3UDWA

Crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
b'MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell immunoreceptor with Ig and ITIM domains
publication title Structure of TIGIT immunoreceptor bound to poliovirus receptor reveals a cell-cell adhesion and signaling mechanism that requires cis-trans receptor clustering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3udwA00
4R8WL 1O7SA 3HZYA 4HAFA 4LVNB 5H37H 4FN0A 4ALAL 3QFDB 4JY6A 4YHIA 5JDSB 5ITBH 5EDXA 4AMKH 1MHCB 1I9IH 2J5LC 4G6JL 1FPTH 3HTLX 3BZ4A 4ODBD 4Y2DC 3UPAA 4M7JH 3DV6B 5TDPA 5IGXL 1G1CA 2VLRB 4I3RL 1BVZA 5F44A 3CLFL 5J6GA 5FCUL 2H45A 5C07A 3FQNB 2LU3A 1G0XA 4NGHH 4P9HL 3RHWF 1FL6B 4JFPB 4NN6B 2NY3C 1NJ9B 2DICA 32C2B 2I5YL 4TNWK 1FJ1A 1UJ3C 3HNTL 2IPKB 4FQXC 3DECA 5IOPB 5C6TL 1OAQL 3ZE1F 4MJ5B 2X1XR 3PDOA 1NANH 4G7YL 4XP4H 3DUUB 3RTQC 1UCBH 2P45B 2BNQE 1KULA 4HT1H 3UTTD 3R06A 2R4SL 4J1UA 2VXVH 4P57A 3WKML 3VRIB 5C9KA 3EDFA 1D5BB 1R0AL 3DRTA 3CFJA 2DLFH 4FQ1L 4X80H 4KZDH 2D9QB 1A6TA 2R8SH 2BVQB 1ZGLM 1RUML 2R2BB 2VDLL 4OLVL 2ESVA 4TUKL 1AXTH 2XWTA 2DDQH 4OZFA 1T2XA 1Z9OA 5HHQA 4Y19B 1LEKA 4KRLB 1HCFX 4XPFH 1CDJA 4NQEB 2R2EA 4H88L 5IKCA 3LV3B 1FFQA 3LSOA 5DQJB 5C2UB 2GT9B 3EFDH 3HHRB 1T1WA 3M45A 4HUVB 4HPYH 1WQVT 4WCYH 2IPTL 3OKLA 4CDHA 3EBAA 3S7GA 2ZG1A 3ARDD 1L7TH 4X9BA 3D0VB 4XBPA 5FYKH 3UO1H 3LKQB 1T7WA 1L9MA 4LPVA 2RFXB 5IW3A 3MRHA 1NC4B 3QXVA 4X7TA 3MJ8B 5DHVA 2GITB 4Z9KB 4EDWL 3TN0C 3MUZ1 4U31A 1QR1A 2R2CA 4KK5C 4P3DA 1CLCA 3HS0B 4YXHH 1QZ1A 3OJDB 3BGMA 4JJHA 2VN7A 1FE8L 1W72H 3RBSA 1ZSDB 5I8EB 1YQ2A 3UTSA 2AV1B 3E3QE 4PGDA 3VRLF 4J3VA 1GGBH 4BSVB 3RZCD 1VKXB 4DZ8A 4JFFA 3V5KB 3ZE0E 3U36B 3CVIL 4KTEL 5DEFA 4TTDC 4I3SH 4N8VB 2UZIH 1M6OA 3P30H 5EU6D 1WUNT 4FXLA 2WM0A 4GXVH 1MI5B 4APQB 4OCNC 4ZS6D 2YN5A 3KYKH 1G9NL 4ZS7L 3K4AA 3W5MA 5J1AA 1LD9A 2Q6WA 1G6RB 3ZKMD 4KI5C 4MQXD 4BM7A 4XPGH 3UZQA 4FQJL 4WY7H 2CKBB 3KR3H 2PUQT 2FJFA 4NNYA 5AZEH 4YBLB 3VH8G 5I1HH 3QDME 1TCRA 1WSST 3KPTA 4HXAH 3VXSD 2X70B 1S9YB 4WFGE 2NY2B 4I18B 3B9KB 5BW7C 2JK5A 4JFEE 4UDTB 3VXTB 4X9HA 1PZ5A 3QIUD 1IJ9A 4LLMA 3MCG1 3QIWD 4HJJL 4PJDA 3KPQB 3QUMB 2IBZY 4N1CA 1I1AC 4EJ1C 1J1OH 4PG9B 2Y9RT 1MF2L 2VTFA 3FQWA 5J6HA 5MEND 2VLKD 2VWEC 1KPUB 1A8JH 3BGFB 4F37F 3IXAA 1JNLH 4U1MB 2VDKL 2EZ0C 3RDTC 3UTTA 5EU7E 3S98A 3WFEL 3LS4L 5DFWH 4CNIB 4OUOA 1DDHA 1K5NA 2VZ3A 5EC2B 4U6VL 3S6CA 2AP2A 3O3DA 1QP1A 4OF0A 4X6CB 3H6JA 1EFXB 5EZOH 4ZUTB 5JHDA 4PJ9C 4HIHA 1ZHBB 3QIBB 1CGUA 4UT9L 3HRZB 4BZYA 2X42A 1W8OA 5EWIH 4JR9L 3WO4C 3VXRD 2KH2B 3Q2CA 1U2HA 3QHTC 4PJGF 3QO1A 2FSEA 3U0WL 1D5ZA 4NBZB 1A3QA 1JZ6A 3O0RL 5E70A 4WTZG 1NQBA 4ZFGL 4JCLA 5GHWH 2QSCH 1CL7I 1DBJL 3ZHLA 3ARDA 3PGFH 4Y4FB 4G6KH 3LRHA 3C09C 5DWUL 3MLZH 3U7WH 1I8MB 3VFUB 5FKAB 4BUHA 4EUPG 2NLJA 5C0AD 5KBNC 5IK3A 3BKML 3KWWB 3HE7A 4RGOH 2GTZB 2F54D 4P2OC 1KCUL 1L6XA 1W0WB 3Q1SH 3VU2A 3NCJH 1EGJL 4FXGB 4HKZA 5D2NA 2RJMA 1QLRB 5LXGL 3OJ2C 3QFJB 3L5IA 2EYSA 3U82B 4O2EB 2X5PA 4YDVA 4LDOB 3O11B 1QLEH 2UWEA 3Q6FA 4LARH 3BUTA 4E42B 5CSBA 4H0GA 2HAZA 1YUHB 1JPGB 3BKCH 2ZJSL 2E9WA 4NZDA 4U1IB 3NBNA 1PSKL 2YMXH 2FHBA 1IAKB 4A6YH 2UV3A 35C8H 1UM5H 4LCWB 1CFBA 1KTDB 5D7KD 7FABH 2P8PA 3UTOA 3GB7A 4K8RC 3JV4A 3JWOL 2FBOJ 3BIKB 3S35H 2MHAA 4KTDL 4GW1B 3TBWA 2VDOH 3ZL4H 4JAMB 4OCWH 5HYQA 2MSPA 3DX7B 1GGUA 5CP3A 2XNAB 5I1KH 5I1EH 1RUKL 1DLFL 4UQ2A 5F7DB 3DMMD 3QIUA 4P2RB 3PWUA 3U0PA 4YIQA 3GRWH 1RZ8A 3GMNB 1FL5A 1MPAL 3WNMA 5MENA 5I16A 2F5AL 1XR8A 4GRLA 3OHXA 3OAYK 4G42B 3PP3H 1GHFL 1AO7E 2GSIB 1A2YB 1F90L 3OXSB 5HVGB 5HI4D 3TBSB 2ZUSA 4K7PH 4M8QB 1A7RH 3ARFC 43CAB 5LWYH 4V1DB 2I60L 4OQ1A 5GZNC 3ZDYF 2GSGA 4QY8A 1FIEA 1KJ3H 4MQ7A 4JM2C 3FAWA 3GSVA 4DUXA 4PD4J 2RAMA 2DI9A 2F5BH 4J8RB 3VFNB 4FFVD 1CR9L 3DV4B 1RZKL 5HD8D 4LSUH 1EVTC 5IB5B 1WV7T 3MRPA 4O5LL 3VXRA 5FO7B 5TE4H 2DMBA 3F7RA 3S35X 4MWFB 2FX9H 3LN5B 3D3VA 4HIJA 3K1KC 3T1WA 2X4TA 2VQTA 3CDCA 1IM9A 2NXZB 3WIHL 1ROWA 1T7YA 2G5BB 3EJZD 2Q7YB 3SDYH 1BBDH 1YYMH 2EIZB 3RIAF 2EDXA 3KS0H 4EOWL 2NY0C 1T83A 4DFHA 4XHJC 5H8DA 1XGQA 4R7NA 4FG6D 1JHTB 5JOPE 1UQSA 3FO9A 1J0IA 1NDGA 5C0AA 3KDMA 4AIZA 4WFFE 4BK4A 3V4PL 3QULB 5GGTL 3U46A 4LRNH 2PKDA 4OGAC 1A9BB 2W65B 1I7UA 4C4KT 2DWEB 2BDNH 1LO3H 4LQFL 1I8LA 3VWKB 1ZTXL 4IMKA 1FZKB 4IIQC 5IV2A 4AT6A 4K7PX 4X7EC 1CGTA 4R7DA 1YY9C 4RBPK 5L0QB 5SWSB 3WDIA 5D7IB 4YWGL 3JUYA 3DTXA 3QA3B 5IEHB 4GKNA 2WINB 1GIGH 4LASH 4LVEA 2G75A 4PJ7E 2P7TB 1I3GL 4L4VD 1WC7B 1BD2A 1X5YA 4KUZH 3DETD 5HJ3B 5ANME 2MCPH 5AYUH 4YXKL 4Z7WB 4WU5A 2R29L 4M03A 3QEQE 5ICXA 3ZO0A 5JORA 3FO2B 4MSWB 3REVB 4LPXA 3RVWC 3WHE0 4J6RL 5D5MB 1LK3L 3V5HB 5D70L 5IFAL 3OPZL 4PRNB 1X4YA 4O02H 1N64H 1KJ2B 4MJ6A 4PJIE 3GIZH 3DMMA 3MGAA 4XI5C 4J12A 4NO3B 1U8NA 5F7UA 4JDZB 5KN5A 5E2TH 1MELA 3MO1B 1JZ8A 3NTCL 2ATPA 3BN9C 3KJ6L 5HY9A 4K3GA 1JZ3A 1OTSD 3UBXB 2DN7A 5FM8A 1BVLA 3CFDB 4KK9D 4UV4H 5GGSB 2VXSL 2Q8AH 5C08D 2JJTA 3SCMD 5IJKA 2KKQA 1Q0XH 2FR4B 4ODSH 4X99B 4JDVB 3QDJD 3S4SB 5J11C 5MEOA 4NZRH 1DBBL 3B9EA 3S3SA 2C4FT 1QRNE 1T22B 2AW2A 1MAJA 2BOBA 4LLQA 4Y4HC 1ZVSA 3HUJB 3QQ3B 