3UDWC

Crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
b'DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell immunoreceptor with Ig and ITIM domains
publication title Structure of TIGIT immunoreceptor bound to poliovirus receptor reveals a cell-cell adhesion and signaling mechanism that requires cis-trans receptor clustering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3udwC00
3MRFA 1DUYB 4NRZB 4OIBA 2XZQL 5DDHB 1P7QA 1I8MB 1T3FA 2EH7L 1FSKB 3C5SB 5DO2C 1T0NB 3SE4A 1HKLL 1CBVH 5GGQL 1GPOH 1CD9B 2IMMA 4I77L 4Y16C 4P3CL 3OHXA 5IHZA 4YEFA 2X1XR 4KKAD 5HGAA 5I75C 1J10A 3MRRB 5EC1B 1FIEA 4NM8H 2A9ML 5C0DB 4Y19B 1S9KC 1E4KA 1QR4A 3K2MC 4WTZG 4L8CB 3NH7L 5GIRA 4OZGF 1T0PB 4KRLB 4JM2F 1W72H 2AW2A 3QEHA 5HHPA 1R3KA 4LSPL 1T83C 1A3QA 3ULUC 4JVPA 4AT6B 3FO2B 4LVOB 1C5CH 1RUPL 12E8L 4I48B 4OCSH 2PKDA 3HC0B 4ACPA 5T5NG 1U36A 1FL6B 2XFXB 5I1DA 1DBJL 2BNRE 1NBVH 4U6XB 5D5MA 5T1KB 5L7XH 4PJBA 3ESVF 4FXKB 3FB7B 1NFDE 4N8CL 2RB8A 4XI5C 4ZO9A 1MFDL 5D72H 5DRNA 3FRUB 1GZQA 4L9DA 4U1LA 2B4CC 1MWAA 5FF6A 3PXHA 1CD1A 5E8DL 3QJHB 3WLBA 4UV7H 2AXJA 3HNTL 3VXME 3NZHL 1G6RA 5D2NC 4Y4KB 3VXTA 2GSIA 3KNBB 3NAAH 3K3QA 4HJ0D 4PJDF 3T0DA 4MYWB 3ARFA 1ITBB 1I9EA 5BV7B 1V5JA 1VACB 2NZ9D 1NKRA 1OLLA 1KLGA 4NPYA 1NGQL 3CFIC 3F7RA 1KC5L 1ONQA 3LMJL 5CAYB 5KVGH 5IB5A 2XTJC 3B9KA 3TIDB 2VDMH 3EGSA 4UNTA 4TUOB 3OPZL 1ZTXH 2XN9A 3QNXA 2J6EL 1A1NA 1PY9A 4GRWH 4OF0A 2BNQE 3TZVC 1VSCA 4MA8H 3ARXA 1EHLH 4LVNB 1I9RH 1ZT1A 2APWA 2DS4A 3O6FB 1S5IL 1NCAH 1OSZB 1QLFB 4FXGB 5DUML 3RA7H 1NDGA 1JYWA 5ISZE 1INDL 1F02I 2I07B 3QWQB 3IGAA 1KN4H 1WSST 4HJJH 4JM4H 4LHUG 3GMMA 3FT4A 1AH1A 5AYUH 5DT1H 2NY6D 1TITA 1TNMA 4XCNB 4GOSA 4H1LA 3GUTB 1GYAA 2XQBH 3PF2A 4FQXC 4FTVD 2OTWA 4O5LL 3T2NL 1RK1A 5JW4N 2Y7QB 3QBTB 2HTKD 1X3DA 4MCZB 1AXTH 4N9GA 5HGGS 3CIQA 1E28A 4RMVA 3K4AA 3VWJD 4S2SA 3GSNH 1T1ZB 2VXTH 3HNSH 