9H 3TYFA 4HMDA 4OT1L 4OSUL 4UIKH 3IDGA 1JNJA 4URTB 2RB8A 1SQ2N 1V7ML 2DICA 5CLWA 3OF6D 5JPNA 5J6GB 1IMHC 4JKMA 1CD8A 4NO5A 1MJJA 3D69B 1D3CA 2IJ0C 4TN9A 2XXMB 4H20L 2V9TA 2NW2B 4X7DC 1SM3H 1BM3L 1TENA 4QY8A 3LD8C 5DRXA 5GISH 4WFFD 5EC1B 3QFJA 2G60H 3TC9A 2J1KA 3SCMD 2AABL 1NDMB 1U41A 3VGGA 1S7SB 3QUKB 4WUUB 5ESAA 4FS0A 3TA3B 5E08L 4PJFB 4Q58C 2WQRA 4F58H 4BZYA 3HUJE 2AV7A 5D7JA 1FNSH 3P77B 3O6MH 1PSKL 3MQIA 3SKUD 1B88A 3EKCA 2E7HA 1PKQE 4R4BB 4R97B 3KS0H 4ORZC 3VXRE 4X8JA 1DBAH 3BKYH 3RU8L 2J8UE 4NJAL 2ZNXA 1P4LA 1FC2D 2GUOA 3IETA 5GZND 2AEWA 1L4IA 4NO0B 4NRZA 2VXSL 4YK4B 5DJAA 2B20A 4NQCB 3OAYK 5C7XL 5HHVL 1VEMA 4K3EL 4LU5L 4ONGL 5CKAA 4NFBA 1CDCA 5HDBF 2ZUWA 3LN5A 3MRNB 1FZOB 3TJHC 1JGVH 4I2XE 1DEEB 5A3ID 1Q1JH 5KOVC 4GQ9L 2NY6D 1CS6A 5JNYA 1MQKL 1KT2B 1ACYL 3WO4B 4KHTL 3H0TA 2OK0L 3GRWL 4XNUH 1GVIA 3VFNA 2AJUH 4QHLA 4JN1H 1QBAA 1RJLA 1YECL 1T5XA 1FH5L 1JFQH 5E24E 3SHSA 1BEYH 2EXYD 1SY6H 1W0VB 4HJGB 4ZYKA 3U6RB 1SBSH 2MMXA 3FFDB 4LP4A 5MHSD 2PTTA 5H37G 4NNXA 4R96A 4P2RB 2R56H 1T1XB 4KKCC 4PGBB 1A14L 4PJ8D 5DUPH 2R0ZL 2SEBB 1JZ3A 1C5BH 4LLDB 4AH2A 3TPUB 3MUZ1 4XPTH 3BFOA 3GMQB 2QSVA 4Y2DB 4Z77A 2OCFD 2A9NL 3F65A 4X7EC 4I0PA 1IC4L 3DHJA 2I25N 3MOBH 4TTGA 4QXUH 4L8SC 4JPKL 4M43L 2WINA 5GJTH 3T4AB 3GHEL 4Z0XA 1MVUA 4ZFOL 4UZGA 1CL7L 5B39A 1OTSD 2EDEA 3U82B 4RGNC 2B4CL 2UZIL 2XTJB 1RMFL 2R0LL 3NH7L 1RJZA 3WEXB 3ARGA 3ROOA 1L7IH 5ESVA 3ES6B 4FQHB 5I19H 2HFTA 2NY2C 4V1DA 4I18B 2R8SL 3QDAA 3UTQB 1MFAH 4N0CC 4YGVA 1HDMA 3BDBA 4U1GC 3Q6GL 5D6CB 2Z31D 5AG9A 5KVEL 4LIQE 3LKQA 4X6BB 2Q6WA 3BKML 2J6EH 4WFGD 5EUOE 5JOFA 4PGEA 4ZDHB 4APQD 1BBDL 3T3ME 1KPUB 3EBAA 4ZOCA 1K85A 3JWOH 5HGAA 4XCEB 4OM1L 1N8ZA 3LIZL 5EIVA 1NBZB 3S97C 1XF3A 1BD2B 3BN9D 3ARFA 4LCWE 5D7KE 2QQLL 5D2NB 5HGGS 2NXZB 5C0IA 3WN5A 3OKYA 2A83A 5I8CB 1JYWA 2H32H 2X5PA 5JDJA 5C9JB 1IQDB 3O11A 5DTFB 3W0WE 4X4XA 5GS0H 2JJSC 4LRIC 2X7LA 1TFHA 5L7XH 3B2UC 8CGTA 4I9WD 2E27H 3EYSL 5D1XD 1A6ZA 3MRLA 5L9DL 3HFMH 1NFDB 3CSYA 3TVMB 5HSFA 1QG3A 3IDXH 3NOIA 4S1QH 1AD9B 4TVPD 4GUPB 4KRPB 3VXOB 3EYOB 3DJ9A 1DN2A 3O4LA 4AIZB 3BHBA 1NAKL 3CC5A 5DEFA 1KENH 1X7QB 4JZJB 3S98A 2NY7L 3MGTA 3N06B 5I75B 3PV6A 2C7UB 2ZCKH 2QQQA 3NCEB 3P73B 1JWUB 5C6WH 5EU4B 2CIKB 2HVJA 3S5LA 5SWSA 1AR1D 3CUPB 3HB3C 5JPMB 2DMBA 2F54E 3T4YA 4JKPL 3RKDD 3ROLB 2XRAH 5CBAB 5CEZE 3OKNB 3UDWA 2BHZA 4FZ8H 5JUEL 1C5DB 1D5ZA 2WWMC 3T8XA 1Q94A 5GSVA 4BSWA 4JFZH 1X5ZA 2YPLB 1MUJA 1BQHA 1CU4H 5DQ9A 3GSWA 4PYGA 5EO1B 4OGAC 5JTWA 3HG1D 5JHDE 1LP9F 2RCSH 4N0UE 4HUXB 4U1MB 2BRQA 2NY3B 5D9SB 2ENYA 4X6DF 1C1EL 2B0SH 1I8MA 5CZXC 2DWDB 1WTGT 1RK1A 2BZDA 1H0DA 4LNVA 3UTPE 1QHOA 4G42B 3MLRL 4NM4L 2NY1D 4RISL 4LOUC 4M7ZC 12E8L 2IALB 4ZO8A 3KPPB 5GJSH 4YDIL 2BERA 3QBTB 1S7QA 3IFLL 4L8BA 1Q0XL 4YNYB 1TZIA 3NCMA 1WCBA 4NUGH 4G6JL 1NCCL 1RZIA 1LWRA 2GJZA 3MLXL 1BOGB 3PWPA 4HUNB 3MRQB 3T0EE 3AS2A 2GK0A 3TH3T 5IOPA 1ROWA 1LHZA 3MA7A 1MLBA 3ALWA 4OT1H 3FQXA 3H9SE 5GIRA 2I24N 1PD6A 1FLTX 1TCMA 1N64H 1V7MH 4OIIL 4TPRL 5ADPL 5F7MC 2XKNB 1YA5A 1UQSA 4QKXB 2JE8A 5EZJB 3B8SA 3MLTB 1IQWH 1ZS8A 5K9OA 4ODBD 2ADGB 5DJYA 3DX8B 5KJRH 3AM8C 2R2HA 4H20H 2HG5A 1BM3H 5CJQH 4MNQB 4NC2B 3ARBA 3TNMA 4P3DB 4JPIA 3T08A 3ULUD 3V7AE 3VG0L 1BQLL 5CSGA 4C54A 1JN6A 3BT2L 2LE9A 3D2UA 4Q7DA 1PFCA 1NAML 2P44B 5DVKA 5HHQA 4PB0L 4QOKE 3CZFA 4TTDD 1I7RB 1PSKH 2NPLX 4KROC 6FABH 3MCG1 4JFQA 4O2FA 5C0BA 3ZHKA 1XEDA 1D5BB 2R4RL 5EH1A 1PLGH 4IIQA 3X3FL 2XN9A 2R1WB 4JGMA 5F7UA 4ODUA 1QHPA 1U58A 1JP5A 3RU8H 2A9ML 1QPPA 3BQUA 4NJAH 5IVZB 3VFMB 3QQNA 3FT4B 3OAUL 3VXSB 3SKJL 1AGBA 3ZYZA 2YC1B 2VXSH 1CGTA 4PREA 3ZTNL 4XXCA 4JFED 1MI5B 3TZVD 5HHVH 4X6EB 1I9JL 2FO4B 4ONGH 2Q86A 4JDZB 4LHUD 4YDLC 5INDA 2DL9A 3RKPA 3S7GA 4U1IA 4GQ9H 4RBPH 4R2GD 1MQKH 1ACYH 3KPNA 3SGJA 4KHTH 5B38G 2OK0H 3G5YB 2PUQT 4LLYB 4Z95H 1YECH 2A1WL 1FH5H 4ZS6D 1MEXL 3VWKB 5DFVD 2OI9C 2XTLA 3V4VL 3I75A 1TCRB 1UACL 1NCDL 1YN7B 2CXKA 1EAPA 4XCFL 3CDYA 3MJ9A 2CSPA 4ETYA 3OKOA 4GRLA 1A14H 1YN6A 2R0ZH 5C0CB 4NUJB 2R2BA 1YNTB 4XBEL 2IH3B 1NGQH 3BESR 1QBML 1G9MH 5E8OA 2Q1EA 3ZSSA 2A9NH 5C8JA 2IAMA 4O5LL 1IC4H 4BA8A 1UADC 4JPKH 5IKCA 4M43H 1DE4B 1K3ZA 4YLQT 5C09D 1OP5H 3O8XD 1AP2B 1JZ6A 5GGVY 2QR0B 1CL7H 3CSPA 4NSKA 1KJ2B 1GRWA 2B4CH 1RMFH 1T3FB 3NH7H 