3UDWC

Crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell immunoreceptor with Ig and ITIM domains
publication title Structure of TIGIT immunoreceptor bound to poliovirus receptor reveals a cell-cell adhesion and signaling mechanism that requires cis-trans receptor clustering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3udwC00
1CR9L 3CU7A 5HHXH 5B39G 4Z0XA 1W0VA 4YHNA 5JPMA 1EUUA 2I25N 2VLLB 2R1WA 4D0BB 3AREA 4NRZB 4NGHH 4WRLA 1CZ8H 3UDWC 3FONB 3FFCA 3UTPD 2DYPB 1A6WL 4PJHA 4HQQL 5F9OL 2J7LA 4DVBA 5GJSH 1BZ7B 2O5ZL 1J88A 3UXFA 2VDOH 3LKNB 5DQ9B 3DRTB 2JKXA 4KZDH 4JKPH 1G7JA 4OGYH 5DJDA 2PN5A 3ZHLA 3CFEB 5IVOA 4I3GA 5CGMA 5FGCE 4GG6E 1A14L 3X17A 1NAML 5GRJL 5DFWH 5HHPB 1YEFH 3TPUA 4NCDA 1TVBA 1SQ2N 4Z7UE 3VGEA 4DGYH 1H3PL 5E7BA 5M95B 1MCJA 3IXAB 1QNZH 5D7LB 1XR8B 5DI8B 5EO0B 3O9WA 2ATKA 1WC7A 4KKLC 3CSYB 2GEEA 3O0RL 4A2LA 4PR5B 1MJ7L 3RTQD 4ZAKD 4HWUA 3S35H 1A4JB 3HC4H 3MGAA 1I3UA 2VXTL 3G6AB 3BJ91 3MRPB 4NNPH 1ONQB 2NLJB 1VB9A 3MLUH 3QXAB 5CJ8A 3O6KL 4G9FA 3MLZL 5CMAA 2W65B 3PWUB 4ZUVA 5HDQH 2R56L 4M43L 1SEQH 3CK0H 1T4KA 3T09A 5DVMA 2J5LC 5EG6C 3GSNH 2AEWA 4QYOA 4NKMB 4YHML 1TDQA 3VG0H 4U0RB 5E1HB 1G7QB 5IBTL 4I4WA 1AD9A 3RX5A 3VXUD 1N6QH 1YC8A 2ZSWB 4J3WA 3ZDZE 4GSDL 2IH1A 4XBEL 3BKMH 3L1OL 3T0EA 3EOTL 3MRRA 1MCHA 2X40A 4OZHF 5IIEB 4G6KH 1R5IB 1LEGB 3AM8C 3KPRB 5F97E 4HBQA 4LSTL 1E6JL 4X7FC 2FECI 5LCVL 4O00A 4R3SB 1MCNA 1CLZL 2VR5A 2P49B 5GS1C 4F57H 2HRLA 4EI5B 1IT9H 3CXDL 4JY5H 1ZEAL 4QF1B 3GMOB 4Z78B 1AD0B 3TCXA 3TT1H 5DR5L 2Z35A 3QI9D 4GKZB 5JQHC 1MLBB 2CIIA 4DUXA 2HP4A 1NEZA 2YBRA 1ZA3B 4N8CL 3O2WL 4U1NB 1I85A 5JQ6H 5L9DL 3WLWC 3VFSB 1NC4D 3BGFB 4RAVB 1U8NA 3AS3A 3FZUC 3EHBD 3ULUF 5INCA 5EBWB 5CEZH 1YEJL 3MJ9L 5IEKA 3X3FL 5CZVL 4CMHC 1U36A 2FO4B 3OGCB 1YN7A 3DUUB 2NXYD 1HDMB 3STZB 3ZO0A 1MF2H 1ZLSL 4M7KH 1KB5L 1IZKA 4ZO8A 5HI4C 3OAYK 5D1ZA 4DKFL 2PYEE 3QQNA 4S2SA 2VWEE 3U30C 3LRSB 3P4NA 2AP2A 4NC1E 1HYRC 4FXKA 3WFBH 2R2BA 4X7SL 4DEPB 2DIJA 1S7RB 2XI9A 3WFZA 4NNYA 4OF6A 4HIJB 4HJ0C 5D7KD 4ZUUA 3UYPA 4ZFOA 1DE4A 2DQTH 2H32B 2HG5A 3FAWA 2YWZA 3OG4B 5FYKU 3ARBB 3CPLB 4G8IB 5FGSA 3EOYG 1ZT7B 4KMLB 2V7NA 5FO7A 5IFJB 5ALBH 5IHZB 5D70L 3LDBC 1B90A 5GS2H 2MCPH 2M8XA 4P9HL 3KVQA 2XTJB 1HNGA 3HCVA 4UBDD 3X11B 4OZFB 2IALA 4U3HA 2V2TA 4PRHB 5DD5H 1G9NH 4CMMB 4JPWH 2D7TH 3P9LB 3QPXL 1XF4A 1IGJA 5E03A 4JR9H 4YGVA 1G9EA 3C08L 4Y5XB 5D93B 3H9HB 1GC1H 1OSPL 5DJ8B 4ZTPH 4HS6A 4LAQH 4M93B 3F7YB 4F9PC 1CYGA 1FYTB 4JFPB 3ARFB 4JM2A 1QRKA 3T0VA 3BEWA 3H42H 3OR7A 3FO1B 1B4JL 5FB8A 3BVNB 3BPCA 3QIWC 4YNYA 4UOW1 1IEBB 1IM3B 4TN9A 1NBYB 4QHMA 3HRZA 3ARXA 5HGDB 4MNQD 3S98A 2EDQA 3ZE1F 2Z8RA 4AH2B 1K6QH 3GMPA 1BM3L 3IF1A 3R0MA 1OAXL 1K8DB 4GG6A 4RGNC 5TJWK 1U93A 5KZCB 4EJ1C 3WFEL 4X4YB 5GGUB 3VXPB 4N0UB 2D31A 3ZKNC 4NO0A 5F1NB 1X5AA 5HVHB 1OAZL 1S9XA 5T1KD 1GSMA 5IBLC 5IWLC 3N85H 4Z7UA 4OFPA 3MV7B 3MV9E 4OD1H 5KSUB 1DQJB 2EEBA 2DQDL 1FZOA 4RAHA 1JNHB 2AQ3A 3BEVA 3DYOA 5C6TH 4DKEL 3HI6H 1NGPH 5CUSH 1T2XA 3I84A 1BD2B 2AJVL 3CZJA 5DT1L 4UDUA 5KSVB 4OI8A 5SWSB 4GMTL 1GGCL 4K7PY 3PWVB 2XN9E 4MQTB 5C09D 4Y88A 1D5MA 3DUSA 1RJZA 1B2WL 1NCBH 3V7MA 2ICWA 2IANB 5E94B 3R1GL 4JFQA 5I2IA 1HQ4A 2BNQD 4HV8A 2GK0B 3QSKB 1RVFH 2A6DA 3EO1A 2JIXB 3LPWA 4LMQE 5CD3B 5HVFB 4MSWA 3DMMC 2B5IC 3TYFA 1EJOH 5DVLA 3L3GB 3CVHB 5I1HL 1QR4A 2F74A 2IH3B 5DJ0B 1ND0B 1T89A 1UCBL 1M71B 3ARTA 4WVRA 3WUWB 4HLZG 3TESA 4PUBL 1A1NB 3K1KC 2CJUL 5GS0C 3GSOB 2YUVA 1N59A 4WI2A 3GMNB 2ZUWA 4X4XB 4KMQA 3LKRB 1EEYB 5JOFB 3D9AL 3SE9H 5MENE 5I71B 5TFSH 1KGCE 4NUGH 2E8ZA 3WXWH 4F9LA 1J1PH 1JNNL 2YD4A 1LILA 1DLFL 4ORZC 4Y5YC 3B9DA 2OBGA 5DJCA 2XZQL 4KJWD 1F4WH 3MLPA 4QRRE 2HMID 1AHWB 2VDQL 1K8IB 1A7QH 2RAMA 3IYLW 4MNHB 3D48R 5SWZB 3CMOL 4OLVH 3UO1L 2XNAB 2VABB 1U3HA 2QADB 1Q0YL 4LCUA 1NMCC 5D7JA 3D1MC 4N0CC 5EC2B 5KBNC 1ODAA 2FIKA 1NBZA 2VXSL 3KWWB 5KN5B 5E6IA 1ZKAA 5J57B 5I1IL 3IU4L 2OMBA 2P43B 1HH6B 5FIEA 2JELH 1KLFA 2CLZA 3MJ7A 4OZFH 4X7CC 4X80L 1S8DA 3KYNA 3HS0A 4XC3H 3T4AB 3NACH 5GZOC 1I3GL 3MJ6A 3L7EB 3GI8L 4Z7WE 1JK8B 1IM9D 2C4XA 3D39E 5IVNA 25C8H 4PJCE 4YBLC 4RMRA 1U95B 2WP3O 2R2EB 4OFIA 4LKXB 4R7NB 4IMKA 4B53A 5BV7L 5JHDB 4J8RB 1UWGL 2XTLA 1S7VA 3BI9X 3KYOA 2DQUH 5ID1A 2ICEB 4XMPL 2BP3A 5H37H 1CQYA 2XXCB 2PYEA 3GBNH 1C12A 4PBXA 5J0BA 3OX8A 4PJBB 3O11A 1B0GB 4MD5B 1T6WA 4KTYA 3ALXA 2Y6SC 4GXVH 3DO3A 5EORH 5LBSL 2HJFB 1E6OL 4H1LA 4X6CE 3QEHA 2D7NA 2YZ8A 1BWMA 4PFEA 5KSBB 2HFFA 2ZUXA 2R8SH 1KULA 1FG2B 1FPTH 2WIMA 4UIKL 1HINH 1XF5A 2WBJA 3A67H 3BQUA 1TZIA 3WNMA 3ULVF 2GJ6A 4KKLD 3WN5C 3RKPA 1YQVH 2VDNL 3BUYB 3V79C 1R5VA 3AS0A 2E5EA 1QO3B 1RUMH 1FCCA 3MO1B 3VWJD 1FNFA 5CEZE 5EN2B 2GAZA 5HYSG 1MI5B 3EYFA 5DD3H 1U8MB 3UTPE 5CEXB 4YX2H 5I15L 4M1CD 1QR1B 1AFVL 2GSIA 1FG9C 5LKNA 3MRBB 4JN1H 4FTVB 4UINH 4NDMA 4P2RB 4AEFA 1KT2A 2JCCB 1DUYB 4QXUH 2PTVA 4DFIA 4UQ3A 3NCYP 3SGKA 3CFDA 1NEZG 1PEWA 4M02A 3CVHH 1PX3A 5AD0A 4YHPB 1OOAA 4FTVD 3QP3A 1A4KA 1UB5A 1SBBA 4FFWD 4AIZA 1LNUA 2FHBA 3RX8A 3IDUA 2RR3A 5GRZA 3OB8A 4GQPH 2C1OB 4LRNH 4FQJL 4YGAB 2YRLA 2CDGA 4FFYL 