4PGCA 4TULH 2JB6B 4XRCA 1JYXA 1A9EB 1X6NA 3CC5B 1U8LB 1IKFL 2X4NA 3O9WD 1DSFL 1YN7A 3L1OL 2E7LA 4Z7VB 5EZJA 4XCFL 1KCVL 3H8NA 4PJ5D 5D9SB 4WU7B 2EC9U 4Z0XA 2XYCA 3RBGA 4HLZH 1CXFA 5E8PA 5T1MB 4NKQB 2XZAL 3VWJA 2YC1A 4LDEB 4NZUH 2Q86B 3RKDC 2Z8WC 4LBEB 4DN3L 1QEWA 1J87A 4RFNB 1YYLH 2HG5B 2YZ1A 3SKOB 3EOYG 2FX8H 4TSBH 1I3VA 4KQ4H 2HT4C 3ULSA 5MP6L 3FZUC 2VQUA 4HIIB 4XMLH 5HDOA 2B0SH 3NAAL 4XC3H 1T5XA 5C09E 1F3RB 4TN9A 4IMLB 1SMOA 1T1XA 4ETQB 3P11L 1FG2B 3TBYA 4E0RB 4YEFA 1NC2B 4YPGB 3HNVH 4BQCA 5I8CB 4YE4H 2DQTH 5DUBA 2YK1H 3AROA 1UXSA 2H2PD 3CUPB 2D4FA 5HHVL 4J7RA 2I9TB 5JMOC 5I17A 5KAQF 5A2JH 4YXLH 4HBCH 2VXUH 1BM3H 1UEYA 1FFPA 2CUMA 3TJEL 2OJZL 1CDCA 1FO0H 3U4AA 2Z35B 1FAKT 3FQTB 3MJ9L 2IADB 3LEXA 2NX5D 2OTWA 4RMTA 5IVNA 1RUQL 5B38B 2FYYB 2VDQH 1EAPB 5KSAD 1CFNB 1AQKL 4WUUA 3UYRL 4PJFA 3TH2T 2V7HA 3KLSA 1Q9LB 3MRLA 3C5ZB 5C0RH 3MBEC 1O5DT 1TJGL 3LD8B 4F3FB 1J0JA 4PLJC 4DW2H 3VXPA 3MJ9A 2CMRL 2AJUH 2B39A 4UAOB 3TVMC 3NIFE 1MCDA 2IAMD 1LHZA 4P2QE 3UC0L 4XXCA 3TT1H 3QI9D 4NHUA 4X83A 1P1ZB 3VE0A 2EDYA 1WCBB 4LPWA 4JKKA 4HG4K 1GGIL 1G7PB 3G5VB 2XG5A 2PXYD 3R8BB 5D6DC 4QRTA 3MLUH 5FUOL 2XICA 4DTGL 1BOYA 4M5ZL 1AHWC 2GKIA 1JZ4A 3WSQL 5KS9A 1A7NL 1W0VA 1D7FA 3SCMA 1T2QH 1WAAF 3D2UD 1YJDC 3QDJA 1MVFA 1SEBB 1U8HB 3V0VA 1PKOA 3ULVE 4A2LA 4AH2A 3ULVC 4FFWD 1PQZA 2XA8H 3PWPD 2NW2B 4K55A 3GJEA 3IS0X 3F7VB 4YNYB 1T89C 4FTVA 3UYOD 3HRPA 2HRPL 3PWVA 4OAWA 4XP5H 4MS8C 2D7QA 5I19H 3L3GB 2H1PL 4H25B 3SE9L 4JRXD 1S9VA 3WS3A 3GSXA 1FH5L 5EBWA 1EHAA 4PJ5A 5DMGD 1CI5A 3U4EA 1QFWI 4L3EE 2DD8L 4BELD 4XVUD 2VNCA 2OR7A 5E00A 2ORBL 2DLIA 5KG9A 5L8LB 2DL2A 5DJ6B 1IKNA 1D5IH 1G9MC 5HI5D 1HIMH 4XAKD 5H94B 3WDHA 1RFDH 3LRGA 1J86A 2HJFB 2BVTA 1YMHB 2QQLH 4XH2A 3MRNA 1P4IL 3VFGL 3ZDXE 4FHBD 3BZFB 4GKZB 1BWWA 2V2XB 4JPKH 5KOMC 4B7LA 1JUFA 5KVGL 5FCSH 4EVNA 4YHZL 2CIIB 5BS0D 4NQDB 3U9PH 4E9LA 5A43C 5CHNB 2ZP0T 4JHAL 3V8OA 5CJ8A 1D5XB 1RZFH 1EEYB 3PV6B 4YHLL 2Q3ZA 4JO4L 4ZMAT 1YNKH 3TYGL 4DN4H 4JFHE 5IG7A 3CXHK 4OB5L 1OD7A 2AK1H 3T2PA 4U2YA 4M61A 3VI4E 4NWTL 3QXDB 2CLZA 1J10A 1VACB 2VZVA 1XGRA 1XIWA 2NX5A 5KSBE 4LK4A 4ZXBC 3EYSH 1OGTB 3NA4A 2NR6C 5KSUA 4UU9B 5EC1B 1OLLA 5CSGA 5IHZB 4NC1E 3ZKXC 3MRBA 1HDMA 3DSFH 5KTEH 1JGDB 5CSZA 5I8OL 1MQ8A 1N6QH 2B2XL 3IFNH 3DUHA 4NO0D 4U33A 3NFPA 4C83B 3SOBL 2FGZA 2EDNA 3BSZL 2AJSL 3AXLA 4OJFL 2IAMA 3O4OB 5DHYA 3QI9A 3GSNB 1BOGA 1XGTB 2B5IC 1VADA 3VDBA 1ZA6A 4LLUA 2PXYA 4H20H 4Z7WF 1I8KA 4OQTH 3QQ4A 1BBJB 4HIEA 1GC1H 5I6XC 3NCFB 1EDQA 2VO5A 3FRUB 4KROC 3RUGA 5D5MF 5B8CC 3VH8B 2V5RA 3QJFA 5I75C 4P59L 3PWPA 4GG8B 4KJQD 1LK2A 1NKRA 1AY1H 4QXTA 4X5WA 4IRJB 4KXZI 5DRZB 3MNZA 2FECI 2XY2A 4HH9B 4BJLA 1C5DA 4RGNE 3GGWB 4LSRH 2V7NB 2HFEB 4NM8L 1HXYB 4DGVH 1T21A 3NPSC 3PNWB 5DXWA 1SHMA 4DVBA 5FV1L 1YEIH 1VFBB 4YO0A 1NAML 5EG6C 2N4IA 3MA7A 2MOVA 2E6QA 3HUJF 5EUOA 4WHYH 1AGCB 5DEGA 5KZCD 1Q0YH 4TQEL 5B39A 1MLBB 4G6ML 4RWHA 5E94A 3NFSL 3WN5A 5GZOD 3C60B 5DDHB 5TE7H 1KB5A 3VXNA 3ULVH 2PN5A 1A5FL 1NDMA 1NAMA 4WWKC 3T04D 2ED9A 5C92A 2VABA 3IKCB 1HI6B 4S1DD 3V4UH 3STLA 4HS8H 4R3SA 4HUXB 4JGUA 3HMWH 5E9DB 1EEZA 1BIIA 4OCSH 1I1CA 4GAGL 4MGXA 1YPZB 5HI3D 5IJVB 1B0WA 1MRCL 1YEGL 5EIVA 2XTJD 3BEWB 1MUJA 2Z31B 4OZIB 4P3WA 4L4TD 4EUPB 4OCRH 2A2QT 1N5AA 1WBYA 3OB0K 4WHTB 2D7OA 2A1WL 1G9MH 3L7EB 1M7XA 5HHOD 1WWAX 4R6UA 5E2WH 4YGAB 1HHGB 4Z7VE 1R3JA 3EFFA 4XCYA 4GG6F 2AI0H 5FF6A 3M8OH 4TSAL 3D48R 2QADC 4P4KD 3SDCB 1ZANH 2ZSWA 1P6FA 3INUL 4PJBE 4JQXC 4UUJB 4HUUA 1OM3H 1BFOA 2PTTB 1C5CL 2DL9A 1RZJL 2R69L 3QPXL 4KU1A 1SJHA 1YEJH 3BP5A 5JQ6L 5TQ2H 4HSQA 3EO1A 2X7LB 5C0ND 3NACH 4FP8H 3IJSB 2R0ZL 2HLAA 1OF2A 1CLZH 4WI3A 2D3VA 2UYLA 5BZDB 2B8OT 1GH7A 4I5BA 3W5NA 3CPLA 4H1LG 4KKLC 2D31A 4F33B 5DTFB 1JN6B 4PJ8C 4DK3A 2XN9E 1N59B 3MRRA 4QXGH 3G5YB 5JLZA 4OD3L 3UTPE 2H8PB 1MNUL 2BNRB 1TVBB 3G08A 3HC4L 1IAIM 3MGOB 5HYIA 5D72L 1UM4L 3S96B 4C55A 3R1GH 2OR9L 2HH0L 5DO2C 2FDBP 4XCCL 3KYMB 1GZQA 2AXFA 4ONHA 4XPHL 3ARGC 1BJ1J 1IEAA 4NWUL 5E8DL 3MRKB 1AP2A 3O6KL 4HK3J 3MFFB 4MAYD 3W81A 4PRID 2AEQH 4EQ3A 1QO3A 3IETB 2FZ3A 2XZQH 5F9AC 3BQUA 4D0CB 2B1AL 3B5TA 1MQKL 4H5SB 3KLAA 3VFVB 3HAEA 1M71A 4MVBC 5CUSH 4PGBB 2FGWL 3B43A 1ZT1A 4OZHF 4G7VH 2CSPA 1S7QA 3OKMB 5I1CL 4BUGA 2M8XA 3F7PC 4PJCA 5I2IB 4HKXA 2JKXA 3G9VA 1CDGA 4YFEA 2XKNB 1VCAA 3G6AA 3SDDC 2FBJH 4HHAB 5EUKB 1M7DA 1I9RH 3SE3C 4M4PA 3T2OA 1JZ5A 3GMMB 5FYKD 3M17A 4D0DA 2M2DA 1S9XA 1OP9A 4N0FB 1QACA 5HHPB 3IXTB 3Q6GL 4R26H 5TE6L 1A6VH 5I1IH 1UA6L 1NFDE 4P23D 5FB8A 4OI8A 1ORQA 1ZHNA 3WL9A 4JVUA 5IWLC 3VFMA 2BZDA 3P4MB 1FZOB 1JPFA 4BZ1L 4L4TA 4RDQG 1FCGA 4EN3A 1CE6B 1MLCB 2YN3A 4AMKL 3L3IB 1I9IL 2A73A 3IDIB 1FPTL 4MQSB 3V6ZA 1EVUA 3CLEH 5MERA 1Z0MA 2GHWB 3MLYH 1FL3A 2IQAA 1BPVA 1JRHH 4P4KA 3X14A 1A6UL 1T0NA 2DIJA 3MRQB 4YQXH 1P5VA 3DI2B 4OF5A 1R3LA 4IRSB 5MEPB 4NGHL 2X4PA 4JN1H 1J5OH 3ARBD 3UPRB 4HF5H 3UTZA 3ZLQC 4EI5B 2W38A 1JHKH 4X4ZA 4M3KB 3D25A 3O3AA 4N0CD 4WV1C 3ZHDA 4GKSA 2D7NA 1IQDA 1Z3GL 3BX7C 4XVSH 3CXDL 3WEXB 1FNEA 4MX7B 3BYTA 1HQ4B 2KBGA 1D6EB 4U3XA 5DRXB 2ICWA 2DLFL 1U8IA 4ZQKA 2R8SL 3GSOB 