3UDWA

Crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TIGIT immunoreceptor bound to poliovirus receptor reveals a cell-cell adhesion and signaling mechanism that requires cis-trans receptor clustering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords T cell immunoreceptor with Ig and ITIM domains
total genus 18
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3udwA00
3CSYB 5BO1H 4KJWC 1T4KB 4Q0XH 4QGYA 4JM2D 4ORGB 3MLZH 1C08B 3W9EB 3VXTB 1IAIH 3C6LC 3H6JA 5J06A 3OX8A 4HWNA 4RSVA 1LD9A 3HZMB 4L3AA 2XI9A 4WFGE 2ICWB 3LDBC 3HAEB 1VESA 1GHFL 4OCRH 4KKLC 5F8QC 3UXFA 3TV3H 3P0VH 4OGZA 3V6FA 4L8CB 1ZHKB 3LKSB 3HC4L 1IKFL 2FJFA 3L3GB 3DX6B 2QHRH 2AJ3B 2I60H 3ES6B 3JSSA 1T83A 4WI7A 5HHME 3CX5K 3RGVB 5KVGH 2IH1A 3IF1A 4S1SH 1LK3L 2I24N 1OLZA 3ULSA 1CE6B 2DAVA 4NC1E 5L0QC 4O2CA 2B0SH 2BOCA 2IALB 4AG4L 5KJRL 1Q72L 3BP7A 4RMVA 4UI2A 1K85A 4J7RA 1DUZB 1NANH 2WMPA 4PY8J 2V2TB 3LB6D 3SCMC 5GZNC 5E6IB 5E9DA 1QSFD 4I18C 2DJSA 3W11C 2B2XL 4QEGA 3UTZA 4JVUA 1MH5B 4WNQA 5EBMB 5EOCJ 5BV7H 5IVXF 1O0VA 4S10A 3BHBB 4Y5XB 5T1DH 2FYYB 3MRRB 2VAAB 1BREA 3OKYA 4NN7B 3TIDA 2EIZA 3N1GC 5DEFB 4XPFL 2P4AB 5TDOB 5CIPA 5J12B 3GGWA 1HHJA 4YUEH 5GSVA 5DD5H 3ARFB 4NO0A 5DFVC 2R29L 3UTQA 1IAIM 1BD2A 2CUMA 1RUMH 3MRKB 1PZ5B 1I3VA 2X7LB 4GBXA 4HH8A 5IVOA 2FO4B 1KPRB 1CFSA 4UNVA 2G5BB 2CDGA 4PD4K 2AEPH 4PJEB 2VDKH 3H3KA 4MD5B 1KTDB 3U30B 2P5WE 1XGRA 4XH2B 3JV5A 3V0VA 4EUPG 2D7TL 4U33A 3VW3L 4LLVA 4LEXH 3IFNH 5JOFA 2HLAA 2YS4A 5AD0A 1YNKH 4HZLB 3F65A 1WEJL 3BT2H 2E9JA 3BZ4A 2D4FA 3T0EA 2MHAB 3LRSB 2IAMD 4GW1A 1KLFA 4ELME 2QV2A 2HFEB 3QO0A 4LCCC 1TZHA 1JWMA 5IR1B 2PNDA 3IFLH 4UBDC 1BF2A 3WLBB 5I1CH 5CLTA 1I9IL 4N9GB 4K7PH 4LVOC 1FYHB 3U36B 4YHNB 1JNHB 5J3HC 1JGVH 4WV1A 3V4PH 1PKQB 3BN9C 5FO7B 5C8JA 1OSZA 4BFIA 1KLUB 1JHLH 3G6JE 3INUH 4EDXA 3KS0J 2Y07L 1QFUH 5E6ZA 3QUYC 4LAQL 5EBWB 4HHAA 5EA0L 3RRQA 4WEMB 3OPZH 3B2UD 3CPLA 4G3YH 1FFRA 2DWEA 3OKDB 3TO2B 2R39A 3FN0L 3IKKA 3MRFA 4I8DA 1ZEAH 1AHWC 3UC0H 1IKFH 4L4VA 4JRYD 2DQFB 2WINA 4L8SA 1MJ7L 2PYFB 4GW5A 4KUZL 3SGKA 4EQ3A 2R2BB 1T0MB 2FGZA 3DUHA 4XNUL 2ZCKL 4S2SA 2C5DC 1TDQA 2HTKD 4Y2DC 1A2YA 4XCFH 2EE3A 2WAHA 4ESKA 1A9EB 3TBYB 5ABDE 1MCRA 5C08E 5D5ME 4RFEB 4WUUD 4ZOEA 3PHOB 4H0HB 4QOKD 5FKAA 4PLKD 4F15B 3L5JA 2XFXA 4O4YL 3QG7H 4N90D 3P0GB 2VLKB 1LQSR 1MRDL 2IBBA 2F8OA 5I8CA 5IQ9B 2WBJA 1BJMA 1A4KA 3DV6B 4O2EB 5DSCA 1GCFA 4JO4L 4I48B 1GOHA 5A16B 3DXAE 2BXZA 1HHHA 1IILE 4LLUB 3BP4A 2GSGB 5IEKA 5KS9A 3TF7C 3QZWA 4BQ9A 2WANA 4MX7B 4MQ7A 4MA1B 4NRXB 4QHKI 5K59F 4RA3A 3FHQA 4PRHE 3CFCH 1MVFA 4K8RC 3FB8A 2IQAB 3HC3H 3AMLA 5E7FA 5F72S 3BUYA 2ADGB 4PP2B 4LCWD 5D1QA 1V7MH 4M3KB 4MGXA 5CJXC 1N0LA 5F21B 4XPAL 4MYWB 1OAXL 3PL6D 4M1GH 3VMOA 1FVEB 3PWVB 2MOVA 2VDMH 1WK0A 1MCNA 3IT8D 4RAHA 1FQ9C 2WWMD 2VDNH 1MY5A 4TNVK 4HKBA 2VUYA 4HZAA 4G43B 3WIHL 4AZ8A 1N6UA 2HFFA 4KJYB 4P9ML 3RY6A 5IROA 1AQKL 4IMKC 5TQ0H 1SVZA 2P44B 3P11L 3T0ED 5DEGA 4P5TD 4LRIC 4UB0L 1I75A 3S3SA 1I9RL 1F58H 1MCQA 2IJ0C 1AD9B 2I26N 5SX4H 4LLWB 3ZTNL 3ULSB 5EUKB 2X9WA 3PV6A 4LLMB 5JQ6L 5FUZL 4WO4C 3L3HB 1BOYA 5JHDA 5FYKH 3BRGC 4GAYB 5BOZG 1BVKA 1UCTA 5DF0A 5GSRA 4HH9A 3KYNA 3FB7B 2BHYA 1AGDA 1BPVA 1N8ZB 3H3BC 4LLQA 2B4CC 4WUUA 1R0AL 1MVUB 5D1ZD 2BCKB 4RRPG 5J7CC 1TQBB 4Z7VE 3IXAB 5EFIB 3OAUH 3CUPA 5ESVA 3OJ2C 3MACH 4JZJC 2M2DA 4WHTB 1JVKA 5HHVH 3OJDA 1NGQH 3FHAA 4QO1A 3MJ7A 5D7JB 2WUBH 4KK8C 3V95A 1HHIA 4WU5A 4QNPE 5J89A 2DJ4A 5FB8B 2A6JB 5EO9A 2ZUQC 3QQ9D 4I2XA 1L9NA 4P57B 3VXRD 3S37X 1NEZG 2WWKT 1EO8H 3HAEA 5AYUL 3ARZA 4POYA 3SDYH 1ITBB 1NQBA 2BNRE 4YXLL 4OM0L 2ENSA 4UQ2A 4GRLB 3MBEA 4U6YB 2E8ZA 3DVGB 4QHNB 1ZWIA 4X8XA 3JTSB 3QDJA 4X8JB 2EDKA 3QHZH 3VFSA 1EXUB 1E6JH 1KG0B 1P53A 4JRXE 3QFJB 5I74B 1ZTXH 5B38G 5AUMA 4FOMA 2X4OA 5E95B 3GHEH 1WISA 5GS1C 5HGBB 4Z7QE 1A9BA 1RD6A 4JFOA 1JWMB 3MLVL 4X7FC 5IB2B 3MREB 1EO8L 5FYKL 4C56A 3LIZH 1NUDA 3FQNA 1HZHL 3QIWB 5IV2A 5KANG 4NRZA 3O3UN 3RUGA 1P6FA 5ID1B 4RGMC 1G9NH 2BSTB 4MLSA 2YK1H 2VXVL 2WWKO 2ED8A 2R0LL 4N8VB 2PTTB 4UT9H 5HGGS 3C5ZD 5F7EL 2BVPA 5HVWA 3DVNB 5FFLA 4PJGE 2DWEB 3OR6B 4F37K 2EDXA 2CLZB 5DD1H 5E00A 5ETUB 4NKMB 3RDTD 4U1GC 1KACB 3EYUH 1BZ9A 5GISH 4P2RD 1KJ2B 4PRBB 3MRJA 1LP9F 4DN3H 3I50H 1FNSH 4KRPC 4PJ7B 4LPVA 3ARBC 3HG1A 3WXVL 1CIUA 4GXVH 3D87B 1OD7A 3X17A 4OIIH 4JZOA 5CEZL 3S97C 3QUKA 4K71B 2MWCA 3AU1B 4ODSL 4TQEL 1UACH 3WJJA 4HZLA 3DXAD 4Y8AA 1U8MA 1A64A 1PYWB 3KDMB 5IW1B 5CSZA 2ZUXA 3F5WA 2K9UA 3IFLL 3O6FD 3IU3B 5HPOA 5KSAB 1HHGB 1MFAL 1NCCL 1PQZB 2YXFA 5C2UB 5DFWH 4MHHG 1HN1A 4U3XA 1PX4A 2FATH 4AYFA 3U36A 1OTTC 4GKNA 5IMKA 2NY4D 2VSDA 5JDSA 5FYLE 5FA4B 5C6TL 3LKPB 4KDVA 2N7BA 1NGZA 1AH1A 1JK8B 1ZS8A 2DLGA 5SX5K 4PY7A 5EA0H 3D25B 3G5VA 2D2OA 4XBGA 5DMGC 1I7ZA 3CVHA 3K7UA 5IVZB 1Y6NR 4M9OA 4AEHH 4Z78B 1S8DA 3MLYH 3RVVD 1DLHB 3DPBA 3L3KB 4MWFA 3WFBH 3C09B 4XNUH 5EOQH 1UH2A 1LE5A 2HKHL 4R2GB 1A3QA 2NLJA 5EU7C 4KROC 1QVOB 3OF6A 2V7NA 2ZSWB 2EIBA 1QRNB 1KEGL 5F7HA 1M7XA 4UU9A 4JKMA 5FUOH 5DWUH 3HPJA 4NHCH 4M48H 2X4NB 1PDKA 5HHMB 4X4MA 5BRZA 4MDIB 4PP1C 2AW2A 3ZDXE 4TOYH 