2R0LH 3I3EA 2UYLA 2A0LC 1Q0YL 1JHKL 1NUNB 4Y16A 3G9VA 4HCRL 4F7CA 4F7PB 2AJ3A 3BDYL 5HHNA 2H9GA 3ARYA 2R8SH 1FVCB 1SJEA 1W72B 2YBRA 4H88H 4Y4HA 4PRNA 2ZG1A 5KVEH 3Q6GH 5DD1L 2Z35A 3EO1A 4H26A 5DURD 2HJKB 5I1AB 3BKMH 1YNLL 1U8NB 4YQXL 1BBDH 3GK8H 4MMXC 1CI5A 1UM4H 2D7TL 5F9AC 2VLLA 1E4XH 1EGJL 1QFWL 4OM1H 2BX5A 3DWTA 4HDIA 1FVDB 5C0GB 3ARGC 4EUPG 4U1JA 2QQLH 4G6AD 1NUGA 4HFUL 1UZ8B 1XH3B 3TF7C 1EV2E 4F8TA 2XWJA 5KN5B 3DUSB 4JM2B 1D9KD 1QSEE 5D70H 3EOBA 1C7TA 1M6OB 2XA3A 3I6LE 1JUFA 1UFUA 5E7BA 4NQED 4O58L 4X5WA 1P7KB 2FHFA 3UJJL 3PHOB 4L3CB 1CGSL 2YEZB 1KXQE 3DVGA 1RPQA 1P69B 4E41D 3OR7B 3EYSH 5DMKB 5T1MA 1CLYL 4GBXB 1SHMA 2DQJL 1RFDL 3KPLA 3OXRB 1MCEA 4XP5H 5DO2D 1ZLWK 3T0VA 4O2CB 3FB6B 5FYJL 5EOTB 1P7QA 1NAKH 2Q7YA 4M1DL 4NBYB 1Z3GL 3L5IA 4Y19D 2OS7A 3OKDB 4R4FL 1C12A 1FFNA 3QUXD 3U9PL 4LVEA 4J3WA 3PGCB 2XA8L 5ITFA 5J11B 5KSUB 1T5WB 4R0LC 1F3RB 3HZVB 3NBNA 3RI5F 1E6JL 1W2KT 1YY8B 2ESVD 3DROA 4FFYL 4PLOB 5EU6D 2EDYA 4YXKL 4PV8B 5DQDL 3RVUD 3EIFA 1XF5A 5JUEH 2Q7NA 4K8RD 5GGTA 3HMXL 1PAMA 4PJ5E 3MLUL 2F5BL 4UQ3A 1DN0A 1I8LC 4OTXH 5T1DL 4KVNH 1QEWB 4CVWA 3G5VB 4WU7A 3QWRA 4PGCA 1K8DB 2EE6A 5B8CC 1YZZA 3B5TA 3OB0K 3IAQA 4NOFA 3BO8B 3PGDB 2YD8A 3EFFB 3MLRH 4KFZC 2CXGA 4RISH 4OLEA 12E8H 4UBDD 3ESVF 3MRFA 4YDIH 3MNVA 3IFLH 1UH3A 1Q0XH 3MBEB 2AEQL 5LG1A 3NIDF 5EOQL 1GAFL 4N90E 2H26B 2VLJE 1NCCH 1QTYT 1VA9A 2RIKA 32C2A 4WW2F 3U0WL 3MLXH 4PRPA 4UDTB 4HK0B 2VUYA 3KHOA 4OZHB 4Y1AE 1JIBA 3WHXB 2DM2A 3VFWB 4G5ZL 1I8IA 2XACC 1J9CT 5F7LB 4XP9H 1TTFA 4ZO6A 4GG6B 4LARL 4TPRH 5A2JH 4HC1L 1A1NB 1SJVA 2NY5C 2O61B 5ISZD 2GSGB 2GCYB 2DIBA 5JW3H 4K3JL 4HH9B 5GS3A 1K6QL 4ELMA 4ONFL 4WW2A 1A22B 3V5HA 5DMGD 4EI5C 4XWGL 1FL5B 2DDQL 3O41A 4WVRA 3KPSA 4OAWB 4OGXL 4OFYD 4L8CB 2XOTA 4AL8H 1A6PA 5HDLA 2ZUTA 5F89B 5J9PB 4PJHF 2UY7A 1BQLH 3BWAB 3BT2H 4PJ7E 3BZDA 3SJVE 3HA0A 4G9FA 5T1KA 3NAAL 4JZOA 1U8MA 3G6JE 4UV7L 1HWHB 3QG6B 3OHXB 4NQXA 1NAMH 3MV8B 1R3KA 1YUHB 3T2QA 4KK8D 4PJGA 3CX2A 2EC9T 4PB0H 3TBTA 4MJID 3GHBL 3ILPA 4LFHD 4HS6B 2R4RH 4YHIA 3ARBC 3X3FH 5F6HJ 4FTVD 3WFCL 3DMMC 4PJHA 3MLZL 1QSFA 3ARZA 3MJ8B 3FQWB 3K4ZA 3OPZH 3X13B 1MCWM 1WWBX 3SKJH 2NY5L 3LDBC 2W0FB 4DTGL 5EBLB 3B9AA 3ZHLA 4YXHH 5F1OB 2WWKO 5I17A 1FV1B 1INQB 4WFHD 1SVCP 2BVPA 5E99L 1UVQB 1N2RA 4ELKB 1G7JB 2Y07L 1ZHLB 4IIQC 4X6CF 5D7LB 4LSDA 1BZ9A 1GGIH 2XTJD 5BV7C 2EEAA 1V3LA 2PR4L 2CLZA 2AK4E 2EE2A 1AGCB 2DL2A 3U9UA 2EDLA 4IHOA 1FZKA 2FLBT 2A1WH 1DQML 4IS6B 3UJTL 2JB6A 3VJ6A 1MEXH 5INCA 3BSZL 5L2KA 1ZE3C 3RGHA 4I3RL 2R9HD 4HS3A 3V4VH 4JFFB 4KKAC 5IWLC 2HTLC 4C57C 1NCDH 5E2VL 1Y0LB 1DBMH 4XCFH 3GSQB 4X6CA 5C0AD 4ZXBB 3MLVL 3EZ8A 2NYYD 3BZ4A 4GSDL 3SGJC 4XBGA 4XBEH 1QBMH 3VW3L 1OL0A 2EIZA 3EYVA 4O5LH 3OF6A 4WHTA 4GMTL 4MHHI 1CICD 1OF2A 4LSUL 1QLEL 1CTOA 2DM7A 2J7LA 2Z0BA 1BIHA 4Y5VA 4WY7L 4M1CD 2JIXB 3OKEB 5E8DL 4RX4D 3PWNA 4OCSL 4L9DA 4ODWB 1HXYB 3IF1A 3IGAB 1Q0YH 3S3PA 2YN3A 1LEIB 3RWCA 3VXUD 1QP1A 5I1EH 3BDYH 1I1RA 1UZ6E 2ARJB 2YPVL 3FT2B 5KSBA 1Z0NA 2G5RA 1HSBA 5HI3C 2ATPA 1NBVL 5DD1H 3SCMA 2WIIB 3AY4A 4MMZC 2RFXA 5DHYB 3DGCR 2NY0C 2D0HA 4XCNA 4J3UA 3P0GB 1T03L 3E2HC 4NBZB 4TQEL 5DZNA 4P5KA 1EGJH 1KYOJ 1QFWH 1T7WA 4U6YA 5EZOL 3KLHC 2O93L 4F9LC 1BAFL 3D9AL 1KFAH 2XWBA 1J8HB 3BP5B 2XYCA 5CGMA 5C0RL 2V7HA 1LO2L 1BIIB 3RDTB 4Y4HC 2GYSA 1ZSDA 4AG4L 3MV9D 1UXSB 1XF4A 1B3JA 5L8KB 3O6FC 4QHUA 1PQZA 4O2EA 3HE6D 3UJJH 1RURL 1Z2KA 2H41A 2VLRD 4WEUD 1D5MA 1L6ZA 3L3IA 4AT6B 4QRSA 3UPRB 5IVNA 4Y5XA 4HX1A 2DQJH 2PYED 1RFDH 3L9RA 1F2XK 1ETZB 4YBLC 3GZKA 5A40E 1M4KA 4HHAA 5FYJH 1CGWA 1FL3B 1CG9A 4OLXL 3V79C 4ZS7H 4M1DH 1Z3GH 5C0EB 3QAZB 3ULVE 4F9PC 4KZEL 5MEQB 3VMNA 3U9PH 2N1KA 5D8JL 3D87B 2XA8H 2AEPH 3DIFB 4LLWB 4P5MB 2ATKA 2GTWA 1O7SA 5ELIA 3K8MA 4KK6D 4PJ8A 1D5IH 4D9QE 4FFYH 4DVRH 4JN2B 4Q6IC 1UJTA 4KVCL 1P6AB 5DQDH 3B5HA 3MNWB 1ZWIB 3BRFA 2QKIB 3MZGB 5DQJA 3HMXH 3RL2B 1CR9H 3MLUH 5CJ8A 5ILTL 2F5BH 4UAOB 3DRQA 5I9QB 4HGKC 1NGWB 5I15L 4I5BA 4ZUVA 5T1DH 5DUBB 5F7DB 5HDBE 1JYXA 4JG0L 5H37H 4JDTL 4OLUL 3RPKA 1JWMB 2FH6A 2XQBH 4HJ0D 4FQLL 5I8OL 4YIQB 4G3YL 2FIKB 5I6XB 5L0QB 4LIQL 5TE4L 3WIHA 4OIAA 2EYTA 3VWJD 4J3XA 4MNQD 1HILA 2VL5A 1EFXD 2A6JA 2Z31A 5IQ9A 3P0VL 2ICWJ 1JPFB 4F7MA 2X4QA 4XNQA 3AXLA 3P40A 4APQA 1T0NB 4IDJH 1GAFH 