1LP9B 3DIFA 3KXFD 2DLGA 1XAUA 3BZEB 5IFHL 3A67L 2D7TL 4NHCH 2DF3A 3PJSB 4LP5A 4MDJB 1G7IB 4YZFE 3MUY1 1HSAB 1VGKA 1NANI 3VXUA 4NQSA 3EFDL 1B0RB 4HPYL 4I1NB 4WCYL 1KENH 3VGHA 4PRDA 3QUKA 3MODH 3QAZB 1NGWA 1OARH 1ITBB 4EEEA 4Q6IC 3T4AB 4ODWA 4JKPH 4JANA 4LAQL 1MCFA 5FYKL 3UO1L 3OKNB 4BQ8A 4LCCB 5DJCB 4JPIB 1VEMA 1OTTC 1N7MH 2XQBH 4Y16D 1NGZB 2WWKT 4YXHL 3FO1B 4E5XA 5MI0C 4PRHE 4LSDA 1MREH 1T20B 2CO6B 1W72L 1IGYA 1AKJA 4WHDA 5F3BA 4EQ2A 4ZAKB 1G7HA 2CGRH 2BNQD 3ARED 3IDGB 1TZIA 2OXHA 3GDBA 3H2WA 1EEUA 3V7MA 3MREA 1J05B 4NC2B 4P23A 4UI2A 4YDLC 4Z77A 1Y18A 2NY1C 3SDAC 4QXWA 2XKUA 3EAKA 2UZIL 5GRJH 2DOCA 1E6OH 3EYFB 1PEWA 1W72A 2HVKB 3GHBL 4GXVL 4JZJA 5E8OB 5JW4M 4UDUB 1IQWH 2R0WL 3K0WA 3D0LA 4LHUD 3CVHH 1KCSH 5CWSB 1MCSA 1FP5A 3HE6B 3DO7B 1FBIH 4XHQA 3KPRE 3LQZB 4XPGL 4LSVH 3DX8A 1DQQB 5CZKA 1Q9WA 4WY7L 4RA3A 4YDKH 2HJLB 5BO1H 2H6PB 1YEEH 5I1JH 5AZEL 5I1HL 4HXAL 1IC5L 3H9SB 3RWHB 3QZWB 3ZTNH 1B2WL 2YSSB 2XWJB 1WFNA 4N8PA 2F53E 4DKEL 1JTOA 2V5YA 3ARBA 3O2DL 2BHUA 2G60L 1XF3A 1YN6B 4OZIF 5DC4B 1ZHKA 2GYSA 4MNQE 5GRVK 5GRWA 3GMPA 3MMEA 1JNLL 4LLVA 4X6DE 5MHSE 1S5HA 2IPUK 3ZE1E 4ORZC 3O4LB 3L3HA 1WICA 1BF8A 4LSSL 5E6IC 2BSSA 1S7WB 3V6FA 1NCWH 3ABZA 4Y5YB 4Y5VA 3GSUB 2YD3A 1T4KA 3IB4A 4FNLH 3RY6A 3KXFA 3HZYB 4UB0L 5EZOL 5TDOA 1MCLA 1MCOL 4MD4A 4GO6B 4FQQB 3UJTL 3N1MC 1VEOA 3RPKA 5E6YA 2W9LA 2GI7A 1UB6A 3BP4A 4NRZA 5EWIL 6FABH 4MCZA 4R4BA 4KY1H 3GBNL 4LCYA 4S0TD 5C2BH 1QKZL 3BZ4B 1N8ZA 4N5UA 4PJAF 5E6ZA 3OJMB 1A6AA 5TDPB 4PV8A 5GISL 4G5ZH 3OKYA 4OF6A 5I0DA 3S97C 5J6GB 3QNXA 2ADFH 2QSCL 4Z7NE 5C07B 3QH3A 2W0KA 2WUBH 4HWBH 2RQ8A 4D94A 4BSWA 5SV4A 1UFUA 3PGFL 5IMLA 5JOFA 1BJ8A 3QDMD 4M43H 2E8ZA 3MLZL 2ZNWA 2QHRL 3U7WL 4WFGD 4NOFA 1FJ1B 1UWEH 4JFED 4RGOL 4KAQH 1OTUD 4BQBA 1QPXA 1I1AD 3T8XA 5F7LB 4GRWB 3NCJL 1WWWX 5F6IC 1H3VA 4CVWA 4FQXA 3VFPA 3ZE2F 3R06B 4OSUL 4ENED 4J1UB 5ECJE 4PLKD 4KDTC 3RTQA 1A3LH 3H9YA 2BNQA 3AREA 3CFJB 3DRTB 1A6TB 4U7MA 4XBGA 4F8TA 3WNOA 4Y7MA 4KV5E 4LARL 3WHE1 2ESVB 3BKCL 3PHOA 1NCCL 2XWTB 3SE4A 2YMXL 2RB8A 5HHQB 3NGBC 1WEJH 1P2CA 4WIQA 1LEKB 4KKAC 4M7LT 4LEOA 2R2EB 5E2UH 4PBWD 5IKCB 3WIIH 1DVFC 3NIDF 1R3IH 1LE9A 4LHUA 2BC4A 3LSOB 4FXKA 1EA9C 1T1WB 2VDRL 3S35L 3OKLB 2FHFA 3RWJA 3RL2A 2VDOL 3ZL4L 4OCWL 4OCMC 4A6YA 2N7AA 1QHPA 2X89A 4XBPB 3K7UA 1ZK9A 2NY5L 4MA1B 1JZ7A 3REWA 5I1KL 3MRHB 4X7TB 1F11A 3QUZB 3V4VH 2EH8L 1MWAH 3MV9B 5ERWA 3TCXA 1QR1B 4P3DB 4LMQI 5CEYA 4U4BA 3BGMB 1CE1H 3TN0A 2E9BA 1AD9A 2CJUH 2VDPL 3B5GA 5HSFA 2EIBA 3UTSB 2VAJA 4QXUL 4PGDB 5C9JA 3BN3B 4LVOB 5HDBF 1BX2A 2OI9C 1N3NB 3QJHA 4K7FA 4DZ8B 5E99H 1LMKA 3MV8A 3M1BA 4JFFB 5EORH 4CADA 1LGVA 3GRWA 3PP3K 5DEFB 4I13B 1E28A 4Z95L 5GSVA 3S5LG 1M6OB 1DE4A 2IGFL 4ETYA 3O6LH 3ZTJH 1GCFA 2F5BL 5F21B 4AEFA 5SX4H 4QHKI 1LD9B 2Q6WB 1UKSA 5E1AA 5TE4L 4ISVA 3LQMA 2AJYH 4XVJH 4PJGE 5TQ0H 2CLRA 3QCVH 3ZYOA 1BFSA 1HQRA 2FJFB 4NNYB 1S7VA 3SDYL 1TCRB 5JPMA 1KIRA 3O45A 5BV7L 1WBZA 3H42H 5BQ7A 1LP9F 2XQYG 3WNKA 2JK5B 2DB8A 3QDMA 5JZ7C 2OL3H 1OSPH 1PZ5B 1XGYL 4LLMB 3K46A 2VLJE 4PJDB 2K7PA 5BW7A 4JFEA 4ORGA 4HIXH 3FQWB 5J6HB 1ZA3A 2N1KA 1PKQA 3NCBB 3IXAB 1I1AA 2BDNL 5HVFB 1LO3L 4L5FH 2JTDA 3O8XC 3UTTB 1JF6A 5L9DH 2O5YL 5IQ9A 3QG6A 3C2AH 1AO7D 3H3PH 5CIPH 1DDHB 1K5NB 1MIMH 1DQMH 5T5NG 1D9KD 4YR6A 1IILE 3FFDB 1IGTA 5B39G 3I6GA 3ARFD 4PV9A 5JHDB 4KVCH 5KSVA 5C86A 1GIGL 4HIHB 4LASL 3CMOH 2HRLA 1P7HL 5IMKA 4PJ9A 3O6FC 5C0IA 3RX5A 5ADOL 1A14L 4KUZL 4KJPD 3S88H 3ROLA 2ZUQC 3QO1B 2FSEB 2OCFD 1BREA 2VL5A 5E4IA 5AYUL 2MCPL 4NQUA 3QDHA 1OY3B 4ZUSA 3ARDB 2X4OA 1EV2E 1C16B 4U1NB 2EE2A 1HNGA 3ZKNC 1IT9H 4U1GC 5IK3B 4ZTPL 3GIZL 3HE7B 1U8QA 5GRUH 4LVNC 4R0LA 5FIEA 1YNTA 5JOPD 3ARTA 3C6LC 5D1ZD 2V2TA 4NQVA 2XXMB 4WFFD 4P2OA 1FGVH 4HKZB 2C3GA 5GGQH 1CDYA 1F4XH 5D2NB 1X9QA 3ZT7A 4DAGH 3L5XH 5IVOA 2EYSB 4YDVB 2AV7A 2HYMA 5L8KB 2X40A 2UWEB 4GAYA 2DKSA 3Q6FB 1YY9D 5B4MC 1L0QA 4HUKB 3ZDYE 1F4WH 4TULL 3F12A 3CK0L 4XNYH 2H2SC 2P8PB 1JMXA 2ATKA 4YBHA 3GB7B 4R9HA 3WJLA 3JV4B 5I9QB 1SVZA 1RZIB 3KJ4C 3CU1A 2MHAB 3PP4H 5F7YC 4UV7H 4OCLC 3TBWB 2G9HA 4FFYH 4NQED 4DGYH 5HYQB 4OFDA 1IGIL 3QEQD 4BKLA 4NZUL 4PRPE 5CGTA 4H1LB 3UEZA 1YYLL 1JWUA 4UQ2B 3QIUB 1NBYA 3PWUB 3U0PB 2FX8L 3QIWB 4TSBL 4YIQB 5FK9A 5K9JL 1H3PH 1OVZA 1FIGH 2M1KA 4X6FA 1RZ8B 4YHYB 1I9JL 2OSLB 3IKKA 5F93C 4X8JA 1FL5B 5MENB 5I16B 1XR8B 4UTAH 4GRLB 3U30B 4YHMH 4I48A 4GUPA 1OAXH 3JV5A 5INCA 3HZVA 3MPCA 3U7AA 4U3HA 2AGJL 4EI6A 5A40E 5KVEL 4K23L 1FNSL 2JF1A 3RL1A 3F58H 1G7QA 1HNFA 1BZ9A 4QRPE 5E95B 5FA4A 4GQ9L 2YK1L 1OSZA 4XWOC 2GSGB 4QY8B 5HGHA 3ARFA 4MQ7B 4WDIA 5DZOA 4HBCL 2VXUL 1QRND 4CU6A 4Y4HD 2YD5A 1MCRA 1FO0L 1KBGH 2VXTL 3MRPB 2AEPH 3VXRB 3NOIA 4PB9H 1CN4A 3HPJA 1IE5A 4Q6YA 4YHOH 4HIJB 3D3VB 2E7MA 2X4TB 4JO3H 1MI5D 4L8BA 1F6LL 2VDQL 5E08H 4ONFL 4QGTA 3VRJA 3EZ8A 4LGPB 2EYRA 1XGQB 4LSQL 4R7NB 4L8DA 3GSRA 2AQ3A 4O2FA 1UQSB 3FO9B 2YXMA 1NDGB 3WFCL 5C0AB 4DW2L 3KDMB 4AIZB 4EXPX 2AJUL 3U46B 3C9NA 2ICWJ 5D1ZA 3TT1L 4Q97A 3BXNA 3MLRH 1I7UB 4JB9L 4XB7A 2B4CC 1RJCA 3RPIA 3CU7A 3RWFA 5H37G 1EHNA 3KYNA 4GRWE 5IV2B 2PCPA 3BISA 4RFEA 