4E42B 2P8MA 4X7DC 5H35A 3SE3A 4OUOA 4MNHB 4F15C 1ZHKA 4GQ9L 1C5CL 4DVRH 2Z93B 4TVPE 2WIIB 4ZQKA 1A1NA 3IAGC 5CS7A 2VZUA 4KI1A 4I48A 3OKNA 3EO9H 5I1IH 4PJAF 1JTOA 3Q5TA 4N0UB 1BGXH 4KUZH 3THMH 12E8L 3G9VA 4KV5E 2X4UB 2VKXA 2J8OA 3LVEA 4TSAL 2FEDD 4EN3B 1RAMA 4H8WH 5JUEL 1QLRB 4RDQF 2A73B 3FT4B 4HMEA 3SOBH 2LAAA 3DX9A 4LHUB 3QFDB 1DZBA 3NAAL 4UUJA 3EYQD 1RUPL 2ARWA 4C54A 1T03L 2ICCA 2OLDA 3RWEA 2BCKA 4N5EC 1QUNA 4UOW0 4HBCH 1OPGL 1RI8A 4OD2A 1YEHH 4JM2F 3OAYK 5GPRA 4YHLL 1IC1A 4OLZL 4S1RH 5F1SA 3PP4H 1X6LA 1A6AB 3CH1A 3MV9E 1D5XB 3NCMA 2Y1VA 5CIPB 2GIYA 3PQYD 1A1MB 1AGCA 2A9MH 4JG1H 3ZT6A 3SKMA 4OCYH 4ELMF 3W2DL 5J8OA 1J0IA 3VRLE 2FGWL 5F3BA 3DWTA 1R5IA 2HT3D 4GBXB 2H6PA 4KI5D 4R26H 3V0WL 4TSBH 1AR2A 3WBDA 3E6FB 2EC9T 2P47B 4WJ5B 2Y5TB 3BYYA 3DROA 3G6AA 3B8SA 4URTB 5IROC 5D1QD 2BVTA 2R23B 3GSRA 4ELMA 2P42B 4GMTL 3LEVH 1SHMA 4RFOH 1BLNA 4LFHG 4HCRL 1DL7H 4PJ9A 4WW1B 4V2CB 4J3XA 5HI5C 4IIQC 5H37G 4M61A 3TEUA 1OWRM 3HN3A 4WO4B 4JDTL 3SKNB 3O3DB 3GEWB 3S37H 2F19H 3CXHJ 2CLVB 4MA7L 3U9PH 3AGVA 1U6AL 1IC7H 1OAZH 3KYNB 3AM8A 3TT3H 1MWAL 1TZHB 2BSRA 5CJQL 2Z31B 1F3JB 2IPKB 2JJUA 4YHYB 5F9JA 1Y18B 4QYOB 5EBLA 4YXKL 1NKOA 5IIEB 4YHIA 4WFHD 3MRGA 3LIZL 2NY2C 4IRZL 3QXTA 3KPSD 1J8HB 4XP4L 5B39B 4OCRL 2NY6B 1CBVL 5KS9F 1DBJL 4PJ8C 4Q9RH 1FCCA 1WJ3A 3UYPA 4KQ4L 4D3CL 1ND0B 2VL5B 3MR9B 3HR6A 1JZ4A 1XEDA 4LIQL 1CD8A 2YRZA 1VPOH 3PDOA 3UZQA 4D9RE 4GO6B 1K3IA 3B2VL 3SDCD 1J11A 4TVSa 3VG0H 3VI4E 2RFXA 5KW9H 3LB6C 4XPHL 5CIPH 1M7DA 1EXUA 3BD4A 4JREB 1QFWI 3O2WH 4S0TD 2UY7A 1QLEL 3HA0A 2R2EB 2VXQH 4UTAL 1CLOL 3WHE1 2F58L 4NKOB 1IGCL 4XP6L 1V7NH 3D1MC 5JO5A 4PG9B 5CJ5A 2WP3T 5BW7C 4M3JA 1UA6H 1NGQL 1WBYA 1DANU 5BVPH 5LJYH 1GHFH 4KFZC 1FL3B 1KUMA 2A6DB 3H9SE 1FZOB 4HAFA 4B5EA 5B3JF 4GKOA 1K9TA 3F6LA 3RA7L 1R24B 2VLME 2FX7L 3GJEA 1YECH 3VXRE 2BRRH 3RUGB 2YC1A 4JO4H 5HHXL 1RU9L 3HUJF 4PB9L 4Y88A 5LXGH 3ULUF 5J11B 4B41A 1OAKH 4GLRH 1QSEE 2PTTA 2VXQL 2PXYD 1NMAL 4PJDB 3ZDYE 4HLZH 3BOVA 2XN9D 3N06B 5KOVC 2XY1A 3VFGL 4QRSB 3ARGB 2GUOB 4DKEH 5E00B 4YDVB 3EO0B 1XR9A 5HHOE 1KXTB 1NDGB 2EDOA 4JFZL 4MX7A 5CEXB 1T5WB 1Z9OA 1P4IL 4XCFL 3MJ9L 4ZTPH 3M17B 3PWLA 1U91A 1UB6B 4UIMB 1UADC 4KHXH 3IS1X 3Q5OA 1IGJB 2ZCHL 4EZMA 4GMSH 4NFCA 4RIRB 3KYAA 5HYEA 5KSBE 2EDDA 1BX2B 2AV7B 5K9KA 5CD5D 4IRZH 3OG6B 3AM8C 4HIJA 4E41D 1ROWA 1H3VA 3SKOA 1FBIL 3NZHL 5C1MB 3VGDA 5IW3A 3RDTB 4XP9L 3T77A 1M71B 4NQXB 1IAOA 2F5AH 5T1MB 4O51B 3IDNB 4XVTH 4CVZB 3HFML 3TH2T 3BKJL 3RL1A 1YEGH 4M7JL 1GH7A 3VJ6A 5AG8A 5IMLA 2C3GA 1WIOA 2IG2H 3PABB 2QSCL 5IBUG 5EU6D 3L3IB 1CG9A 4JFHD 5DWUL 5LGJB 3V4VH 3NCYP 4Q6YA 1CGTA 1IEAA 4YO0B 4OM1L 1SMOA 2FHBA 3T09A 1MQKL 1HEZA 1SJEB 3PXJA 4JY5L 4P9HC 2DQUH 3DX9B 4LHUA 1ZA3A 4PJGF 1KTRL 3L3JB 3ARXA 1S9WB 1U41A 7FABH 3DRTA 2A1WH 3BJ91 2VZ3A 2E9WA 4F57H 1HH6B 1HHJB 2BJMH 4JQXA 3FONB 1LO3L 3FQXB 3GB7A 3P9LB 4P4RA 1ACYH 1MREH 2EDHA 4ZTOL 4M6OL 2YPVH 2CK2A 5HYSG 4Z7UA 3O4LA 4R2GC 1RULL 4QKXB 2APTA 3PWJA 1VACA 1OQOA 2A83B 3SDCC 1X5IA 4PJXE 3D69A 1ZGLA 5EIIA 1S7WB 1E27B 3RGHA 1QLFA 5C6TH 1J0KA 3MTRA 3W9DB 3UZEA 5TGBA 1YNTB 2DQIL 3WN5B 1I85C 3BX7C 4PJEA 1YEHL 4L29B 1BOGA 1H5BA 4JRWA 5EIVA 1OPGH 1OLLA 4ZO8A 4H88H 4WJ5A 5I8KL 5I1GH 5C09B 1S3KL 4AK1A 4JFXB 3E3QC 5AD0B 4BELD 1CLYH 2P8MB 4EJ1C 1LO2H 4GQPH 4XP5H 1WWAX 1WWCA 3P9WB 5DJ6A 3TNNB 2PKDA 5I1JL 1EX0A 2G5RA 1P1ZB 4UV4H 4DK6A 1VKXA 4W70A 1CQYA 3X3FL 1BGXL 3THML 2Q87A 3ZTJG 3PHQB 1HIMH 1J8HE 1MSPA 4HIHB 1JN6B 3C60D 3ALPA 4WTZA 1B4JL 1QRND 1D7FA 1GIGL 1HCVA 4M8VA 1EUUA 3T0AA 4JQVC 5JXED 1LE9A 4BZYA 4WV1B 3SDXE 2XRAL 3AMKA 3OL2A 2BSRB 2KQNA 2E7CA 4I9WD 3AS3A 3QFDA 4U3CA 1OSZB 5I71C 1UM6L 4C56B 4G7VL 2RBLA 1YY8A 3V52L 2MTPA 2XPGB 5D2LB 1A6TB 4H25A 4NRZB 1CK0H 4YEFA 1AGBA 1MHCB 2QSVA 3CH8A 5C6PB 5IHUL 1IL1B 2ATPA 5HI3C 1EIBA 4ENEC 4XVJL 5SV4A 4WW2C 3P0VL 4P59L 2DM4A 1MEXH 1RUAL 5CBEB 5FO8A 3GBLA 3RVWC 4TTDD 4FQIL 1XCQA 2J88L 4GRMA 5C0EA 4RX4D 1J05A 3WS6A 5BV7B 2LVEA 1R3IH 3RIFF 3G08A 1OHQA 5GIRA 2A38A 3C5JA 3MZGB 1X7QA 3VD4A 2RFXB 4C4KT 1CWVA 4PJHB 5TE7H 5B21A 1IT9L 4AM0B 3ILQC 4XBEH 3SDAA 4JZOB 5GRXG 3TNMA 4LSRL 4P2QE 4BSVA 5BRZE 2DKMA 1DL7L 2W9EH 1PVHA 4CVUA 5L2KE 2Y06L 4D3CH 5AZEL 2VDNL 1I9JH 4IIQB 4LPYA 3SY0B 1YDPA 2I07B 1BQUA 3O3DA 2XN9E 1HYSD 2XTJC 3EHBC 2BSSA 4ZAKB 1IAII 1H15B 3BEVA 1REIA 1MFAH 1K6QH 3MGOA 1EZVX 2FX8L 2WBJC 1FIGL 1HI6A 1YEKL 4G8GE 2N7AA 5GXBB 2FIKB 2PYEE 4O2FA 1CDHA 4OCYL 3WFDL 5JNYB 3HI6L 2AEQH 3T4YA 3FT2B 4XZUB 4A2LA 4U7MA 1C1EL 5ECJE 3NIFE 1JV5B 5H94B 1X5FA 5E94A 1G0YR 4ZUUA 3S4SB 5CEXA 1IGYB 3CMGA 4JANB 4XPBL 4UIKH 4CMMB 4AEIL 1NGPL 1RIHL 2Z8SA 5ALCH 1X9QA 3PWVA 2CLRB 3SO5A 2CXGA 4M00A 4PREB 4BQ6A 3O9WB 5DJYB 2O5XH 4Y8DC 1FAKT 1OY3B 1WT5A 3SKJH 3TYGL 5HYQB 3DARA 3FMGH 5ADPH 3I85A 3RBSA 3ZT7A 1NGWA 2YD9A 4ORGA 5FUZH 3HE6C 4BFEA 3TN0C 4ZNEE 1FNEB 4KUCF 2UV3A 2D7NA 3UYRL 3QJFA 5JO5B 4IS6A 1R5WB 2V2WB 3NGBB 4R6UA 4Y89A 4L3CA 2YEZB 3DV4B 4IRJB 1S7SB 3QIBC 5L8JB 4YBQC 4N1CA 3HTLX 2O5XL 4MNGA 5GGSY 2ESVE 5EC1B 1ZT1B 1N5YL 2NNAB 1CE6A 25C8L 1T21A 3GMRA 5F44A 4HDIA 4HKJB 5D1XA 2OR8A 