1DQQA 3DYPA 1AR1C 1T5XA 1RIVL 2BRRL 5KVFH 5GS1B 1NCAL 3KPSD 2GJJA 5B8CC 5C0EA 3MLSL 3T65A 5TE6L 5E8NA 3S36X 2MKWA 4NUJB 1OM3H 4EIZC 4DFHA 5DA4A 1G6VK 1MJJB 1OPGL 4BZ2H 1F4XL 1RULL 3SDDC 2VDPH 1FV1B 1I8MB 4OZ4A 5T1LB 3GSXB 1P7QD 1E4XH 3MV9A 2QSCH 3SDXB 3W9DB 1NSNH 1YJDL 3JWDH 3VI3E 3TNNA 4KJQD 2WIIB 4OSUL 2VIRB 4TUKL 2JB6B 2QLVB 4NJ9H 3B4NA 3P40A 1I3RB 2XN9A 4FMFA 4NT6B 4CMHB 3KXFB 4JAMA 2Q8BL 4R2GD 1RU9H 4JRYD 3DROB 5DA0B 4M7JL 3MRIA 5DZNA 5AUMA 3T2NL 3GM8A 4KRPC 1QPXA 3NA9H 5C7XL 5L8JB 3FQWA 2APFA 4GRWF 4R26H 1CFNB 3IJSB 5B3JF 4HIEB 1KJVB 2R23B 2XV6B 3HLAB 5HI4D 5I1JL 1X3DA 3PL6A 4G5ZL 5DD0L 3D85B 4HFUH 5F7KC 1I8LC 2FYYB 4CW1B 1BGXH 4IS6A 4JO2L 4XHJD 1WBYB 1G7PA 4PRPD 1T80A 2QQLH 1XGTB 1EHLH 1YEDB 3KPNB 4BFIA 4UU9A 1CVRA 3D69B 5MENA 2E9WA 4RAUB 1FH5H 3EJZC 1YMMA 3T77B 3QWOA 4JHWL 1ZGLP 3K2UL 2KZWA 4YWGH 5L2JB 3MRCB 2P7TB 3PQYD 5SV4A 4HK3N 2Y07L 3QJHB 3I6KB 1SY6H 1D5IH 1C5DB 3T1FB 4Z7OF 4YPGA 1ED3B 3X12A 1D5BA 4AENA 4QRRA 1NANH 3QCUH 3H3PL 1JP5A 3NFPA 4GKSA 2EDRA 4M6MH 3TM6A 4Z7NE 4PGCA 1JPFA 5IQ9B 4L8SC 4DZ8A 3VXQA 5J6HA 3G6JF 1ES0A 5FO9A 3W81A 4MD4B 1DL7H 4YXLH 3TEUA 1I9RL 2B0SL 4Y1AD 1FL5A 1IGIH 5D8JH 4AMKL 3GSNA 3UAJC 4JFEB 2CDFA 3QRGH 1A7PL 1OLLA 5J1AB 4GLRH 4GUPB 4L4TD 1FO0B 2D03H 1CVSC 3QNZA 4JLRA 3QIWB 2VN7A 2VAAB 4Z7WA 3D39A 1H5BC 2VAJA 1QD0A 1ACYH 1MAKA 3ZKSD 5D7KE 3THMH 2ZNWA 2OQJB 1GGUA 4KK5D 5DXWA 3OJ2C 2PNDA 1TCMA 1WFUA 1CGYA 3QXTA 3LKQB 3NH7H 4BKLB 2EXWC 2OP4H 3G6DL 4R4BB 2ADJB 1T0PB 4NQCD 1T0NB 4NN5B 4RGNB 3ARGA 2ADIB 1W8NA 5CJQH 5EU6B 3MBXL 3VFNA 1W2KT 4NHUB 1JHTB 3Q48A 4EIGB 1FVDB 1QBMH 3V52L 2PF6A 2E7LA 2IPTL 4GH7B 3PABB 3ES6A 3WLBB 4UT6L 1QBBA 4NZUL 5JXAL 1H8OA 3GRWH 4PY7B 3VFMA 2I07A 4Z7VB 4FQIL 3WL9A 3QDMB 4B7IA 1CTNA 2B1HH 5IBLD 3IFPB 3W82A 4CUCA 3N06B 3VXSD 3OR6B 4QRUA 3K0WA 2VZOA 4ELKA 1VFMA 3MRLA 1PBYA 1MREH 5BMFH 3BPLC 4Q6YA 1Q9KA 5E9DD 1RD6A 2H8PB 3H2WA 3DMMB 3VRIA 3VFRB 1ZVSB 5IB3A 5B4MD 2FDBP 2I60L 1DUZA 3OKKA 1WIPA 1FL6B 5HBBA 1Q9WA 2NR6C 1EHAA 4D0BA 4CVWA 2VDKL 2C3HA 4MNQE 3V8CA 5DHVB 3UBXB 4WFHE 3INUH 2Y5EA 1QSFB 3WO4B 1RIUH 1OARL 4ZYKB 3ZDYE 3ZE2F 1A6VH 2IQ9H 4YO0B 3OWEA 4JKWA 1A2YB 3DRTA 3FQNB 5A16B 1QLFB 3MREB 2V9TA 4XWOC 1HEZA 3CFEA 2YD6A 4D0CB 4I18A 4Y5YB 5L2KD 1J5OL 3MV8D 4LLQA 1JWMA 3ZL4H 4OF5A 4N0YL 4BQCA 4YQXL 1AXTH 2CMRL 2X4NA 3RTQA 4LHJB 4UT7L 4ZAKA 4G9DB 1NMCB 1RMFL 3IXAA 4LPVA 4RFEA 1X5ZA 5DI8A 5C09E 5J6GB 3N1GC 3WD5L 2FR4A 4ZPVA 1T66D 1DBML 2P5WB 2XQYG 4NCC2 3F7PC 1BD2E 2HWZL 3SGEH 4PJAB 4PGDB 1GPOH 3RU8L 1BVLA 3KG5A 4H1LG 3TH4T 3RWJA 2VERN 2X4TA 4UOW0 4YDIH 4DCQB 3MBED 1Z0MA 4PJ7B 4QHKJ 2AV1B 1T20B 4EQ3A 3KPPB 3ZLQC 2HVJB 3PWUA 4F7CA 3L5HA 3D87B 1KYOK 4HUWB 3VXUA 5L6YL 4HMEA 5GIRB 2YA2A 5F93C 2NTFB 1ZA6A 4E5XA 2OK0H 3ISWA 5I30H 4WEBL 3S6CA 3TZVC 3CIQA 2PYFB 4ZTOL 3OKOB 1QEWB 3KPLB 4HPYH 1FLRH 1FO0H 1W0WA 3I6LD 4FQ1H 5FF6B 4OF7A 5SX5H 1DQLL 1DP0A 4OCYH 4WWKB 3QXWA 4Z77B 5D1QC 3MZGB 3VFOA 4O2EB 1K4DB 1ZK9A 4Y2DC 2X4QA 4Y5VC 15C8H 3R0NA 3W9EA 5EZIH 3OSKA 3U7YL 1ZHNB 2XICA 1BWWA 4MS8C 2ZJSH 5I74B 5FK9A 2GY7B 3MV11 2HJKA 1CFTB 3Q6GL 5GGVY 4FQXD 1EX0A 1F6FB 1JGUH 1YNLL 4P46D 1INEH 5EZOH 2APTA 3QI9A 4UQ2B 4M6OH 1UWEH 1L9NA 1A02N 2X70A 3WJLC 2C3XA 1FL3B 3QG6A 3CFKB 5MI0C 3U7WH 4M1DH 1IKFL 4PJEE 3HNVH 2WWKO 4XVTL 5FDWB 4Q2ZB 1HWGB 5E8OA 1NC4A 1Z6JT 3HPLB 4ISVB 1XGRA 4M7LT 4NPYB 3GNMH 3DVNA 5IB1B 1KEMH 2X09A 5DMGC 1KC5H 5HPOA 2HLAB 2BY3A 4TNVK 2ZG1A 4EUPB 1J10A 4L29B 1JPSL 1BQUA 4NO5B 1C1EH 1QSZA 2E27L 4DUWA 2V5SA 4U1IB 1MCWW 4UV7L 3HNTH 2BFVH 5EBWA 3ALWA 4JG1L 3BFOA 1I8KB 2PXYC 5DUML 1K85A 3OGCA 1T0MB 3DUUA 5LGHL 2QV2A 43C9A 1V3LA 1P7HL 5JIIA 3PHOB 3UJIH 5IOPB 4ODUA 5HDLA 3P2TA 2DLFL 5GS0H 2FLBT 1LMKA 3ARVA 1IGCL 4P5TC 1I75A 5DHVH 4APQD 1GIGL 4XB7A 1R3JB 1NAKL 1HILA 5KSAC 4KVCH 3DSNA 2XYCA 3NFSL 4P2OC 4UTAL 4HGWA 5IROA 1U58A 4K3DH 5GJTL 1F3DJ 1JWSA 3GHEH 2Y5TB 3NZHH 5B8CB 4LARL 2VDRH 3L3IB 4KU1A 2BOCA 5E08H 1WBXA 2E7BA 2W59A 4NO2A 4EBQH 5K9QG 1M7XA 2FJFA 2ZUUA 3WKMH 1AY1H 5KJRL 5ICZB 3LH2L 3SDDB 4G8IA 3QFJB 4LHUB 3U48A 2YHGA 2K9UA 3MRHB 3CSGA 5IHZA 2CSPA 1WZ1H 5DF0A 4NQSB 4N68A 2W0KA 3GIZL 5DEZA 4OCMC 3O3AA 3D2UD 1DBBL 4ZUWA 3EIFA 4M9PA 4OZFA 1HKFA 1OB1A 4OM1L 1F4AA 4HX1B 4NM4L 4BSWA 5JORA 2BSED 2EKSB 5DRZA 5FYJU 4YFEA 3TYGL 4MCYB 3PJSB 5K59F 5DRWB 4GRLC 3L6FB 4KHTL 2Q76B 3P9LA 2AK1H 3BO8B 2MKLC 4FTVE 4P2RE 4RBPH 5FOBB 4LQFL 4JVPA 2VISB 2NY1B 2DQHH 4HLJA 1EVTC 4JRXB 2ZUTA 3C5ZB 4R9HA 3O6FC 2XWBA 5BQ7A 2R0ZL 2PTTB 4KRPD 3LKSB 4PG2A 4NO3A 4MNQA 2ADGB 1SMOA 1C5BH 5DWUH 1X5KA 4HWNA 4JM2F 1ZLVK 4EDWH 3NCBB 1FNHA 1CDJA 3QQ9D 1A6AA 2VDML 4ZD3H 4JKMA 4E41D 1AO7B 3HI5H 5BW7A 1ZHKA 3D18A 3RVTC 5HGDA 3NTCH 3WE6A 2X5PA 7FABL 5DGQA 3BN9C 3T1WA 1LO3L 2ARJQ 5T1KA 1K8DA 2E9JA 2OR7A 2WLYA 5LQBL 5GGUA 5JW4M 4C56D 5J1SC 5EULV 3TJEL 3W11C 4N0FB 4UT9H 4GG6F 4PTUA 4HUXA 5T3XD 4YAQB 4J3XA 1U8QA 3IRZA 5ELIA 4AEIL 3OZ9H 4J7RA 4L8SB 1CDCA 5C09A 3CH1B 4TNWK 5DJAB 4HHAA 3FFDA 4Q7DA 4Z5RA 4JRYE 1IGML 3VXOB 3O3EA 2F5AL 3QNYB 4Z7UF 2BNQA 3EGSB 3KPOA 3I9GH 4N1CA 5TDPB 1JWUB 3V0VB 2QKIB 4TVPL 