4AT6B 3W11D 4W6YB 2R1WA 4R7DB 2DM7A 2Q8BH 3FOMA 2HT3C 2HA1A 4GBXC 3SQOH 3DTXB 4GKNB 2NY2C 4I18C 3B9KC 1R5IA 3LN9A 5JW4Q 2W07A 1OAUL 1RI8A 5K9KA 4Y5XA 2G75B 3FMGL 3B9AA 1MFEL 5I8KL 5I19L 5D2LF 1FGNH 3JWDC 2FJGA 4LNRA 3L5WA 1MFBH 3BGFC 4PJ7A 4WU5B 1CQKA 5ICXB 2NY7H 5JORB 5C8JA 3UXFA 4PLNC 3THMH 1EJ6A 5EO9A 5ANMA 4GMTH 4X7CC 3QEQA 1KIPA 1E0OB 4M00A 4OLWH 2ENYA 3T09A 1II4E 1D5IL 2QV2A 1HIML 4FQIL 1TJHH 4MJ6B 4NYLA 2F74A 3DMMB 1JPTH 3VGFA 4NO2A 2LTQB 2QQLL 4HGKC 1U8NB 5KN5B 3QIBC 3N85H 1DQLH 2QSVA 4PJIA 5GQBA 1J0HA 2JIXA 1MJJA 1KSRA 2ATPB 4PY8J 5HY9B 4P2QD 3P0VH 3S34L 1ZVHA 1BVLB 5BMFH 4I3GA 4D9RE 1CFSA 4HC1H 5HHXH 3ULUE 4KGLA 3WLWD 4BK5A 1M1SA 1RZFL 3MGTA 5LBSH 1NGXA 3PHSA 4Y4FC 4DN4L 3FQUA 4FFZL 1RULH 5FO9A 1O0VA 2BOBB 1GL4B 4LLQB 1ZVSB 2AK1L 2W1NA 4PGCB 4XRCB 1G6RL 3FQXA 3ULVD 2BY2A 5EU5A 2X4NB 4Y4HA 5CJOL 2BSRA 4FZEH 2IH1A 5F7NC 1YN7B 5EZJB 2CKBL 2WBJD 3T2NH 5ABDE 4QEGA 5D71H 2PW2A 3EYSL 4JG1H 4PJEF 5CJXC 3Q48A 5DD1L 3WFBH 5E8PB 1DTUA 1F8TH 5DJXA 2YC1B 3QR2A 4F7CA 5ETUA 5A1AA 5IBUB 2A6DB 1QEWB 5HYSG 4KRPD 1KJMA 3LEVH 1N6QL 1YZZA 1U3YA 3IGAA 1VPOH 4NUJA 4BQ6A 3ULSB 4QRRA 3BDYH 4K71B 1OP3H 2HWZH 4S1SL 3W82A 4S0SD 3SDXE 1T5XB 4IJ3C 4K9EC 3GM0A 1F4AA 1ULVA 1CZ8L 3UJJH 1N26A 5C09A 4KJWD 4ELMF 1I75A 2R9HC 1GC1L 3QEHA 2XRAL 4B5EA 4JQIL 1E4KC 2D9CA 4S2SA 5DUBB 1NFKA 1UXSB 1KGCE 1WAAE 3OGCA 5IR1B 4QNPE 1DQJB 1CCZA 5I17B 4ERSL 4PREA 1K8IA 5F72S 1DL7H 4JFHD 2LAAA 2QLVB 2D7PA 3IFLH 1FFPB 2O5ZH 3QBTB 1PX4A 4OQTA 3LKRA 4PBVC 3LEXB 4NPYA 2HKHH 2OTWB 3LEYL 1NSNH 2IPUG 4PJHF 4IOFD 5F1NA 4ZXBD 4LSRL 4WUUB 4PJFB 2D4DA 2V7HB 3MRLB 1J9CT 2P43B 3NZ8A 2NXZD 1YEIL 3KG5A 3VXPB 3QCTH 4HULB 3MBEA 5KW9H 3G5ZB 2X05A 4AM0A 4LOUC 5F97E 4NHUB 5DLMH 3VE0B 1DUZA 3HI1A 3WFZA 4I0PD 4P2QA 4JPVH 5TE7L 3EW3B 4QRTB 2OQJA 3UTQA 1A1NA 2W9DH 4BA8A 1JL8A 5T5FL 3G9AB 3BT2H 1L6ZA 4MDIA 5F6HI 3LKSA 2VE6B 1UEMA 5KS9B 2QTEA 4MXWH 1BVKA 3SCMB 3OG4B 4OZFH 4BH8A 2NY6D 1JYVA 1JF5A 3JWDH 2YD7A 3V4UL 3HB3D 2P5WE 3NCYS 3X17A 3BE1L 3QDJB 3HMWL 5BVJA 5IB1A 4KROD 3V0VB 3WS6C 4AH2B 1PQZB 2HLFD 2J8UE 3D6GA 1K85A 1HZHH 1HN1A 4JKLA 4FTVB 3O3EA 1JMZA 3PWVB 4OAWB 2JB5H 3VGGA 4N5EC 2V5TA 1OLZA 1DR9A 5F89A 1T2JA 4MXQC 1T89A 3CCHA 1UZ8A 4HMEA 3VGAB 1S9VB 3WS3B 4JFXA 2R4RH 3TFKC 3QUYC 5EBWB 4PJ5B 2O61A 4Y1AE 1U8OA 2FX7H 4DOHE 3TIDA 3VWKC 4JKWA 4QRUA 3U4EB 2AI0L 1N5YH 3EJYD 2C3WA 4CN6A 5E00B 4RGND 5KG9B 4PJXF 5L0QC 1ZANL 4L3EA 5GS0H 4X5LA 1OM3L 5JUEL 3B2VH 4LHUG 15C8L 4XH2B 3MRNB 3NACL 4FP8L 5LCVH 5D1QD 5F7FA 5AZ2L 1JUFB 4LEXH 3V7AE 3K3QA 4EVNB 3P4OA 1YEHH 5I1AA 4JPWH 1F6AA 3WNNA 5F1KC 1HH9A 4U6XA 3UJIH 1LO2H 4KKBD 4CUCA 1FNFA 3TWCH 3FQRA 4XP1H 5IG7B 2EH7L 3TH4T 4KHTH 1UACH 1F13A 3AS2A 3EJJX 4M61B 3OKEA 3MV11 4WEBH 1PW3A 3PDGA 2CLZB 5IQ7H 4UINH 5I71B 2O5XL 1XGRB 3OTTA 3FN0H 1XIWB 2NX5B 1VESA 4RDQF 3MRMA 2VIRA 5KSUB 3D3VE 4I77H 4ZXBA 5KSBA 2AEQL 4WFEE 1BFVH 1LILA 3MRBB 4K9EH 1HDMB 1R3KA 2P46B 2DQCH 4G6AC 1G7LB 5CSZB 3KS0J 5EU4A 5CUSL 3RVUD 3NFPB 4G7VL 1HILA 3AXLB 1DUYA 2IAMB 5DHYB 5CJ5A 1KCLA 3QI9B 2EXYC 1BOGB 3T0DA 3CFBA 3FAXA 5DFVD 3H9HA 3BDBA 4I0PA 2FBJL 5DR5L 2PXYB 1I9RL 1PG7W 3CAFA 3QQ4B 1GZPA 4HIEB 1EZVX 3EHBC 1NMCC 4HX1B 1QD0A 4XC1H 4XB8A 1JYNA 1H8OA 3RUGB 1OAYH 4ODHH 3C5JA 4R26L 4QLRA 5I76B 3DPBA 1A6VL 3D2UB 2WP3O 1EJOH 1NCAH 5I1IL 3QJFB 2XN9D 4RFNC 1YDPA 3PWPB 4ZNCD 1LK2B 4LDLB 5BZWA 4QXTB 3UTPD 4X5WB 4DKFH 1CL7H 3CMGA 3VFRB 2R1XB 2AJVH 3EOAA 4ODXB 3MNZB 2DTMH 4Z7UF 4HQQH 3JV6A 4X6BA 1MCHA 4QWWC 3PIQA 5HVWA 1C5DB 5DC0A 4AEHH 1AE6H 1BD2E 2GY7B 1AR2A 3SKMA 4QHLA 3CLEL 4GG6E 1YQVL 2Q76A 1T21B 1RMFL 1JRHL 1JF1A 5GPRA 1QFUH 3MLTA 3ARYA 1ORSA 2P5EE 4YQXL 4DVBB 5CINH 3EO0A 3T08A 2MFNA 4YO0B 5IHBA 5JPNA 2C9AA 3MA7B 1J5OL 4NJ9H 5EUOB 2EIDA 4MVBD 3B8YA 5DEGB 5B39B 4LU5H 4HF5L 2XV6B 1JHKL 5JA9A 4JG0H 3WN5B 1FVDA 1KB5B 3VXNB 1TNMA 2A9NH 4OTXH 1IC7H 4GS7C 4XVSL 1NDMB 1NAMB 3CSBA 2VABB 1ADQA 5KANI 2ADGA 4R96A 1G0YR 1TPXC 2EDTA 1EEZB 3JVGA 1BIIB 3LB6C 3IDYB 1HHJA 3GMRA 5LG1A 3RQ3A 4X9GA 4NHCL 1MUJB 5DJZA 1N5AB 1WBYB 1Y0LA 3UCRA 1BQHA 1IGJA 2DQUH 5T3ZE 5D7JC 1S78C 1R3JB 3DHMA 3EFFB 1JHLH 5GJSH 1MRDH 1NGPL 1NBZA 5FF6B 1A4KA 3MODL 4QGYA 4W4OC 1OARL 2ZSWB 4JHBA 8FABA 4JKPL 4HUUB 1BFOB 2DJUA 4XPBL 4Z76A 4JQXA 3BP5B 4PJBA 4OZHE 3EO1B 3RX7A 3O2VH 1DBAL 2HLAB 1DANU 1NUDA 3RP1A 4M1DL 1UZ6F 4TVPE 1XMWA 5HXMA 2UYLB 4XCEB 4U6HA 1OPGH 3DVIA 4I5BB 3ILPA 3CPLB 1MCWW 4M7ZB 2D31B 3VW3H 4XVTH 1Z9LA 2CGRL 1YNLH 3MRRB 3C5SB 1I7ZA 2NCMA 3L5HA 1X7QA 3LKPB 5LGJA 3G08B 2XN9A 2P8MA 2J4WL 1L9NA 5F71A 3PUCA 3CFEA 2V9QA 3KAAA 3BWAA 4Z0BH 1IQWL 1GZQB 2WBKA 4P5MA 1R5WA 2AXFB 4LLWA 5L8JB 1KCSL 3C08H 4ONHB 1JFQH 3G6JE 1IEAB 2PR4H 5SX5H 1G84A 3NIGF 1AP2B 4OIIH 4LSVL 3QHZH 4E41A 4K94L 5KS9F 5F9WC 5BO1L 2EDRA 1QO3B 2FZ3B 1CD9B 3HNSH 5I1JL 1E4XI 2XWBA 3FB7B 3KLAB 5IESL 4WUUE 4PJFE 3HAEB 3WMSA 4CMHB 2LABA 4X9IA 2X44D 1HSBA 2X2YA 1RIHL 2FJHA 1CG9A 1S7QB 3CVHA 1T03H 1Q9KA 4D9LH 3HCVA 4HCRH 5KZCB 4NKIH 4PJCB 5DK0A 3BH9A 3G6AB 1S7UA 3LDBB 1WISA 4HUWA 1M7DB 1BGXH 1PYWB 5FYKU 1KB9J 4D0DB 3M17B 4XCNA 5FUCC 2EDWA 3BIAX 5FM5O 