1EEYA 1FGVL 4RAUB 2EDRA 3WFDH 5D7LB 1KNOA 1AGDB 1MCFA 4PG2C 1YN6A 4QRSA 3VWKD 43C9A 3D3VE 3U30C 1HK6A 3AB0C 4MS8D 4J4PD 3NIDE 3HI6H 5EBGA 1GAFH 1G9ML 4BZ2L 35C8L 1YPZB 3KLSA 4R90L 4PUBL 3TIDB 1MFDH 1MPAH 3PWPE 1T1YB 3P4OA 4JFQA 3PWPA 3HS0A 1UZ8A 5T5FL 4JZNA 3GO1L 4G7YL 1BX2A 5K9KB 3QYCA 5HVGB 1IFHL 3TZVC 4OCWH 2D7MA 5I8OH 3QI9C 4RRPA 2Z0BA 2FATL 3RDTC 1BBDL 1DBMH 4GRWE 2I9LA 3VD3A 2AXGA 1R5VB 2NY1C 4HUWA 4L4TA 3VXSA 3WHXA 3I75B 1PLGH 5HHMD 5JHLH 1G7PB 3G6JA 2Y5EA 4UT9L 3QRFM 2WLZA 2YA2A 3KG5A 1UXWA 3GRWA 3PHQA 5DQDL 2ORBH 3MREA 3T0EB 3V6OA 3FOMB 3DI2B 4WW1A 4XCNA 3VWJC 4J8RA 5I2IB 5EUOF 3CFDB 1GXEA 1QBBA 5ID1A 1L7TL 5DDHB 4RNRB 2H9GA 4ZSOA 1FNSL 3RI5K 2YD8A 4LOUD 4K3EH 2VLLB 3HZYB 4Y2DB 1K4DB 3TJEL 5DZOA 3U83A 3AREA 3MJ9A 2IGFH 3O0RL 3D85B 3C60A 2IAND 3QQ4B 4Z7UB 5EUOA 5F93C 4RMRA 5E56A 3BVNA 4N8VG 2XZCL 2A83A 5GRJH 1I8KA 5DJDA 2X70A 1X44A 2C3XA 1T1ZB 1EHNA 2FHCA 1IZJA 1FVDB 2LU7A 1UKQA 4UDTB 7CGTA 4MJIB 3ARPA 1RJYA 5FYKD 5HDBE 1MCHA 1P69B 4JM4H 4NNYB 1MJJB 3TBVB 1IGFL 5D7JD 5JORA 2H1PH 1VERA 3CFJA 3ZDYF 4YGVA 1G7LA 2GTZB 1S3KH 3RY4A 3BUTA 3PNWB 5D9SB 1NJ9A 4CADA 5IB3A 1QQDA 4JDVB 5E7BA 4YHZH 2EKSA 4UINL 3QRGH 4KZDH 2PO6B 4U1JA 1CFVH 3ULUC 2HWZL 1CE1H 3LKQA 4XPGH 1FZJA 3T0VA 2CO6B 4NPYB 2JELL 5B4MC 2BY2A 1F8TL 1DN0A 3TBTB 2VLRE 2COQA 5TE7L 3VGGA 1LEGA 3VWKC 3KVQA 2EICA 4BSWA 1NEUA 3VGAC 1JGLH 4PBVC 2QADB 1I3RA 1Y6KR 4WO4D 1FL3A 2W65A 3MV7E 2H8PB 4GG8B 5E8NA 1IC5L 5DVLA 4QNPF 1U3HD 4MD4B 1CDUA 3QUZB 4RISH 3LKNB 5FO7A 1I8IA 2XTLA 4TVPL 3U7YL 1NH6A 1G0DA 5JIHA 4RAVA 4BZ1H 3E0GA 1KYOJ 1UYWL 4Z7WA 5E94B 3VFOA 5C0JA 1XF3B 3QXDA 5IGXH 3QA3A 4NJAH 4YHML 1GC1L 3HI1A 1L7IH 2EIDA 5D7IE 4BK5A 2APXA 3STZA 1CDCA 3VFNB 5C07E 1NBYB 3CMOH 5GRUL 1XR9B 1QPPA 3K8KA 1HWHB 5IMMA 4C56D 5MP6L 2DN7A 2Z92A 4XNXH 4R0LA 2D7QA 1EDQA 4LSQH 1ADQL 1BQHA 3OB0K 3ZKMD 1FVEA 3S7GA 3PL6C 5F6IB 2DQEH 2V5YA 2W0LA 3U4BL 4I3SL 1IM9A 5L7XH 3NMEA 4GS7B 5AYUH 2A9NL 5IF0A 4HX1B 4KXZI 4M6OH 5MEPA 1MJUL 2QHLA 1UENA 1U92A 3CJJA 3CXDL 5L8KB 1RSFA 2UUDH 3RDTA 3STBA 1JPGB 1B0GB 5AWNL 1RZJL 4PB0L 5IM7B 4JR9H 1JI2A 2RB8A 3MGOB 3NFPB 4ZODA 1B0RA 1ZLUH 5MEOB 2UWEA 5LWYH 1Q9OA 5GJSL 4AL8L 1F4YH 5D7IB 2YR3A 4IDJL 4PJ9D 3V4VL 1CFNB 3QHZL 5ERWB 3S8WA 3QEUA 1ULVA 4NQDA 4RGNC 5KG9B 1YUHB 4DK3A 3QDAA 4M1GL 4O4YH 5H94A 3GK8H 4PJIE 4IHOB 4PJCA 4DGIL 4XNYH 2DS4A 2NXYD 2ADIB 4YXHL 6FABH 1PY4A 4AENB 4U0RB 4M03A 5L88L 1S9WA 1KENL 5E08H 3LHPL 3SQOH 4F57L 2ADFH 4LK4A 1BAFL 4XP9H 3R8BB 1E4WL 5TF1L 4K23L 4OGYH 4DUVA 3O9WA 2VLRB 1ITCA 2Q8BH 4NZRL 1NMBL 1Q94B 5FO9A 1EEZA 2HVJA 1G7IA 2X6MA 4WHTA 4YE4L 5DTFB 1AFVH 3K80A 3MA7B 1OWWA 3QIWC 5IK3B 4J1UA 1QBLL 4XHQA 3VGFA 3SCMB 1AO7E 4OZHB 32C2B 2Y5TA 2GTWB 5DGRA 4UTAH 1OGTB 4WWKC 3RUGE 1BVLB 1ZAGA 3VXRB 3EOTL 4ZD3L 5FK9A 1N3NB 4RGOL 4L4TB 1GC1C 4DKFL 3D18B 3WFZA 2VDML 5L2KA 3TJEH 1UKSA 4ENED 4K7PX 5D71L 4PJ7F 4DEPB 4LLWA 4M61B 4U1NB 4NUGL 2APVA 1T21B 1NFDA 2XZAH 3GMRB 3PHSA 4LLMA 4D8PA 3PWUB 1FL6A 1U3HA 3UO1L 3KXFA 1AY1H 4FXGA 2OL3A 3L1OH 3FO1A 3RWCB 3ARBB 1ONQB 3OGCA 2IPTH 1RJLB 4WEBL 4L3EB 2DQJH 2A2QT 4ZSOB 2KH2B 3DX7A 1I1YB 3S4SG 4PJIF 4LEOA 2YUVA 2P5EB 4OFYA 3WYRA 4MCZA 3QEQE 3QWOB 1N8ZA 2E27L 5KSUB 3NFNA 4XP6H 1NC2B 1CD1A 4G9FA 3C60B 4JQXC 4HIEA 1EH9A 1JBJA 2AK4A 3EJJX 4OBRA 1KPUB 5JPNB 2YN5A 1FYTD 1IBGL 4JFQB 4XNYL 1MIEH 4HUKB 1WF5A 5I6XC 2ZP0T 5DJDB 2H2PC 4YC2B 4HEPG 4NKDA 4FZEH 4ONFH 5EZLA 2CIIA 3V5DB 2QKIA 1ES0A 5D7LD 3EFFA 2P5WB 4PV8A 4QOKA 4EVNA 2HJFA 2H26A 3K2UH 4L8BA 4WWKD 3RA7H 1KYOK 5B8CA 2DJUA 4DZBB 4ETYA 2NY1B 3GMLA 2PCPA 1ZWIB 5E6YA 1KLGB 4OM1H 3BSZL 3X13A 5JOPE 4ZFOB 1V7NL 1Q1JH 2XNAA 1UXWB 4FZEL 4HS6A 4NWUH 3C09C 4LVHC 1S9VA 1K4CA 2XQBH 4HD9A 1G7JA 2ZUUA 4ODUA 2BK8A 1LO0H 4N68A 3RBGA 3S98A 5GZND 3SCMD 4EI5C 4NO2A 2C9AA 4XVTL 1NL0L 4LLYA 4WTXA 1RHHA 1U8KB 2J8UA 2QQLL 3QXUA 1U95A 2F5BL 4P3DB 5KBNC 5FM5O 3WNKA 5F9DC 3GSWB 4YHOH 2ZCKH 3ILPA 1NFKA 2RCSH 3MV8D 1RUML 4Q9RL 1V3JA 4R97B 12E8H 2R1YA 5EUOB 3LEXB 2BC4A 4APQA 4M5YH 1B2WH 3SDAC 4X4YB 2FX8H 3RVTC 3WNOA 3VDAA 4D9LH 5C0AB 2X4TA 4KKLD 3LD8B 4XMKL 3N1FC 3HAEH 5ICXA 1FORL 5E8EA 3BESR 3ARDB 5DZNA 3WS6C 4XVUD 4H0IA 2IMNA 4EEEA 1XF5A 1JZ7A 4HWZB 2ZG2A 3JUYA 4GUPB 1T4KA 5GS2H 3IVKB 4OLYL 4W6XB 1U36A 2CMRH 1MWAA 2OTUA 5JORB 1I1AB 1ZSDA 1T66C 2DYPA 3H2WA 2R9HC 5DQ9A 2UVEA 1M71A 3VFVB 4OSUL 1CXLA 3S6CA 1U8LB 5JR1H 2B20A 2WQRA 4CADB 1IGML 5I30L 3H3PH 1EMTL 5HGDB 3VH8B 4Y1AA 1CFVL 1JYVA 3ZKMC 1TJHL 4WFGD 5A1AA 3MXVH 2FX7H 2JIXB 3I6GB 5C92A 2I60L 3TLRA 3T2PA 4P5MA 4LHJB 3ZO0A 1BFSA 2MPAL 5HHNB 1MCPL 4NZTL 2VLJB 1S5HB 4HGMA 1RUQL 4JGMA 5MEOA 3W0WD 3VGAB 4R4FH 5DMGD 1A7NL 2CKBA 4OFPA 1WEJH 1SJEA 3MRBB 4NO0D 3VXUD 1IJ9A 3H0TB 2R0ZH 3QUZC 5DD0H 3H3PL 3TCXA 3PJSB 1N59B 2YSSB 5HHPA 5CJOL 3BQUA 3UTZB 5C0AE 4JM2B 4OZIF 2XY2A 3CDGB 4RBPK 5C0RH 3L5IA 3ULUL 4U1MB 1QFWM 2X5PA 3Q5YA 4KPHL 1YMME 3J8F7 3MXWL 4KDWA 4MA3B 3X14A 4ZUWB 2OK0H 5KJRH 3MZTA 2NX5D 1XGPB 2M1KA 2EYSA 4JN1L 3MRNA 1LK3H 4PJIB 1ZGLB 1G7IB 4M7LH 1MLCA 3BPCB 1A1OA 1ZV5A 1DN2A 1QVOA 2HJKA 1DUYA 4AT6A 5BVJB 4OI8A 3OB8A 2FWOB 