4FFWD 1ZGLB 1C08B 4ZUWA 1NMAL 2HT2C 4X4MA 3GSXA 3H7BB 2X70A 1QR4A 3ARVA 4XGZB 4G5ZH 1T7XA 2C3WA 4WV1C 3UTTB 2YA0A 4V1DE 2DTSA 4OB5L 4CJ0A 4R3SA 4LARH 2G2RB 4R7DB 1ZKAA 4HC1H 1QLFB 2DBJA 3QNZB 4S10A 5HJ3B 4K3JH 4QYOA 1K6QH 4WHDA 4ONFH 5E70A 3BIKB 3WCYA 2ED8A 3T65A 5HDQL 3VGAB 3KGRA 5D1XA 3RGVB 3DOSA 2EXWD 4XWGH 1KN4H 2DDQH 5DJDA 1MRDL 3GUTA 5CJXA 4NJ9L 1IAKB 2UZYB 2VJXA 1CBVL 5ENWA 4OKDA 4WEBH 3H2WA 1FNLA 2BNRE 2PO6D 2XG5A 4TNWF 2R1XB 1XF2B 2C1OA 3OJVC 5GZOD 5ACMA 4PGDA 2V2TA 4JO4H 3RIAK 2VISA 1MH5A 1HSAA 1XZ0B 4N8VB 3MROA 5HYIA 1AXIB 1MCIA 2E7LC 3T0EC 1FN4B 1GGTA 3GHBH 5CEZL 1NUFA 4P0DA 4P3WA 5IGXL 3BAEL 3MLZH 2W60A 3MUGA 3O4LE 1A6TA 3TP4A 3EDJA 1MLCB 4DFHA 4IMKA 4S2SA 5IB3B 2H32B 1R5VB 2IPKA 5DS8B 2CUMA 4DTGH 1L7TL 1U8OB 1J1XL 3C5ZB 3HG1A 5JLZA 4KKLD 5AYUL 4GW4B 5SWSE 5BOZG 3VXPA 4WUUE 4RQQB 1I85A 2Y07H 5HHOD 2IQ9L 4MQTB 4HAFA 4DKDC 4YHZL 4W81A 4NQSA 3SE3A 4PP1D 3VRJA 3KXFB 1U8KB 5D1ZB 3B6SB 2F8VA 3KPRD 3PIQB 3HRZA 1OGAD 3EYFA 4YO0A 1NGYA 1OTUC 4KJWD 2X1QA 3UJTH 3DURB 5GRVK 2OX5A 4KK5D 2PW2B 3BSZH 3I6GA 3UZEA 4OZ4A 5IJVB 4I3RH 3C87A 5CSZB 3W9DA 3UBXG 5T33L 4CRPA 4P59L 3LRSB 4XP4L 4EOWL 1QRND 3A6CL 2AJYL 1X6LA 3IDJB 1H15B 4GSDH 1HHHB 3RWGB 2QLVB 1JGLL 3LS4H 1FYTD 4GMTH 2H8PA 2AI0L 1ZHNB 1FE8L 3DVNA 1GH7A 5CFHA 3E6FA 3GSOA 2QTEA 5GPRA 4LGRB 1SJHA 1U92B 4PRHD 4OZGB 4WY7H 3FT3B 25C8H 3QP3A 4OCSH 3WJJA 1KIPB 5KSAB 2A6KA 1TVHB 1ZLWH 1FIEA 3TBSB 3FRPA 1FCGA 5FOBB 4JREC 2D7MA 2OJZL 2B39A 5C0ND 5E00A 1BWMA 1QNZL 4HUKB 4KJPC 5LWYH 2CKBL 1UC6A 4FNLL 4IOFC 1UM5L 1LE9A 3BPCA 3IXTB 3LKRA 4XP6L 1T03H 3O6LH 4O02L 2DYPB 4YR6B 5IV2B 2ADFL 1YJDC 4YFEA 3TCLB 4E5XB 4UTBH 5EZOH 3IJYB 4JHZA 1JE6A 3D9AH 5JW4M 1I1YB 4LDLB 3R4DA 5DFWH 1G6RL 4OV5A 2YD7A 3O2DH 4UT7L 2FR4A 3QJHB 5CD5C 3EHBD 4FQJL 3SCMC 2HN7B 1JNNL 1KIUA 3AY4C 2Y06L 4AG4H 4MJ5A 4PTTB 2XFXA 5GS1A 4KC3B 1A6AB 2EH8L 3PNWA 5CLTA 5HVWA 1T04A 4NN7C 4JFEA 5DVOA 4XVSL 3TZVA 3VD9A 1JGUL 1T2JA 1S9XB 3NFPB 2BXYA 2Z8RA 4LHUA 1C5CL 4UNTA 3VFOA 4KTEL 2LQRA 3ZE0E 3OB0H 3MGOA 4UT9H 1JV5B 2Y7QA 1NANI 2XN9E 1KXVC 4R4ND 2OR9L 1BD2E 4OLXH 1ZT1A 5D2NE 2ZPKL 3N1PC 4QTHB 5T3ZD 2W9EL 4LCYA 1OAKH 4RNRA 4WCYL 5HGHA 1A7RL 3IDIA 2FWOB 5D8JH 1YJDL 1HH9A 1QVOB 4I3GA 2Z93A 4UUJB 4Y5XC 1EHAA 2BY0A 3O9WC 1WSST 4P46C 4KV5E 3GMRB 4LGSB 4CMHC 2VABA 1WC7A 1JZ7A 1NFDE 1ADQL 3OBAA 4MA7L 4OZFB 2FCBA 1H3TA 2OMNA 5B39G 3BPLC 1X5YA 5C09A 4FQ2L 2V2WA 2VB5A 3O8XA 2XPGA 4JLRB 3HAEA 4M93C 1I1FB 5ERWA 4OLUH 3UTSD 4FQLH 4PJ8C 5I8OH 4HWBA 4CMMA 3JTTB 4KQ3L 3PL6B 1DUYA 2G5BA 3QDMD 4HBQA 1FBIL 1LDPL 3B9KB 1N0XL 2W9DL 4LIQH 4Z7UE 4G8FA 5D96B 5TE4H 1VFUA 43C9A 3MMEA 5BRZB 3VG9C 3P0VH 4LF3B 2LV4A 3RVVD 4MWFA 3WFHB 3ZDZE 3QUZB 4MDIA 3FCTB 5ALCL 3D85D 2Y5TA 1NMAH 3MYJB 3WYRA 1FFRA 3MV8D 4M7JH 2JJVA 4U1HA 2CRZA 3B9DA 3CLEH 3RBSA 4Y4FD 2XZZA 5MI0B 3S9DB 5ACZA 2ZOKA 2Z31C 3GB7B 2QADC 5EU5A 1D9KA 2J3SA 2HFGL 1LK2B 4EQ3A 1N3NA 5BVPL 2XZCL 3WO3B 3GSRA 2HJLB 1T2QL 2FZ3A 1A6UH 1R3JA 1WBYB 4NQEA 3OTTA 4RDQF 1FL6A 1KTDB 1G84A 3T0BA 4E41A 1MSPA 5A16B 2I9LA 1K8IA 1XCQB 4FP8L 4EQ2A 5LAXB 4JJ5A 1MRDH 4E0RB 2G9HA 4ONHA 2W0PA 4EUPH 4I13B 4P2YA 4J8RA 4XCCH 2NNAA 1P5UA 5IFHL 2P49B 2IADB 3RVTC 4CADA 4FN0A 3U2SB 5GRVL 3C9NA 1CFSA 1Y18B 4G8GB 2W9LA 4K9EC 2O5YL 4Q2ZA 2VH5L 5J56B 4Y19A 3S5LG 2BMKA 3QDGD 4ISVB 3QXDB 4ZOBA 2VKXA 4Y7MA 3QUXA 4PRAB 3RNQB 1EJ6A 1NDGB 3WFBL 2K7PA 5JXEC 3LKPB 5D1XC 5IROC 1E4KC 1JI1A 4W68A 5FKAA 3G5XB 4QRRB 2BY2A 5CEZH 3WLWC 3MCKB 2ESVA 4HLZG 5FYLD 5EU6A 3KWWB 1IT9L 2V2XA 5IB4A 4JO2H 4QF1B 4LVNC 2LTQC 5EZLA 1BQHG 1XGYH 4JO3L 4ZFGH 3WNPA 3NN8B 5IMLA 1FGNH 5SWZB 1CDYA 5DVNA 3C60C 1NKRA 1UM6L 5AYUH 3OJDB 3BGFC 5E8PA 3IXAA 5FB8B 4WI6A 4PJFF 1FZJB 2IQ9H 3DV6A 2IBZX 2CLRA 2FJHA 1I7ZB 4YHZH 5BXFB 2NZIA 4M9OA 1MCSA 4K7FB 1SJXA 4R90H 5FECB 3BH8A 2P8LA 4I8DA 4IMKC 3T3PE 4XMKH 4MD4B 4OLYL 2X10A 1OAUL 1NDMA 1DVFD 2NY4C 5T33H 3SDDD 5JOPD 2BNQD 2I07B 3ILQD 4JGJA 4XP4H 1I85C 4YHPB 3HZMB 2JCCB 4HV8A 3TBVA 1MI5E 4DCQB 3A6CH 4LKXB 3SE3C 5EO0A 3MV7B 2VN7A 3U4BL 1J0ZA 1INEL 1T83C 4YAQA 4NKMB 1X3DA 4PBWD 1TVBB 2ITDA 1JGLH 5KVGL 2C4FU 2NY1C 5I66B 1I9IL 2MPAL 3ARPA 4AENB 1DJSA 1JWSB 3VRIA 5GGRB 1QQDA 3VXMB 5ISZA 1IBGL 1X9QA 4OCYH 3VMOA 4POZD 2ILLA 1AGDA 3BE1L 5I1IL 5AD0B 2PXYD 4U05A 