4PGEA 3HMXL 4PRHD 3OR7B 4KZEL 5JHLH 4MAUL 2HKFH 1EAJA 5C0BA 3PQYE 4F58L 1UH3A 2EC8A 1NCWL 2X4RA 4ZOEA 5FB8B 4FNLL 5EIQA 1AFVH 1ORQB 1ZHNB 3WL9B 2WUCH 3VFMB 1FFRA 1WWCA 1NFDA 2NY1D 1JPFB 3ECBA 4L4TB 2MNUA 5FA3A 3G5XA 3O4OC 3K80A 2A73B 4ZTOL 1B0GA 5HHOB 5C2BL 2H9GA 3MXWH 2YZ8A 2G2RA 2DBLH 3V6ZB 4FRWA 2AJ3A 4PB0L 5MERB 4G5ZL 4UILL 1FL3B 2IQAB 3KPRD 4P4KB 3X14B 1T0NB 2WUBL 1LO4H 2UZYB 4F9LC 1R3LB 2ZKHH 2X4PB 5B3JF 1PFCA 1ZHLA 3VFWA 1NKOA 2CDFA 3MJ7A 3L3KA 5DMKA 2F53D 5IBTH 4TSCL 3UTZB 5DEZA 4AK1A 3V52H 3D25B 1QFOA 3O3AB 2ERJB 5CKAA 2QQKL 5A16B 4GKSB 4MNQD 1IQDB 4HWBA 1L7IH 2ZOKA 5FYLE 2W0LA 1GJIA 5A3IC 1FNEB 1FFOB 4Z78A 5MHSD 3CSYA 4NQCE 2DAVA 2MMXA 2Y6SC 4TPRL 2ICWB 5ACZA 1U8IB 4ZQKB 2WLYA 2OS7A 5E56A 5L88H 5M94B 3DIFB 4Q9RH 3LH2H 2E3VA 3I3BA 1KXVC 3MACH 3QO0A 4XBEL 5IT2H 1ZLUH 4N8CH 1PBYA 5CP7A 4Q58C 4OV6F 3ES6A 1ZGLA 3BPOC 4RFOL 43C9A 3WIIL 2EDJA 5GSRA 5IP4A 1Z9SA 3RWGA 2HT2C 1S7XA 2XACC 4NQSB 3TO4D 3C60C 2R23B 2W59A 3AB0C 2NZ9D 4PRDB 3EDJA 1NGWB 1TZGL 3D9AH 3RUGF 3LQAH 4ODWB 1RVFL 4JANB 4TVPH 5IMOA 4Q6IA 1KT2A 5F7MC 3GSNL 4KK8C 4XWGH 1WF5A 5ILTH 5EO1A 1MWAL 3M07A 4N8VG 1S7RB 3QCUH 2Z31C 4NNXA 4Q9BA 3K4ZA 4F15C 4E5XB 3ESUF 1CE1L 5BVPH 2CJUL 4KVNL 2VISA 1IGYB 1IL1A 4YDIL 1CXEA 1AKJB 4NP4L 5F3BB 2OTUB 4PRHA 1G7HB 5CZXC 5IROC 2LQRA 3GSQA 4CJ0A 4ZO6A 1TZIB 2QKIA 1HEZA 1MWAA 5E99L 3DBXA 5IVXF 5K93A 1FLRL 5FOJA 3MREB 3MA9L 4ZPTA 5E5MA 3MBXH 4P23B 4Z77B 1Y18B 2BSED 5T5NF 1VFUA 1HHIA 5EZIH 2KQNA 2N56A 4ZD3H 5EUOF 5DMIL 4R2GD 3BPCA 1LEGA 5FGCE 1W72B 3O81A 3O6LL 4JZJB 2FL5B 4DZBA 1K3IA 2E6JA 3D0LB 1F45A 4ZOAA 2CPCA 4LFHD 2D0FA 1DVFD 1AI1H 1TTUA 3Q5YA 5I18H 1QBAA 3DX8B 4OFYA 5J1TC 1Q9WB 4XVJL 3MLSH 3P9LA 3T77A 1CD1A 5TQ0L 5EOQL 4C59B 3QCVL 1LQSR 3BP7A 3KPRA 5JDJA 1WJ3A 1JI2A 3RHWK 3H42L 3FO0H 2CLVA 2KDGA 4KDWA 2OL3L 1OSPL 3TP4A 4OCYH 3DVFA 3ARBB 2DM2A 5T33H 3DLQR 1XF3B 3MV01 2F53A 3WKNA 1JNNH 5SX4I 1F3JA 1ZHKB 4K7PY 4F2MA 4HIXL 2LVEA 3GMPB 3T4YA 5E7FA 3ISWA 3MMEB 5IB4A 2R39A 3CFCH 4LLVB 1S5HB 2IF7A 4F80A 4MNQA 2XT1B 4MNGA 3T0EE 3L3HB 1A7OL 4GAJH 3ZE2E 1PZUB 1KG0A 3X11A 3ME0A 4S11A 2BSSB 2OL3A 3VI3F 3V6FB 2EDDA 4LSPH 4Y5VB 3VGDA 1DQML 5GGVH 4PP2A 4OV5A 4PUBL 5DT1L 1T4KB 3UZEA 5HDQH 4C56E 3KXFB 3D87B 1ES0A 5TDOB 4JJ5A 4MD4B 1A6PA 4JO2H 3O41A 4UTBL 4O58L 4MNHA 1P9MC 3BAEH 1UB6B 4NRZB 1A6WL 1I3UA 1WZ1L 4MCZB 1JIBA 4R4BB 4V2CB 1MEXH 3SKNA 1CD8A 2SEBB 3NIDE 5CIPA 1N8ZB 5DD6A 3TO4A 4U1JA 2J5LB 1A6AB 4PV8B 3T65A 4WHYG 3K2MC 4OZGF 3QNXB 3NMEA 5ALCL 4P5KA 2O26U 3FN3A 3QH3B 5CILL 1WTGT 4BSWB 5IMLB 4QTHA 3OKDA 5CD3A 1WVZA 3C8KA 5DD3H 3NPZB 5FYLH 2C3XA 3R4DA 4GMSL 3GBML 1H3XA 3FL7A 2VLJD 4Y16B 1C08A 3K8KA 4GW4A 3T8XB 1OAZL 4YX2H 4J2XA 3MV7E 1MAMH 4RAUA 1FGVL 4FQXB 3VFPB 4U1SA 2OK0H 2XIDA 3WUWA 1F4XL 3S36L 4G8EA 4DAGL 3L5XL 5F1IB 4DGIH 4YHKH 4EI5D 3KPSE 3RTQB 4YHNA 2BNQB 3AREB 3G6DH 3O8XD 5HDBE 3VGBA 4J3OC 4XBGB 4NFCA 1GXEA 3PHOB 1DBMH 2H32H 4IRSC 4HFUL 1U36A 4B7IA 5CZVH 1F4WL 1LO0H 1P2CB 3P0GB 5DS8A 1F4YH 2APVA 4LEOB 2ZCKH 4OKVA 1OWWA 3TPUB 2EXWD 1WK0A 1LE9B 4LHUB 4XTRD 2BC4B 1NMAH 4FXKB 3MUGB 1DVFA 2F58L 4GRMA 3LVEA 2YBRA 3L5JA 4DFIA 5F8QC 3RL2B 4FFYL 2HTKD 3WO3B 4A6YB 3ARRA 3ETBF 3D18A 2AJXL 1G9EA 3REWB 1TJIH 1F11B 3SBWC 1MFCH 3SEPA 5L2JB 5ERWB 1C5BL 2DQJH 1FAIL 1FIGL 4JFZH 3KLDA 3PXHA 1FG9C 4HPOH 3DURB 1NEZA 1A1MA 4F37K 4KMLB 1V7NH 4UTAL 3TN0B 5HVHB 3C6LD 4YHML 5I15H 2V6HA 2IALA 1OAXL 4HGWA 3HLAA 5F70A 2VDMH 5TDNA 5C9JB 4UNUA 7CGTA 4CVZA 3BPLC 3F58L 1BX2B 5K59F 2J88L 2PYEA 3QJHB 4KXZH 4K7FB 3MV8B 3M1BB 1R3HA 3QRGH 5D1XC 4CADB 5I66A 1J8HE 3WXWH 2BK8A 3BD5A 1E28B 2JCCF 5GSVB 3SKJH 1E27A 4DCQA 5C0JA 2VKXA 5B4MD 1DE4B 3V8CA 1P4BL 2HN7A 4HZAA 3RI5K 4G80A 1X5ZA 2A74A 3T2QA 1BMGA 2FO1A 1KBGL 3QUXD 1YEFH 1OT1A 2AEPL 4WGVB 4PB9L 5E1AB 2H2SD 1U8KA 2GCYA 4ISVB 2QSTA 3RGVD 4YHOL 3P77A 5IMMA 4CL7A 4M3JA 4K3DL 5FXCH 3KPPA 2CLRB 3X12A 1UYWH 1HQRB 1GYAA 1S7VB 5E08L 2AQ2A 1NLBH 1KIRB 3MYZA 3PGCA 4PJGA 3O45B 4ZAKC 2OTPA 1SBSL 1WBZB 5DD0H 5BQ7B 4RZCA 4HWZA 4JHWH 3QDMB 1MCCA 5FHAH 3VD4A 1I85C 4PRPD 1VHPA 2RBLA 4OKDA 5F9OH 4JFEB 3H0TB 5CGYC 3W39B 4ORGB 3ARSA 2AJZB 5DQDH 2LAGB 1ZA3B 2VLJA 4F9PC 1PKQB 4UIKL 1I1AB 4RWYH 4TOYH 4Z7QF 1SM3H 5JW5A 3HE6C 4ZFFB 1MRFL 4TUOB 9CGTA 5L6YH 5IQ9B 3QG6B 1JGVH 1RK1A 4IDLA 3O8XA 2ZCLH 4AG4H 4K3EH 4YR6B 3J7HA 2Q8BL 1ZGLP 1IGTB 3ZDZF 3SQOL 2VSCA 3IS1X 4QRPD 3MZTA 3HN3A 4UOW0 3I6GB 2OP4H 2Y23A 4PV9B 1H15A 4PRAA 5KSVB 4DVRH 3GNMH 1N0XH 1S9KC 1QBML 2YS4A 2DLHA 3PL6D 2ED7A 5IMKB 4PJ9B 2ZUUA 1ZT4A 3N1QC 1SJEA 1KXQE 3ROLB 1MFBL 4Q2ZA 5FHBH 2VL5B 5CMAA 5E8NA 2YR3A 4L8SA 2NY7L 3VXUE 3LMJL 3THML 3L6FA 5I74C 2APXA 4ZUSB 2OJEA 4GMTL 4U0QB 3NVQA 4OLWL 1RUAH 1U42A 1WITA 1PLGH 3F5WA 4HMDA 2Y5TB 3UAJC 1N2RA 2VXQH 3BRGC 3S4SG 3C09B 2JE8A 2YUXA 4AENA 4PRBA 1U8QB 1BQHG 4R0LB 4MHHG 1YNTB 2V2TB 3N85L 1DQLL 1KF9B 4NQVB 4PP1D 4P2OB 2BCKB 1KTRL 2LFGA 3C6LA 4CAGA 5CJQL 3P0VL 3W0WE 4HWEH 3MCLH 2VQ1A 1IGCH 5BMFL 2WIIA 1RUPH 1D6VL 2NXYC 2AV7B 3EDDA 5HHXL 2FO4A 4JHZA 5ALBL 3W2DH 2CIKA 4GAYB 4B0MM 3MRDA 5LBSL 5J1SC 4X4XA 4XMPH 1Q72L 1VSCA 2HT3D 