1TVDA 3EYFB 3P30H 2NY5C 2R0KL 5I1GL 1C7TA 1H3PH 4LSSL 3F62A 4H88L 3G6DL 2APBA 2DQCH 1E4KC 1KJ3L 2XZQH 4K23H 4PJ8D 5C0NC 3E6FA 3HMXA 2F5BH 1P1ZA 1CIDA 1G7HA 4Y19D 5IM7A 1QYGL 4WUKL 2IQ9L 1VHPA 2HH0L 1INDL 4HWBA 5IKCB 2APFA 4YIQA 1Q9OB 2FCBA 5L2JA 3WKML 1YPZE 3C5ZC 2CR6A 3CSGA 3DJ9A 2OS7A 1CICB 2X09A 1YYLH 1S7UB 4PGZA 3C5ZA 4S1SL 2P49B 5FYKU 3MOAL 3CZFA 2CGRL 1NAMB 1FN4B 4YHPB 4GKSA 3D3VB 3FQTA 4F7MA 1FORH 2HLFC 2CLVA 3FQRB 3C6SA 5JXEA 4LEOB 4ZS6D 1SYSA 2V5RA 5CZXC 3TIEA 5BS0E 4UUJB 1CTNA 3JV0A 5CBEA 3H9ZA 5FO8B 3VXOB 3ZHDA 3D85A 4XBPB 4LOUC 1ZTXL 4JLRA 1KIUA 5JTWA 4OIIL 1QSFB 3VXSD 1C12A 1ES0B 4H5SA 2HT3C 4M62L 1ND0A 3I50L 3MRHA 3VI3F 1B0WA 4PJHA 4Y0GA 4HQQL 5D2NA 1Q9LA 3ROOA 4TUJA 5FK9B 2J5LC 4L8SC 3ZLQC 3TZVD 3O81A 4RGMB 5E9DD 2EIEA 2OJZH 5DK2B 3ROLA 1OB1B 1I4FA 4PGEA 3WSQL 3VRLF 3WCYA 5EO1B 4CVXB 2F54E 1FFNA 4H26A 3KJ6H 3KPLB 3H7BA 1VFUA 3OMZA 4LAJH 2DLFH 3O6KL 1C5CH 4GQ9H 4DVRL 1AO7B 1FJ1B 4J6RH 3BEWA 3MUY1 1A7PH 9CGTA 1HHKA 4R7DA 5C0ND 3VFPB 4N9GA 3DIFA 3Q3GA 2BNUA 3QUML 1R24A 2FL5A 1EJ6A 3UJTH 2GK0B 4JFFB 3L7FA 3QCUH 2ZUSA 1A7QH 1G7MB 4BFIB 5IHLB 2PO6D 4WCYH 4EDXB 4K71C 3MMEB 3BWUC 4P3WA 3QHFH 5IG7A 1MHHB 4Y4FD 4NQEA 1LEKB 2HKFH 4N1HB 4QCIA 3F7VB 2VABA 3MUJA 3QDJE 5GRYA 3TFKC 2XN9B 3GBNH 3GI8L 1GGIH 1HQRA 4NC1C 5C3TA 2D31A 1XGQA 4YXLH 5GJTL 2GEEA 4M93C 4PREA 5CILH 3TO4A 5DXWA 4XI5C 4JM4L 5M95B 4HWZA 3SJVE 4M6MH 5SWZA 1R3KA 1TQCB 3IDMA 4X99B 3V6OC 2DQTL 5FCSH 5IJVA 4E5XA 2W59A 3MFFA 1XGUA 4Q74A 4BK4A 2BY1A 4MCYB 5B8CB 5BMFL 3ULVD 1PG7X 4HXAL 4G6ML 5ILTL 4YBLC 4MQSB 1W72A 4HGWB 4OCNC 5HGDA 1MHEA 3RKPA 3VH8A 3VH8G 3BPOB 1WTGT 1G7QB 1YJDC 3GSQB 4LCYA 1DBAH 3I2CL 3OX8B 4LL9A 3DV4A 1J1XL 1S7SA 1IAOB 3FKUS 1R0AH 4GW4A 3IGAB 4LHQB 3JTTA 5TE6L 1TZGL 4LRIA 3DHJA 1DJSA 4GAGL 1XCTB 4NO2B 2LFGA 4N0FA 2VLKE 3O4OC 3OGOE 4ISVB 5IMOB 3WHE0 5BMFH 1XR8A 2VMFA 5LVEA 3RNQB 2EZ0C 1B0RB 4I18A 5CWSB 3GMMB 4KH2A 4X7TA 1NFDF 5DURB 3LEXA 1TNNA 2GITB 4PJEE 3F58H 4XI5D 4PLNC 5K9OA 3I3EA 4H8WC 2V5MA 4XVUC 3UCRA 4G9FE 5I15H 2OCFD 4YDVA 3RWDA 1SJHB 4OI9A 5KZCB 1Z9MA 3O2DH 5EFIA 1AKJA 4IEFB 4LQFL 5E2UH 2CMRL 2G2RB 3V6ZB 5F6HI 1A21A 3OKOA 4F80A 1YQ2A 1OD9A 1MLBA 1OAXH 4WI2A 4K2UH 2VDLL 1HYSC 3WN5A 2DI8A 1A7PL 1QZ1A 2ESVB 2VIRB 2AXGB 5DMIH 3IU4H 4EI5D 2YD4A 1HOCB 3G6JB 4HXBH 4F7PB 3U82B 4PD4J 4JFFE 3WO3B 3OKEB 3V5KB 4K3DH 1NC4A 2IC2A 3VXUE 3IDXH 2FD6H 4BJLA 5AUMB 3PP4L 4FQHA 1JWSB 2PXYB 4PJCF 2GJ6D 2LU3A 4XNQB 3VFRB 2XA8H 1G6RA 4JFOB 4J8RB 1HNFA 4BQCA 1UJ3B 3HNVH 4ZPTA 1OSPL 3SGKC 1JHKL 3PJSA 1S9XB 3FQTB 1AIFA 1U3HB 3BQUB 1J0ZA 3NPSC 2JJSC 4CUCA 2VL4A 1RJZA 2VLLA 3DSNA 5KVEH 5KN5B 1DSFH 3WO4B 5T3ZH 4OCLC 4FTVE 1TTUA 2OXHA 1E0OB 4WWKA 2DTML 3REVB 2ZCHH 4HJGB 3D48R 2UZYB 1UB5A 2GHWB 3REWA 1KN4H 5HHQB 3U6RB 1NC2A 3QEHB 2CGRH 5I1CL 2ZJSH 4HIEB 3LN9A 5JPNA 3FOLA 4HHAB 1WLHA 3N0PB 4KJPD 2Y7QA 3TBSB 3SJVB 1QLFB 4XAKD 1KJ2H 3PWNB 2UZXB 5IWLA 1KJVA 4NNYA 1YEEH 1DP0A 2QL1A 1PKQE 4OLZH 5C0RL 3HKFA 4U6VH 3MNWB 3RWGB 3ARVA 1ORQB 3C6LB 1IGIL 3VFTB 4A6YA 5CP7A 3JTSA 3QDJB 5EZIL 4OGXH 4EBQL 4UIKL 3MV8E 1INDH 1A6UH 1J0YA 3HFMH 5JXAL 5GGVY 1XGRB 1P7QA 1OARL 1VKXB 4K94L 4QTIH 1CICA 4J3UA 1P5UA 2XWTB 3C5ZB 5D72L 4F7CB 1HNGA 2X2YA 3PGFL 1CICC 1VEPA 1IC4L 5DJZA 4BSWB 2YPLD 3RL2B 5J0BA 3RVUC 3SY0A 5FA3B 3A0OA 2BFVL 1M6OB 4KTDH 4OLVL 4YDJA 3S88H 1KBGH 5KVMC 4M1DH 1H3GA 4GKNB 4ZAKD 1M7IB 5IMKB 1HXYA 5BV7L 4MAUL 2BNQD 3HE6B 4JCMA 3UAJC 3IETA 3QZWG 4F7TA 3RVXD 3BXNA 3B2VH 3GSNB 4HK0B 4KPHH 4J3TA 1K8DA 5C0CE 1F45A 5FHBL 4LSUH 1JNLH 3ARYA 4CKVX 4JDZA 4U49A 3VFNA 3BMVA 1JV5A 1FVCA 1PX3A 3OAYH 1HQRB 4XPAH 5EBWA 5D7LE 1N0XL 3L5WA 2BVYA 1EO7A 2R4SL 4G8GA 4J23A 2ZOKA 5K9JL 2OTWA 3KPRD 4MAUH 3QIBA 1AJ7H 1SBSL 2HMID 2GSIB 1AGEA 1IQWL 2GCYB 4E9LA 1MQ8A 1G1CA 1EZVY 4IRSD 4B7IA 4HWBL 4WY7L 3AS2A 2GW5A 4EKXA 5B38B 2GK2A 3QXAA 2R2HA 1RZKH 1S7TB 2NPLX 2PYFA 2VRAA 2NY4B 1MFBL 3TYFA 1I4FB 2DDQL 3LZFH 3MUGA 3GSQA 2NZIA 1IEBB 4ODBD 2LVCA 3LQMA 4CBPA 4Y4HD 1U9KA 3HMXH 2IADB 3RWIA 3JTTB 1UGNA 4EBQH 1KTLB 4QHLA 3P73B 1IGIH 4ZSOE 4FQQA 4OSUH 5F1OB 3QIUB 4N0CD 5K93A 3MJGX 4JCLA 2BVEA 5I19H 4E41A 1UFUA 2CRZA 4QHMB 1WITA 4LCCB 1XF4B 2BX5A 4LVNB 1G7MA 3I02A 4HKJA 5D1XB 5F3HB 2EKJA 3TZVB 3O4LD 3MLUL 2EECA 3DV6A 5DSCB 3MSPA 5D7LA 4X6EA 5SWQB 4A6YH 4KKAD 2VABB 1A7OH 1D5ZA 3KLAB 1HHHB 1HSBA 1KCLA 5EU5B 5ADPL 5HGHB 5LCVL 4IMKA 4L4TE 2OR7A 1NLBH 3HMWL 4HUUB 3MRPB 1ETZA 4JHBA 1BD2E 4WUUB 3GSOA 1A6VH 2JKXA 2NTFA 1I1CA 5IFJB 3LV3B 4G9FD 1ZT7A 4YNYB 2W0FB 3HE7D 3BWAB 4LSUL 4XNZC 5ICYB 5HPMB 4JPWH 1FYTA 3ABZA 3V6OE 2LAGB 4WFEE 1CDIA 4TPRL 4CNIA 2R1XB 4HW6A 3BKCH 2CSPA 3L7EB 1K3ZA 1I1AD 3DMMA 1HOCA 1KBGL 5I9QC 5BRZB 1I9IH 3MYJA 1QP1A 4X5WA 4GMTH 2KL6A 4JFDA 2EYTB 4GLRI 1CFBA 4BZ1L 1JF5A 2CRIA 3NCJH 4D8PB 1G7PA 2XZAL 4ZFFB 4R7NA 4X8JA 3VFSB 4NUGH 4APQD 1PW3A 1F3RB 3F8UB 4WO4A 4M5ZL 3STLA 2KBGA 4Y4KB 2AJZB 3U7WH 3FT4A 3U4EA 1F8TH 1VA9A 2VLJE 1ZVYA 3WUZA 5F96L 3GHEL 1BEYL 1LDSA 1NAMA 4YHPA 2VR5A 5EZJA 2AEWA 2ITDB 1JZ2A 4G8FA 4X83A 5JLZB 3RWEB 3UBXI 1Z9LA 2BOBB 2EH7H 1AKJB 5CZKA 2DYPD 4W4OA 3UTOA 