4E0RA 2ICWI 3T8XB 1CICD 3QEQD 2E8YA 2MHAB 4XWGL 3MQIA 3MUZ1 2BHYA 3C2AL 5E94A 3BT2L 2L4OA 5DRNA 1H3WM 2IMNA 4RMTA 3UAJD 1AGDA 4W4OC 4JFXA 4K8RD 3FO0H 3WNNA 1I1CA 1QBLH 3RY4A 3P0VH 2P8LB 4OCLC 3EOAA 1K2DB 2CKBH 4X9BA 4JO1L 4PPTA 3BWUC 4ZG1A 1T22A 1V7MH 4LPYA 1MHCB 1PD6A 5I1GL 4KTDH 3I2CH 3KHOA 4OFKA 4RMUA 4RGOH 2K3TA 2DL2A 4GG8A 4L8BB 4JM4H 3PQYE 1QG3A 4XP1H 2D7MA 5B38A 1O7VA 2RJMA 1QKZH 2JJTC 2F58H 1XCTA 2FHFA 4YHKL 1OP3K 3L3HB 2R0WH 4NN7C 3ZDZF 4YHZH 2EXYD 1UH3A 3CC5B 2DQFA 1FAKT 3SY0A 1SM3L 3CFJB 3DBXB 1TJHH 1ACZA 5EBMB 4UI2A 3GMMA 4QNPE 3RWCA 4F7PB 3O8XC 3HC3L 4WDIA 1CF8H 4Y1AE 3DWTA 4HGKC 4ZPTA 1KCSL 1MQ8A 5BCAA 1T7YA 1WEJH 4G3YL 2H6PB 5F7LB 3O3UN 2H9GB 1X9QA 4PJEA 3D3VD 4L4TE 4V1DD 1W72B 1IM9A 3MOBH 5F44A 3TBVA 5TQ2H 8CGTA 3EYOB 3T3PE 5GRUH 1P1ZA 1NL0L 4YDLC 3JUYA 4G42B 1MCSA 4OGZA 1FDLL 1MLCB 2Y4SA 1LO4H 1QA9B 1J87A 3GJFH 12E8H 1C16B 4DGIH 4NQCE 5CEYB 3S3PA 3VMNA 1EZVX 4OLUL 4R7NA 2ZPKL 5IFAH 2AJYL 4HFWA 2YUWA 1I4FB 2IAMD 1F11B 1FVCA 4HDIB 1FFPA 4XX1E 3QNXA 4LSVL 5ENWB 4CJ1A 1U91B 4O2FB 4MZ2A 1OP5H 1MFNA 1BZ9A 3I3BA 4MQ7B 5E5MB 5JW4N 4MB5A 2IFGA 2HVKB 3SQBA 4XWOD 1RZ8B 1OQXA 5MEPA 1SY6A 3C5JA 4P0DA 5GZNC 3FRUB 3VXSE 1AJ7H 4PB9L 2YD8A 3E6HB 4LPWA 4TTDC 4DZBB 1TJIL 1WVZA 4MNGE 4PIRF 5T3XH 3QDME 1FG2A 4WJ5A 1A7RL 3QIUB 5E9DE 5IESH 1FFNB 4K3HA 5ALCH 1RI8A 3EYUH 2OX5A 3VWJA 3SDCC 4DN4L 1I1AC 3S88L 4FG6C 4I3RL 5GGSY 4WI5A 3B9KD 1J0KA 1BAFL 3ET9F 1A9BB 3V4PH 1QFWI 4HKJA 3H3BC 4QRQA 1L0QA 2QBWA 3D0VB 4IRZL 4HPOL 1TVHA 3MA7B 4AIOA 1RK0A 2GFBB 3LQAC 3TZVB 5JOEA 4XBGB 1XFPA 4FTVA 3DX6A 4ETQB 5LAXB 4NQXA 5D6DC 1Q8MA 4TULL 3LIZL 3K80A 2O5XL 2NY0C 5KVEH 2CD0A 1Y6KR 3IDYC 5D1QB 4YHIA 2LAAA 3HRPA 1H0DB 4Y2DB 1S9VB 3GIVA 4Y5VB 4B41A 4BQ9A 2D0FA 4NZRL 2ZOLB 2V2XB 1KJ3L 2X4SA 1RZJC 3QO1A 1NLBL 1I1FA 3FJTA 2A9NL 3NPZB 2OL3A 5C0CB 5B22A 5GS1A 3B6SA 4XP9H 1E4KC 2G75B 2UV3A 3FQRA 1MFDL 4YHOL 4WO4D 5MI0B 4HIXH 2R29L 4XH2B 1ZSDB 4HT1H 1P7QA 4OUUB 3WDIA 5IG7A 4WHTB 3CXHK 4QOKD 2OJEA 3VJ6B 2DMCA 3FB6B 2JTDA 4PJAE 5IMOB 3OKEB 3BP5A 4PLKC 1KPVA 4HF5H 5JTWA 2HRPH 5HHNB 2XWTB 3W9DA 5J12C 1DBJL 4KJYA 4KY1L 4NN6C 4JRYA 2FATL 5EO1A 2WIIA 3BWAB 3BZEB 1XCQA 2OXHA 3PGFH 4OI9A 1K3ZA 1HHKB 3MXWL 2VQUA 4NCC1 2PXYB 3I6LE 3RZCD 4NT6A 5EA0H 1W72H 2DJSA 1I7RA 3DROA 2OSLA 1ROWA 4XCEA 1ZT1B 3QUYC 4U1HB 3QEUA 1B0WA 5ISZB 5FM4A 1JPTH 3NIGE 4P5TB 4OLXH 2BVPA 5CJXC 3RBGA 2Q6WB 2EEDA 2IC2A 5KSAB 1JE6A 35C8L 3FN0L 4BH7A 4PRPA 2VR4A 2EDFA 4NRXA 4P2OB 1HHGB 1U3YA 1T04B 2PW2B 1ADQL 2OR9L 3HMXH 3OAUL 4EOWL 3C60C 3TT3H 2D0GA 2A38A 2H3NB 4CW1A 1LE5A 4MA7H 1DEEA 2IF7A 3PQYA 5AZEL 1N64H 1FP5A 3SKOB 3MRDB 5KANI 3K81A 1NFDF 1RFDL 3D0LB 1CGSH 1REIA 1FFRA 1MFCL 1KYOJ 3QUZD 2DJUA 5DD6B 2VZ1A 2BMKA 4JQVC 1BQHB 4IJ3C 2D9QB 3GSUB 5L2JA 4JY4B 2ARJA 1C5DA 4FQPA 3MJ8A 4WNQB 2O61A 1ED3A 5FYKD 2QTEA 1WICA 5BJTA 2P1YA 3WFCH 5K33A 1PFCA 1I7TB 4J6RH 5BVPL 5K9JL 4OZHB 4A6YL 2NY6C 4EXPX 2BSRB 4ONFH 4OKVA 3B43A 4GRLB 4Y1AA 4DVRH 4LLDA 5FKAA 1S7SB 1XT5A 3DO7A 1RZGA 1ZMYA 4QXTB 1WQVT 2IFFL 43CAA 5C0NC 4UAOB 5AAWA 4MD4A 3X13A 1UH2A 4L4TA 3UTZB 5FM5M 4FA8A 2XZAL 3GI9H 1WBZA 5IGXH 5CGTA 5EC1A 1AGCB 2X9WA 4F9PA 4LSRH 5GPRA 1JRHL 3WHXB 1UYWL 5DSCB 1RJLB 4TUJB 2FB4H 4TSAL 1FO0A 2VC2H 2ITDA 1Q1JL 5HYJB 1A6TA 2VO5A 2JF1A 2KH2B 2DBLL 1CCZA 3O6FD 4NQCA 3CFCH 2L0DA 1T1XB 5F7YC 5K93A 1HCFX 5CINH 4Z7WF 4LSQH 3REWB 4QEGA 3QDJD 2WUCL 5K9OB 3BAEH 4XVUD 1PG7L 2AJ3B 5TE4L 5DJ2B 1DDHA 5JUEH 2BY2A 4PRID 2QR0A 2DWEB 2F53D 3GMRB 4JG0L 5EU7E 1ERNA 1NGXB 4P2YA 2HKHH 1S7XB 3D25B 2W91A 3NN8B 5HGGS 2AKRB 1IL1B 3VXSA 5CIPA 4X5XB 2ESVD 2WINB 3WLBA 3OPZH 1DCLA 4XP4L 4PREB 1QSVA 4MNGA 3X3GH 3RWEB 3IVKB 3QDMA 3QCVH 3BKJH 4KROB 5E9DA 4XRCA 1WFTA 1EIBA 1KACB 1OAKH 1CBVL 3HZVB 5F72S 1JTOA 4AL8L 4PJ5B 2MFNA 2YSSB 4XNQA 2OTWA 4K9EL 3LRGA 1XGUB 2N56A 1M05B 3T0DA 4UNUA 5FAAA 3PP4H 1PYWA 3VFRA 3U4BL 2ATPA 3RVUC 4Y19D 3BE1L 1L9MA 1JHLL 4G7VH 4JFDD 3BZFB 3RDTC 4PTTB 5F89B 5C0BB 4CRPA 4OIAA 4ODHL 4E41E 4NKOB 1KB9K 4NZTL 2PETA 4PB0L 3GK8L 3RWFA 5I8CB 2GTZB 3HZMB 4UILL 1UJTA 5DHVA 5FXCH 2H26A 3DVGA 4NP4H 4LLMB 4IOFC 3EFFA 4LDOB 3QHFH 4OLYH 1JHKH 5L2KA 4W6XB 1CGTA 3MV8A 5J89A 4C56E 2DTMH 1FJ1B 1FFOA 3PV6B 2CLVA 3REVB 5HYQA 1CWVA 5IV2B 3U2SB 1PQZB 3SCMC 3ZMRA 5CLTA 5F96H 3TBSA 5T3XE 1KJMB 1FGNH 4QHLA 2CLRA 3ZKMC 1A7OH 4L3EB 1FORH 3VD7A 3VFPA 1TETH 5I1EL 4LCIL 1A6ZB 3HAEH 3NCCB 4ALAL 3O8XB 3QEQE 1WTGT 3MRFA 1SMAA 5IW3A 3WHE1 4ZO9A 1JTPA 4WHCA 2XFXB 4PBVC 3O8XD 1QFWM 3MBEA 4PJAA 3S5LB 4RDQG 2ED9A 4OBSA 3FT3A 3WIHH 5IQ7H 4U6VL 5IVZA 4M4RA 5F1SA 3FL7A 1EFXD 4XCNB 1MJ8H 2DQEH 5C71A 4Y4FC 4O02H 4OZGE 3P4OB 4WGWB 5CJBA 4LSPL 1KFAH 4NQUA 4RIRB 4P99A 4I5BA 3C9NB 1XMWA 3UYRH 2ZUYA 1NFIB 1NJ9A 1A3RL 3VI3F 3O3DB 4LFHG 3NBNA 2NTFA 2NY4C 3TVMD 4KMTL 2VL5B 2AS5M 4ZXBC 3IDXL 2EH7H 4DN3L 2PYFA 4JHAH 3IDGA 5AZ2L 3RWGB 2NY5L 2HT2C 4FZ8H 3MR9A 5ESAA 4N90E 3B83A 2N7BA 1SJVA 1QVOA 5E2VH 2FJHB 4FQXA 2HLFD 4XNXL 5ACLA 3RKDC 3LS4L 3QULA 1ZHLA 3NIFE 4HUVA 1IILE 3ECBB 3DXAD 4HZAA 3M07A 4FQHB 4Z95H 5I17A 3JV5A 4E42A 3DURA 3D3VE 2FX8L 3IGAB 4YE4H 