1RULL 4M7KH 5T3XE 3F12B 4RMSA 3TBTA 4U1LA 2YA0A 2L7JA 1NJ9A 4OI7A 2ATKB 4QRSA 4XP9H 1QYGL 4HC1A 5BXFA 3QUXA 4KFZC 3T2NL 4FOMA 1YC8A 4L3AA 1CICD 2BRRH 3RGVA 1KYOJ 4CN4A 5D71L 2G9HB 4JG1L 3WFBL 5HGBA 4P9HC 2ARJA 3RIAK 1F8TL 2DQDH 1P6AB 4BKLB 2DQGL 4NM4L 5AD0A 2HTLC 1J12A 4J3UA 5EA0L 1JWUB 5GS2H 3BKJL 3LEVL 3GMOA 1NBYB 4PRPA 1RURH 1VPOL 2FEEI 5FK9B 5J13B 2HWZL 4RISH 4X8JB 1BQLH 3DGGA 1S7TB 3AM8A 4W6WB 4I48B 1RSFA 1CVRA 4GUPB 5INCB 3HZVB 3BEVA 2ZPKH 1I3RA 4EI6B 3UJJL 1OP3K 2GQHA 5F1SA 5CBEB 2YKLH 4NSKA 3RL1B 5GS0D 5JQHC 1G7QB 3ARZA 4WI9A 4D9RD 1BZ9B 1HCVA 5FA4B 2FCBA 5DA0B 5DJ2A 3ULUD 3V6BR 3MYJA 5HGHB 4QRPA 4MA1C 3ARFB 3P73B 5J3HD 4WFHE 4WDIB 3QUZC 1DL7L 3C6SA 4JN2A 5ACLA 3QG7H 5CEZD 3IFLL 3PL6A 2O5ZL 4WNQA 1FZJA 3MJ8A 1CU4H 3LRSA 3HPJB 1H3UA 5D2LE 5E5UB 3RA7H 3IU4H 2HKHL 5F7EH 4L8BB 5FOBA 3RWEA 3VRJB 2EYRB 2AV1A 1P84J 3GSRB 2CXGA 1FO0B 1XGUA 1EHLH 4O2FB 1MHEA 4L1HA 1S9WA 1CT8B 3QCTL 2B7DT 1TDQA 1V3JA 5KW9L 1OAKH 1R24B 1YEKL 5F3HA 3C9NB 5D1ZB 1PJ9A 1HH6A 3BXNB 2AABL 3RKPA 3V79C 4GLRH 4Y8AA 4XAWL 3RPIB 2OXGA 3RWFB 3KYNB 2PCPB 4RFEB 4M7LL 3BT2L 3EYUH 2R1WB 3B2UD 2R9HD 5E2VH 4IDJH 3FOMB 1EEQA 4MXVE 1R5IB 1DCLA 3QDGE 1KGCD 4GBXA 5K9KB 4J4PD 4Y5XB 5F8RC 1G9NC 1V3MA 4Q7DA 3B9KA 2VITA 1CIDA 4NJAH 3F62A 4LNRB 3QUMA 3L5WB 1A7PH 4PJ7B 3TO2A 5JHDD 2R4RL 1CICA 5HHME 1HWGB 5IHLB 4RNRA 3KPOA 2DYPD 2FX7L 4LSTH 1KPUA 5K9OB 5EO9B 4PJEE 3IVKA 5ANMB 4Q9QH 3QEQB 3MLXH 4IRZL 1XR9A 1KIPB 4TTGA 2NYYD 4MA8H 3T0BA 3Q3GA 5GS0L 4CNIA 3MNVA 2F74B 1U3JA 2YD9A 1RIVH 3ZE0F 1LDPL 4NO2B 2YA2A 3A6CL 1EO8H 4R8WH 3B2VL 2P4AB 3ULUL 3SN6N 1OGAE 4PJIB 3HI5H 3FT4A 4LMQE 2JIXB 1MJJB 3VXMA 1T04A 1FNLA 4XNMA 4O2CA 3HE7D 5CEZL 1CFSB 4KK6D 5T3XH 5DYOA 4ELME 1T66D 3UJIL 1TVDA 2YA1A 4KTYA 3MOAL 4X7FC 5E4EB 1SEQH 3MGTB 5HDLA 2YD8A 1NGXB 3ARDC 3VG9C 3SPVA 5FCUH 4XP1L 3FQUB 5FO9B 3GI9H 3MV8E 2P5WD 5J11B 4P9HH 4WEBL 3FQXB 4G9FA 1QRNB 5EU5B 4Y4HB 5IQ7L 2BSRB 2IH1B 1I8MA 2YHGA 5JO5A 2L0DA 4FQHB 4S1QH 1RK0A 4C4KO 3MRCA 3HNTH 3KWWA 1IBGH 1OCWH 1W0WA 2PW2B 5D2NC 3VFTA 3QUYD 1IZKA 1A0QL 1ODAA 4G7YH 1KXTB 5DJXB 2BVOA 4Y1AD 3RVXD 4RA0C 5CJXA 1BFVL 4F7CB 4KI5E 5ETUB 4LVHB 1U2CA 3WKMH 3RZCC 5MEQB 1I1YA 3IGAB 2KL6A 4NUJB 1FRGL 5FKPA 4QRRB 1MCWM 1RUMH 2VDLH 3MRFA 4OLVH 3VFSA 4YLQT 1IEHA 2Z8RA 2R0LL 3TZVD 4J3WA 1LNUA 4LCWA 1KV3A 5I1DA 1KTDA 5DK2B 3SDXA 5C09B 1BF2A 1PKQE 4MQXC 2FIKA 1DN2A 5IF0A 2PETA 3ZTJG 3QEHB 2VWEE 4P5TD 4GRLD 4S2SB 4WI2A 4XC1L 1HE7A 1X5JA 1OAYL 4TNVF 4ODHL 3VXSE 3OGCB 1E4KA 3I75A 4WI7A 3EIFA 4PREB 1K8IB 1WAAA 4UNTA 4J4PA 1BFTA 1A22B 4PYHA 4RMQA 3QIUC 3ZT5A 5ISZA 2BRQA 3JBG7 3DROA 3QIWC 4DKFL 3JWOC 1CL7L 4YHYC 4Y0GA 2AJVL 1T6WA 3LKRB 2X41A 1NCTA 5CJBA 5ID1A 2DTML 4NPYB 4HQQL 3OG6B 3U30C 1XH3A 1G7JB 1TQCB 1IARB 2Y07H 2WAHA 2HJKA 5GRYA 2DYPA 4H8WL 5DRNA 5F1NB 2GK0A 5JIKA 3DXAE 3TA3C 2R1YA 3KNBA 2B20A 3D3VD 1QFUL 3EOTH 4HBQA 1UKQA 2E7HA 4MB5A 1S5IH 4KUCF 3NZ8B 4NT6A 4WFED 4EZMA 4PJXE 1IM9D 5CINL 4CU8A 3HI6H 1X5IA 5DGQA 5CD5D 4QOKE 3K81A 3HKFA 4NJ9L 4KTEH 2DI7A 2A6KA 3ARVA 1CTNA 4LU5L 1DUZB 4ODTH 2ZG3A 3HG1E 4NRXA 3HI1B 4M6OH 2CK0L 4JG0L 4P2QB 3TEUA 3GZKA 2EXYD 2AEWA 4J8RA 2OQJB 4OTXL 2A9NL 3DV4A 5EULV 3UTQB 1A1NB 4BFGA 4ZS7H 1IC7L 4L9LA 3D5OF 4MDIB 3LKSB 3QWQB 2CR6A 2W0PA 1BVKB 4P9ML 4RGMB 1EH9A 1L4IA 1TZHA 5CLWA 5C7XH 4EBQH 5IB1B 2C1PB 1RZKC 2E7BA 1HWHB 3P9WB 2P5WA 1A6ZA 1KELL 2IANE 3DJ9A 4IOIA 3O3EB 4PTUA 4M6NH 5F89B 3N1PC 2J8UA 1RJYA 3CCHB 2VZOA 4G3YH 4HJJH 1UZ8B 2WBJB 2WWMD 3KYOA 4JFXB 1MF2H 4GFTB 3QULA 3QDAA 4MJIE 2O61B 1U8OB 5DURB 1CDHA 3MX0A 4QRUB 1MRDL 5GJSL 4Y2OA 2D2OA 3QUYA 4G8GE 1BD2D 3GIVA 3NCEB 4Y1AA 1J7VR 1XF1A 1UXWA 3RWDA 1R5VA 4L3EB 4KRPB 5FDWA 3TJHD 5DJYA 5EZLA 2P5ED 1Z5LA 1KJVA 4LFHG 3IJYA 2MPAL 4LLAA 1XCQA 3O2VL 5J4MA 1ACYL 5DJ8A 2FEDD 4XPAH 1NBVH 1RIUL 3TZVA 1IFHL 2XI9A 3L3DA 4UT9H 3W9EA 1I1RA 5K9QG 3ORJA 3TLRA 5I1AB 1G7MA 4JR9H 1OPGL 2P7TA 3AY4A 4HUNB 1F6AB 1RQ5A 4M02A 4Z7OE 5C0EA 4ZUWA 4U1HB 1UM6L 4D8PA 3QEUA 3VW3L 1CLOH 4P5TA 2BFVL 3U0WH 2YD2A 3P9MA 4Z7WA 1YNLL 3QWRA 5IBLD 4HMCA 3FQRB 2YUZA 3CH8A 1DBJH 4GSDH 3LIZH 1EO7A 2C4FU 4POZD 1GPOH 3UYPA 1XF5A 2VZSA 1NEZG 5TFSL 1IAOA 1MVUB 3OKEB 3FB5B 1T80A 3LB6D 3JSSA 2AK4E 5DWUH 4FZ8L 4W81A 2LTQC 1KJ2A 3T3PE 4WI4A 2VN4A 1KCUH 3D39E 4Z7UE 3MRMB 2JJVA 1JFQL 5I30H 2JELL 1IAII 2Y5EA 2VIRB 1EGJH 5JIPA 3QHZL 4MD0B 5D7JD 5T3ZD 5F9DC 4ZXBB 5KSBB 5M7QA 3QWOA 4N0UA 1K4DA 1R3KB 1QNZL 2JJTC 3MLVH 3TPKA 3HNSL 1NMBL 5LXGH 5HI4C 2X1QA 5GGSA 4U05A 2YXFA 5SX5K 3OKOA 1XGPA 4M1CD 4XX1E 5EU4B 3UBXI 1WZMA 1VENA 3CX2A 5HTSA 2F19H 1HILB 3VWJD 1T03L 1DUYB 2ZJSH 1NGQL 4D9LL 5ADPH 4HCRL 4NKIL 3CH1A 3CFBB 4FFVC 1IRAY 3H9HB 3HUJA 5HD8C 4OD2B 3U0TA 2E7LC 4I0PB 4JO1L 1UH4A 3BJLA 1BGXL 1GZPB 4U0RB 1ZLSH 4JFDE 1V3LA 2WBWB 3JWOH 4XNZB 5DZNA 3U83A 2HKFL 1AJ7H 2NY6B 4KTDH 5I6XB 3EJZC 3C5JB 4M6ML 1EERB 4HCRA 2J7LA 5T1MA 4WEUD 2OMNA 4KROB 4X9FA 1Q38A 1MIEH 1AFVL 5CCKH 4FG6C 2PF6A 2WUCL 5D96B 5BZWB 4WTXA 1CGXA 5I75B 4K71C 1AXSA 4PJIF 3EOAB 4MCYA 4YGVA 3JV6B 4X6BB 4KQ3H 3PXJA 5ENWB 2P24A 4FQPA 1K4CA 2Y72A 3TYFA 4JKMA 1MPAH 3GKWH 