2C7UB 1MUJA 5F7KC 5GS0D 3WDJA 4S11A 4FFZH 1RZKL 3T2OA 4DN4L 5GS0L 1I8MA 4KVNH 4KKBD 1JRHI 2AJUL 5AAWA 1MEXL 3EYVB 3ZE0F 4LDOB 4XVSH 4OLWL 3OR6A 3EZ8A 1T83C 1MLBB 4UT7H 2F54A 1FO0H 1NBVL 5D71H 1RUKL 5C9JB 2FH8A 3O11A 5KW9L 3VFMB 3E2HB 2R1WB 1Q9WA 1T7ZA 4GKZB 1ADQH 3SPVA 1UM6H 1JHKH 4GRWH 2JCCF 4RMSA 2OJEA 5INDA 3GMNB 4TOYL 1BLNB 4KQ4H 3MBEB 4U6YA 2G9HB 3BIBX 3K4ZA 3KYKL 4JDVA 1WBXB 1RIUH 4RFNB 1UKTA 2AV1A 4KI5F 5DJZB 5E4IA 5KVGL 4O02L 3SKNA 1NKRA 3FOMA 1UJ3C 1MAKA 1Z6JT 3RAJL 4ZYKA 4ODVL 4UNUA 4LLDB 4NM8H 4UV4L 3GI9L 1NCNA 4QRTB 4NQEE 2J88H 3HR5B 4XC3L 3CFBB 3BKMH 3VXMA 3CFDA 2E7LA 3IETB 3O6KH 1AFVL 3PQYA 4IJ3B 4R7DB 4F7TB 3NCEB 1FDLH 5DUBB 5D2NC 2YBRA 1AXIB 1OAZL 2EDNA 2BC4B 4APQB 1IAIL 3EAKA 2Z9TA 3LKNA 3PV7A 4CL7A 5JDSB 1K4DA 3BPNC 3GRWL 4M9PA 3RIAF 3GIZL 5C9KA 3AC0A 1IKNA 1FL5B 4GXUM 4FFYL 1CLOH 4PY7B 2QR0A 4GAJL 4G42B 2JB6B 4PRIB 3V52H 4QRQB 2J4WH 1DQQB 4DGIH 3U7AA 4WCYL 1BFOB 1E4XH 3GIVB 5SWSE 1DBAL 4JHWL 3ZSSA 2H41A 5EN2B 5ACZB 3BGMA 3U4AA 3U0PA 5JPMB 5E24E 4MS8C 1RK1B 4KK6C 1JF1B 5HYJA 2DYPB 4PJ9C 4OZGF 3CSYA 4NOBA 4PRDA 1T7YA 3CCHB 3LQZA 4Y1AB 2ZSWA 1QBMH 1QRNA 2Z8WC 4DGYL 1FFQA 1MFEL 4Z7UE 5DD6A 5C07A 4D9QE 1P7QB 2RQ8A 4LSVL 5L9DH 2PW1A 1KB5B 1CR9L 4UT6H 5AEAA 4CVZA 1S5HA 2W07A 3DMMC 1FCGA 5IBTL 3MLSH 5CZVL 1A5FH 5CAYB 2IG2L 5HVHC 1DN0B 3TBTA 5F7FA 3CNKA 3IU3A 3D85D 4LCCA 3B9KB 3V6BR 2UWEB 2Q7YB 3LQAL 2H8PA 3MV7B 3BXNB 3C9NA 1J18A 1UWXH 3HHRB 1HEZB 1DCLA 1FO0B 2FJGB 4PJDA 4PRNA 3TVMD 1F4WH 2IFFH 1F02I 1ZA3B 1EFXD 1WCBA 4LRNL 1YY9C 2MSPA 3GUTB 4Z0BL 3OSKA 4RWHA 5SWSB 3RVVC 1SEBB 1QLRA 5DA4A 5I1IL 1D9KB 5EOTA 2WBWB 4D0CB 1OT1A 4X6FA 4YPGB 3MRPA 3DTXB 2L0DA 1IC5H 4MJ5A 4QXGL 4CN4A 3LY6A 4G6JH 5EIQA 1FPTL 4LCUA 2WUCL 1NUFA 4PJ5E 1D3CA 1M4KA 3QIBB 2EH8L 5E5MA 3BWAA 1JPSH 3ESVF 3L3KA 4MWFB 4KMQA 4JE4B 2GCYA 2CKNA 4JN2A 3CLFH 5EIIB 4ORZC 1DBML 3EYFA 5CSGA 2IFFL 1SEQL 3ZDZE 3RJQB 2Z8VC 3SKOB 2E6JA 2R1XA 3W9EA 5FUCC 2QADD 5IJKC 2P43B 5ITBH 3UYOD 2VE6B 4U1HB 5EU4B 5F3BB 3T8XB 5B4MD 2DF3A 2Q6WA 3O3EB 2A74B 3WL9A 5LBSL 4PJ8A 1YN7A 3RX8A 3MC0A 2KZ1B 4MDIA 2Y25A 5EU7E 2CIKB 4KJQC 4OM0H 5BVPL 2IH1B 1LHZA 5I0DA 4TUOB 5GRVL 1X5KA 3PGCB 1SBBA 2ESVD 1P84J 1YEJH 4XP1L 1U8PA 4HFWB 4UILL 5FF6B 4Y16C 4PR5A 4MXVF 5FGRA 1U2CA 2JK5A 1CVRA 5HY9A 3P9MA 3AY4C 5ELIA 2DQGH 4NQCA 5C0BD 2EDEA 4G8FB 2G75B 2XOTA 1B6DA 1RJZB 3ARTA 4ZUTB 5DFTA 2XWBA 2ICWI 1BJ1J 2ADIA 1VPOL 4MVBD 2J12B 5SX4I 3S35H 4HXAH 5JR1L 1N2RB 3EO1A 1S7VA 1KXVC 2DQTH 5TDOA 3P77B 5GSVB 1FYTB 4LBEB 4QRPB 1Z0MA 1E27A 4BZ2H 5IVXB 2MCG1 3IJHB 4QY8A 3KYMA 5SWSD 3GI8H 4R4FL 4EN3D 3VWJD 3VRJA 1FSKB 4K8RH 3MYJB 4JRYB 2XTJE 4EVNB 4X80H 1A8JH 2Q7NA 1P5VA 4AM0A 3UJJH 1XGTB 5DC4B 5EZIH 1FG9C 3KPLA 3D18A 4FQLL 3S96A 1BFTA 1URLA 2F53E 4XWGL 2Y4SA 1PZUB 1KGCE 3MXVL 4ZFFA 5F7YC 4XCYB 2NY3B 3MRDA 5I30H 4WW2A 4MVBC 4NQED 1QNZL 4YR6B 1A6ZB 2PYEB 3NTCL 1N5AB 4UDUB 4P9MH 4NQCE 4WFFE 4NKOA 4K07A 5AZ2L 4P2CG 3WE6B 4MXVE 2VXSH 4Y4KC 3U4EB 3T0BA 5HYSB 2HTLC 2YKLH 2FO1A 4NNXB 2GT9B 2CXKA 1OAUL 3O6LH 3WUWG 3PQYB 2J8UB 4XC1H 2HAZA 3B5TA 2YWZA 5BZDA 1XMWA 2KUTA 1F3DJ 4F8QA 5SWZD 3C2AH 2Z31A 4KTEL 1ERNA 3GSNA 4HK0A 5I1AB 4NOFA 2PW2B 4GAGH 3W0WA 2YD1A 3QULB 3R0NA 3MLUH 3OQ3B 4NKDB 1QTYT 3DNKA 5GS3A 5IBUB 3N1QC 1NEZA 3HAEG 1RK1A 2A77H 4H20H 4FP8L 3NOIA 1C8PA 3MR9A 2P5WA 4PV8B 5TE4H 4V1DD 4R3SA 3IVKA 3LQZB 1E28B 3FJTA 1SYVA 15C8L 3CK0L 2AS5M 3UJJL 4GAJH 3PGDB 3JV4A 4LIQE 2YD2A 2WWMC 4BH7A 4H8WL 1AGFB 4K8RL 1BJ1H 4NN5C 5DHVH 1OAYH 3VD7A 1LNUA 4DKAA 4HG4J 3GZKA 3U0TA 3A67L 2F8VA 2W9DL 4OB5L 4U0QB 3SKJL 3TYGH 1M05A 1YDPB 4QXGH 3P4MB 5DRXA 2YK1L 4HUMB 4M5YL 4O51A 5HHNA 5D96C 2WBKA 1YY9D 3BKML 4HJ0D 4NC2B 4QRTA 1N6QH 4MD0B 3SE9H 1MJ8H 3L3OA 1UCBH 1A6PA 1MFNA 1UQSB 3BD3A 5ANMB 4P5KB 5IFHH 1ZEAL 3NFSH 4ZXBC 2AXFA 2GJZA 4EQ2A 3BP6B 3FO0H 3EBAA 1BVKB 1T89C 1VFBA 3TPUB 5BZWB 5DJ8A 5CBAB 3RZCB 5F7UA 5HDQL 2J6EA 5CUSH 1DQQA 5JQ6H 4GRWB 3BD5A 3SEPA 4LCUB 3BDBA 3FB8B 3NACL 5EN2A 5DRNA 3L5XH 4NIKB 1W0YT 2HKHH 1T1YA 5C0CB 2NY5H 1I9RH 5IHUH 1PGRB 4JY4B 2VNCA 3M17A 2LE9A 2FZ3A 4GH7B 1GGCL 4DGVL 1D6EA 1QBML 3VI4F 1OQXA 2IAMA 1DVFC 5CGMA 1CGSH 1FRGH 1J1OL 4RIRA 3KPPB 2VC2L 1B90A 4MNQE 3W9DA 5C6WH 1MRFL 2XKUA 4OF7A 1G84A 1A6WL 1C08A 4MXQD 1R5VA 2E5EA 1H5BB 2VZOA 2NX5A 4HUWB 2DRUA 5AZEH 4K3JH 1QRKA 1LD9B 1YZZA 3DVGA 3QH3B 4QHNA 2N4IA 1FP5A 1TVBA 1NCAH 1G6RB 3VI3E 3MV8B 2ID5A 3UJIH 3QFJD 3BPLB 5EUKA 3HC3L 4OKDA 5I75C 1RZGB 2BRRL 2AXHA 4GBXD 1RZ8B 2H2SD 2FJGA 1MFBH 3MRCA 1CLYL 2NXZD 2JK5B 3KR3L 1FDLL 5LGJA 1YEIL 2OX5A 2DBJA 3H9SA 4NYLB 2CUIA 1N64H 3G5YB 3QDGD 5J11C 3BP7B 4ACPA 1XIWD 4D0CA 1DUZA 3KPOA 1G6VK 1T2QH 4Y2DA 3AREB 4R8WH 3U6RA 1F58L 1PAMA 3P4NA 3BYTA 3VGBA 1MVUA 1ACZA 3IJSB 1ZHLB 3IDJB 4C83A 3BVNB 2E7MA 3O3BB 3WJLC 4Q6IA 4TPRH 4WTZG 4TUKL 1I8MB 3JWNC 4MJ6A 3LS5L 1NUNB 5HD8D 2X70B 3TVMB 2HRPH 5E1HB 3HUJA 3QNXB 4ONHB 1JPSL 1MNUL 3KJ4C 1SVCP 1UWGH 2AGJH 3RWHB 2FWOA 3VRJB 3WS3A 1OW0C 3UTQB 1KCVL 4MJIA 4Z76B 4QRPE 1MCOH 4WEBH 4M1DL 4TTGA 4JFEE 4EIZC 2ARJQ 4Y2OA 4L29A 4HKZB 4YDIL 5HHOB 2YRPA 3CFJB 1IAMA 4IMLA 3KPQB 