4NBXB 4MDJA 3QDJB 1QA9B 4FFVD 5HDOA 3QNYB 4JQIH 4OCWL 3QI9D 4M1GL 3VI4E 4JFDB 4OD1L 3CIQA 4LQ1A 2DF3A 4OFYA 1N6QH 1AKJD 3EOTH 3MRNA 1YMMD 2OJZH 4HG4K 3KYMB 3RPIB 1MCNA 3QUMH 5C0CE 3ESUF 3AS1A 4F57H 4A6YA 2CKBH 4FNLH 1OAYL 4NHCL 1UM5H 1ES0A 4EVNB 5E5RB 4CU6A 4EN3B 3S36X 3MFFB 1QFOA 4P2QD 3BUYB 4ELME 1OSPL 4O02H 2ADFH 4G6KL 3VH8B 5I73C 4MJIA 3KPSE 3KVQA 4FTVA 4GKNA 5F44A 4PJ9D 3CVIH 3BP6B 3SGKC 3PQYD 4JFYB 4FQJH 5JW4Q 5FAAA 2SEBA 1R5WA 3CDGB 3O2VL 1GZPA 2Y06H 3TPUA 4PJEF 2ICEB 3CDFA 1QR1A 2EH8H 4G9FE 4WI9A 5JIKA 4Q74A 4GG8A 1YQ2A 5HYQA 1MREH 4PJGE 1C5CH 4RMRA 2ERJC 1ITBB 1H8SA 3F58L 5I74C 1B6DA 2GJ6B 3L1OL 3L3GB 3L3OA 5IBUB 1GGBL 4PR5A 3FL7A 1V7NL 2CJUH 3X17A 4ZUUA 3C8KB 3QCTH 4KGLA 3MREB 1NCBL 2OR9H 4DKAA 4PJEA 2ZPKH 2W9EH 3CFKB 4WW1A 3QJFB 2OP4L 4J4PC 3DUHA 4NRXB 1FRGL 4IDLA 1A7RH 3CFBA 5HHME 3TZVC 3FQTA 1REIA 1CXLA 4YEFA 3GMNB 1U95B 4YHLL 1NAMB 3A6BH 3RUGB 5C0AA 1BQUA 3P4NB 1OY3B 1G7PA 4LEXL 4PTUB 2DBLL 1ZT4A 4QXGL 4BSVA 4KU1A 1YC8A 3O4OC 2HFFB 5IMOA 1NCTA 4GW1A 4LSPH 1KPVA 3MOQA 5DR5L 1JYNA 4PJAE 1ADQH 4QRTA 3VXTB 4JJHA 4J2XA 1BFTA 2YUZA 3I6KB 1CDJA 2WAHA 3IKCB 1CICA 4PJDA 4FQ2H 5IW6B 1EEZA 3S35X 3AGVA 4YEEA 5GGUA 4HFWA 4RX4A 4YHOL 4HIHA 1UEMA 1SBBA 3OKMB 1KSRA 1FBIH 3TCXA 3VXUA 1N0XH 5J7CC 1H5BA 2OQJB 2W0LA 2ZJSH 3T2OA 1AD9A 5JIHA 5E5UB 3ULVC 3QDHA 2VQ1B 4YHYB 3AREB 2IMNA 5D7IB 1U8QA 4QNPF 3GGWA 1F00I 3D25A 5HVHC 3EGSA 2J88L 3BXNB 1P84K 1U6AL 2HLAB 4F8QA 1KCKA 4K71B 5KSVB 5IBTL 3OGOE 4P5TD 5KG9A 5DRNB 2UUDK 3WXVH 4Q9QH 1DLHB 3OJMB 1IARB 1H9VA 5KVFL 5KSBE 4HKZB 4JHWL 4G7VL 5A43C 1FZMB 5BQ7B 4CJ1A 1NMBL 3SE9L 3HR5A 2HFGH 3MV9A 2UWEB 4MA3A 1T2QH 5E8EB 5CP7B 4LCUA 1R5IA 2VNCA 3HE6A 1U93A 4S0SD 1CD1A 2VLRA 5E56A 1VADB 3V6OE 3V6BR 4FP8H 5ECJE 2FX9L 4XT1C 3HMWH 1A9BA 4G6AC 2PYEA 2FL5A 4LPCA 4Z7VB 5IK3A 3K46A 4NT6A 2EE3A 4DZBB 4LLMA 3RZWA 1M05B 5AUMA 2OJEA 1BVLB 4OZHE 4RAVB 3VXNA 2E8YA 1MRFH 3ULVL 5D1ZD 3A67L 2VH5H 3IFPA 3M17A 5GSRB 1T6WA 2AKRA 3N0PB 3CGTA 5TDPA 4GS7C 5DJ2A 3MFGB 1D5XB 3G5ZA 4I77L 5DO2C 4X7SL 1IT9H 4H0GA 3KHQA 4UU9A 3TO4B 3H3PL 5E1AB 1AQDA 5MERB 4UINH 3C6LB 4U1SB 4JO3H 1XGPB 3V6ZA 3HN3A 2HRPL 2VXUL 4O00A 3PUCA 4M9PA 1MHPH 4D2NA 1CZ8H 4DN4L 5E4EC 4NQUA 4RWHA 2R69L 1FC1A 3WNLA 4BKLA 2IFFL 2AV1A 3D18A 3OV6A 3ARDD 5E9DB 5D5MA 2VUOA 2FEDD 3U36B 3CFEB 4X7FC 3FB8B 3NFNB 2WANA 4X98A 4XNZC 5DXWA 3RVUC 4CDGC 4MB5A 3VWJA 3PWJA 4MNQA 5HY9A 1DDHA 4NO3A 3U4EB 1EFXA 4C83B 4LHJB 4PRIB 3FQNA 1LEKA 4MXWL 4OLYH 5H35B 1OAUH 1WJ3A 1I7TB 3BZFB 3MRDB 1J0IA 4LKCB 4XPAL 1UWXH 4QGTA 4NZDA 5CD3A 1TZHB 5FYJU 3CCHB 4NN6B 1IZJA 1K4DB 1I1AB 5HYJB 3SDCB 3U4BH 1I8KB 1INEH 1EHNA 5CJ5A 1CXEA 2P46B 2XZAH 5DJ6B 1D5BA 4NWUL 4LPTA 5D7LE 1H3GA 1HKLL 3RZCD 1HHKA 3FQRA 4WO4D 5IVZA 4ZSOB 4I48A 3K1KC 1A7OH 4GMSL 3N1MC 3DX7A 5K59E 3H42L 3TA3C 4OCWH 4M1GH 4KHXL 1NQBA 4X4ME 4JFFE 1C7SA 1PEZA 1QO3A 4OD1H 3SO3B 4JY4A 3F7VA 5MEOA 3BPNB 5TDNB 3T77B 4CVZA 4L4TD 1OB1A 1IRAY 2PO6A 4R97C 3V5KA 5DRZA 4RSVA 2FRGP 3UX9B 1RUKL 3QIWD 3CLFL 5HGBB 3I02B 4OGYL 4U1NB 3QULB 4NZRL 4ZFFB 2X40A 4FZEL 4YK4C 2IANB 3S37L 4M5ZL 2FLRT 4HIEA 4PP2B 5DMGC 1TCRA 3VE0B 3F12A 4PBVC 4X7TB 5H8DA 1UT9A 5ICZB 1YN7A 1MQ8A 3MLSH 4UOJA 1LO4L 1T2XA 2KZWA 3RRQA 4XPHL 1MRCL 5I16A 4P23D 4HUMB 4NUJA 3O2VH 2DOCA 3BEWB 3WO4C 4NRYA 2VLME 4ZPVB 5E4IA 5FEBA 1X5AA 2GFBB 3UP1A 3P4OB 3CFDA 1QOKA 4JQVC 3RA7H 4KK8C 4PJCF 4PGZA 1S7WB 1PG7L 4DZ8B 3F58H 1IEAB 1IC1A 4X6FA 4DAGH 5HHOA 1X5LA 1BJ1J 5ETUA 2MJWA 1GGBH 3MLYH 3P4MB 5B21A 3V52L 1HCVA 3BVNA 4PRBA 1RUML 2E9IA 4LCCB 1V7NH 1MHHA 2D4DA 2VZUA 3KPRA 1OGAA 1FVCA 2QL1A 1ZLUK 5KVMC 5T1LB 4XZUB 4D0CB 2OP4H 4PJCA 1FRGH 1I3RB 4U49A 2HJKA 1KLGB 5IHUL 4YHLH 4J23A 3MC0A 1QRNA 2QQKL 4QRPE 2D3VA 2NX5B 4GW5B 4LEXH 2XTJC 1A2YA 1CLOH 4QXGH 4FQXA 3S34L 4HGMA 5FUOL 1TIUA 1S8DB 5TF1L 4M61B 5DR5H 3DHMA 4I18C 4WDIA 2XQYK 1R3HA 4X7CC 4HZLA 3MV11 2IBGA 1FYTA 1CFNB 3Q2CA 4J12A 5KN5A 3QWOA 1MCWW 3MV01 1MWAA 3MRJB 3KPQB 4PRHA 1M6OA 5J6HB 5F97E 1YYLL 1Q9WB 4YHOH 2YSSA 2NXYB 2WMPA 2R0KL 3SDAB 5IJKA 2KDGA 4XXDB 3AAZA 3JVGA 4QHMB 4G8IB 1DQLL 5D2NC 3OXRA 4L3ED 3TJHD 2NXZC 3M1BB 4UNUA 2FJFA 2OZ4A 5H2BA 3VI3F 3OL2A 1G7IA 1NL0L 1CICC 4QHKJ 4JE4B 1X4XA 2MOVA 3NCYS 3QFDB 5KAQG 4MQ7A 5EBMA 1DP0A 5J1AB 4CVXB 4HMEA 3WSQL 