2AJVH 1YY9D 3D69B 1IGYB 4X6FB 4R97B 4PJ7E 2OJEB 3FONA 3H3PH 1NMCB 1DQJB 3TO4C 3RPIB 4TULH 3U7YL 4PGDA 3VXOA 3JTTB 4EI5A 1U3HA 4E41A 5JW4R 3DSNA 2CDGA 4NOBA 1I3GL 3MXWH 4PGEB 1VADB 1MCBA 4O51A 1FH5L 4QCIB 4QHNB 1JHTA 5A1AA 1VGEL 4YXKH 5C0ND 4MX7A 3LKNA 1J0HA 1GGCL 3V7AG 3CU7A 3WLWD 5IQ7H 4FQ1L 5GRUH 2P44B 3VFSB 2W91A 2EE9A 1L9NA 3EFDH 4YGVA 5KVDH 1K6QH 2VDPH 2GFBA 2QQNL 5EB9A 3JUZA 1FGNL 3RP1A 5K9QI 3UTSA 4YDJB 1QP1A 4B7IA 4Y4FA 1IZKA 2YN3A 1VENA 4H1LG 2M1KA 1MCLA 3VFNA 1B0WA 3KPMB 5EUOA 4OZHB 1G1YA 2O5YH 3KYMB 2FH6A 5DGQA 1HQRB 4XNMB 4KHXH 1LO0L 2H45A 1YNLH 2PYFA 3CH1A 1FG9C 1IT9L 1CLZH 4OAWA 1I7ZA 3DYMA 4X6EA 1QSZA 1BHGA 3V4VH 3AVEA 5CEXB 3M07A 2RCSL 2YPVH 5F9OL 2QQLH 1YN6A 3BW9A 1AO7E 4GXVH 1NAML 3MROB 1EXUA 4FG6C 2YD2A 5MHSD 1JGEA 5C0RL 4MHHI 4QRSA 1JJUA 4RFOH 5ESQA 2MPAH 4KQ4H 4YK4B 1Z9SA 1ODAA 1W2KT 1IAIL 4P9HC 3ARGA 3G6DH 1OSPH 4LPCA 4BK5A 4TOYL 1YMME 2X09A 3CDFA 1F3DH 3G6AB 4IJ3C 1JV5B 2OMBA 4KKLC 1LEGB 4L4TB 4PRIB 5M95B 1A6TB 3KYKH 5CINH 5C0AD 2CIIB 5CBEA 4MZ2A 1NC2A 3QZWB 3ARDB 4R0LA 4MJIE 3GSRA 3HI6L 5F6HJ 2F19H 2HVKA 1MHPL 4XNUH 3O41B 1T80A 1HSAB 2ESVB 1FV1A 2DWEB 1Q0YH 5C6TL 5EU7E 3QIBD 4QXTB 3ECBA 3ULVE 2VDRL 1P7QD 3TA3A 3H9SE 3HUJA 1ZS8B 3CFJA 3GSXB 3OR7A 4DTGH 2C3VB 3L5HA 1J05B 4CMHC 4DKEL 1MCIA 1MIMH 1RZIA 2MKWA 3HG1D 3IS1X 4LCWE 5JHDB 1SBBA 4JFEB 1EHNA 1OAXH 1HYSD 3AM8C 5I8OH 1QRKA 2E8ZA 4H25B 3GMNA 4ODXA 4MA1B 1YEIH 1ZGLB 2QSCH 3HE6D 4R96B 5CEZH 1SYSA 3OAZK 5AG9A 1BP3B 1NGWA 4LHUD 4YR6B 4EJ1C 3ZL4L 5EZOH 5FYLE 5I1HH 4JFQA 3LKOB 3SO3B 5HGDA 3NFNB 2VLRE 1DVFC 3BKYH 4OD3L 1NH6A 3VXRB 3WIFA 1URLA 1U8KB 4QOKD 5BJTA 5I15L 1FBIH 1KJ2B 3VI4E 4TVSa 4X80H 1REIA 3VDBA 5A3ID 1CDGA 5TF1L 2XXCB 3C09B 3GJEA 1ACYH 2V7HB 4MDIB 3CLEH 5F21B 4HC1H 3MXVH 1JPSH 1JL8A 4BELD 1KACB 4M7JL 5DQ9B 1RURH 4HWBL 2FD6L 4Q6YA 2YRPA 2E6PA 1KNOB 1VB9A 3WS3A 4R4ND 5CP7B 4Y1AA 3EYFB 3MBXL 