3AS1A 8FABB 3QAZB 4OD1L 5C08B 3RIFK 3VXME 4P2OB 3FN9A 5DMYA 4FHBD 4U6HB 1UACL 5HD8C 4PGEB 3OG4B 5F89A 3WFHA 4K94H 3M1BA 1N5AA 1RIUL 2DM2A 3VXQA 1K5NB 4FFZL 5FECB 3MPCA 4MSWB 4L1HA 4C4KO 5HYSA 1TQCC 4MA7H 3U9PL 5CEZD 3R0MA 1HHGA 2GT9A 3MLZL 4OGAC 4HIHA 3HE6A 4JG0H 1IRAY 2W65B 3MUZ1 4RNRA 3IFPB 1R3LA 5DT1H 3QRGL 1RK0B 3HR5A 3ARFD 5GRUH 2EXYD 1T0NB 1NBVH 3BZDA 1YEDB 4RAVB 4HPYL 5DVKA 4YHMH 2UVFA 3VXOA 4Z78A 2D9CA 4O58H 1DTUA 1S8DB 3F6IA 3TJHD 4ZUUB 2OL3L 1BIHA 1AGEB 3WNNA 4QF1B 2IFGA 3BO8A 2WSKA 1DANT 1YEGL 4UDTA 4F33A 1AQDA 4AH2A 1RJYB 5C0EB 4YAQA 3VG0L 3U4BH 2YMXH 4DZ8A 3HNTL 1Z0NA 3ROOB 3MNZB 1JF1A 4YHLH 2C3WA 5F9WB 2CK0L 1KCRH 2DIBA 2GTZA 2FX9H 4YWGH 3DRQA 3LS5H 1DVFD 5J1AA 5JW4R 1WC7A 3CCHA 1E6JL 3SDAB 4WHDA 1KTLA 2CJUL 4LCYB 4AQ1B 1OP5H 1M05B 3ZL4L 5CSZB 1GPOH 1JE6A 3QDJD 5TQ2L 2ZCLH 3N1MC 5T33L 4PJDE 5LQBH 1T7WA 2ATKA 3CFEA 1HHKB 2O61A 1AXSB 5AG9A 4DCQA 3ZDXF 5DMIL 1NFIA 4KJWD 5GGQL 3BH9A 4P0DA 4IM8A 4WVRA 4PJXF 4YHOL 3B9KA 1YYML 1FGNL 1HI6B 1IC7L 3T4AB 4FG6C 3GMMA 3MMEA 4U1SA 3WJJC 1MI5D 3OR7A 1NL0H 5IG7B 5BZWA 2XKNB 1CTOA 5FHAL 5F9OH 3T4YB 3BT2L 3I6LD 4N8PA 3GSOB 4LP4A 1QR1A 4L3EE 5KSBB 4HK3N 3ULVL 1GVIA 4LPCA 4Z7QF 4PJXA 1A7QL 4M48L 5IMMB 3S4SA 3OV6A 4M5ZH 4Y4HA 2Z92B 5DQJA 5CCKH 2V5TA 5D6CB 2W38A 5T1LB 3WDIA 5I1KH 1NSNL 5E5MB 4K3HA 2Z35A 4D0DA 5GGVL 3QDGA 2M26A 1MCWM 4Z5RA 1YECL 4HKXB 3RP1A 4JN2B 1AC0A 4OKVA 5FYJL 2HMIC 5CINL 1OTTD 1SM3L 2ICWA 3HPJB 4KK5D 3VXMD 3A67H 5D70H 2HVKA 3IDGA 3LPFA 5C0DB 5HSFA 3FN3A 2PR4H 4U7KA 5K9JH 3W81A 3ZMRA 1RIVH 1WFTA 2VDQL 4NO5A 3DX6A 4P23B 4MAYC 4E42A 3L95A 3VD5A 4XHJD 1R3HB 1A7RH 1WVZA 2OMBA 4YK4B 3V5HA 3CSBA 3UTTA 4OZ4A 3LEVL 4RFOL 4R4BB 2CIKA 2EE6A 1XR8B 3TBWA 3NABH 3NFSL 5EC1A 4OF0A 3EOBA 1FNGA 2EXYC 5ILTH 1Q0YL 2VSCA 2X05A 1F4XH 3HRPA 1QHPA 4YX2L 3C2AL 1YMHB 1H0DB 5CBAA 2O26U 3BHBA 4Y5XA 2Z31C 4LP5A 4AENA 5KSUA 3GSVB 2HFGL 43C9B 1ORSA 5ITFA 3C8HA 2G75A 5L7XL 1LP9A 5MEND 4MXWH 2YKLL 4PJAB 4ZUTA 4Z9KB 3F7PC 3RHWF 5CKGA 4M6NH 3S37L 2VWEE 1CL7I 2P8LB 1U8QA 1WZ1H 3B9DA 3EO1B 4XNXL 5EZLB 3QQ4A 4IRJD 2VXUH 1MY7A 3LAFA 5HI4C 4P5TB 5JIPA 1I8KB 1X3DA 3O9WC 5E99L 1V8HA 4NQUA 4TNVF 5INCA 5CHNB 2HJFB 1C7SA 1U8JB 3NBNA 4XPTL 3KXFD 1XZ0A 2NW3B 3ZKND 3TN0B 4FFWC 5D7SH 5HI5D 1IQDB 1LVEA 4HT1H 4YEEA 2RJMA 4LLVB 5CINH 4P49A 1OF2A 3L6FA 2R0WH 4ODXA 2W1NA 2VB5A 2C4XA 1QSEB 4NZJA 5I73C 1SBSH 4OCXL 4FQHB 4ZYKB 2BNQE 1JWSA 2PXYA 4EUPB 1TJIH 2BXYA 5BRZD 2IPUG 4MSWA 3MRCB 2JJSA 1GZQB 3VXMB 2PYEA 4UDUA 4WWID 1B4RA 5FA3A 3H9SB 2X4OB 3UC0L 1TZIB 2H3NA 2NW2B 1JNHA 2F54D 3BGFB 2J5LB 2V9TA 1TVHA 5DJAA 1CGWA 1EAPB 3BIKA 5E8NB 5T3ZE 2VDRH 3WFEL 3QG6B 4XCEB 5IV2B 1VDGA 2GJ6A 3HZYA 1WZMA 1GJIA 2C26A 2GUOA 1WTLA 1DBBH 1SY6A 5CJOH 4NQVA 1XFPA 1NDGA 2BY3A 5ICXB 2HN7A 1BFVH 4E0RA 2FB4H 4P2RE 4HWEH 2DTMH 4MXQC 3TH4T 4OF3A 5D1XC 2P5ED 4LLAA 1ZLVK 2AQ1A 3ZYIA 3WLWD 4EDWL 3QUXC 1RZIB 4K2UL 1LDPL 4G6FB 1KJ2A 1T0MA 2VDRL 3WFEH 1MCPH 3MACL 2XIDA 3TCLB 2EC8A 1KXQE 5C08A 1T1WA 5MP6H 3JZ7A 4L9LC 4HGKC 1YEEL 1G7LB 2XV6B 2FBJL 2FJHA 2V9RA 1BHGA 5FECA 2B0SL 4BM7A 4TSCH 2KZWA 2NY3D 2VTFA 3MYZA 3ARWA 4XNZB 3T0EC 3FQUA 3QPXL 4LCWB 5H2BB 3TGXA 3I6KA 1EAJA 2R0WL 2W9DH 2GJ6E 4OB5H 4QHMA 1E4WH 1HXYB 1RK0A 3RWJB 3VU2A 2M8XA 3UP1A 4TQEH 4QTIL 2XG4A 2XXMB 4G8IA 4M4RA 1PQZA 1PLGL 3T4AA 3TN0D 4YO0A 5HHPB 4KVCH 4YXHH 4N8CH 1QOKA 1CGYA 4MD4A 1K8DB 1D9KA 1S7XA 4HS8H 4X4XA 2J6EL 4NBZB 4KU1A 5DVOA 3ZKXB 1NC4D 1TCRA 3O6MH 5DJCA 4ZPVA 4P46D 1NAKH 3H9HA 3MRIB 2H32A 1VFBB 3TPUA 1JPFA 3FRPA 3HPLB 4H20L 3RUGF 3RZCA 3QUYA 1P84K 2C4FU 2XXCB 5TDNB 1JWUB 4BKLB 2B1HH 4G8GB 5T5NG 5DRNB 1UB6A 2OMNA 4YNYA 1DLHA 3ULUH 3ULVC 1VACB 1T1XB 3GGWB 1MPAL 5ICYA 1LE5B 3ARFA 2AV7A 3CLEL 3PDGA 4LSPL 3VFVA 4ELKB 3VXTA 1IM3B 3MRLA 3O3EA 5DEGB 4FQIH 1WICA 5ESQB 1TPXB 2YUWA 32C2A 4PLKC 3CXHK 3WXVH 2AGJL 1WV7T 3TNNA 5D1ZB 2WZPD 4OFDA 5TDPA 4HG4K 4CJ1A 3V0VB 2FJFB 3VJ6B 1EVUA 3LN4A 5F88B 2YOCA 3WUWA 4E41B 4LKCB 3H0TA 1UH3A 4O2CB 3I02B 1N59A 3C08H 2PR4L 2X42A 4HAGA 2Z93A 4KRPD 5MERB 4OZFH 3MODL 1JHTA 3FB7A 1BZ7B 1QEWB 1TITA 2EYRA 1UWEH 1LO3H 3OJVC 1YUHA 4JFPA 3QNZA 3PP3H 3KPRE 4QXTA 5C0BA 5KOMC 1MOEA 2BOBA 3MCLH 1AR1C 2Y9RT 3QFJE 1YEIH 5IB4A 4LFHD 4I9WE 4J2XA 1WWWX 4GT7A 2NXZB 2P8LA 4R9HA 3KJ6L 2DQJL 5IFJA 3WIIL 1G9EA 1QRNE 4P99A 3QDGB 5D7KD 3GFUA 4F58H 5KVDH 1EEZB 5D2LF 4NO0B 1JYNA 3NVQA 4I0CC 2P24A 5LAXB 5J6HB 3CZJA 3TVMA 3CFKA 3PUCA 1MNUH 4PTUB 4Z0XA 1YJDH 4K3JL 2QSCH 4OCWL 3MGTB 3VXNB 4HC1A 5I8OL 5ICZB 4PGDB 3QSKB 1MI5B 4TULH 5C9JA 3LQAH 3SKMB 4UQ2B 1W0VA 3WS3B 3DSFL 4GRLC 4JO2L 1E4XL 3SPVB 1OF2B 3L6FB 4KKCD 3VFGH 1A7RL 3QHTC 1MCCA 2A0LD 1TENA 2QJDA 4C58B 1CFQA 4ZOBA 3ME0A 3SE3C 3OWEA 4XH2A 4NM4H 2PCPB 2VDQH 3BZFB 3GMOB 3EKCA 4R7NB 5ALBL 5C7XL 5JOFB 1GGUA 4NQSB 2AJVH 5GGTL 1S7RB 3MLTA 4JY6B 5GS1B 4WRLA 1RURH 3CZFB 1BQLL 5GJTH 1I3GL 1A7NH 4FXKA 4WI6A 5DRWA 2GYSA 1EK3A 4OV5B 1T3FB 4OFIA 4XVSL 3FO1B 3RWCA 3K1DA 4PJ5D 4LDLB 2Y06H 3CFBA 3DVFA 3T3PF 3GSVA 1GGYA 3QHFL 4LLYB 3BDXA 5GGRY 4XAKE 4NQDE 1U95B 1EVTC 1TJGH 4I13B 1NCAL 4PJAA 1I8LA 4NCC1 3DBXB 1A6TA 4YH6A 