1CFVH 3T2NL 5FKPA 2J88H 1HHJB 1H8OA 1U6AH 5KW9L 3L3HA 5IBTH 3MRCA 3NZHL 2OXGA 3TVMC 4QRQB 3ULUE 1K5NA 4KKCD 1OPGL 3B5GA 4G7VH 1EX0A 4JHWH 2FGWL 1LE5B 5FHBL 2IG2L 1EVUA 3PE9A 4XNYL 1S7UB 1WWAX 2AVGA 4Q6YA 4JZJC 3OKLB 4FFZL 5I75C 2HA1A 2WBJB 4X5XA 1HEZB 5K9JL 2P8PB 3UTZA 2FX9H 1J18A 1MJ7L 4RMSA 4NP4L 3G5VA 4RGND 1R0AL 4YHMH 3LN4A 4J1UB 4YDJA 4J3SA 4NHUB 3UTTE 2NY2D 3A67H 5F96H 2AQ1A 3G08B 4OD3H 1UA6H 2D9CA 4N0CD 3CJJA 5FA3A 1KB5B 4LPVA 3CXHK 4GG6F 3HUJB 2AK1L 5J1SC 1Q9KB 1KIRB 2E8ZA 1PKQB 1V3KA 2ADIB 2H26A 4I77H 4PY7B 1AIFA 3VFPB 4XRCB 1U2HA 1KLUB 2NY3C 3MRMB 4X7SH 3VXRB 1G7QA 2RR3A 4X0KA 2KQNA 1UWGH 5IW1B 1A6WL 4LPYA 3WHXA 3V0AC 4IOIB 5HD8C 2BK8A 1UENA 2DMCA 2HRPH 3GJEB 2KZ1B 4GG6A 2VDOL 4MQXC 2APTA 3MJ9L 1S7VB 4QCIB 4Z76B 3RJDA 4DN4H 2MTPA 1DSFH 2L7JA 5IB2B 3QEUA 1A3LH 5I8KL 3UTSA 1CDIA 1JGEA 5EB9A 3B2UD 3QDMA 4MS8C 2R1YB 2EZ0C 4G43A 5CS7A 3LKSA 3G04B 2PKDA 1FNFA 4HUWA 2AQ2A 4HKJB 4K3DH 2ZCLL 5J9PA 4KDWA 1J5OL 4MXWH 3L3KA 3JWDC 1YEEL 2YRLA 2YZ1A 5C09E 5M95B 4KMTL 1PDKA 3FB5B 3D85A 1YYML 3ZKQD 2VQTA 2DWEB 4N1HB 3OHXA 3MV8A 2XI9A 1YUHA 3N1GC 5IW3A 4Y5YB 1IM3B 2EC9U 5GGQL 3HZKA 4Y4FA 4XX1G 4NWUH 1OSZA 4Z7NE 1Y6NR 1YEFH 1HKLH 2FBJH 5B38B 3KXFE 3WNKA 3D3VD 3CXHJ 4GMSH 2WWMD 4UDUB 1KJ3L 5IVXF 3GMMA 4FFWC 4DGIH 3ULSA 2W0FA 3FOMB 1ONQA 5E94A 2ZUYA 1JMXA 5L88L 4OGAD 3PG2A 1MF2L 1RZFH 1RZ8A 1F6AB 5EG6C 4PS4L 4ZNCD 1M7DA 3DX9B 3IJSA 4DGVL 4G6ML 5CZXD 2C3XA 2BFVH 4Z7OF 3SDXA 4OKVA 2CDGB 1RUKH 1WAAE 3CLFH 5EUOB 4NQVB 1KG0A 4NZRH 5IVXA 4UNVA 1ITCA 3QDGA 4NQEE 4WUKL 3CPLA 4LOUD 3S37H 4M5ZH 4D8PA 2F5AL 5DI8B 4DQOL 1MHEB 1MHCB 4U3HA 43CAA 3O3EB 3FFCB 2EXWC 3HPJA 3GI8H 5FCSH 5DRWB 5F1IB 4OZGE 3HLAB 5FK9B 1LO4H 3LPFA 3JXAA 2PO6C 3IAPA 2BCKB 4XPHH 1AGEB 2A2QT 2ZSVB 4MD5A 3V9FA 4PD4J 5ITBL 5GZOC 5TGBB 3C6SA 3U0TA 2A6IB 3KPOA 3GMPA 1OAXH 4MCZB 5E95B 4OQ1A 4BQ6A 1BX2B 3W0WB 3QHZL 1DBJL 4Y19E 4H25A 3REVB 3W81A 1K4CB 2VITA 1YPZB 3VWKC 1U3HB 1TPXB 1VGEL 1FCCA 1MFDL 2Q76B 4D0DA 4L8DB 3ZE1F 5JZ7C 2DQCH 4DK3A 2O5XL 3V52H 4K55A 2ESVE 2GSIA 4KY1H 1RUMH 5GS2H 4LQFL 4EUPB 15C8L 1T89A 5FM5O 1VFBB 1PYWB 3CXDH 1CIUA 4KJYB 1XGRB 2ID5A 5MEND 4L1HA 1DVFA 5IHLB 1EMTH 4KKLC 3SDDA 2BNQA 1XGUB 5IHUH 5IFJA 3FOLA 3MRHA 1ZHBA 2F54B 5IR1A 3QG7L 5T5FL 2QQKH 3R06A 4DFIA 4F3FB 1IAIL 3DSFL 2Z91B 1DUZB 4PP1C 3RHWF 2A73A 1JGDB 3S34H 3NIFF 4KROD 2AERT 5TF1H 2ZWLT 4RGOL 5J57B 4KK5C 2BOCA 5TH2B 4G6FB 4TSBL 4WNQA 1JPST 3FZUC 3MRKA 5JHDB 2D03L 2PXYA 3EUUA 1S5HA 4N0UB 5ANMB 3FRPG 3QI9A 2CO6B 3O3AA 2FSEB 5FO9B 1MCRA 4W6YB 2DQHL 2R0KH 4E42B 4YPGB 1RJYB 1AKJA 1HINL 1YMMA 3QXUA 4PG9A 1DQLH 4CN4A 1TJIL 5DD0H 4NYLB 4TUOA 5IG7B 1CL7I 3WUZA 1IGYB 1B9ZA 1NL0H 4K94C 5B4MC 1NCWH 2D7OA 3MJ7B 4P2QA 4R26L 4LLVA 3WSQH 4ZO9A 2I26N 5KS9B 5EIIB 1KJ2L 5JO5B 5HYFA 5KW9H 3DIFA 4HIIA 4BQBA 2YPKA 3BISA 1ZK9A 3NZHH 4PJ9A 4LHQB 5I1JL 2EO9A 3VA2C 3H9SB 3PQYA 4P4RB 5C0NC 2LAAA 4ODXB 2XWTB 2W65A 3E1F1 2EKSB 1FG2A 2FGWH 2HH0H 2BC4A 3LEXB 3LH2L 1W72L 4PV9B 1NGZA 1E4JA 5FHBH 4Z18A 5IF0B 5IB1A 2IG2H 4XP1L 3MXWL 1ND0B 1X5XA 5B3NA 3TO4D 1E4XI 2ICWB 4LHUG 1AI1L 1DTUA 1OT1A 3RAJH 5BRZE 5CHNB 1YEDB 3DXAD 1WZ1L 1S5IH 3LEYH 4FFZH 1LK3L 4QXTB 2PYFB 4MJIE 5K9JH 5J11C 4PB9L 1MJ7H 2QBWA 1T1YB 4NP4H 4AEHH 4FTVE 1R0AH 4AYFA 1JWMA 2BJML 2HKHL 1DR9A 1NCAL 4NNYA 5E2WH 4HKXA 3S88L 2A0LD 5BJTB 3LQAC 1OW0A 2BRRL 3WD5H 3MRBB 3L5JA 4K94L 3BKJL 3ZLQC 3QUMB 1N26A 2CKBB 2YD6A 3PABB 4DVBA 4I4WB 1LO5B 3BEVB 3M45A 3R0MA 4L9LB 2X1PA 1AJ7L 1BJ1H 5LQBL 5GXBB 1T0NA 3WJLC 2AAVA 4M48L 3V4UH 3RTQB 1AGFA 4WFED 4R4NC 4BH8B 1V3JA 4UTAL 4DW2L 1KGCD 3FJTA 5JW4R 1XR8B 5J12B 3C2SA 2GY5A 1ZHKB 3MLPA 5DMIL 3HI1A 4ZQKB 5SWQB 3HAEG 5D6DA 2VDOH 2MFNA 3Q0HA 3MJ9H 1EEYA 3EO0A 5JQ6L 1QLFA 3VFGL 3BW9B 4G8GE 2X2YA 4X8XA 1CE6B 1K2DB 3MBEC 4M6ML 1NFKA 5I8KH 5C0DA 5C1MB 2PTVA 4JRYD 1AO7D 2MWCA 4Q9CA 4PJIB 3GSVA 5F7FA 4KWUA 4V2BA 5F88B 4OZIB 1AH1A 3FO2A 1GOHA 4QRRE 4P4KB 3RL1B 3PWUA 1BBJB 4U4BA 3FMGL 2PN5A 2VZSA 1YEEH 4LBEB 4PJDE 1HE7A 3IFOB 4NWTH 3AMKA 4KMTH 4KQ4L 1EXUA 4JY6B 3OXSA 1KTLA 5IP4A 1W8OA 1SYVB 4Z78B 1TETL 1A0QL 1KIQB 4P5TA 5GGQH 5FYKH 3STLB 4CW1B 1FGVL 2IPTL 3TWCL 2BDNL 1X4ZA 3OGCA 3O3UN 6CGTA 1SYSB 1JPSL 2ZKHL 3HR6A 4J7RA 4K3HA 5LKNA 4H5SA 4XC3H 4PJBB 5DJXB 1F90H 2P8MB 5C07D 