5IM7A 2AABL 3L9RA 1TZHB 1KELH 4V1DE 4RQQA 3SDCB 1HN1A 4TTDD 3SBWC 4QTIH 3WS6C 2IJ0C 1IC5H 2AJSH 3WN5A 3T08A 2P4AB 1L6ZA 1JYWA 1G7MB 4FFZL 1NQBA 3VW3H 1G7HA 4GRMB 2YC1A 5ESQB 1VDGA 2W0PA 1WWAX 5H94A 4TQEH 3H7BB 3T4YB 5HY9B 1WLHA 1I1AD 3AREC 4OD2A 4XB8A 4NPYA 1KN4L 4WFED 4XP6H 1FE8L 4Y4KC 4K23L 2KDGA 2X4OB 1CLYL 1JPGB 1X5FA 2G60H 5F7DB 2VQ1B 2YKLH 1Y18B 3ZTNH 3ZKXC 1KXTB 5EOTA 4Z7NF 4U1IA 3F6LA 1AXSB 4IRJC 3WKNA 4XNMB 3N9GL 2NY0B 3FB5A 2CKBA 4MA1C 5FUOL 4C59B 3V0WL 3H9SD 2VXVL 3MRJB 4HH8A 4QRSB 4X8XA 1X5GA 3ARRA 5IOPA 2GT9A 4XGZA 1I1YA 3C6SB 4K3GA 4KTEH 4RZCA 2YPLB 5GSVB 4H5SB 2E7CA 2FGWH 2X6MA 5B39B 2FJGA 3MA9L 1QFWL 3P0YH 1F4YH 4G6FD 3JTTA 4M5ZL 3TBTA 3MRKB 2DKUA 5CSZB 4XNUH 1HXYB 4LPUA 5JO5B 5C08D 1XIWD 3MGTA 4A2MA 1OAQH 1UACH 1RHFA 1QYGL 4UTBH 3OKYA 3D2UA 3QR2A 4ZNEE 3BOVA 4LLWB 3MCLH 3KLAA 2R1YA 4LCWD 4LEXH 4XMKH 1ZGLB 5C70A 5JXED 1QLRB 4DGVL 2MQ3A 3BPOC 4NN6B 5FM8A 4FABH 4W70A 4NQED 5ESVA 2V9QA 3ROLB 4FN0A 4RFNB 2W9EL 4HX1A 1P7KB 4KUZH 3HTLX 4AYFA 4ORGA 1RUKH 2HT3C 4OIBA 3HFML 4LNRB 5GGRB 5D72H 4HXBL 4QTHB 3RGVD 1U0QA 1A7NL 1S5IH 3W0WD 2X4UA 1S5HB 3ZYZA 3TO4C 1R3LB 3T0EC 2YK1L 3GJFA 4LLUB 4ZNCD 3ULSA 4S10A 1LO0L 1GH7A 4G7YH 2VLJB 1WT5C 1MY5A 4OT1H 4CU6A 1E4JA 4GAGH 5IHUH 3QUYD 4JFOA 3L7FB 4GO6B 5F3HB 4E41A 4PLNC 1OF2A 1K4CA 3ZYOA 1U3ZA 2Q3AA 3LKSA 3C60B 2ADGA 5E6ZA 2BERA 2A6KB 5JDSA 3K8LA 3UC0H 2XA8H 1S7WA 4RWHA 4PRAB 3KYMB 1F6LL 4NJAH 3LRHA 5HHXL 4KV5E 1JF1A 5DJ6A 5C0CE 5I66A 5ITBH 4C56A 4QOKE 1XR9B 3OKMB 4YUEH 3VFTA 5E2UH 4IJ3B 2RB8A 1MWAA 3ESUF 3HI1B 3ZDYF 1MCPH 4N1HB 1M7IB 5ACZB 5I1DA 1G0YR 2DJ4A 5JR1H 1EEZB 2HTLD 1GZPA 4ZFFA 2VDOL 1LD9B 2NX5B 1HCVA 3R8BB 4XX1G 2NY6B 1QRND 2DQGH 4JKPL 1EZVY 1CICA 3QEQA 4L8SA 5DJAA 3SHSA 1INDH 2XKNB 4M62L 3ZE0E 3EGSA 5TDPA 3TO2B 2QKIA 3U36A 2VL4A 3V6BR 2MWCA 2FH8A 2ITCB 3QIBD 2MHAA 3KDMB 5D1ZC 1Z9OA 4LLVA 2OZ4H 4RISH 4OZGA 4MDJA 4NBXB 4NYLB 4O9HH 5J56B 1H5BA 4QRPB 3RNQB 1MRCH 4G8FA 3Q0HA 4KVNH 1CE6B 3CXHJ 4YDVB 3DOSA 4QHNA 5GGTH 4AG4H 3F8UB 3TBYB 5JIPA 4L4VB 4JO4H 2BVOB 3CDFA 4QRPD 1IC4L 3SOBH 5J13B 3H0TA 3OJDA 3QPQD 3H8NA 3MROB 5HDQL 2QSTA 5MEOB 3DI3B 3CK0L 1R0AH 1BREA 2Y7QB 1RZJH 3V5HB 3UTTB 2HFGH 4OCSH 4FQQA 1L7TL 3QH3B 3MNWB 5AEAA 3BKYH 5DDHB 1HIMH 1CT8A 4D9LH 1CL7H 5F1OB 5FOJA 1T7XA 5HHVH 3UTTD 1K9TA 1WJ3A 1E4XI 3BKML 4U1KA 3DBXA 2Y06H 3P11L 4MB4A 5EBMA 1UXWA 4GRWB 3D3VA 1MH5A 4V1DA 3SDAD 4KZEL 2APWA 1MNUH 4R8WL 4NSKB 2AEQL 1MVUB 3GB7A 2ENSA 4FQCH 4ACPA 1TTGA 4OKDA 5TE7L 3JTSB 2H6PA 2MSPA 2H9GA 3RJDA 4JM2C 1FNSH 4U7MA 1UEYA 1VEMA 2X2YA 4Z6AT 3U0TB 4NKDA 2XG4A 4PRBB 3SKMA 1IT9L 1J1OH 5IEHB 4PJEF 1EO5A 3HR5A 2X1OA 4LBEB 4K7FB 1VESA 4Z0BL 4MJ5B 5DLMH 2G9HA 2IAMA 4OBRA 1VPOH 4JVWA 3SE4C 1H3XA 3RDTD 3SKJL 2EICA 3WNLA 3RHWK 3JSSA 3NABH 1A9EB 1JUFB 4XPGH 4JN2A 3ARQA 5GGSA 4DOHE 2DMKA 4PRIE 2YRZA 3HMXA 5CFHA 2EYRB 4N5EC 5F7HA 5JQ6L 3QHTC 1AKJB 1IVLA 2F53E 5DUBA 5LXGH 1BJ1J 2JB5H 5KVDH 3LEVH 2C3VA 1ZLWK 1BIIB 3FQTB 2QSQA 3G6JB 2CGRH 3QUML 1CXEA 2G5BB 3AAZB 1U91A 4OF0A 4XPTH 3F7VA 2A74B 1OW0C 4M5YL 5HDOA 2LABA 3SCMD 2P8PB 1NBVH 3T2PA 4JFYB 4K3EL 4UNTA 3P77A 1AGEB 2IADB 3AFLA 4WY7L 5BS0B 2NYYC 4M7KL 1NANI 1SYSB 3ZKMD 3LQMA 1PDKA 1F58L 1YN6A 4RDQF 2M2DA 4G6JL 1FFNA 4ZNEA 3B9KA 4U1JB 4PJ5E 2Q86A 5BV7C 4S1RH 4YEEA 1NCWH 2VLKB 4WI6A 4Y4FB 4JFDE 2V7HB 3E2HC 1P2CB 1ZOXA 3FQXB 1XF3A 1E27B 4GLRI 5I1AB 5C07B 3IDIB 1HH9B 2XACC 5JW3L 5D4QA 2NY4B 5DJZA 3HE6D 3MLXH 2Z92B 2MCPL 4XBGA 2DRUA 3MACH 4ETQA 1XGQA 2ZCHL 4NM8H 4QGTA 2XZCH 2Y23A 1BECA 2NY4D 1AC6A 3CMGA 1F2QA 1LDPL 4ZXBD 1DR9A 4Y4HD 2DQJH 4OM0L 4M6NH 1OGTB 3K2MC 4TPRL 1T1ZA 1JNLH 1YEKL 3L3JB 4RRPG 4Y2DA 4Y5VA 4OIIH 2NXZC 2JK5B 1RZKL 5CJOH 5E00B 3VFGH 1N5AA 1MIMH 4GW5B 3RL2B 2V2XA 1KBGH 1TVDA 5EU5B 4OFDA 3DNKA 2CIKA 4ZS6C 5IT2H 4WO4A 5IJKC 4L3EE 3LHPH 4JB9L 1U3HC 2W0LA 1QLEL 2NCMA 5C0CA 1CGVA 1KUMA 2UYLA 4NRYB 4DW2L 1S7QB 2R0LH 3BIBX 4L3CA 4QOKA 5E6IC 3QA3B 4Y16B 5D2LE 4MA3A 1H15B 1K5NA 4HWBH 4WI3A 2XQBL 3DTXA 1FZMA 1KB9J 1I7ZA 3P30H 3QZWG 3QHZH 2XPGA 4OUUA 1W8OA 4WHTA 4Z0XB 1W0VB 1RPQA 4YHNB 4LL9A 2R1WB 5IMOA 5AG9A 3AREB 4MXWL 1Z0NA 4YR6B 1K6QL 4GRWH 3MLVL 3L95A 3FFCB 4UZGA 4LU5H 3RWHA 2LVEA 3BPNC 4DVBB 4IMKC 2EDKA 4YZFE 4X6FA 2ZCKL 4Y4KD 1CS6A 3VD4A 1HHKA 2F19L 4AQOA 1G7JB 5DJDB 1DN0A 4MA1B 2PXYA 3N85L 3GO1L 3N50A 2WLZA 4P59H 4IRJD 3EZ8A 4NC1C 1NGPL 3NAAH 1OAUL 3TPUB 4D9QD 2FD6H 3CUPA 4P5TA 1TVBB 3MUHL 5JW5A 2Q6WA 1VSCA 1JF5A 2ADFL 3MUY1 1JGDA 1NCBL 3DXAE 3O9WB 3OAYH 3PDOA 5KOVC 1D3CA 1WC7B 2IBGA 2QEJA 1UKTA 2NY2C 1G9ML 4CNIA 3WHE0 4HWZA 1YJDC 2FX7L 2Q20A 1I9JH 1IC7L 2VE6A 3HAEA 3ROOA 4L8CA 3HC0A 3AROA 4G9FB 4P3CL 1CR9H 4UIMA 5CMAB 3SGEI 4EN3D 3GSUA 4ZUVB 1OD9A 4WFEE 5DEGA 4JY4A 4ONGH 4QT5A 3BPOB 4LCCA 1T4KB 4OQTA 4ELMA 3V4VL 3SN6N 2BHZA 5C6WH 2OR8A 5E8DH 4AEEA 3SE9L 3DX9A 1A6WH 1F5WA 2CDEB 4HQQH 4QYOB 5F9OH 4PGBA 4X4ZA 4I4WB 1AD9B 3VH8A 1KNOB 1J1PL 4W4NA 2O5ZH 1GGBL 2Z8WC 1TITA 2D7QA 3H9SE 1M1SA 2IH1B 3T0EB 4KKBD 3P3YA 1A14H 3G5ZB 2HA1A 2F54D 5GRJH 4OLVL 1VACA 3TO4D 1KCUL 3O6FA 3MGOA 4X5WB 2R69H 5TDNA 3KJ4C 2FH6A 1H3PH 