1H9VA 1FNFA 4NDMA 3E6HA 4LKXB 4XPHH 3LDBB 4XBPA 2IBGA 4TYUA 3T1FB 1ACYL 1MREL 4LCIH 4OZGB 4WFHE 4Y19A 1OAKL 3O8XD 1N6QL 5KVDL 4F58L 4GSDL 3JWOL 4OZFG 5C70A 1VFOA 3B9KC 1YNLL 1Z3GH 2JCCB 5D1QB 1FBIH 4DAGL 3V5DA 4XX1E 1JMXA 4KRPB 4LF3A 2NQCA 4KY1H 5E8EB 5FGSA 2IPTL 3TCLA 2B1AH 5E8PA 5DK2A 4KK5C 4P9HL 3SDDA 5DK0B 1BFVL 1G7QA 2IWGA 2KKQA 1BBDH 1UZ6E 2OJEB 2R2BA 4PRPD 5IW1A 4BSVB 5HYIA 1HQ4B 3ARRA 4FQXA 3HE7C 4I0PA 5LGHH 2CJUH 5A2IH 2OM5A 3KAAA 4HS6B 4H1LA 4EI6A 3LOWA 4Q2ZA 3IKCA 1S9KC 4PJGA 4U1GB 1NFDE 1FH5H 5J13B 3PHOA 2H3NB 5J12C 3EOTH 2MCPL 4ODWB 4RMQA 1UCBL 4MMZC 3EZJB 3RNQA 2GK0A 4JFFA 4DOHE 5ESAA 2VLKA 4LNVA 2GJZB 3PV6B 5IQ9A 1FZOA 2VQ1A 1L0YA 4DTGL 3MV7D 5JW3H 3MNVB 5TF0A 2P5WD 4XBGB 1XF1A 5D2LE 5DJXB 3SJVD 1PSKH 2OBGA 3PE9A 5L6YL 3UTSB 1QSED 2AI0L 2YSSA 1O5DT 1FAIH 2WW8A 4HSQA 3CDGA 5C0IA 2AQ2A 2XKNA 4Q9BA 5C0GB 4TSBL 1Q8MA 1IGYA 4E0RB 1TETH 2WP3O 4MA8H 1I3UA 4OF8A 1AP2A 5DR5H 4MA3A 3GNMH 4YC2C 4D94A 5ACZA 2NLJB 3QIUC 4B50A 1KN2L 3ARQA 1WSST 3K74B 1QNZH 3A6OA 3JXAA 1LO4H 3ARDA 3OKOB 3TO4C 2IQ9H 4JQIH 5EC2A 1VB9A 4LVNC 3INUL 1CLZH 1MF2H 1NAKL 4YDKH 2ILLA 1YPZF 3WDHA 3ALWA 3DURA 3GRWH 4JO1H 4ALAL 5BVJA 5E2VL 4G80B 1Y6MR 4OKVB 3VXPB 3FO9B 4HWBH 2LU4A 1F6LL 1IZKA 2GJJA 5GGVH 2UWEF 1QSFE 4XP4H 5HBBA 5C0AD 4XC3H 4OZGE 1RZJH 3RVTD 1A3LL 3SDAD 4GRLA 5TDPB 4NQXA 4UAOC 2HFGH 3UJIL 3RAJH 3QUMA 3I6KB 1CT8A 4PRID 1RQ5A 5BQ7B 1JIBA 1MCLA 1W8OA 4LEXL 5EO0B 4LARL 4X7SH 5AAMA 4O9HL 2A9ML 3BKCL 4HV8A 3OXSA 2B2XH 2CKBB 3R1GL 4TN9A 1QFUL 1EGJL 1ZHNB 5MHSE 5DUPL 3BI9X 5C0BB 3C6SB 3REVA 3MA9H 5D7KE 1JWUA 1H3XA 5EG6C 4BKLA 1J1PL 3ELAT 3CAFA 3RVUD 3O6ML 3IDYB 4I0PC 5DD5L 2F53A 4MAYA 3R4DA 4IOFD 4WI8A 3VE0A 4GOSA 4Q6IC 1EHLL 2GAZA 3EDJA 4I4WB 4TRPH 4XRCA 5GRVK 4JZNB 1P7KA 3BN9D 5FOBB 4N1EA 4ODHH 4UQ3B 3WFCH 4CJ0A 5CLWA 2GFBB 5J3HD 1RZ7H 4ELKA 1QSFA 4KTYA 5FGBC 3QDMA 4NBXB 5GHWH 4ALAH 3TT3L 3NIDF 4BQ8A 2W9EL 1S7WA 1V3LA 2MKWA 2ADFL 5INCB 4PJ7A 1U8JA 1YNTA 5IFHL 2ARJB 2H2PD 4KAQL 5FUCE 5F96H 4OIAA 2E9IA 1LO4L 2YD5A 1JUFB 2OZ4L 3X12A 4MQXC 5TH2B 2JB5H 5BS0B 4UV7L 1PEWA 4LMQI 2QSTA 2XWTA 4MQXD 1CDYA 4ZO6A 3CLFL 5DS8B 4HUXB 5J6GA 1R3JB 3G5ZA 4WHYG 4L9DA 1CN4A 3H42L 1RUAH 3NCJL 4X6CA 5LWYL 4P59H 4NC0B 4QRUA 1GZQA 2PF6A 2EYRB 1BQHG 3CSPA 3IXTA 3D3VA 4HWEL 3FQNB 2H9GB 3ARSA 3I9GH 5FYJE 3TWCH 4P2RA 5DFVD 1S7QB 1IC4H 4ODTH 5FYLH 2FR4B 3PGFH 3RPIA 1CLZL 5TPWL 5DJAB 1JPST 4X6CF 4X9FA 1F4HA 2NXZC 3B83A 2X4QB 2HYMA 2OI9C 2PW2A 4Y19B 3WV0A 2GJ6B 2NY6C 5L2KD 1P9MC 3KHOA 4QCIB 3FO2A 4LMQE 2R56L 1Z9SA 4HF5L 4KZEL 4HFUL 5ETUA 5J6HA 3RX7A 3UPCA 25C8H 3MGTA 3VXNA 3WXWH 1DR9A 1NEZB 2ZG3A 4M1CD 5CMAB 4J12A 3RWGA 3TH3T 3HNTH 3QIWD 4Z7UF 1XIWA 3AAZB 3DRQB 3O6FA 1KCSL 4WI5A 1KTKE 1ZT4B 3MFFB 2D0HA 3RZCC 3KYOB 2R2EA 3JV4B 3C5JB 5C0FA 1FNHA 3ZHKA 1YMMB 1LEIA 4NN7C 1MHEB 5GS1A 5EH1A 3TNMB 3H7BB 2J8UF 4FQQB 3GDBA 1EEQA 1TQBC 4X9IA 4YFLF 3WE6A 3TA3D 3F5WB 1MRCH 4ODWA 3O2DL 4RGND 3KPNB 3SDCA 5D8JH 4GRWF 1I1FB 4FS0A 1QA9B 2CKBL 2A77L 2ZOLB 2ZUQB 2V7HB 2X4SB 2AXFB 1A14L 1CGVA 3ARGA 2NMSA 4ZXBD 1HCFX 1J8HD 3T1FA 3DETD 4QRRE 5FEBA 4K7FA 1CZ8L 5TFSL 2DICA 2O5ZL 3K4DA 1INEH 3FT2A 4XZUA 4I5BB 3CVHB 1YNLH 2E8YA 35C8H 4ZMAT 4OD1H 1AJ7L 4XMPL 5HVHB 4P4KB 3U46A 3HZVB 4Y4HC 5L88H 5E08L 3B6SA 3FRUB 4P46C 4U7SA 1ZKAA 1N0XH 3QUXA 3SGEH 2A9NH 3ZE0E 5DK3A 5E1AB 4JHAL 1IBGH 3RTQA 3DURB 3G6JF 3TP4A 3IDIA 4MCYA 3PGDA 1JGDB 1JGEA 4LQFH 4HJ0C 5E2UL 1OSPH 3K0WA 4LIQH 4UU9B 4FMFA 5FM5M 4CU7A 2J4WL 2A6KA 5HDBF 4AL8H 3CC5B 1W72B 3VXRA 2I5YH 5T5NF 5GRZA 2FHFA 43CAB 1KELH 2DI9A 2NX5B 4FQ1L 5D6DC 5SWZE 3RL1B 5GZOC 3VGHA 5L2KB 5D6DA 3NCBB 3K81A 5EZOH 3MV9B 3UYRH 4OUUA 4KVCL 4Z7VA 2JIXD 1RZGA 3LHPH 3SQOL 2IEPA 2BSED 2OR9H 1RZ8A 1IEHA 3HB3D 3MNVA 4LKCA 1RY7B 3ARBA 4XAWH 5ACLA 2NY0C 4ZPTB 4A2MA 1RJCA 2X4UA 1EEYB 5CCKL 1AIFB 1E6OH 3DX7B 3DRTB 2AABL 2GKIA 1YJDL 1JTPA 3ULUD 5EWIL 3EYUL 3VGEA 3O8XC 1CICD 2VAAA 4IDJH 3L3DB 5MEQB 4X98B 1DEEA 4NWTL 3LV3A 4C83B 3TA3B 4M02A 1PEZA 1HSAA 4G6JL 4XAWL 1GIGH 5JHDE 3CVHH 4ZO7A 2AKRB 3P4OB 2NW3A 1S5IL 3OKLB 1ZLWK 4Y4KD 3SJVA 4WFED 1HZHH 3WIHA 1BVLA 5DZLA 4JG1L 5DJ6B 5HHOA 5INDB 3BJLA 3KPMA 3L5XL 5L8LB 4AIXA 2BVQA 2YHGA 2AVGA 5C08D 2HKFL 3WFHB 5DS8A 3QB7C 3M1BB 3CD4A 2A0LC 3T04D 3I75A 4KKCC 1E4JA 2AJZA 4KHTH 4OQTA 3VRIA 1H8SA 5I18H 1GYAA 1XAUA 1V3KA 4DUWA 4L3EA 1S9XA 4NYLA 5DUBA 5ISZD 1EPFA 1A7OL 5D2LA 4FQPA 2P5EA 1MJUH 2XWJB 5C8JB 3WIIH 3LKOB 3B8YA 4HS3B 5DDHA 3N9GH 1IL1A 2ATPB 2X1WL 1MWAH 1RPQA 2CRMA 2H32H 2K1MA 4NCDA 4WU7A 5AZ2H 4Q6IB 4DQOH 4Q58C 3MRGB 1LILA 1AR1D 1OVZA 1X4XA 4Z0BH 3BGMB 4NRYA 3U0PB 3HUJB 2DKSA 3QNXA 4ONHA 3QI9D 4OLUH 2EEAA 5MENB 1T5WA 1KOAA 3QNYA 1JI1A 2ITCB 1OTSC 1TXKA 3EFFB 5DD1L 4U6XA 1X7QB 5CEYA 1U3ZA 5I17A 2O5YL 3OXRB 4GKZA 1OGAD 4NN6C 4DZ8B 4WV1C 2L4OA 5IHZA 4LF3B 4IBLT 1TCMA 1MWAB 2OTUB 1VCAA 3MNWA 2R0KH 1E4KA 1WZ1L 3GO1H 4IMLB 2OR9L 3QXAB 8FABA 5GQBA 4QRRD 4I2XE 3GJFH 1WC7B 5E9DE 1KB5L 1NLBL 1A2YB 5D93C 4IIQA 3V8CA 3SGDH 2MKLC 3KXFE 3W2DH 4J4PC 1S9VB 4X9BA 4KDTC 1H15A 2GY7B 2P5EE 2BDNL 4S1RL 2CDFB 5HGAB 2VN7A 4QT5B 1KCVH 3AY4A 