3QUZA 3FB5A 4OLEA 1T1WB 2ATPB 2CK0H 5D2LA 1IFHL 3WFBL 1Q72H 3WKNA 3QQNA 2NW2A 4Z7OF 3P2TA 3QEQA 1CE1H 4ZXBB 4OZGB 3D1MC 1KB9K 1KXTB 3MREA 4JM2B 1O7VA 4FFVD 4XPGH 2E27H 1YMHB 3ZHLA 3PP3H 3P4OB 4HBQA 3MNZA 5IB2A 2D7QA 1T7XA 1DQDL 4IOIB 3UTZA 1E6JL 2LAAA 3O3DA 2YK1H 4NQEE 2RJMA 3DX8B 3C8KA 3BE1H 4Q0XH 3QUMA 5I71B 5JW5A 3QXWA 4LRIC 1Q94B 4CMMA 3HRZA 5TPWL 3O3EB 2YZ8A 4OQTL 1HHIA 2AEWA 4FQIH 4UT6H 5CKAA 1T20B 4NBYB 5F8RC 3MR9B 4PPTA 1QRNE 1T2QL 5KVFH 5LVEA 1UH3A 5GJSH 2HT2D 3BUYB 1U8JA 1YN7A 5KSBB 4XRCA 5T1LB 1YPZE 5T33H 4BQCA 2P8LA 5E7BA 1GL4B 2WBKA 2IG2L 4GG6B 2V5RA 4KROC 2VITB 3HS0A 4Q9CA 1CDUA 5C7XH 5BOPA 5F7EL 2XKSA 5HHNB 4POZC 2XXMB 5FM4A 1QZ1A 1T89C 2G2RB 5IMOB 2EE3A 3MLUH 1EO5A 4XCFL 2P5WD 1BQSA 3BKJH 4JDVA 2XKUA 1D5BB 1WISA 3C60C 2DLFL 1WWAX 4RGNE 2COQA 5GGRY 2YPKA 4MJ5B 4WGVB 5C09D 1WBXA 5MI0B 3RVVD 2BMKA 4M7LH 3VFTB 1YEKH 1G9EA 2P5EE 2AJYH 2A9NL 4KRNA 3IAQA 2IAMB 1HK6A 1IM9A 1IGFL 1MCWW 3BIKA 2OZ4H 43C9A 4OCYL 4MGXA 2QHLA 1EFXA 3VFVB 3FQRA 3GSQB 3MRLB 5CIPA 1AI1H 1MHCA 4N0FB 4S1QH 4K3DL 1EUTA 3OGCA 3BZ4A 3HAEH 5ID1B 4PRPB 5D6DC 2PUQT 1ZANH 5D7LB 3VXUB 3KXFE 4MQ7B 5E70A 3WFDL 4Y4FD 5DK2A 2AJSH 2C1PA 4RGOH 3L3OA 3PJSB 4UB0L 2X2YA 2Y5TA 1MCDA 1VCAA 3KPSA 5FYKD 2GTZA 1YEGH 2GITB 2F74B 1IEBA 3VRIB 5FM8A 4FFYH 5D1XD 2R9HC 4GMSL 3EJZD 3LHPH 4JHWL 5DZNA 5T3XL 2VZUA 1X5IA 3QPQD 5J13C 4JY6A 3WFZA 5FYJH 4R6UA 3WKML 3DBXA 4JLRA 4JPVH 3DRQA 3QNZA 3LDBC 5FGRA 3QFJE 3D39A 3TFKD 4KVNL 3RNQB 1F6AA 2WBJA 2WWKT 1H3PL 4HJ0C 4PR5A 5F93C 1JHKL 5A2FA 1ZLWH 5E2JA 2DYPB 1BLNA 1R5VB 2APFA 2N56A 2NZ9C 5DJZA 3BXNB 1FYTE 5T5NF 5I6XC 3JVGC 4UQ3A 4PRHA 1I3RA 4CU7A 5EUKA 5FAAA 4ZPVA 4NO5B 3RWEB 4G8GD 3U6RB 1CGVA 5DD1H 1UC6A 1WLHA 3RDTB 1OAUH 3QG7H 3NCEB 1FZOB 4QY8B 3VDAA 3DRTB 3MA7B 2HFFB 4HFWB 4FFZH 3O2VH 2ZCKH 5DI8A 3WFEL 1UACH 2B5IC 5D9SA 4WEMB 3LIZH 5B8CC 1QPXA 4UDUB 1CIUA 5DEZA 5T1KD 3T04D 