4JANA 3L5IA 5HYSB 1OTSD 3T3PF 2JELL 3TP4A 4F8TA 5MP6L 1WWCA 3EYQC 3NACL 4R4ND 4PRIA 1MJ7H 1RZ7L 4KFZC 2F53A 4P23D 1EDQA 2VXTH 2Z35B 5T33H 3LVEA 4MJ4A 1YDPA 4Z18A 1NEZB 2YBRB 3O6KH 2DWEA 2ESVA 3MLZH 5FYLH 5HI5C 4M43H 4HLZH 1HHJB 3D25A 1U8NB 3WDHA 4XNZC 1YY9C 2AKRA 4ZS7L 3QDGD 5INCB 1U8PA 4ZO6A 4ZO7A 5IEKB 4YHMH 2NY3D 5FYKL 5IBTH 5I1KL 3W0WE 5MERA 1YN7B 2BJML 4EZMA 1WAAA 5EOCJ 4PJ5A 3EOTH 4K71C 5D1ZB 4JZJA 4JFDA 4S2SB 4MX7A 3P4NB 3P4MB 3ILQD 4FXKB 5CLWA 2R2BB 3VFVA 3I50H 4W4OA 4WV1A 1FNLA 1ORSA 3ZZ1A 5LWYL 4NNYB 1CLZH 3UBXI 5I8OL 4ZFOB 3RX7A 1DE4B 4NKOA 2HG5B 2FX9L 1RHHB 3MX0A 3CXDH 1RUML 1P4BL 3HZMA 5DJYA 4BZ1L 1ZEAH 5BOPA 1R24B 3ARDD 5FO7B 2V7NB 3D5OF 2H2SD 2MOVA 5INDA 4YX2L 2JJTA 4FS0A 3F58L 1ZAGA 4NQDD 4F58L 4NBYB 3PV6A 3HCVB 1CI5A 4P2CG 4JN1L 3IDMA 4N8CH 4BQ8A 1PZUB 2V2TB 1QRNE 2J88L 4M48H 5L9DH 4XC1H 5C0FB 2A9ML 4KAQL 3CVHL 4I3SL 1TJGL 1XF4B 4KKAC 1PSKH 4YGVB 3MJ9H 2N1KA 5DQDH 3O8XA 1PLGH 3X3FH 3ARPA 5CZVH 1YEIL 5E70A 2NW2A 5D2LA 3L3OA 1OCWL 4CKVX 1OTTC 4C4KO 4HS6B 1ZLSH 2AQ1A 4JM2B 3BEWB 3OR7B 3S37X 4DKFH 1X7QA 5FB8B 3BPCB 3FCTA 4I0PD 1WF5A 3RNKA 4YNYB 1J12A 4GS7C 4HH9A 4X7SH 4UNVA 3TVMA 2ED8A 5HHQA 2RFXA 3IFOA 3MCKA 3UTSD 4QHMB 3HRZB 2Z9TA 3C9NA 4QRPE 5F70A 2FO1A 2HFEB 4M03A 1F3DH 3KYAA 3K8MA 2VSCA 5A40E 2YWYA 5DHXB 1LQSR 3IF1B 4G6MH 5FGCB 4GG6B 1IEAB 3UJTL 3UMTA 1N7ML 2D31B 1VCAA 4NO0B 3VI4F 5I1LA 5D70H 1T7VA 1S9XB 4NJ9L 3VXRD 4CBPA 4Z7UB 4N9OB 4N5ED 4PBWD 1GL4B 2WNGA 3UTTE 2E7LC 3E1F1 4K94C 5DEFB 3DXAA 1FZOB 2DD8H 2FJHA 3BEVB 3NIGF 3I02A 3KJ6L 4XTRC 4J12A 3BGMA 5F9WC 1KEGH 1NDGA 2B20A 1BVKA 2BVUA 4UDUB 1EMTL 5IW1B 4OCWH 2KQMA 5DURD 3O6LL 1D5MB 4ODSL 3C08H 1RJZB 3DUSB 4PJGE 5BVJB 3QDAA 1OSPH 4JFQB 5I2IB 1HQ4B 4Q74A 4HV8B 1FLTX 2A6DB 3EO1B 2I9LA 3SDCA 4MSWB 1CDBA 1I1AA 4N8PA 2F74B 1B4JH 3CJJA 2DKSA 2VXQL 5IUSA 3HMWL 1N59B 1NCNA 1G6RA 1JL8A 3PGCA 2OZ4A 2BHUA 3CAFA 1KPUA 2X4OA 4M7LL 3H9SA 5KOMC 2VQ1A 1BM3H 2NMSA 4Z7OE 1S9YA 3JVGA 3QCUL 1CFQB 3G5YB 4KRLB 5GGTA 1CD8A 2UWEE 2YPVL 3Q3GB 4IMLA 3WFEH 2Z31C 2QQKL 3FT2B 1OAZH 3EJJX 1J1XL 4HKBA 1HI6A 2R2HA 4XT1C 4I18C 2NXZB 4QRSA 2R4SH 2VH5L 4H26A 2W9DL 5DJCB 4POUB 5H2BA 2DI9A 3B3IA 5HHMD 1CLOH 3MOQA 1D9KD 5D8JL 5GSVA 5C08A 1T21A 1XIWA 1MCRA 1U3HB 5B39A 4ZAKC 3QRGL 5D7JB 4WW1A 4YHYB 1GGCH 1NBZB 2E6PA 2E7MA 1Q9LA 2D03L 5E6IB 1E4KA 4QCIA 3WYRA 5FDYA 1B2WH 5DZOA 3IRPX 2CO6B 2LU4A 3R1GH 2CLZB 4LKCA 4PJ9C 4JQXC 4WTZG 1S8DB 3KYNB 5E2JA 5ITFB 3HS0B 3MJGX 1CFBA 4TUOA 3ARWA 5I1HH 4KI5C 3KLHD 4NQEA 4PJDA 1RUQH 3VE0B 3AS2A 2OTUA 5FKPB 3KR3L 2VLKE 4PUBH 1ZE3C 5T1MA 1WFOA 1R3KA 2CJUH 5ECJE 5FEBA 1L4IA 3BPNB 5CJQL 3RGVA 4IRSC 3W0WA 3I3EA 1OY3B 1TFHA 5TF1L 1P7KA 2XWJA 5C07E 1J0HA 2C4FT 3KYOB 5ID1B 3DX7A 5FA4A 2PYEB 1C12B 3LN4A 3OX8B 3B2VL 1S5HA 4LPCA 3O11B 4C58B 1JGEA 4JREC 2AK4B 2G2RA 1JNNH 3QUYA 1JV5A 1G6RL 4LIQL 1DLFH 1UVQA 3IETB 1F3JB 1NFKA 1BFVL 2XZQH 3VH8G 4H1LB 1JFQL 2IEPA 3QEHB 2VDQH 1X4YA 3R06A 2FBOJ 2AK4D 2HFFB 2AV7A 4KQ4H 2JJWA 3CMOH 1CXLA 3T0BA 4QXGL 2VSDA 1SEBA 3C60A 1Q0YH 1XF5B 2WBJB 5FGBC 4J23A 1TZIB 3QI9C 4JEGB 3RL1A 2GJ6B 1IAKA 2WW8A 3DGGA 1BIHA 1N5YL 1PG7W 5I1IH 3U1SL 2NY2D 3IU4H 4H0HB 1R5VB 2MJWA 2GTWB 3OKMA 4X80H 1J8HD 1JGLL 1AH1A 2ZP0T 1WIUA 3INUL 2GAZB 3BDBA 5IB5B 1JMZA 1QRNA 1L7IL 3CDGA 3EYFB 1M7IA 3MYJA 3EHBC 3UPRA 1A3LL 1A6VL 4TSCH 2GSIB 1P4IH 1SBSH 2NXYC 4XPBL 4NDMB 1E0OB 4X4ME 1KT2B 3U6RA 1NCCL 5BV7H 4TSBL 4UQ3B 3QIBA 5IK3B 4K2UH 3CFDB 1UWGH 4HUMB 5HHOD 5AD0B 5C9KA 4XMPH 3ZL4L 1A4KB 1UB5B 3TGXA 2J6EA 3LD8C 1LNUB 1YECL 4D9QE 3QO0A 1AXTL 2J4WL 5LVEA 3MUGA 1YMHA 2W9LA 5JOPD 5TPWL 3EO9H 4RGMC 1NC2D 1FFQA 3KJ4B 2AI0L 3VD3A 1XGPA 2CDGB 3SJVD 1DQQB 1DVFD 1T5XB 4QRPA 1GPOL 3GBML 3FT4A 5IROC 3Q2CA 4OZGF 4DKDC 1CE6A 5C0EB 1D6VL 3T65B 1P84J 3VA6A 4UIKH 3DIFA 2VJXA 3EDKA 1INQA 4RMVA 5HYFA 1VGEL 1TQCC 1T03L 5E8PA 4UBDC 1KV3A 4OZ4B 1D6EA 1BBDL 1F13A 3UTTA 3WMSA 3MV9B 1KCRL 1JZ8A 3TNNB 4R90H 4HWBA 5DDHA 1FLRL 4XNZB 4ZOEA 4BFGA 2XKUA 3SDAA 4LVHC 4C4KT 5HI5D 1UXSA 2XN9B 4OCYL 1N0XL 1SYVA 4PJGA 2X4PB 3MRIB 3MTRA 4WUUD 3JV0A 2QHRL 3NIFF 4LSUH 5EZIL 4CJ0A 4J1UA 2YRPA 3W39B 2F54E 4K71B 3FQWB 4G43A 3RWIB 1WIOA 3IAGC 5ANMA 1S9WA 2CK0L 1PZ5B 3WO3B 3NA4A 1INEL 5EZOL 3U0TA 1NFDB 3PL6B 4CDGC 4FQJH 4CADA 4M6OL 1UWEL 3RDTA 2EO9A 4IS6B 4FFYH 1RIVH 1G7PB 4K7FA 2O93L 4BFIB 4UU9B 1NCAH 3WNOA 3MLSH 5TE6H 1YMMB 2UWEA 3GMQA 1SJEA 4MWFA 3OAZK 5CBEA 3TIEA 1KEML 2YN3A 2PW1A 3A6OA 3WNKA 1JZ7A 4YPGB 1F4XH 4H1LH 3X12B 1XF2B 4XVJL 1D5BB 4QRRB 4AENB 3SCMA 4GKNA 4HJJH 1NMAH 1KXQE 4X99A 2G5BA 1YJDH 3QYCA 4GKSB 5EU3A 3V7AE 4PGCB 3QDGE 2J2ZA 4OSUH 3HB3C 4DZ8B 4JJ5B 4TUKH 4U4BA 3VXQB 1KN2L 4YHLL 1ES0B 3EYVA 4EVNA 5GS0L 3FN9A 4KHXL 4M7JH 1FL5B 3N0PB 3HPJB 3WSQH 3GSNB 4KKAD 1I9IL 3T2NH 2CDFB 5F9AC 3L5XL 4KVCL 2E9IA 3EJYC 1FIGL 5C7XH 4JLRB 2YR3A 1CE1L 3QNZB 1OTTD 4Z7WB 4MQSB 3TLRA 3D39B 3NZHL 4WHDA 2VLKA 2A1WL 5E08L 4KKCC 5FCSH 2LQRA 4G5ZH 5DD0H 1T2QH 3V4UL 1NAMA 3V6ZA 2VZTA 1GOHA 2EIZA 3KS0J 4JO2H 4F7MA 3M17A 3WFHA 1WZ1L 2BDNL 2X44D 4ZXBA 1EV2E 1OGAD 2Z92A 2AVGA 4U05A 4Z8FL 3GUTA 3K2UH 3VFNB 