5J13B 5HGDA 4IRJD 4JGUA 2X44D 3WFEL 3CH1B 4ZTPL 1JTOA 3ZT5A 1C8PA 4TUKH 2HYMA 5L88H 3IDYC 2X1XR 5TQ2H 4HGWA 1G6VK 3LD8B 1ZLVH 3QEQD 4Y4FC 4GKZB 1VESA 2JCCE 3LSOB 4G6MH 5LVEA 1JZ2A 1RZKC 3TV3L 3MV7E 1U8KA 5D1ZA 1H3VA 3MV9E 5F9OL 3G6AA 3EOYG 1RIVL 1KCLA 4WUKH 4PJXA 3DURA 2VLRE 5T1LD 4UMGA 2F5AH 3HNTL 4DQOH 5IMKB 2AGJH 4IMLB 1IEHA 4NKOB 4MNHB 2IWGA 2EEDA 3LMJL 5F3HA 2PYEE 3VXQA 3TBYB 3QDJE 1B4JL 1J11A 4MZ2A 4HH8A 2FIRT 4JFDE 3TNNB 4LNRA 4C56D 1JHLL 3SQOL 3GSNA 5ITBH 4CGTA 3TBWA 3TIDA 2WM0A 1PEWA 4P9ML 2YHGA 3ZDYE 1DBJH 4JM4L 3BP7A 5I2IB 4FXGB 2L4OA 4JRXB 1VGEH 1ACZA 1ZHNA 5J4MA 1GHFL 1UCBH 3ARDA 3X14A 3JZ7A 5EWIL 2O5XH 1FFPA 5C0FA 3HC3L 1U42A 4LQFH 4MNGB 5GGTH 4EI5D 1RZKL 2F53D 15C8H 4GRWE 1FORL 2DLGA 1NGPL 4PRDB 5IFAH 1EPFA 2JJTA 4CUCA 4LSSL 5DD6B 1N59B 3GNML 5EU7E 1SEBA 2HFEA 3QG7H 1IAMA 4G80B 5T5FH 3D0LA 4GXUM 1QLRA 4HJJL 1IAIH 5D5ME 3WIHL 3DSFH 4YFLF 4LLUB 2VZ1A 4F80A 4ALAH 2GITB 3FO0H 2GJ6E 3RY4A 2ZUQC 3UAJC 3DMMD 3S6CA 3RZCA 4RFEA 3V0WL 2AXGB 4WO4A 3EYUL 4L8SB 3ARSA 4TSBH 3IVKA 2BSTB 4M62L 4XMLH 1XT5A 2D03H 1A1MB 5DDHB 1AHWA 3DBXA 1G7HB 2N7AA 5GRJH 3T1FA 1WBZA 2R23B 4L4TA 4M02A 4XNMB 3TIEB 1MAKA 3KNBB 3FAWA 1MCFA 3BP4B 1JF1B 3IDMA 5DMYA 1TJIH 4U1GB 3RDTC 3NTCL 2BY3A 2V6HA 3QIWA 2EYSA 2HMIC 2PW1A 3L95B 5F1KC 3QIUB 4OFDA 4QTHA 4D94A 3PDGA 2VLJB 4R26H 4LFHG 4FFVC 4ZO7A 5K9KB 4JAMA 4Y1AB 4OLVH 4KKAD 2OL3B 4UILL 1D6EA 2Z4QA 4EIGB 3PWLB 4NC1C 3SBWC 5I1JH 1KC5H 5EULV 1GPOH 1ZAGA 3WIIL 4P23A 1T1WB 5CKGA 3TO2A 4XP1H 4U2YA 1QFWI 4BH7A 4XH2A 1AI1H 1QBBA 4ZPTB 4U3CA 2CMRL 1WZ1H 3QAZC 3L7FA 2BNUB 1IGCL 3O0RL 1LK3H 3D0VB 4PB9H 3E8UH 1FAIL 2E3VA 2X1OA 3LKNB 5D72L 3WE6B 4XVTL 5D7IE 2VAAB 2BSRA 1IM9D 2P5ED 4MCYB 5GGSY 5CBEA 3AFLA 3QXVA 2F74B 3S88H 3F6LA 2A77L 5JOEA 1YMHB 1VCAA 2BRRH 1FVEB 3HE7B 1PKOA 1V05A 5FDWB 3SJVB 3BKJH 4EDXA 5I76A 1UKQA 3MYZA 3G6JB 1KEGL 1VGKB 3QO1A 1E28A 2W59A 5IEHB 3GRWA 1CN4A 3IDNA 1X5JA 5I9QC 4OJFH 1AJ7H 5LQBH 2NY0D 2ZSWA 3OX8B 4YHNB 4JQXC 1T4KB 2LU4A 4AEFA 4M48H 2QEJA 1GOGA 4BELD 3KYOB 5JW4N 4UTAH 4DW2H 1JNHB 5I6XC 3L7EB 5LXGL 1OGAE 5GISL 3U48A 4DEPB 5DMIH 4Z7VE 4FQCH 5EO9A 3QQ3B 3BH9B 4FXLA 5JQ6H 1G7LB 2M8XA 3WS3B 1U91A 1F4XL 1RK0B 3CX5K 5EC2A 5CEYA 4M6MH 3O6FD 2VERN 4XBPA 5EOCJ 2A74B 1A47A 1E4WH 1N5AB 2X4NA 3QR2A 5FA4A 3DI2B 5EFIB 3MJ6A 4M8QB 4U1LA 4ZFOA 3O6ML 4Z7WA 5LAXA 1WT5C 2EDQA 1S7XB 4L3EA 3WNMA 2BVQB 4M7KH 3ZKNC 2YD5A 2P47B 4M7ZB 5D6DC 3WL9A 3QHTC 2IADA 2GAZA 2X4TA 4KXZH 4TYUA 3PHQB 4X9IA 4KTYA 1YY9C 4WHCA 1EEQA 3MNZA 1A1OB 4MXQC 2BHYA 2O5ZH 1DZBA 4PRAA 1KPRB 3ULUL 3VGAC 3EJYC 3O45B 3RGVC 1A9EA 1HH6A 2CLVB 4X99B 1FGVH 1F42A 1T21A 3DUUB 2BDNH 4LCWD 3TWCH 4EEEA 5E9DE 3UYRH 5DEGB 1ORQB 1T22A 4OF5A 1JPSH 3QIBB 2ZKHH 4MAYB 4U1KA 3KWWA 1J88A 4QWWC 3RFZC 5IIEB 1BLNB 3F5WA 3K8LA 3BIBX 3WFEH 1JFQL 1BEYL 4PRIE 1SY6L 4ZTPH 3UBXB 5CAYB 2OSLB 4IM8A 1U3HD 3OKKB 4N0FB 1CQYA 4N68A 1GOFA 3U1SH 3D48R 1HHGB 3JWOC 1EZVY 3P0YH 2R56L 3TYFB 3KPMA 3AUVA 5FF6A 2CDEA 1N6UA 5DUPL 3TV3H 1D6VL 5JPNB 4XPTL 2AXFA 2C3GA 4NO5B 1MJJB 3MOBL 4RWYL 1BJMA 3HNTH 3L5WA 4HWNA 1ED3A 4MD4A 3RP1A 5GJTL 3K3QA 5GS0C 1VFAA 3LMJH 5C86A 1W0WB 4OIBA 4QY8B 1KNOA 4UT6L 5HTSA 5DRXB 1B4JH 2F54D 3UXFA 4BSJA 4ZUSB 3VFUA 1F13A 3QFJB 1JHLH 4U6XA 3SQOH 3B3IB 5D1ZC 3UYOD 3C8HA 5CEZD 4YHKL 5T3ZE 4P9MH 5ESAB 4JM4H 4RBPK 1L0XA 4HIJA 2VO5A 2AV7B 1IAOA 4O9HL 5D7JB 2AJXL 4G6FD 1WV7T 1UB5A 2J6EL 4XWOC 4YDLB 4MA8L 1G0DA 1IKFH 5AD0A 4XHJC 2IPUG 2NCMA 3HC3H 1NC2D 4X8JB 3DO7A 1P4LB 2GUOB 3IETB 3VFRA 3HNVL 4GJTB 3UTPD 2VDRL 4NRZB 3W9EA 5DJAB 3QCUL 4QLRA 4WHYG 1FORH 4M4PA 5C08D 5K9QG 1NGPH 5BMFH 5EOCL 5F7NC 1L0QA 3GNMH 1A3QA 5GS0L 1EBAA 5L7XL 3D39D 3WIHH 4JZNA 1FNGA 3LAFA 4KI5E 3QDME 1OP5K 2CH8A 4JFHE 5DFTA 5KSAC 2VLKD 5CZVL 5JNYB 5I1LA 3REWA 3T0ED 3H0TB 4TNVK 3VFNB 4QHLB 3NCJH 1X5FA 3KR3L 1RJLB 1T5XB 2X4RA 2Q3ZA 3V0WH 3EYUH 4QRUA 3D3VA 4ZYKB 5JXAH 3Q6FA 4M62H 2GTZA 2PTTB 4NNXB 4R96B 3SO5A 1KENL 3H3KA 2HRLA 1BP3B 4PLKC 1RI8A 4KJQC 2HTKD 1MCQA 2ZCKL 3B9EA 4R7NA 3LRHA 1EHLL 4ZUTA 1CLCA 2PCPA 4AH2B 1WIPA 3C09B 2OTPA 3QXTA 4NFCA 4Z77B 1U8LA 4BFIA 4I0PB 2QSQA 3NTCH 1OD9A 1ZT7A 4MX7A 2WINB 1MCBA 4N1CA 1S9YA 1G7MA 4Z0XB 1MVUB 2NTFA 1CXHA 1OTUD 5B39B 4JFZL 1DQTA 35C8L 3IFNL 1A7PH 5D1QD 1RJZB 5C2UB 1MPAL 