3MRMB 3P4LA 3U2SB 4YO0B 2OTUB 4KI5E 5JOPE 2DMBA 2VISA 5CZXD 5H37G 1IVLA 1CU4H 1AR1C 1QYGH 4GKNB 3O4LE 5TGBA 3GJFB 3TBWB 5C0CE 2KQMA 4Y4KD 1WBYA 5D7IB 5AZ2L 4PB0L 2IADA 1EMTL 3D85B 2FIRT 5E2VL 4RIRB 2PF6A 2NW3A 5DJ8A 2EKJA 4ZS6D 3P0VH 1IGCL 1MF2L 4KFZC 1YY9C 5IESH 5J4MA 4NWTL 1OM3H 4PJIE 1BAFH 4AEHH 4XCCL 3ZKXB 5JPNA 1N5AB 4XBEH 1BZ9B 4EEEA 5JXEA 3SGKA 3TYGL 4WDIA 1XF2B 2ZUQC 2AKRB 1MPAL 4F15C 4PJGE 4ZSOE 4U05A 3F5WA 2V2XB 4PGJA 3RU8L 1WZ1L 5B3NA 3O6FD 3WLWC 4GFTB 4HH9B 4ODUA 2WNGA 4O9HL 1R0AH 3DO7B 5E9DE 4JZNA 4G5ZL 2Q7YA 1W0WA 1F3DJ 1EA9C 3DSFL 3DX7A 2VDQH 1FLRL 2ZKHL 3QQ9D 4NNYA 2XA3A 3MLRH 2DLGA 1M05B 3K2UH 3O3BA 1G1CA 4OBSA 1NAKH 3GO1L 2BDNH 3E8UL 1TCRA 5I66B 3SJVE 4JQVA 4QT5A 1TLKA 3KPOA 1DQMH 3K81A 5CSBA 4PJHA 2OJZH 1LO5B 4ZFOA 2HN7A 3QUYB 3BYYA 4M02A 3NCMA 15C8L 2DB8A 4U6YA 4ETQB 1T6WA 3NIGF 3ARSA 4WUUA 4Z0BH 4EN3A 1J0KA 3JWDC 1K2DB 4O58H 3G6JE 4F2MA 5DC4B 1OD7A 1RK0A 2ARWA 1JIBA 1M4KA 5LWYH 1P2CB 1MEXH 1P1ZB 3RNKB 4ZFZB 3T65A 5I1KH 1NC4B 1X5HA 4RQQA 3SKJL 4L3EB 5DA4A 3CXHJ 1X5LA 1Z9OA 2NXZB 5C07D 5I1CH 3ES6B 3BN3B 5IF0B 2J8UE 3LY6A 2XZCH 4OI7A 3PGFL 3B9VA 1KF9B 3VFUB 4E0RA 4XPBL 2A6KB 1EK3A 3KYOA 4LCUB 4XVSL 3MRGB 2V9RA 4X5XB 1R5IB 2BSSA 5IM7B 2AJXL 4M43H 3IU3B 4DVRH 5KSVA 4WW2C 3H6JA 1HH9A 5D6CA 3NA9H 5JTWA 3VGFA 3DV6A 3RBSA 2ZOKB 1FRGL 1EEYB 3EOTH 5GGUA 4ELME 2DWDA 2IMNA 4ONHA 4QXUH 3MV8A 1MFEL 2IFGA 2VO5A 4BZ2H 4OZ4B 4UUJA 2AEQL 4HWZA 5JPMA 3O2DA 5TE6H 4JHZA 4NZRL 4JFHE 2NPLX 1J88A 1JHLL 1OP5K 1KJMA 4AMKH 4E5XB 4R4FH 3PWPB 4ZPTB 3SE4C 3O6LH 3HTLX 4HUXB 1AD9A 4UIKL 4HUNB 4L4VB 1LVEA 4ODVL 5F6IC 3R8BB 2ZPKH 5CBAA 3ILQC 4ORZC 2FR4B 4KK5C 4YNYB 1HYSC 3CMOH 3ULVL 3KJ6H 2R4RL 5J6HB 1E4KC 3HE7B 4KXZI 1BM3H 1JZ5A 4HIIA 1GGBH 1I1CA 5IMMA 2AXHA 1FZJA 5K93A 4WV1B 3LN5A 3LS4H 3OZ9L 5MERA 3HE6C 3C87A 5MENB 4JR9H 5EUOF 1FGVH 2OTPA 3CVHL 4X6DB 43CAA 5DHXB 4R7DA 4OZFH 5E0QA 