4UNVA 3SKMB 4QHLB 1QR4A 1F02I 1INEL 4N9OB 2Q76B 1GGYA 2BSTB 4RGNB 1JF1B 1NC2A 2NY4C 3MLTB 4TUJA 1ORSB 5E5RB 1F90H 1LO4L 5L2KA 3EO0B 4GG6A 3MFGB 4LRIA 3NPSB 2NZIA 5JPNB 1TNNA 1S3KH 1C8PA 2DQHH 1JGUH 1H3WM 4YK4C 1BAFL 3F6IA 4WUUD 2P5EA 4YFLF 3OR6A 3MUJA 1WIUA 5DVNA 2I60H 4KKNA 2W9EH 5IBTL 2I9TA 2XKSA 1UVQB 2F8OA 5D1QB 3UX9B 1FVDB 4QCIA 3ILQD 1UZ6E 1RZKH 4M48L 1BJ1H 3WHXA 4O5LH 2Z35A 1YECL 2D0GA 1JYWA 2UY7A 2ITCA 1KLUB 3NH7L 4OLXH 5D7LE 2ADGB 1XZ0A 1FNAA 5I73C 3QP3A 5L88L 5GIRA 3PQYD 5DRWA 3NN8A 5T3ZL 1HHJB 3X3GL 4CU7A 3GMRB 4EOWH 1T6VN 2A77L 2K9UA 3WLBA 3MACL 5JW4N 2YPLE 3NA9L 1OQXA 3GHEH 5ICZA 5DJZB 1KCKA 4K8RH 1K6QL 3L3JA 4KKCD 1F97A 4ZDHA 4XXCC 4MYWB 1BQHB 3H3BC 4BYHA 1IGJB 4JREC 3V4PH 4D3CH 1H3TA 1ZLUK 5J12C 3T3ME 4FTVD 1NBZB 1OTSC 1I7RA 3LAFA 5D7JA 4KK9C 1A4KB 4Z5RA 3G5VA 1ZEAH 1ZTXH 4NDMA 3SCMC 3D9AL 3LQAL 8FABB 1B6DA 1IVLA 2DQEH 3D85A 4I0CC 3RVTD 4Z76B 1NAKH 4PJBB 1UCTA 1FFNA 4YWGH 4DEPB 3B4NA 1B3JA 3HR6A 4QRRE 4X6CF 3ARQA 3ZHKA 4U6YA 4OZHA 3O9WC 4WEMB 5J06A 2ZWLT 4YHPA 3B6SA 3VGAC 4U6HB 5BVPL 4CRPA 2DI8A 3L3GA 3PE9A 3ILPB 3QYCA 1MSPA 4YXKH 4LPYA 4NKDA 5FYLD 2R29H 4CMMB 2FD6H 1PVHA 1I7ZB 4WJ5B 2WZPD 1X7QB 1YY8A 4U6TA 4FQCH 5EIIA 5ID0A 5LGJB 1TENA 2XN9B 3OXRB 3QZWG 1TCMA 2P8MB 2A9MH 4LLDA 5IFAH 1LK3H 5D70H 3OPZH 3CFEB 2WSKA 4NRYA 3BWAB 5EBGA 1U91A 4P5MB 1R5WB 4LLWB 1D5MA 1K2DA 2Q7NA 5EOTA 1AI1L 3SGEI 1ZXQA 3C2SA 3RIFF 3LHPL 5EBMB 3KJ6H 5EOCH 1LE5A 4NBXB 3G6JA 3VGEA 1CIUA 2C3HA 1JJUA 1Y6MR 2IFGA 2XWBB 3HC0A 1XIWD 2RIKA 2VXSH 3R8QA 1X4ZA 1QG3A 3FONA 1QSZA 2FLBT 4ELKB 1FYTE 3FO0L 2H2PC 2FJHB 4AJ0A 3MUHL 1CG9B 5B3JE 4BH7A 3CVHB 1GRWA 1Q9KB 3PGDA 3HCVB 5T33L 5KVFL 1GOHA 4KK8D 5JXAH 1JNNL 5DK0B 2H26A 3BH9B 5E8EA 5I71C 1S7UB 1AIFA 4KC3B 1ACZA 5HYEA 3STZA 4XCNB 3L1OH 4HKJA 1NCBH 4PGEB 1V3KA 4XCFH 1KCVH 4GAJL 3WV0A 3MNWA 2VJXA 2OLDA 2UVEA 1CDIA 5C0BB 1UT9A 5KSAC 1UWGL 4LSPL 2X4RB 3QQ9D 1QTYT 1U93B 2XZAH 5HDQL 3IT8D 3PQYA 3SE8H 2F8VA 4BFEA 4DN3H 2Q87A 2BJMH 1FORH 1VFAA 1NFDB 1QFWL 3ECBB 1H0DA 1T7VA 4JLRA 5T1KD 5FA3B 3G5XB 3BAEL 2IAMC 4TVSa 4R4ND 5MP6H 3QI9C 1B0GB 4DQOH 1MEXL 4O9HL 3ZDXF 3I2CL 5EFIA 1QVOA 2AJ3B 3P11H 1T0MA 4K3JL 5DSCA 3ZSSA 1MH5A 1ZHLB 3VFWB 2DIAA 4P46D 5EPMA 5AAMA 2CDFB 4F9LA 3MJ7B 5DD3L 3L3KB 4UOW1 5FYLL 3OMZA 5DMKB 4FFWC 4RMUA 4ZFOA 4DK6A 4OZFG 3VI4F 2EDFA 4DUWA 4YX2L 1CGYA 2OJZH 2OK0L 1HYRC 4ZSOE 1XF2B 2ZOKB 4OBRA 2V9RA 2ZG2A 4DGIL 5DMGC 4Z78B 3CSYB 2J1KA 1I9EA 2WLZA 3T0ED 1RUQH 4CKVX 2CXKA 1KEML 2KZWA 2PYFA 2BVYA 5IHUH 3JTTA 3S3JA 4OLUL 4TRPL 4NQCA 3UYRH 5IVXE 4GQPH 4ZPVB 3QO0B 4M62L 5HI5C 1DBML 3BJ91 4X8XA 1ND0A 4C56D 3BRFA 3ES6B 3GJFH 5J89A 1ZOXA 4YFDB 1DLHA 1F4YL 1VFBA 2EYTA 43C9B 4OGZA 1S7SB 2XA3A 5GSRB 5FM4A 3AVEA 2OYPA 3RWGB 1S7XB 2DKUA 2VAAA 3LPWA 3WN5C 3OV6A 5ESVA 3DOSA 5J0BA 3VXQA 1X5HA 3D69A 2A6JA 4O51A 4BZ2H 5DDHA 2H32A 5FUOH 1LEIA 4DTGH 1U3HD 2DJSA 5FYJE 1A7NH 1QSEA 3VMPA 1I8IA 4Q6IB 4PFEA 1KT2B 1MFCL 5EO1B 1MCPH 4HUXA 2EDEA 1KPVA 2EEDA 2DQJL 5D7IF 4OM1L 4R90H 4HPOL 5ESAA 4HEME 3AGVA 4OGXH 4NN5B 2HRPH 1XFPA 3BEWA 4LCIH 4Q0XH 2VISB 2H1PH 5T1DL 4BFIB 1IL1B 3MV7D 4PRHB 1AGEA 3GSQB 4WO4D 3N0PB 1NUNB 2QKIB 1HEZB 4M1GH 1MWAB 4XNXL 5GS3A 3DBXB 3MJGX 3KPSD 5DUPL 1J8KA 3QRGL 2FECL 5IROA 3ZT6A 4ZPTB 5E5MB 1BP3B 1HHIB 3WFDH 3BPCB 1LEGB 4UT7H 1IC4H 2NY1B 5A2KH 4UUJA 3GBLA 5T1KA 4DZBB 1TVHA 2DQIL 1V7ML 1YEFL 4RQQA 1P4IH 3P9LB 3DRQA 1CD1B 5KVGH 1H8NA 3BP7B 3KPRB 3SGJC 5AG9A 1RZJC 4PJAA 5IB3A 12E8L 1KCRL 4JHAH 3V6OC 1F6FB 2CLVB 2K7QA 2P47B 4P46A 4JRYE 1ZLVH 4JO4H 4MMZC 5F9OL 3V5DB 2YRZA 4D0BA 2EDKA 1KB5L 2F53B 3TYGH 3BQUD 4OB5H 4KJQC 1F3JB 1JK8B 5DQDL 4P2CG 1FVEB 1CF8L 4MZ2A 2B1HH 3T4YB 2VH5H 2VOTA 5IB4B 4OM0H 3CJJA 2V17H 2VMFA 4RWYL 1OOAA 5DFTA 4MNQB 1IEBA 5EO0A 1RZGA 1HYSD 4HAGA 4UBDD 1KG0B 3X11B 4X6DB 5GS2D 2OL3B 3HC3H 3NFNA 4JRWA 4Z7VF 1JGVL 2FH8A 5ITFA 3T0EA 1JPST 1YJDH 2I07A 4PP2B 1TQBC 3FRPA 4LF3A 4LKXA 2ZCLL 4K3EL 4JZNA 5TF0A 1ES0B 4JJ5B 3NCYP 3ZSTA 4F57H 1SJVA 2OP4L 1N4XH 3O41B 1J8HD 2CK2A 3GNML 3IFOA 2R56L 4MNHB 4C56A 1N0XL 2B2XH 4AZ8A 1WIPA 1P9MA 2RHEA 2WWKO 3SKNB 5CIPB 4Q9CA 3VMOA 1L0YA 5DD6B 1CGVA 3TO4B 3LDBC 4AIOA 4U1JB 5GZOC 3MC0A 3ZYZA 3FN9A 4FQLH 4EN3D 4CVXA 1PGRB 4P5KB 1A3RL 2EE3A 1U3HA 5BJTA 4S1DC 4QTHB 4NOBA 5BRZA 1RUAL 3OKDB 4JFYA 1PLGL 3E2HC 3C8KB 4KPHH 2VXQL 2PO6C 5HI3C 4A2MA 2BNUA 3TV3H 1F2QA 2XPGA 2XTJE 1C08B 2XTJC 1YA5A 2IEPA 4GW4B 5CGYD 2HFFA 2ZSVA 2ZCHL 4RAUB 4U1SB 1MCKA 3P4MA 3K74B 4G8IB 4HWEL 4G8EB 4KMTL 5F6IB 1IGCL 2XY1A 3MV7A 3DX9A 1ZAGA 4OF3A 4PD4K 1RUPL 2A0LD 5FUZH 2BY1A 4YHNB 4RX4D 3IDIA 1CXKA 3N9GH 3FB8A 4WO4A 1UWXH 4P4KC 3W2DL 2Y06L 3KPSA 5GXBB 2BHZA 4XMPL 3VA6A 1PD6A 2JCCE 3HFML 4U1KA 1WFTA 3B3IA 4M7KL 5DS8B 4R2GB 5C0GA 4IRSA 1MJ8H 1IC1A 4P48A 2LU4A 4OKVB 2YOCA 2Y7QB 5C0NC 5FYJH 3SO5A 4TQEH 1EMTL 2FHCA 2ERJC 1DVFB 4GRMB 2YBRB 2BRRL 3WXVH 4G6MH 5JXED 2PW1B 1QSFE 3DUSA 2LU7A 2O93L 4ZG1A 4JFQA 2DQDL 3D18B 5C0CE 2IQ9H 4E41E 1JBJA 3VXUD 1ZV5A 1X44A 4O00A 1D6EA 2BVEA 2WQ8A 2ICEB 4HUMB 4KDVA 4I2XE 4GAGH 5KVDH 1FNGA 1NEZB 1A1MB 1BQLL 2X9XA 3PWJA 1CXIA 5DJAA 2IALB 