3OSKA 3ROOB 4QOKD 5ID1A 4UILH 2BHUA 4JG1L 4V1DB 3GSUB 1P53A 3C5SA 1DANT 2B0SL 4YGVB 1HDMB 3WIIH 2QHRL 5AAMA 3SDXE 4OCLC 3LKQB 2Q6WB 1RUQH 3WMSA 5JOFB 4PGEB 3VXTA 2Y4SA 5HGAB 2GY7B 3V4PL 5GJSL 1IGCH 4DK6A 3O0RH 4AZ8A 1VB9A 1RULL 1XF3B 3ARFB 1T7YA 4U7MA 4FA8A 2H3NA 5C0IB 4GAGL 3INUL 3WN5B 3AM8A 1T6VN 3IT8D 2A83B 3FQUB 2A77H 3ZTJG 5DYOA 3O11B 4X4XB 1OLLA 1LD9A 2OTUA 1KEGH 2X7LB 5MENA 1GSMA 5F6HI 5L6YL 1A5FL 4YJZL 1N64L 3W39A 4NZUL 4KJPD 4IOFD 3K80A 4MJ6A 4NKDA 1A6ZB 3MRLB 2UWEF 3CSYB 3ZE2F 1ORSA 5J06A 3B43A 5J3HC 1IQWL 1FNAA 1BECA 5KJRL 3PL6C 3O4LB 4GAYA 2EKJA 5KSVA 3B9KC 1LILA 5CWSA 4KMLB 4F37K 3BHBB 4JY5L 5CJQL 5BS0D 5DRNA 3CC5B 4NDMA 5LXGH 1KACB 2Q20A 5D96C 5DEFB 4W70A 3STZA 1IEBA 3MACL 3MGTB 2EC8A 2BOBA 2P7TA 5CD5D 1MCHA 3PV6B 5D2LF 1DQJA 5DJZA 2BNQE 4L5FL 2MSPA 3GJFA 3S5LB 2HVJB 1F4XH 5SWSB 1P2CA 3QUZC 3L3JA 1I4FA 3LQZA 1JZ8A 3SE8H 1EVTC 1NCUA 2W0KA 1EZVX 2CO7B 2WNGA 6FABL 3NPSB 3DLQR 5DJCA 2NMSA 2GKIA 1PLGL 1D5ZB 1O7VA 2APWA 3T8XB 5I0ZA 1Q94B 5GSVB 5E6ZA 4BSWB 4HCRA 5D2LA 2Y9RT 1MUJB 2DMKA 1BQHB 5DQ9B 3GSWB 1HN1A 5DSCA 1G9MC 1CFTA 1II4E 2OTWA 3LZFL 3KYNA 3JUZA 3M07A 3ULUH 1I8MB 1RK1B 4FOMA 1XIWD 5FDYA 1H0DB 1GZQA 4YUEH 4X4YA 4LVHC 2WBWB 2B4CC 4JB9L 2DAVA 2I27N 3O9WD 4M7LT 1FAKT 4OCRL 3OZ9L 4P46D 1UKSA 2YZ8A 5FO7A 3TO4A 1S7QB 3UPCA 4L8BB 3QT2A 2NR6C 4LVOB 1QSED 5DJ8A 1JK8A 1TZIB 4QXWA 4Z95L 4MA1B 1WCBB 3DXAA 1RZIB 4N8PA 5EUKB 1KCRL 2H2PC 2GJZB 5DVLA 3PWPB 1U0QA 2GK0B 5JR1H 5IOPB 1UH2A 3MA7B 3TJEH 1MLBB 2J4WH 3FQXB 5GIRB 2DN7A 3KYAA 1DQDL 4HUUA 1D6VH 2WBKA 3ZDXF 1UXWA 1S7RA 1MIMH 4UIMA 1NGQL 2NZ9C 1G9ML 1UQSB 4DKFH 4B50A 3THML 4BQ9A 2OLDA 1ZS8B 1B2WL 1JHTB 4RWYH 5FM5M 4Z7QE 3EW3B 5DJYB 5K9OB 3QEHA 1ZANH 2R2HB 4GRMA 2QSTA 3P9MA 1CFBA 2HG5B 5TPWL 3VFVA 1MCDA 4UT6H 2P1YA 3ARBB 4Y4KD 3TNMB 1DBBL 4JPIB 1IGTA 2ED9A 4XPFL 3O3DA 2DI7A 1JN6B 4B5EA 3D2UB 5GGSA 5CGTA 4YHKH 1FNHA 2X89D 4H88L 1LGVA 3NA4A 4ZAKB 1GGUA 2QADD 4PJ5D 4O9HH 5HHQB 2AJXH 3CFCH 4NM8H 3CZFB 1TVDA 5B3JF 4MA8H 4FQ1L 3HMXA 3GK8L 4JFQB 4O2FB 5C0BB 4JRYA 1AO7A 4U6VH 4U6HA 4DKEH 1UM4L 4IIQB 2XN9B 2D4FA 1E4XL 4ODUB 5BV7B 5CMAA 4CN6A 3MUHL 1U58B 2FX8L 3FFCE 3BQUB 4JFOA 3HNVH 3IRZA 3UEZA 1AGBB 2ZUUA 1F11A 2VDRH 4HEPG 4PREB 3HPLA 3QCUH 2XY2A 3HAEH 3RVTD 2EIBA 3MR9A 3QQ4A 5FUCE 3HS0A 1UB6A 1U2CA 5D70L 5EOCH 4NN5B 4HWBH 5INDB 5FGCB 4N90D 3U46A 2BVOA 4U1IB 1MY5A 1YPZE 5JMOC 4N1EA 1WEJH 2EDDA 5JXED 5CZVH 4R0LA 2F8XC 5E8NA 1EA9C 3KR3H 3WLWD 1HNGA 4XP5L 5EPMA 1TZGL 5FGRA 3RWEA 2X4UA 3FO1A 3MA9L 5ABDE 5C07A 3I75B 3P9WB 1XGTA 4IRJA 4O51A 2ARWA 1EAPB 5A1AA 4OF3A 3TN0D 4HC1A 2AQ3A 4ORGA 3OKOB 4GRLB 1S9VA 1EHLH 1I8LA 1YN6B 3C60D 2ICWI 5F6IB 4H8WH 1FFOA 2R2BB 2HP4A 4Z7UB 3QEQA 1IEAA 3FO9A 1R3IL 2D7NA 3G6DL 2E6QA 5E8OB 2BSED 5C8JB 4MGXA 4RMUA 2IAMB 5B8CA 1WIOA 4LCCA 4V2CB 5F8RC 2DB8A 3D1MC 5IKCB 2DLIA 4HT1H 1ODAA 5ADOL 5KZCD 3HE7D 2NW3A 1UWEL 4P9HL 35C8H 3IFNH 4NSKB 4AIXA 1MPAH 2UYLB 4FQQA 4OTXL 3VU2A 4Y16B 2NY4D 4M7LL 4F7CB 2AJ3B 2OR8A 5HHNB 4KVNL 5ANME 2H9GB 4JG1H 2EYRA 1SJEB 2YBRB 3GBNH 4Y4HB 1X5HA 4C56A 4PRNB 1MIEH 2Z35B 2QHRH 1JPGA 4GXVL 3EO1B 4H26B 4MSWA 2YD3A 3JV4A 2HWZL 5SX5K 2ITCB 4WU5A 4PJXE 1JJUA 2VLLB 3GMOA 3V4PH 1CFNA 3G9AB 4HDIB 1OQXA 1LP9A 5JORA 3MRJA 1RULH 4U1JB 4X6DA 4OM0H 4GAGH 3INUH 1Q72H 3P2TA 4K8RH 4HUVA 4NZTL 4EI5A 2F53A 5KS9E 2XWJB 2VE6A 3FTGA 2E6JA 2AK4D 3MCLH 3EOBB 4XP9L 1A4KA 2ENSA 1JUFB 3K4AA 4WI4A 4X5WB 5TDOB 5L6YH 1GCFA 1A5FH 3DVGB 3S36L 4NZUH 2DD8H 4QT5A 1AXSA 5T1MB 4TUJA 5JW3L 1CT8A 4AQ1B 1OHQA 2XKUA 4XAWL 3KPLB 1OARH 1RZJL 5LGJA 2AEIT 3O2WH 2R2EA 1U36A 1P7QB 4MB4A 5I1GL 3VMPA 4JY5H 3VFTA 4AL8L 2Q7YB 3DMMA 3MACH 3V7MA 3QIBD 4QTIH 1C12B 1FFNB 5ITFB 1L9NA 4L5FH 1IAIM 5A2LH 3H9YA 3AREC 4Q9BA 3K0WA 1LO3L 2ICES 1RHHA 1QFUH 2CPCA 1EJOL 2VDPL 3DROB 3HUJF 1HYSC 1E6OL 1J1OL 4LMQI 2P8PA 4KMQA 3DTXA 4K71C 4AK1A 4L4VD 1XGQA 1XF5B 4HULB 2Y23A 2JK5B 1J86A 1WFNA 4OZFH 2J8UF 4J1UA 4UQ3B 1DN0B 3OPZL 5F93C 3AU1A 3Q5TA 4OUUA 3MUY1 3LZFH 3RWDA 5ICYA 4WU7B 3H8NA 4PGCB 5BVJA 4J4PD 4YXHL 3QUYD 2P5WD 5IWLA 3S96A 4LSVL 4JB9H 3TGXA 1A02N 2YD1A 4A6YH 1WF5A 2WP3T 3BJLA 2VZ3A 4OCRH 3OZ9H 1GGIL 2FYYA 4PJIE 2ZP0T 3BGMA 5EN2A 3RJQB 1NLDH 2J8UA 2WUCL 3MRFB 1P5VA 3MNVB 4OZIE 2F58L 1FDLH 4C4KT 3OQ3B 5SV4A 1VEPA 