4NQDE 1FZJA 2Y07H 2HMIC 4KJWC 1KCKA 2DDQL 4MD0A 4ZFGL 1T3FA 3PWJA 4JZOA 1T1YA 3MLYH 5E2TL 4BH8A 3H3PH 1Y6MR 3B2UC 2X1XR 3VFMB 2AK1L 2I07B 2PR4L 4WFGE 3WL9B 1IFHL 1MHHA 3BHBA 4PLOB 4O2CA 5ADOL 3KNBA 4QRUB 1D5XA 4HWEL 5BO1H 5TQ0L 1MY7A 1LEIA 3MRLB 5C0IA 4XTRD 1TXKA 4KGLA 4EDXA 5F88A 1I9RH 2B0SH 3VRIB 5DWUL 4KV5F 5IB3B 8FABB 5JPNA 3GSWA 1DUZB 1XZ0B 3OKKB 1MHEA 4IIQC 2YS4A 1EGJA 4S1DD 4XVSL 1Q9WB 3UTSE 1Y0LA 4P4KC 4YR6A 3STLB 1MELA 5SWQA 4Y4KA 4X4MA 3LS5H 3PWNA 1Q0XL 4FXGB 1QSED 4HAGA 4LSDA 2WQRA 1PG7X 3G6DH 5HYIA 2VN4A 1BPVA 3L3DA 1OVZA 4XCFL 4IRJA 3OKNB 1JI1A 5EFIA 1VFOA 1P4LA 1HEZB 5FHBH 3MBXH 4OCRL 4RX4D 5SX5K 4KI1A 4I18B 3HE7C 3ZE0F 5J9PB 2ILLA 5ID0A 4LLQB 4YDJA 1JWMB 1EERB 3V52H 4L1HA 2Z31D 2IPTH 4BYHA 4S1SL 4UT6H 1IGTA 4NZUH 5JXAH 3BD5A 1KPRA 1SJHA 2X4NB 4FQIH 3RTQB 4U6YB 4ZAKB 4G8GD 4LVOB 4RFEB 2NTSP 2VLRD 1LK3L 1UADC 4N8VG 4O58L 4ZPVB 3MNVB 2FR4B 1B4RA 2P42B 4WIQA 5BXFA 3QUXD 3VWJC 4EN3A 1BVLB 4MQXC 3FO0L 5JLZA 1ZT4A 1QBLL 2A0LC 3MJ9A 3RWJB 2X4TB 1IKNA 1EK3A 1U92A 4PV8A 4M1CC 5FUCC 4KTDL 3DRQB 2I60H 4P5MA 4PJ9D 3TIDA 4F7CB 4RGOL 3MPCA 1KB5A 2YD7A 3C6LD 3VXUB 3CH8A 3RVVC 3UJJL 1ZA6B 1UEMA 4KI5D 4OGAD 4E5XB 2CDEA 3KGRA 2W60B 5TGBA 2R0WL 2VR9A 1KNOA 4ELMF 1F00I 4FFWC 1W0WB 2F54A 1TPXC 4IRSD 4Z7QE 4JPVH 3TO4A 1EGJL 5IMKA 4JREB 3UYOD 4JDZA 5IHBA 3VFOB 5T5FL 2X4QB 1BF8A 3G5ZA 2M26A 3W9EB 1J5OH 2P5ED 4QHUA 5HHME 4X8JA 3TBWA 1WT5A 5ERWA 4PG9B 4X5WA 3C87A 5FK9B 4F37K 2HJKB 4N0YH 1WEJL 4MXQC 2CMRH 2EO1A 4QXWA 2VQTA 5F7EH 4P23A 5HYSA 5C86A 3QI9B 2EE2A 4OV5A 2H1PH 2X70B 4L8DA 1DBMH 1RIHH 4X6BA 2R15A 3QG6B 2HWZH 3RU8H 2E3VA 3TWCL 2DOCA 2K7QA 1ZLVH 1A6UL 3SO3C 3ME0A 4K94H 4L3AA 1AI1L 5C6PB 1Z5LA 5E8OB 1NC4B 4KJQC 1XGRB 2OS7A 2Y9RT 5SX4H 3DVNB 3QDGA 4MMXC 5H35B 5DK0B 1NGWA 1BFOA 1HHJA 4R2GC 2NXYB 5L6YH 2GUOA 3VWKD 1KG0A 2Y36H 3S8WA 2B2XL 5D7IE 4ZTOH 4X6EA 2V6HA 1BBJA 3QB7C 5HXMA 4FOMA 43C9B 1RY7B 3OG6B 3LD8B 4ODUB 4G80A 4RBPK 4PJ8D 3U82B 1AJ7L 5K9KA 1PY9A 4NZDA 1QPPA 4RGMB 3B8SA 3O4LD 1WAAF 5AYQA 4CDHA 5FUZL 3U7YH 4TRPL 4H20H 1HILB 2AK4E 3P4MA 4XHJC 5HGHA 3WS3A 5FYJL 4R4FL 2EIEA 2GYSA 5ALCL 3UTQA 4HGWB 1YA5A 3Q6GH 1GHFL 2NW3A 1U58B 3UZQA 1CK0L 1JWSB 3ARDA 2Q8AL 1YNLH 5LG1A 3GSQA 2BOCB 2YD3A 3RUGE 1WBXB 4HEME 4NO2B 3V95A 5D2NA 2FJFB 3MODL 3V4PL 1RHHA 1S78D 5E1AB 4NQDA 3EZJB 1TQCB 5GQBA 1NBQA 1Q72L 4P4RA 1R24A 1J8HE 1IBGL 3MUJA 1T7WA 2C1PB 2QHLA 1NGQL 2BZDA 1IKFH 2GJ6E 4XPFH 4XVTH 1EAPA 1LE9A 3OBAA 3O3AB 4K9EC 4ZUWB 1BZQK 1U2CA 3LKOA 4HK0A 2AXGA 4QRTA 1YNKL 5D6CA 3RFZC 2AXHA 5KAQG 1OB1B 4TVPD 4BSWB 5JORB 2FSEA 1WCBA 4LVHB 5DRZB 4X9FA 3IB4A 3TV3L 1NDMA 3MSPA 4PJIE 1JPSH 1KJ2A 2AXFA 1OP3H 5C0FA 2E27H 1RZIA 4UV7H 5E2WL 4L5FH 4ODBD 4JG1H 3GGWA 5DUMH 5LGHH 2X41A 3EDFA 4GOSA 3NCMA 1F45A 2DLFH 1QHOA 2XWBB 5BQ7B 3C8HA 2BNRD 1IGCH 4W81A 5D2LF 2B7DT 3UTSA 4KK5C 1GIGH 4XP9L 1PVHA 4MNQB 4NO3B 1NAKH 4NZJA 5HDBE 3NFSH 2R9HD 1HHHB 4HIXL 2NNAA 3K46A 3HUJE 1A6AB 4X9GA 3K4DA 1Q94A 5GJTH 1WWWX 1ZHKB 3D18B 1S7UB 3O6ML 4LRIC 4MLIA 4R97C 3SE4A 2HFEA 3G08A 3WE6B 3UCRA 4EQ2A 1G0DA 3BUTA 4I8DA 5T1KB 2AGJH 5KJRH 5JW4R 4HF5L 4YZFF 1IEAA 3VXRA 1NPUA 4N5UA 5HD8D 2DTSA 3UX9B 2AJUL 3PHSA 3GJEA 4L9LC 3BDYL 3QEGL 5DFVD 3AB0C 2X9YA 2UZIL 3GIZH 4PTUB 1G7IA 4HUXB 1MHPH 3GFUA 3CX5K 1U8QB 1FYHB 1OW0A 1W72L 5C09B 5DEFA 2RCSL 4OM1H 4NM4H 4HHAB 3FFDB 5E8EA 4Z5RB 1VFBA 3TYGH 1YPZE 3O3EB 1D7FA 3KYKH 3PWPD 1IQDA 2BNQB 3KPOB 3BYYA 3IU3A 1QACA 4E0RB 2UZXB 1CIUA 5IW1A 3HB3D 3VGFA 5BVJA 5B4MC 1YYMH 2PUQT 3BP7A 4LQFH 2F5BL 2LTQC 3MRGA 4I9WE 5DRNB 3B9VA 4XP5H 2BVQB 1PJ9A 4B0MM 1U8IA 3S4SA 2I24N 1R3IL 3TT3L 1KJ2L 2NY5C 2R0ZH 1AGDB 4MA7L 4JFXB 1I1RA 3EJYD 1CGUA 3T2OA 1CFSA 1F6AB 1QFUL 3EOAB 4FXLA 4FZEL 3JV6B 3SE8L 2VXUH 5BZDA 1T22B 5DYOA 1NFDE 3U9UB 1KIRB 2DI8A 1C08A 2VDMH 4XNYH 1ZWIA 4KKCD 3DI2B 1LDSA 4GG8B 4DTGL 3AGVA 5B38B 3N1PC 2QQNH 7FABH 3E3QC 3CLEL 3CLFL 2EE3A 3SGJC 1Q9OA 2PCPA 1LO3H 1EEUA 3WFCL 1XCTB 1CFQA 3G5YA 3KHQA 1YMME 3Q3GA 5LQBH 3TJEH 1T1WA 3FT2A 4JFFD 1D9KA 5I8KL 1PW3A 4NHCL 4U6HA 1OP5K 4YDKH 2DQFB 3SY0B 4KUCD 4AEIH 5I75C 3GMMB 4GBXC 4CN4A 1T66C 3SQOL 3RIFF 3RWCB 5A2JH 1IJ9A 5DMKA 5IGXL 5TDOA 5L0QC 4WDIB 3VXNA 1CL7I 4LSRL 3JZ7A 1IGMH 3B2UD 4ZPTB 5IJKA 4XZUB 3RVXD 2F5AH 4IBLT 4WU5A 3PGDA 1HSBB 4P3DA 4PJEB 1A7BA 3NFNA 4HCRL 4XWGH 1JZ3A 1X5IA 2RGSA 3MBEC 5D1XD 1IM9B 3UZVB 1IARB 4BUHA 1FGVH 3VDBA 5F6HJ 3TBVB 5ITFA 3FKUS 1JVKA 4NBZB 3SDYL 3EKCA 1P1ZB 4PLJD 3WFDL 4H8WC 3S35X 3RA7L 4MAYC 3VE0A 5FKPA 1YNTA 4JO1H 5D7IA 4KK6D 4NKQB 5I9QC 4HFWB 4PJDF 1OGAE 1FVCB 4P4KD 2QL1A 1FFPB 2HKHL 1RUPL 3QNXB 4GXUM 3HN3A 5I16B 4M8QA 4AY0A 4YHKH 1BZ9B 4K7PH 3FRPA 2AK4A 3X3GL 4B5EA 1EO8H 1M6OA 3T3ME 3S34L 4FQXC 2E7HA 3IETA 2A77L 1F3JA 1GOFA 4P46C 5MEPB 1GJIA 3C5JB 3HE7D 1SM3H 4S1QL 5J06A 5GS3A 3HA0A 4Q6IC 3RUGA 5I73C 1AE6H 3PP4L 3HC3H 4WJ5B 4MJID 3SEPA 4AM0A 1F4HA 3TNMA 1J8HA 3VWJB 3NCFB 1X4ZA 1J86A 1HYSD 3MLRH 3G9VA 4OB5L 5T3ZL 2BSSA 2GTWA 2N4IA 4XMLL 3ABZA 4HKJB 3NCJH 4QRQB 4F3FA 4MQXD 4LFHD 4PRDA 5IB5A 2A0LD 1NL0H 3RP1A 4PJIA 1TVHB 3MFFA 5E95B 1F02I 1QSEE 5ICXA 2J5LB 