1JGLH 3PJSA 1CLYL 3HLAB 4HGWB 5TDNB 2COQA 1K8DA 4CVZB 4JFOA 2YKLL 3E1F1 2FRGP 3SJVE 3W0WD 2PYEB 4MAYC 3KPMA 1R3HB 1B0RA 2NXYD 5I66B 4TSAH 2Y36H 5C0BE 3ZDZE 1AKJD 1E27B 3FB6B 4NQTA 5D1XA 4F7PA 3T4AA 1J8HA 2HN7B 1AD0A 4QRQA 1C5CH 3QG7L 5T3XD 2A74B 2R69H 5JQ6H 5DJCA 1U8KB 2GCYB 3RZWA 3T1FA 3TIEA 3EKCA 3P77B 5IMMB 2ARJQ 3KPPB 1LO5A 3IFPA 3X12B 1NUGA 4NKOA 5C6PB 5ITBL 2VSDA 2W0FA 3PGCB 3MJ6A 4PJGB 4WW2B 3BMWA 4RZCB 4HWZB 1H5BB 3V95A 3KPNA 4ONOA 4M7JL 4ZAKA 3KLHD 1SJXA 1W8NA 4P23C 1S8DB 4OD3H 1I85A 2JLLA 3EYQD 2DQFB 2VLJB 2UZXB 3HC4H 5D72H 1ADQH 2RCSH 2ILLA 3OKKA 1UM4H 5C3TA 4F9PA 4YZFF 5JW5B 2OR9H 2ARWA 3P40A 4XCCH 4XPHH 4OF8A 4LKCA 3HE6A 1RK1B 3EYUL 3DO7A 4RX4A 3O8XB 4NWUH 1KNOA 4Y4KD 3O6KH 3HR5A 5E2VL 5F7HA 1DQQA 3IDNA 4XP4L 4X7SH 5GS1C 4M93B 2H6PA 4IS6A 1UCBL 3ZKSD 4HT1L 4G6FD 1H15B 1ZKAA 2VXVL 4PRAB 3ARBC 4X80L 4KZDL 3N06B 4WFHD 3CDYA 3DYOA 4GLRI 1ZT4B 2AXGA 4NJAL 5EU3A 3ROOA 1AGDA 1TETH 1BWMA 1SJEB 1B4JH 3O2WH 5I1CH 1AXTL 4N0CC 1A7PL 2DDQL 2YD1A 4Q2ZB 4ZUVA 5CMAB 5E8NB 5JXEA 4L8SB 2BXZA 1W2KT 4PR5A 4PTTB 4XPFL 3L6FB 1P7KA 3IDJA 2OJEB 3U6RA 4NKMB 4Y5VC 4P3CH 3F5WB 4MA8L 5F96H 2EKSA 4HS6A 3RY5A 3RY6C 1N2RB 4Y2DD 4AENB 1RIVL 3KPLA 4PRBB 1FN4A 3IRPX 4NFBA 1EO8L 1KTLA 1MCQA 4U1GB 1L7TL 3HI5L 4NCDA 2DKMA 2YD4A 4FQQA 4LHQB 3C6LB 1JWMA 4BZ1H 3GM8A 2E8YA 2VQ1B 2NY3D 2WIIB 1HKFA 3I3EA 1FVCA 1PDKA 5T3XL 3NZHH 3W0WA 2FO4B 1MY7A 2CIKB 3BHBB 4FQXD 5DJDA 3MRDB 1SEQL 1RY7B 2V5SA 4X4XB 1BIHA 4W4NA 4ZNEE 5IBUG 1A6UH 3GI9L 3RTQD 4YC2C 4YDJB 3VD9A 1GGBL 1Z6JT 3TBTB 1XF4A 4U1LB 4DJMA 3QDGD 4LP4A 4QRSB 1E4XH 5BXFB 3QUXB 4Y16C 4I3SL 4S1QL 1INDH 2LV4A 3RGVB 2ADJA 1IBGL 2R15A 3P30L 3EO9H 1OCWL 3RGHA 1JWSA 4OI9A 3LPGA 1FV1A 5TPWH 5HGBB 4X6DF 2ARJB 3KJ4B 5HHMD 1SY6H 1Z3GH 3KYKL 5HYJE 3CXDH 5H35A 5AD0B 3AREC 4QHUA 1UB5A 2GUOA 4U7SA 1GGTA 3CDFA 2CD0A 5HPOA 3GMOB 4PRPB 3UROR 3KR3L 2J8OA 4X6EA 3SE4C 3SQBA 1EZVY 3QNZA 2X89D 4GXUM 3DHJA 5IFHH 3A67H 2KUTA 3DGGB 2D7TH 5GRVL 2C3VA 1ZT7A 1JCKA 4M9PA 1YPZF 1OGAD 3BEVB 1I3RB 1QSVA 4G9DA 3CSGA 3LKNA 1FSKB 3MXVH 4HG4J 4MJ4A 4NSKB 4QF1A 2I9LA 1J1OL 2C26A 1Y6NR 4MNGE 3TN0D 4Y4KA 5DJ2B 4KK5D 2D03H 3WDJA 2GJ6E 1MOEA 3MYJB 4K07A 1U8MA 4Z7NF 1KC5H 2P49B 4QRPB 4LAQH 4POYA 1U3ZA 3C6SB 4JN2B 3MV8D 5GJTH 4WNQB 3PL6B 1FZJB 4NUGH 1DEEA 4RRPA 3QUZA 3LRSB 3MV9A 5HVHC 1I1FA 4TTDD 2Y07L 5I1LA 1AQDA 1PG7H 2PTVA 5D2LA 4JY6B 4YHIB 2NY5C 5FOBB 1U0QA 3RWEB 1CK0H 4S1RH 4JZOA 3E3QC 5D93C 1QHOA 3EOTL 3HPLA 3KHOA 1XGUB 1S5IL 2VR4A 1MHEB 4KI5D 1N3NA 1S9WB 3HI6L 4Y2DA 4KV5F 5GHWL 5F3HB 1REIA 3O6MH 1HH6B 4G6KL 2F9BT 4P49A 5L7XH 4ODTL 3DI3B 5GGUA 3RX8A 1BECA 5BCAA 3GHBH 1F58H 4M6OL 5IEKA 4OIAA 2R0WH 4I0KA 3I9GH 3BYYA 4P2YA 4HLJA 3Q1SL 1UJ3A 4WW1A 3PDOB 1F3DJ 2J6EH 5C7XL 4JEGB 4EBQL 2EZ0D 3OL2A 3RDTD 4P57B 2Z91A 1IC5H 1ZS8A 4GBXB 3VRLE 1B2WH 2NTFA 3CXHJ 2VITB 3LZFH 2CDEA 4DKEH 1QLEL 3QDGA 5ICYA 4M6NL 4L29A 3TCLA 1MHHA 1B9ZA 2ITDA 3O2DH 4G3YL 3SHSA 2G60H 2GJZA 4HJGA 3TO2B 4OZFB 1OTUC 4A6YL 5IW1A 35C8L 1CICB 1PG7X 1UM5L 4RNRB 3KPOB 4HDIA 3TT3H 5BV7C 1SYVA 3L3OA 3BW9A 3IVKB 2ZZUT 4PJ9D 3VA2C 4ENEC 7FABL 1QA9A 3ESVF 1XR9B 4PLKC 5A2IH 2VLLA 4PJEA 2VL4A 4JY4A 3TA3D 5EU7C 3DXAD 3Q3GB 4LSSH 3MNVB 1ONQA 3AFLA 3FFDA 4QOKD 4UB0H 1A7QH 1MCOH 3FT4B 3VXMB 3UJTH 4XPAL 1NBVL 1T04B 4XNMB 5DHVB 4O2CB 5I1EL 1OGAA 3DX6A 3HG1D 3RI5F 5FAAA 3GRWL 3GBNH 5DYOB 1QKZH 1B4RA 4P2OD 4J3SA 4NQXA 4WW2F 1CLOL 5GISH 4J3XA 2X10A 5FO8A 4M6AA 4ELMA 3SPVB 2VUOA 2PYEE 3CIQA 1X3DA 4GSDL 4ODVH 3LIZL 2A6IA 1GPOL 4I9WE 1YMME 4G9FB 4U1NA 1C16A 2QHRH 4K7PL 4R0LC 1A7RL 2IAND 5LWYL 1RK0B 3MRCB 3BI9X 5ESQA 3AMLA 1KJ3L 4WVRA 3N1GC 5I30L 4WUKH 3VFTB 3AAZA 1OHQA 4MJID 4LSUL 2BVOB 1PY4A 4HS3A 5J1AB 3HZMA 4OSUH 3MLVL 4G8GD 4PJHA 6CGTA 2FX9L 1BLNA 1KLFA 4K8RD 1DQDH 1I1YB 5DI8A 5FKPB 1M7IA 3RZCA 2E27H 3VJ6A 3MRFB 1JPSH 2F19L 1BBDL 5HGAA 1YYML 3VFSB 1NCCH 3FFCE 5ADPL 3W9DA 1EGJA 4XGZA 1LNUB 5EU6A 5I1DB 3SDXB 3WJLC 4IJ3B 25C8H 5CEXA 1QOKA 3VFOA 4BQ9A 2FIKB 5GGSY 5IF0B 1ZLSL 5IB2A 4LRNL 2VDRH 1RZIA 1AJ7L 1RJLA 3TNNA 3KGRA 1IGMH 3I75B 4KWUA 4HK3N 4MB3A 2X4QA 3RDTA 4FABH 1MIEL 5DQ9A 2KQMA 3VXSA 5CCKL 2NY5H 5ISZB 4H1LA 3DROB 4ESKA 3O3DB 5J13C 1CVSC 2EH8H 2AK4D 5ID1B 3QIWA 2VZUA 4KQ3L 1XH3B 5SWZE 1NL0H 2OSLA 5GZND 3WD5H 2HJKB 3E0GA 4EDXA 2DYPB 2VLKA 3GKWL 3FRPG 3D39D 5DRNB 4JM2D 2GK0B 3MRIA 2VDPH 2R1YB 1QPPA 3KNBB 4QXUH 4BSJA 4NT6B 3FOLA 3SO3B 3TA3A 2IMMA 1D5ZB 1D9KC 3DXAA 4OF7A 4H0HB 5DD5H 2OZ4H 5LKNA 2WW8A 4N1EA 4LPTA 1S3KL 2DQHL 1JGUL 2V5MA 4PJXA 2A6KB 2APTA 2W9EL 4Z95H 4QOKA 3GSWA 1J0YA 4NRXB 2BXYA 3U48A 2IFFH 4G8FA 2IGFH 2NY0D 4O02L 2NLJB 1N64L 2YEZA 4XHJD 3HG1A 3P4LA 4KJPC 1QBBA 5E2JA 4L9LB 1J11A 5EBLA 5E2TL 3BVNA 1MHPH 4OLXL 3U9UA 2YRLA 2E6PA 4ONGH 4OGAD 4JFDD 4WGWB 1TZHB 1CTOA 4OLZH 3ARUA 4UV4L 5BV7H 2Q8AL 2P5WB 1A6ZB 4WENB 2VLRE 3DO3A 4IOIB 3GHEL 3IYLW 4PTUB 2QL1A 4I4WA 1Q0XL 2J8UB 4K8RL 1XGYH 1HINH 1RJYB 4Q74A 4ODSL 2IANA 4DUVA 4NZRL 3RRQA 1NCDH 5D1ZC 1HHHA 2IWGA 3KYOB 5J8OA 4D3CL 4NN6C 2F54A 4Y88A 3WIHA 4C58B 2J12B 3QUYB 4JM4H 5KJRH 3GIVB 5ELIA 4MJIA 3A6OA 4Y1AB 4H26A 4DOHB <