3GJEA 2DIAA 32C2B 3S35L 1KCRH 4HEME 1IC5H 4PRPB 1AC0A 3BKCH 5EBWA 5CSBA 1I8IB 2GIYA 1DBML 1IM9A 2P5EA 2HLFD 4D9LH 1Z9SA 1HI6A 4I2XA 1DQDH 2VKWA 1JI2A 3TO4C 2ZOLA 1XCTA 3T2PA 5C6TL 2N4IA 4ELMB 4WW2B 1G9NL 3THMH 3ULVD 1B2WH 1TTGA 4PJBE 3V5HB 4LMQE 4P2OD 4S1DC 5TPWH 3O41B 1KEML 5CCKL 3KPSB 3I85A 1T20A 3MRIA 1DBBH 5A2IH 2HVKA 3RX8A 4GKSA 4XPFH 4D9QD 4F9LA 2J8HA 4OBRA 2VZVA 5I1EL 3E3QC 2VXTH 3OR6A 4YBQD 4G8EA 4G9FB 5T1KB 4CAGA 1E27A 4WGWB 4JZOB 2VIRA 4NQXB 3VGEA 4LSQL 1R3KB 3PV7A 4PJGB 3UJIL 1HKFA 1CFQA 3TBTB 3EOAA 3EJZC 3HHRB 2GT9A 4FQ1H 3O6FA 5EUOF 3N9GH 2WV3A 3ILPB 3T3MF 4YHIB 3RWIA 4NN6C 3CH8A 4PJHB 1QSFB 2D31B 4JEGB 1RJCA 3C8DA 5HI4D 1TQBB 2FX8H 5L8JB 1I1AC 2A38A 1KFAL 3SDCC 2EDBA 2F9BT 1F6AA 3V0VB 3GMLA 2CIIB 1NC4B 5FUZH 1CCZA 1EO8L 1SVZA 3VFSA 2VZTA 5HHMB 4QGYA 1IGJA 5I17B 5IM7A 5EUOA 1N2RB 4P2CG 1JPTH 3ECBA 4F9PA 3MRPA 2QSCH 3F8UB 1BZ9B 3H3BC 1AR2A 4JRXE 4Z7WE 2CLZB 4NQDD 4LCWA 3SO3C 2C1PA 4PJAB 3BPNC 3PP3K 3U9UB 4IHOB 1FZKB 4CU8A 2MQCA 3RX7A 3LEVH 2JB6B 3ZKXB 1XFPA 3VJ6B 1TZGH 4Q6IA 5INCB 5TQ0L 2BCKA 4MNGE 3MA9H 1AGEA 4HS3B 3B9VA 4UOW1 3DYPA 4YE4L 5I1DA 2A6IA 1DLFL 4ZS7L 4MCZA 2VZOA 5F3BB 1YNKH 3I9GL 4LCIL 3IDUA 4N9GA 4U7KA 3OJ2C 4X6CB 1KCUL 4GAJH 1C16A 2AEPL 1WUNT 3BZ4B 4UB0L 4XBGB 1R3IH 2H1PL 3G6DH 1PZ5A 1D5IL 3NIGE 1NBQA 4DVRL 2Z8SA 4KRMB 2EIZB 1PY9A 3EYVB 4WHTB 1CXIA 2BNRD 2DQUL 1JF6A 1OF2B 5ADOH 4IRJC 3WXWH 1UWEH 5CIPA 1YEKL 4P9HH 4Y5VB 1CR9L 4KJYA 3PWNB 4P49A 2OYPA 1KN2H 3IF1B 4KI5C 2VTFA 1R3LA 4M7LH 3RWCB 4LLAA 4ZNEE 3R8BB 4PPTA 3RX5A 1ZOXA 2F54A 4RGNE 2XQBL 5KSBB 4Z5RA 4H1LA 5T3ZL 5F9DC 4LRNH 5IB5A 4LCCC 3SCMB 4KRNA 4GXVH 4WV1A 2RFXB 3DECA 2HWZH 1FSKC 4XCNB 4JR9L 1G1CA 3ZZ1A 4ZFZA 4F2MA 1EH9A 4TRPL 2C4XA 2KBGA 4P5KB 1A4JA 1CGYA 1AD0A 1DFBH 3P4LA 1A8JH 4ODSL 5JIIA 4FRWA 2J8OA 4IDJL 4WTZA 2XWBB 2X4SA 4WUUD 3TA3D 2RQ8A 2V7HB 1NC2A 4UQ2A 4NZTH 1HIML 3QA3A 4GRWH 1Y6KR 3I50L 3BZEA 1ZSDB 4YPGA 1VACA 4XCYA 1VERA 1XF4B 3JWDH 5GS2D 4XNXH 2VMFA 1PQZB 4MJ2A 5C08A 4O2EB 3ZYIA 4EJ1C 4L29A 1ZA3A 3S36H 1D5MB 3L3IB 3SE4A 3QXWA 4QRSB 5I8EA 4Y5XB 2Z92B 3D39A 5HPMA 4XAWH 4NO0D 4HX1B 4NQCD 1RZJH 3L9RB 2EIEA 2NY6B 3PHSA 2NXYC 2VLKA 2E7LA 3T0EA 1KN4L 1MFBL 4HHAB 3FRUA 3SDAC 1CG9B 5I1GH 3VRLE 4HBCH 4WEBL 3KLDA 8FABA 3RWFA 4HS8L 4HWUA 1HOCA 1HNFA 1KXTB 3HI6H 4LL9A 4JO4L 4LLQA 5IMMA 2ATKB 4N5UA 4YZFE 2GTWB 4MZ3A 4PJ8B 5CHNA 1LO3H 1EJOH 2VDPH 1E6OH 1J1OH 2Y1VA 3GEWB 1OQOA 1U8JA 4P2RD 3P11L 3VG9B 4OCMC 5DQJB 4K7PY 3UBXI 3X11B 5EU3A 3FHQA 5JMRA 1HQ4B 3D3VE 1BHGA 3DRQB 1YEGL 2YOCA 4I5BB 5LJYH 5MEPA 3U0PA 5JW5A 3EO9L 5FO8A 4KDVA 2AXHA 4JFPA 4Y2DD 2ADJA 2C9AA 1S9WA 2X4OA 5D1QA 2CUHA 1BGXL 3BJ91 1PBYA 2V7NA 4L9LA 1LMKA 4JHBA 4QOKA 1BOYA 2WBJC 1KYOK 1Z9MA 4TSCL 4LSVH 2EYTB 3DETC 1HILB 2VL5B 3PGFL 1TXKA 2WLZA 2Z31B 2A6JB 2J2ZA 5IQ9B 3TLRA 2WUCH 4F7MB 1G6RA 2X4QB 2F58H 4XNQB 3AXLB 4APQB 2BVTA 3QPXH 4FXKA 2R4SH 5SWQA 1J05B 3S35H 3JV6A 3ZT6A 4ZUWB 3WFZA 1BMGA 4ZAKD 2V17L 3GSXB 3LN9A 2DQTH 2FD6L 3MRRA 2AJZB 1X4YA 5MP6L 5AYQA 4B7IA 3BQUD 1BD2D 1J7VR 1EUUA 4OQTL 4QYOB 2B5IC 3LS4L 5C6TH 2NXZD 4F7EA 1G9NH 5IESL 3T65B 2FJGB 1GC1L 2ORBL 3GIVA 5DJDB 1TJHL 3GUTB 3QO0A 1KEMH 4HKBA 5C2BH 5CCKH 3V6FA 3QZWA 3IJHA 4YXLL 25C8L 4HPOL 5ENWB 4NZJA 1RIHL 2C1OB 4Q9RL 1RUPL 5BS0A 5EBGA 3LV3A 4PGDB 2V2TB 2WP3O 3TVMD 3SKOA 4UV4H 2VISB 1MH5B 1HSAB 2MHAA 4LSQH 4P57A 4KRPD 5LWYL 3UJIH 4L3AA 1KB5L 2H6PB 3MROB 4C4KO 1NMCC 3RIAF 1EBPA 1KULA 1I1CA 2UY6A 3O6LL 2IMMA 4S11A 4UTBL 4Y5YC 3MUGB 1P4BL 2WZPD 1A6TB 1NLBL 3FN9A 3LPWA 1F58H 4KPHL 1F4HA 5D4QA 1P4IL 3O2DL 1EO8H 2IPKB 2QJDA 2YXMA 2VR5A 3QFJE 3HG1B 4NOBA 5JLZB 1WITA 1YEIL 5DJ0A 4JDVA 3VXPB 2G75A 3HTLX 1Q9OA 1NFIA 4QRPB 2IEPA 3WLBA 2YPLD 1I3UA 4NQSB 1RIUL 1RV6X 3VRJB 1XIWA 5ID0A 2AXJA 3IB4A 2OZ4H 3FB7A 4UT9L 3O9WA 3HRZB 2O26U 2NY1B 3EYFB 5SX5H 3JV0A 3C2AH 1NGYB 2NY3D 4P46A 5SX4H 5TQ0H 3I6GB 5GRZA 4OZ4B 4EZMA 1RHFA 1QSEA 1P1ZA 4YE4H 3W9DB 4M6OH 5HD8D 1DLFH 1OAKL 3I9GH 4LCIH 2C3VA 3O6KL 1KCUH 4MQXD 4FXGA 3R8QA 4JO1H 4ENEC 1XR9A 2CRYA 3CU1A 2HJFA 4UB0H 2R15A 5C71A 1S9KC 4JANA 2H1PH 2X41A 3PWVA 1OGTA 4MS8D 4BQ8A 3T0AA 1F5WA 1RD6A 2EZ0D 4NFDA 5L8LB 1F3JA 2H8PB 2DQUH 3DVNB 3E6FB 3GSOB 4PUBH 1CDBA 1FNEA 1YEKH 2HKFH 2DQFA 3MRGA 1ZGLM 4KH2A 4PRDA 2R29L 5I73B