1MSPA 1RK0B 1QHPA 2DTML 5HHOA 2IPUK 3DX6B 4OLUH 1RZFH 2AJYH 4NQXB 4I77H 3RVVD 2COQA 4ZQKA 1FGNL 5A2KH 3ILPA 5IK3A 2BNUA 5B21A 3V7AG 4H88L 4YHIB 4Z9KB 4LSVH 1NC2A 4APQC 3FHQA 1TETL 3GIVB 2R4RH 1BJ1H 5C92A 1NGZA 5C3LD 1DVFA 5D71L 3QQ3A 2X4SB 4N1EA 3QO1B 1I1FB 3KPSB 1CFVL 3HUJA 3LAFA 3RPKA 3LMJH 2DQIH 4POZD 3KLSA 4JO3L 2OL3B 4WI8A 5JA8B 3HZYA 4KPHL 2B1AL 2EDDA 2OTPA 3B6SB 4C54A 5CZXC 4GQ9H 1TJIH 5CILH 3WIHL 3FQRB 1A7RH 4MXQD 4JY6A 2DQEL 1F2XK 1P7QB 3QWRD 3SO3B 4O02L 5IG7B 4PS4L 5IVXE 2OJEB 1X5XA 5JDJA 1YYLH 1ZS8A 4I3RH 5EU7C 3BP5B 3FOLA 1BAFH 1KPVB 1O5DT 2BCKA 1DQTA 1OD7A 4KI5E 1MCFA 2R2CA 2EH7L 4KJYB 4R2GB 4JRYB 1VKXA 5EO1B 1MUJA 1YPZA 3ZDXE 1XCQB 4UV4L 4WUUA 2X42A 2A83A 4FZ8L 4F37F 3VXUE 4ONHB 5FO8A 1RUAL 2FECL 3BSZL 1I7RB 5BRZD 2WMPA 2X4PA 2OSLB 1GGIL 4TULH 1OAYL 4RA0C 4XCEB 5E4EC 1RQ5A 4M1GH 3QEUB 1NMBL 4GXUN 2P5EE 4PJGF 3W39A 3IJYA 5EIQA 2BVPB 2DAVA 3RWIA 1DQDL 1OSZA 3U30B 4WU7A 4NZRH 4BH7B 4PRPB 3QQ9C 1PZ5A 3NZ8B 4EEEA 4PGZA 1KJ3H 4NRXB 1NLBH 2EYSB 2GIYA 3WV0A 1NFDA 2A9NH 4D8PA 3ULUL 5HTSA 3GMLA 3ZTJG 4OAWB 4QTIL 1IC5L 3LEYL 1LE5B 1DEEB 3PQYB 3VW3L 3RIAK 2FZ3A 1MFDH 4YHOH 2W07A 1UJ3A 1U8LB 4WTWA 1W0YT 2R29H 5ILTL 2BMKB 1N4XL 3IJHA 4M61A 1UWXK 3LDBB 1ZLUK 2ARJB 1UFUA 5KAQF 3U83A 3MJ8B 2O61B 2UWEF 3BP4A 3DYMA 5BJTB 1XF2A 3ZTNL 4XCCL 4YXHL 3QRFM 3FO2A 1EXUA 1M4KA 3BYTA 1DBJH 4KY1H 1MRDL 5H8DA 5J11C 4OKVB 4OD3L 4Y1AB 4LLDB 5FKAB 1CICC 4XPHL 3DO7B 1RZGB 4JJ5A 3MXWH 3TJHD 43CAB 2CRYA 4OLZL 3V6OE 1GCFA 3C8DA 3X13B 4KK9C 4L4TB 4JDTL 1WBZB 5EC1B 3HPJA 4OZIE 3HNSL 5EZJA 4ODTL 3OKLA 3O4LE 4Q9QH 4K8RC 3P0YL 2BC4A 1MPAL 4XXDA 2ITDB 1NGYB 1A6TB 3FN0H 3E8UL 1N8ZB 1AGBA 5DTFA 1MFAH 1BX2A 4JKLA 4NQCB 3LV3A 3MNZA 1UACL 5C8JA 1ADQH 2OR9H 3OAUH 4EOWH 4UTBL 2HTKD 1OGAA 3WXVL 4S11A 1CG9A 4O4YL 5GRVL 2YD1A 3LN9A 1VEOA 4BZYA 2KQNA 1EAJA 5GHWH 2RHEA 5AZEH 1J05A 1RFDH 3DSFL 3MCLL 3S4SG 4LEXL 1MFCH 2UVFA 5D5ME 1AIFA 1DDHB 2EXYC 5DK2A 1N2RA 2QR0B 2D4FA 2V5MA 1ZHBB 1WK0A 3AB0B 3PXJA 5IB4A 2OL3H 5I76A 4TVPE 1E28A 5J1TC 2EDYA 5D72L 3VXSB 5CIPB 1S5IL 5BVPH 4MNGB 4A6YH 4RFOH 5E9DB 4XRCB 4QHKI 4CN6A 4YBQD 5I18L 2IFFH 2J3SA 4XNQB 1EBPA 3KPQA 2OTWB 5JW4Q 3BH8A 4P2QD 4GAGL 2PO6D 2KKQA 2LTQB 2IGFL 2NY7L 1PYWB 1ZGLM 1JRHH 2B5IB 4XBPA 5FA3A 1UYWH 5CD5D 2ATPB 8FABA 4FNLL 4TSAH 2XA8L 1KIPB 1XZ0A 1DANU 1Q1JH 2IBZX 5I0DA 1QSEA 3ZYJA 1UQSA 2DBLH 2IAMC 4IOIA 3SKNA 3RWFB 5L8KB 3STLA 5M94B 1RZKC 1G1YA 2H26B 3DVGB 4EI6A 5ICYB 4FXGA 3EFFB 4X7TA 4RX4A 4WWID 5L2KB 3LKPA 3MV8B 1SVCP 1FFOB 2CLVB 4OLWH 5HYQB 3OKNA 2Z31A 4HUKB 3L3KA 5E56A 3TBSB 5I19L 4QHLB 2CLRB 4JG0H 1KCVL 4JFZL 4WENB 4BFEA 5J9PA 1INDL 2O5YL 3CVIL 4OUOA 4U0RC 4P57A 3RY6C 3VFPB 2VLRA 1R6VA 1WFNA 4GBXB 1QUNA 5GRXG 1MAMH 5L0QB 3SPVB 3QUXA 4U6YA 1OP9A 3MRFB 1CBVH 2LE9A 1YEEL 5FV1L 4AL8H 2YPKA 4GBXD 3MNVA 4PY8J 3FRPG 5EOCH 5IVXA 5TH2A 2BNQE 4GAYA 3LQAL 4K9EH 1LEKB 3B9KC 3MBEB 2GCYA 3VU2A 2HJLA 3VXMD 1Y6NR 1B88A 3A6CH 4HS8L 3FT3B 4JQXA 2CUHA 4PJ9A 5EIIA 4U1GC 1A1MA 5IVZB 4KVNL 4Q97A 3NCEB 3C6LA 5C0GA 5I8EA 2IMMA 3U4BH 4U0QB 3BE1H 3QAZC 1BJ8A 5E99H 1TCRA 4J3UA 4U3CA 4JO4L 3SOBL 1JHLH 3NMEA 3DRQA 4I5BB 5IHLB 4YBLB 2XT1B 4ODHH 1NJ9B 5I9QB 3O2DA 3AUVA 4PB0H 2EDJA 4IRSA 5C0AD 3BQUD 4UILH 5IB2A 4MAYD 5FHAL 3RZWA 4OCSL 2B39A 3IDGB 3BKYL 1DBAL 3CX5J 2W60A 3PDDA 1HIML 4OJFH 4YEFA 4D9LL 1A0QL 2P5EA 1G9MC 3MR9B 5ESAB 5HHVL 4BUGA 1LK2A 4JFFE 3QCTL 5GISH 4X6DA 1J0JA 1QVOB 2I5YL 4FQXB 4OGXL 5CHNA 1FN4A 4U7SA 3MXVL 4P46B 4GAJL 4UUJA 1T83C 1VADA 3QULB 3W2DL 1ZHLB 1FNGA 2ZUQC 4PG9A 3TN0D 4HUVB 2R1XA 4LCIH 5I73B 3HG1D 5I17B 4WO4C 4ALAH 5ACMA 2V5YA 1KENL 5D9SB 4E42B 3DURB 1OHQA 5IM7B 3L9RB 1A1OA 2WUBL 5FGBA 4NOFA 3BIKA 4RQQB 1L6XA 1AC0A 3OXRA 3WN5B 5GSRA 4Y7MA 1J18A 3RRQA 4DQOH 5DLML 5CIPH 1G7HB 4U6VH 2YC1B 1VPOL 5GRVK 4BSVB 3BGAA 5H94B 2FLRT 4OD2B 3VWKA 4RWYL 5IMLA 5KW9L 2GY5A 4LSPH 4ENED 5E7FA 5H35A 3RZCC 5DK0A 2ZOKA 3V6OA 1PKOA 4WHYG 3FB7A 2JB5L 5EOTB 3ULVL 2CGRL 3IDXH 3FB5B 2CKBB 4PJ8A 4OZIA 3E6FB 1UM5H 4PJXE 2XTJC 2E6JA 4XPTL 2NY5H 4APQB 1UZ8A 4QKXB 3O4LA 1IAOA 1TZGH 1KTDA 2MTPA 4D9RD 4ZOBA 2GT9B 5KVGL 4P5KA 4XGZB 1I1YB 2KBGA 4KKNA 1LHZA 4I0CC 4L4JA 2DM2A 4RZCB 3O2DL 3U0PA 2VITA 2ZWLT 3QZWB 1UM4L 4XNXH 5EH1A 3S37L 3AY4C 2FJGB 4HJGB 3LS4H 2C7UB 4MJIE 3JTTB 3S96A 3TBTB 1CGXA 1EEQA 3QUZC 4HC1L 2B4CC 4M9OA 1LO2L 2FX8H 3MGTB 5KS9E 5D5MA 2Z8SA 2AABH 2EYTB 3AXLA 2EIDA 3BKCL 3D2UB 5CZXD 5E1AA 4Q0XH 5LGJA 2C1PA 4MA8L 1LP9E 2BVTA 4FFZH 1IAII 4KJPD 3KLAB 2I9TA 2R1YB 1H9VA 3QFDA 4ZOAA 5FUCE 1I7UA 1KN4H 4LCCC 5CP7A 2DIAA 1AQDA 5ESVB 4F33A 1DFBL 4K23H 4NM8L 2AQ2A 4FRWA 4WCYL 4R7DA 2XZCL 1CLYH 4ORGB 2ED7A 5MEND 4ZSOE 5L88L 2DQJL 2GHWB 4LLAA 4ERSH 3TA3D 2X4UB 3BZ4A 2EDNA 3GJFB 3ULSB 3U7AA 2BNRA 4H8WH 4JE4B 3V0WH 5GGVH 1C7SA 4KRPB 4HS3B 1G0XA 4X98A 4ODVH 1MIEL 1MQKL 4O51A 3FOMB 3LHPL 3PNWA 4JFOB 1DLHA 1URLA 4E41B 2FCBA 1OF2B 1K4CB 1AGFA 4BA8A 1FBIH 1XGYH 4LASL 3MA9H 1QFWH 2MPAL 1HHHA 3KPSE 5JDSB 3EFDH 1S7WB 3FQUA 4M5ZH 1HK6A 4XVUC 1J7VR 4NWUH 2DQCL 1JF1B 5DJ6B 5I66B 5IR1A 4C56B 1S7UA 1OTUD 1OWWA 3VFTB 1MRFL 3OXSA 