2WBJB 4PJGB 1JP5A 3NPSB 5KTEH 2Y36L 4LQ1A 1FZKB 4I3RL 2VXSL 2EE9A 3S5LB 1QFOA 1DQML 5EOTB 1MRCL 3QJHA 4PRIA 3QUZA 5I1HH 4JANA 1MCJA 1V7ML 2AK1H 5TPWH 3FO2B 4LVEA 5I74C 3D0LA 2X4TB 5DA0B 4FFYH 4P2QA 3EO0A 2ADGA 4PP2A 2W91A 1SJXA 3EO9L 2BMKB 5D96B 4OT1L 1OGAE 5CMAA 2V17L 1UZ6F 3BMWA 2E3VA 2NR6D 2OQJA 3GMPA 1W0WB 3MRMB 3FL7A 4P2OD 4YAQB 1AE6H 2IH3B 3C8KA 1ZT7B 1EFQA 5IFAL 1IGJA 1ZT4A 5SX5H 4GG6F 5E6IC 4ETQA 3L9RB 5JOPD 5DD6B 5C07B 1P4BH 5B38A 3EYOA 5DJ2B 4HIJB 5TGBB 2X89A 3QJFB 3VXUA 1JRHL 3CX2A 1TIUA 3MA9L 2JB5L 3EDEA 4Y5XC 4WFFD 3KYKH 2UYLA 4L9LA 5FKPB 4Z7NE 2VITB 4IRJA 5FYJD 3S35L 5FHAH 3NCCB 3AXLA 4KDTA 1BIIB 3MX0A 4CVWA 5ISZE 3WIFA 2JE8A 1TJIL 3V5HB 2F53D 4HDIB 1WCQA 1B0GA 3DGCR 2ZJSL 2DQCL 1NFIB 3L3GA 3QIUA 4HUVB 5DRZA 1Q0XH 2IBZY 1RVFL 4NQDD 2VQTA 1N4XH 2BVOB 1CDGA 1IEAB 4KK6D 3IYLW 1DQLL 1NANI 2AXJA 2W0PA 3RJDA 2GY5A 2IMMA 4U1SB 1K6QL 5GSRB 1LO2L 4MJ5B 3H42H 4YFLI 5CFHA 2I27N 3ESUF 4NT6B 2MPAH 1GL4B 5FM4A 4F7EA 1DEEB 4FA8A 1N7ML 4P4KA 2F74B 4D0BB 3RGVD 4Y4HB 5E5RB 4AMKL 1AGBB 2ERJC 2XQBL 2HG5B 3B2UC 4NKIL 3BPLC 4Z7WF 5KSAC 2RR3A 1K2DA 4FZ8L 1ZANH 1NCBL 3CFKB 3GBMH 3OJDB 1NMAH 1C5BL 4PJFF 1MI5A 4J3OC 1KFAH 2CDEA 5GRWA 5CJ8A 5GHWL 2P7TA 1WWBX 3LMJL 1YEKH 4PJBF 4B7LA 2HT2D 4J1UB 4U1KB 3QDMB 5TJWK 3WFCL 2F15A 4OGAD 1J10A 3CGTA 4OTXL 5CEZH 4JEGB 4PJFA 2J7LA 4ERSH 1RZFL 3TM6A 5JA8B 3MV9A 3GJFK 3PGCA 1WAAF 4MD5A 1FFNB 1NLDH 3Q1SL 4BUHA 4UV7H 2ZZUT 3UBXG 5DJ0B 2HLAB 4EIGB 4U3HA 1U2HA 1VADB 2LABA 3TBWB 2NTSP 4KROB 3OKKB 4JGUA 2YD6A 1AHWB 5CZXD 1FFPB 3S36X 3W39B 5BCAA 4JG0L 4WUKH 5E8DL 5FYKE 1FE8L 2R0LH 4QRUB 1CDBA 4O5LH 4F3FA 3L3DA 2VLKD 3P30L 4BYHA 3BQUD 3ZE2F 1ZLSH 4HLZG 3TA3A 1MI5E 5ANME 2C7UA 3CUPB 5T3ZD 1AY1L 3P77A 4HJJH 2ZKHL 1L0XA 3D39B 4D9LL 2BY0A 4NBYB 2AJSL 1F42A 4IOFC 4HIXL 2W60A 3U2SB 1G6RL 1HHIB 1KC5H 1YA5A 4WU5B 4I0PD 1KF9B 2FNBA 1A47A 1DDHB 5GGUB 3ECBB 1HDMB 3TT1H 5E2VH 3HLAB 4OZIE 2GI7A 4X0KB 2FECL 4V2BA 5JPMA 5JOEA 4R4ND 2MCPH 1U6AH 2HA1A 5DK0A 4U05A 5HDOA 2E7LC 3KPMB 1C1EH 2R1WA 3EJZC 4FQXB 2O93L 5CP3H 1RULH 3BPOC 1KIQA 3MRDB 4MA1C 3R06A 4HCRH 3KDMA 3LKQB 5I15L 3IAQA 4S1DD 5EORL 3O41A 1WIUA 3KNBA 4QRPD 4FQ2L 1K8IB 1YMMA 2VISA 1RHFA 3ARED 5HHVL 5GGSB 3C5SA 2OXGA 3MLPA 4LCWA 5H2BA 4X6DA 1K4CB 3VA6A 5BZDB 1I9JL 2NW2A 3U9UA 1TTFA 1NMBH 3RWJA 2EXWD 2NNAA 3IFNL 1FZKA 3FTGA 2BSTA 5ALBH 5C7XH 3JWOH 2GQHA 3LS4H 1BZQK 5EWIH 5C0IB 2V5SA 4O2EA 6FABL 1LEKA 3CDFA 4ZOAA 4M7JH 3DOSA 1D5MB 4NNPL 2EC9U 1ZVSB 1R3IL 2DLTA 5EPMB 2BNRA 3QIUD 2OL3H 1BZ9B 1KIRB 4PS4L 4QRQA 1MRFH 3SE8L 5CD3B 4QHUB 3E8UH 2VZVA 1GOGA 5KVFH 4NUJA 5SWZB 4MB5A 3BUYB 4R3SB 4KK9C 2IPUK 1X6NA 2R9HD 3MLWH 1E4XI 3E3QE 1G6RH 1KC5L 3HS0B 3D2UD 4TSAH 4G80A 1H3UA 1XF5B 3E2HC 5GGQH 1N4XL 5CILL 1ED3B 4DUXA 4AIZA 1NCDH 2QEJA 4JHZA 5FGBA 1HH9B 3MJ8A 5BJTA 3SE4A 3FN0H 2DQIH 4IRSC 3LKSA 2CK0H 2VE6A 4U1HA 5EU4A 3SDXF 3SE8H 4GW4B 2NY2B 3QO1A 2NY7L 1ZMYA 4I77L 1XF2A 4JVPA 3ARGD 4Z7OE 2Q6WB 4B0MM 5HVFB 4PJ8B 4RCAA 2Y07H 2PXYC 4YQXH 3T2NH 4J4PA 4M8QA 4HUVA 2DD8L 4ISVA 4R8WL 4MNGB 4MHHI 1Q1JL 5J9PB 4OLUL 3SE9L 4BA8A 2BHZA 3ETBF 4MB4A 3GJFA 2ZPKL 1QR4A 3MQIA 3UBXA 1T6WA 5MERA 5F6IC 3S3JA 4IHOA 4PJCB 2BP3A 1BZ7A 1QEWA 4LPXA 5A43C 3D5OF 4GMSL 3UAJD 5LKNA 3K2UL 3I6LE 4NQCB 2R69L 3FFCB 4OF6A 3WSQH 1JPFB 3HPLA 3MJ9H 4D0BA 4X6FB 4G5ZL 4YPGA 2YWYA 4PS4H 3DTXA 1RMFH 5BXFB 2RGSA 4H0GA 2EDFA 4XB8A 4X98A 4HPYH 2CQVA 3MRKA 1JNNL 4W68A 5EU3B 1T22A 2MQ3A 1D5XA 4KQ3H 3ULUE 5TE4L 2YPVL 2W9LA 4ZAKC 3T2QA 5D7JC 2H1PL 3MRQA 3IJHA 4QY8B 2R4RH 2B1HL 2AAVA 3HNVL 3EOYG 4PGDA 4UNTA 1I85A 1ORQA 2RIKA 3V79C 4QWWD 3QH3A 4RGNE 3T8XA 1T2XA 2KPNA 3DX8A 5C0CD 3WIFB 3BZ4B 2IBZX 4MNQD 5J1TC 4NO3A 5IGXL 3QISA 1OOAA 5I0ZA 3LN4B 1X5GA 3CXDH 2OL3B 2HFEA 1P4IH 1L6XA 4XC1L 1AC6A 1FZJB 3W39A 4KZEH 3D2UB 5CJQH 3DUUB 5B39G 3OPZL 5C07D 2Q86B 2X4PA 4ZS7H 2A73A 2YUXA 1A9BB 3ZDZF 2F8XC 3ZYOA 3Q6FA 3UDWA 1N6VA 4WWKB 3QIWA 4QXTB 5I1DA 1KIPB 2MQCA 1MCEA 5IB4B 5IW6A 4Y5VB 4UINH 1DBJH 1TMCB 4Z18A 1UB5B 3REWB 1JRHH 3CPLB 4ZDHB 4MJ6B 5E2WL 4ONGH 3S3PA 1VSCA 1KCUL 2UWEE 3BW9A 4HIIA 3MRFB 2K3TA 2Q8BL 4ERSL 3N9GL 1TTGA 3F7QA 1XIWB 1BAFH 2OTWB 3AAZA 5EDXA 2JCCA 3MBXH 4NRYB 3SDDD 3QEQB 1A6UL 5ICZA 2GSIA 5A2LH 3BE1L 3O4LE 4UTBH 3KYOA 4ZG1A 4JRYE 4H5SB 4M7LL 1IGMH 4KMTH 3G6AB 3UX9B 2HJLA 3SGJC 3MRHB 4JRYA 4S2SB 1KGCD 3OAZK 1NBZB 3NIFF 3UJTL 3DYMA 3MCG1 2FEEI 1DEDA 1KJ2L 2P45B 1KN2H 1WZLA 3T65B 5C86A 3AUVA 3MO1A 3AB0B 3ZKQD 1S9YB 2IADA 1OB1A 1G9MC 4CVXA 3WKNA 3U0TB 1UT9A 3SDCB 1JPGA 3IKCB 4XWOD 1D5IL 4C56E 3JVGC 1IAKB 2Z91B 1CGSL 1FRGL 1JYWA 4OCSH 4RQQB 1HILA 4FTVA 4GG8A 1DSFL 3MLRL 2LTQC 1BMGA 4X9HA 2V6HA 4R90H 2UUDK 4M7ZC 5F1NB 5KS9B 4R97C 3PL6A 3VFWB 4N90E 2C1PA 4HMCA 4OLEA 1FLRH 5DUPH 5JW4M 1WFNA 3S5LA 4Q9QH 1CZ8H 5IB5B 4QOKE 2EZ0D 3BP6A 3K46A 1EGJH 5F7LB 1NMCC 1I7RA 5IT2L 1ZLUK 4UAOB 4NKIH 4NQEB 3T3PE 3MROB 5DMKB 4QF1A 4QHUA 1J12A 2FBJH 3F7VA 3QULA 5D6CA 3FO0L 1HDMA 1SMAA 1HKLH 3WNLA 4PBXA 2W0FA 1XGQB 3LH2H 3RU8H 2ZSVB 3PDOB 2OQJB 3GMPB 3HMWH 1JGEB 1EBAA 2D03L 3HCVB 5JQHC 2Z4QB 3C8KB 4U1IA 4HC1L 3VCLB 43CAA 4R26<