1MWAB 2W0FA 2BY1A 1WITA 4LU5L 1FQ9C 5HJ3A 5I1DB 1N6VA 4NKIL 1GZPB 4ZFFB 3WIFA 5T1DL 2NPLX 5C2BL 2Q1EA 1UKSA 9CGTA 4DGVH 1H3TA 2X4RA 4PJFE 1CICB 1S7TA 3QEQB 4X9HA 2W9EH 1ZLWH 5F7NC 5BRZE 1II4E 3HFMH 3ARGD 3QISA 3NAAL 3Q1SH 4HXBH 2DLHA 2FD6L 4U2ZA 3U36B 1CTOA 4D0DA 3P9MA 2YK1H 1LO0H 1HKLH 3V5DA 3IDNA 4LLVB 4JZJC 3OQ3B 1MFBH 4KK9D 3QUKA 4OZGB 4MDJB 3BX7C 1TIUA 2BVQA 2EECA 1H5BB 1CN4A 3MV01 3PDGA 4WV1C 4G8FB 4QHNB 1F6AA 2YN5A 3PP3K 4PRPE 4HKXA 3JV6A 1GGYA 1AQKL 3QDHA 3U9UA 1KIRA 3LZFL 3H0TB 3BW9A 3OJDB 4RMQA 3F5WA 4ONGL 5CEZD 4JFFA 5IKCB 1VFAB 2OJZH 5E8DL 4FQQB 4R96B 4ZDHA 4EXKA 5ADPL 1CT8B 4Z7QF 1UZ6E 2XXMB 1HXMA 3VGBA 4FQ2L 4R0LA 5C0JA 2DYPD 4U1KB 2XOTA 1UXWB 3D3VB 1C5CL 2WSKA 1MH5B 5CBAA 4V1DB 2ICES 4JJHA 4M62H 5C0RL 1HWHB 5D1XA 4XZUA 1YEGL 1DSFL 3GB7B 4BELD 1MCOL 3BPLB 1HSBA 2R69L 1DBKH 4KQ3L 1F8TH 5CGYC 2PTUA 3DVFA 4CVZA 4NKDB 5CP3H 3N1MC 2ZCLL 1DQML 3SKMB 4IIQA 3HR5B 4LQ1A 2ZG3A 4U33A 4LGPB 1WZMA 5GS2D 2G9HB 2IAMB 3TVMC 1QQDB 4P9ML 4P4KA 5D7LD 5EPMA 5T33L 3A6BH 4LGRB 4K3JL 3VRLF 32C2B 2VUOA 1IC4H 5DUPL 4PJXA 1ULVA 4JN2B 5GGSB 5FYLL 4NNXA 3UROR 5DUBB 4TVSa 3MRNA 5D7IF 1HHIA 2C3VB 2HLFC 4I13B 5F9JB 1JF6A 4YH6A 1L7TH 3HE7A 4KDTA 5I16A 2V17L 5EZLA 1G1CA 1NH6A 3Q5YA 3F7VB 3I75B 4RNRA 4PGEA 3O45A 3BD3A 3P77B 4MJIA 4PP2A 4J3TA 4WUKL 2HH0L 3P11H 3F65A 5KS9A 1MWAH 4P2QE 1YN6B 4AEHH 4UDTB 4KZEH 4R8WH 2AEQH 3B9KB 5TE7H 2Q86B 3I50L 5EB9A 1LP9A 2R0KL 4U1GB 3RUGF 1MFEL 3LEXB 4KDVA 3KPRD 3K74B 2XRAL 4QWWD 3QAZB 4JPIA 1VGKA 4MVBD 1XF3B 1ZVYA 4KRNA 3DV6A 3J7HA 4Z0BH 4IEFB 4ZSOA 3G5XA 2HN7B 1Z9LA 4LCYA 5DJZB 4EI5D 3EUUA 3SKJH 3UPAA 3MLTA 1DANT 3GDBA 1B0RA 4K8RH 1XGQB 4PJIF 3JVGC 3IFNH 1ADQA 3AMKA 4OF3A 4PYHA 5A3IC 3JWOC 4M48L 1QP1A 3E3QE 5L2KE 4XC1L 3MV8E 4MB3A 1T1ZB 3BZDA 3QUMH 1PSKL 4DWHA 2CO7B 5DD1L 5DQDL 1N5AB 4Q9RH 1PLGL 2ZUQB 4M5YH 2CIKB 3KPSA 2EEAA 1UT9A 4K3EH 4WO4B 2AJXL 3V2AR 4WY7H 1XIWC 1F90H 5DZLA 3QWRA 1GAFH 2UYLB 5C9JA 5HDBF 1F58H 4L3CB 4QOKB 1BQLL 4YJZL 3V9FA 3MLWL 3HUJF 4MA3B 1J0ZA 1K5NB 3VXME 5EBLB 1IAIM 4G6JH 3DTXB 4A6YA 1FZMB 1I7ZB 1UA6H 4M7ZC 2XPGB 5JXEC 3G5VB 3S36H 1CD1B 1YEHL 3HHRB 5C0DA 2IG2L 3IFLH 1HSAB 4LF3A 3I6GA 3L95B 5M7QA 4G6ML 4PJFA 3CFBA 3RWHB 3Q6FA 2Q3ZA 3RZCB 1JGVH 5C0AE 3RGVC 5BRZA 3KS0H 4X6FB 5JW3H 2GSGA 4J4PC 2RBLA 3VI4E 3ORJA 3ZSSA 3F6IA 2EH8L 5E0QA 1DN0B 1IRAY 2VZSA 3ARBD 2EDTA 4ONHA 3BXNA 3TH2T 3MOAL 2DIBA 1YPZF 2ORBL 2ZCHH 4LMQI 3QXDA 4TOYL 5AWNL 5EIVA 2DD8L 5ETUA 1LDPH 1SJXA 5K9QI 4U1MA 4OM0H 1KEGL 1FZKA 5A2IH 3CUPB 2SEBA 2XTJD 4TPRH 1YEKH 4F7EA 4X0KA 4OCWL 3L5WB 5JW5B 1RZKH 4HW6A 4PRHD 1JGDB 3HG1E 3NZ8A 2BK8A 3VRJB 3PDOB 4HK3J 2EYSA 2D3VA 4CNIB 1TQBC 4F7TB 4HWZB 3QUZB 4OAWA 4JHZA 4JB9H 1QLEH 4BK4A 4JPKL 4DW2H 4LSSL 4TNVF 3SKUD 1MEXL 2FGZA 2FIRT 3BN3B 2VE6B 3HAEB 3ROOB 4L8CB 4LVNC 2YUXA 5GGQL 1FYTD 1U8LA 3HC0B 2XQBH 2Z91A 3ARFD 2HTLC 5JMRA 3DECA 4UIMB 5DO2D 5DEGB 2IBZY 5IJVA 4QT5B 1EJ6A 4MXWH 4LCCB 4WFHD 4ELMB 3EO0A 1EBAA 2YA0A 3MLVH 2VTFA 1U8OA 3DX9B 4WW2A 2ID5A 5CCKH 4U1LA 4NN5C 2L7JA 4PGBB 1A3QA 3VH8B 4PV9A 2YOCA 3VFUA 1FSKC 1PKQB 1HZHL 2ZCKH 3QIBC 2R4SL 2F19H 3IKCA 5KZCD 4D9RE 4ZFOL 3GO1H 1CLOL 5EWIL 1VACB 3O6FB 1OAUH 3MGOB 2Z93A 5TDNB 1BF2A 3P73A 3MV7D 4F2MA 4I2XB 1NGYA 2ADFH 1IAIL 4JANB 3EDEA 1YUHA 1N8ZA 3PWLA 3QDJB 4JQIL 2YEZA 3PXHA 4PP1D 3QPQC 1BD2D 3U0WL 1G9MH 5SWSD 4DOHB 4PRIB 3OB0H 2FX7H 5FCUL 3DVIA 3FHAA 3FAXA 4LRIA 4LPXA 1UM6L 2F53B 2ICCA 5HGAA 1FRGL 1ORQA 1RUQL 2IAND 1IC7H 1YDPB 3B5GA 2JIXD 1PGRB 4FQLL 4HIHA 2VDLL 1D5ZA 4P3CH 2ESVB 1BLNA 4L9LA 1ZHBA 5F3BA 2ZSVA 2IQAA 3WO4C 1JN6B 3DETC 4QY8A 3V4VH 3B5HA 1B6DA 3SDAC 1RK1A 1U8PB 5SX4I 1I8IA 3GKWL 4P2QA 3T0WA 5DVKA 3OKDA 3T3MF 5MERB 2PO6A 3RGHA 3IKKA 4AT6A 4U6TA 1GGBH 1YY8A 1OQOA 3U46A 4YIQA 4Y19B 5F7UA 4ODXA 2M1KA 2ZKHL 5GRYA 4JZJB 1GZQA 2H32H 1T5WA 3EYSL 4JFDB 1KLUA 3IAQA 4MX7B 4KQ4L 3BP6A 1H3UA 3RAJL 1ZTXL 4Z76A 3GZKA 1IAMA 1KCUH 3VFVB 1AP2B 3KAAA 4GW1B 4N9GA 4WV1B 4D2NA 1ORSB 2YD2A 3ZT7A 1KIPA 3DX8B 1R5WA 1U8HA 5SWZD 1VHPA 4NWTH 4OI7A 2QADD 3LB6D 5MP6H 4ZFZA 5DJYB 1A21A 5ICYA 4WEMB 4TNWF 3LQZA 5EUOE 1RZ7H 1ZANL 1CDGA 5D96C 1FIEA 5INDB 5MEQA 3SGJA 4ODWA 4TSCL 3VA2C 5J8OA 4NN7B 5CWSA 1P4IL 1SBSL 3IDMB 5CKAA 4MCZA 1NCDL 4O5LH 2B4CH 4K2UL 3QWQB 3DLQR 3O81A 3KPMB 4OQ1A 5FFLA 4XPAH 2EE6A 4ZS7H 5ABDE 4GBXA 2FWOA 4WWKC 5FYKH 5I1KH 1KTRL 2NW2B 3HZKA 5D2LB 3L3OB 3SPVA 3VXMA 5JHDD 2BJMH 2GITB 1EFXB 3EO9L 2P24A 1E4WL 4OQTH 1LEKA 1X7QB 2Y1VA 3FO9A 4DAGL 5I74C 1MJUL 3FCTB 3VD9A 3RNKB 1GVIA 2DWDB 5A43C 1CXHA 5CGYD 3GBLA 2DS4A 4HH9B 5IVXF 2IPKA 1CGWA 5B3NA 4UB0L 4YDLB 1FC1A 5C0AA 4GW4A 1JI2A 3TVMB 3WIIL 5HHQB 2RFXB 3IFOB 3MCKB 4MAYA 3HE6C 5LWYH 4WTXA 3KPTA 4HZLA 5I8OH 2DN7A 4KI5F 2FX9H 3O4OC 1TTUA 1P4BH 3ZDXF 4BZ1H 4HBCH 4Y4HC 1CU4H 3AU1A 3VXTB 4R90L 5I1LB 3IXTA 5DRXA 3SE3A 1FAIL 3F58H 4XAWL 4F58H 5EUKA 5AYUL 1P69B 3MRQA 3TN0A 4WI7A 1QOKA 5I0ZA 1U42A 1MI5D 4LLYA 3HG1A 3DXAB 5EOQL 2J88H 4ESKA 4HG4K 3I02B 4LSUL 4P46A 3UTOA 3BGMB 1NDGB 2A9MH 4KAQH 5FECA 1BVKB 4JCMA 4I3SH 1TJGH 4Q6IA 4X6DF 3DGCR 4NOBA 4AZ8A 4P2RD 2XKSA 1G7LA 4TYUA <