1NCTA 5F71A 4IMLA 4L4TD 4PRID 3L3KB 4TSCL 1CVSC 4JO2L 4OIAA 3HI1B 4XBGB 2VL5A 3ARDD 4L4JA 4UI2A 1OWWA 1KCVL 4P48A 2BVOA 3KWWB 4IRZH 3VFGH 2ZNXA 4JB9H 4PD4K 3UO1H 4YWGH 1A5FL 2VWEE 3AFLA 1LE5A 1RHHB 4P5KA 2F53E 2ESVD 4GAGH 4XGZA 7CGTA 3ZHDA 5FYLL 5A3IC 4LGSB 2OSLB 5FA3B 1JNLH 5HHME 3S3JA 4RNRA 1DBKL 3NCJH 3JWOH 4U3XA 3M1BB 3DXAD 3ARFC 4C56D 1YQ2A 4U2ZA 1OP3H 2KZWA 4N8VB 1CR9H 4DGIL 2NX5B 3BDBA 1A1MA 1KCKA 3GBNL 3MJGX 2CO7B 5JHDD 1NMBH 4IRJA 3PNWA 4HIXH 5HVFB 2R2BA 4BK4A 4QO1A 3C08H 3RHWK 2DMCA 1FNGA 2FZ3A 4LEOB 4WFFE 3A6CH 5JIKA 3KS0H 4EXPX 2ZJSH 4LAQL 2X7LA 4PTTA 1S7TA 1MELA 3DUSB 4H8WL 2PCPB 4HKXB 1C1EL 4JFYB 3N50A 3LEVL 1QSEA 4QF1B 5DHVB 3AU1A 1Q1JH 1EGJL 5ETUA 1AHWC 4IOFC 1ZLUH 3RY6A 2WIMA 4FQ2L 5B3JF 2Z0BA 1PG7X 5E1AA 2B0SL 3HUJF 3UTTA 3VXRD 3F7VB 4KK9D 2Q6WB 2VDNL 1KELH 4WFEE 3GSOB 2F58H 4D9QE 2Y06L 4Y5XA 4GRWE 4OJFH 3SE3A 1B0RB 1EIBA 1VHPA 5CCKL 1A2YA 1Z5LA 4I3SL 2HT2C 3W2DH 2C3GA 1LNUB 3FMGH 3DI3B 1R3JB 1XGYL 4Q2ZB 5JHLH 4XP1H 4KAQH 1OTTC 4X83A 4PJ5E 1SEQH 4DAGH 4NT6A 3GHEH 5GS1B 2I9LA 1PKOA 4P4KD 2YBRB 3NVQA 1F2XK 3OXSB 1NFDB 5ID0B 5D96B 4EI5C 1BQHB 5CGMA 1S5HA 4I13B 2VDKL 1EJOH 4ISVA 4LRNH 4D2NA 1A9EA 5C0GB 3RVVC 4KVCH 1MFCH 4JDTL 1S9XA 4MXQC 3MRFB 2OQJB 4AG4H 3I3EA 4AEFA 5FDWA 1I7UA 1H5BB 3T0AA 5I73B 5GRVL 3U1SH 3IFOA 3MRCA 3CCHB 4N1CA 3KR3L 4LCCB 5HGAB 1XF1A 4Y4FC 4HMCA 3Q3GB 2NTSP 4HSQA 5D2LF 3KLAA 1CFVH 5F6HI 1FORL 5T1LD 1JZ3A 4PLKD 2CLZA 4GW4B 4WI6A 2R4SH 2BNQB 3R1GL 2K7QA 5D71L 1ZVHA 4G7VL 3V5DA 4RISH 1DSFH 3QEHB 1R3KB 4G9FE 3VE0B 2QSQA 3BGMA 3EJZC 4HKBA 3CX5J 2EDNA 3LPWA 4KGLA 2AGJH 5ISZB 2Q86A 1OT1A 1N64H 1JTOA 4KJYB 4HWBA 1K5NA 2MQCA 3SBWC 4PYGA 5HI5D 3IVKB 1BPVA 1TZIB 3DGGA 5JW3H 5DRNB 3IF1B 1L6XA 1GZQB 1Q9OA 2DJUA 1PG7L 5GSRA 4ZFGL 4P3WA 5FF6B 1IC7L 2H6PB 3BWUC 5HHOB 3BSZL 1K3ZA 1MQ8A 4LPTA 4LMQI 5CZVL 1WEJL 2GSIB 1MUJA 4TUKL 1P4IL 2R2EA 3AS1A 4S0TD 1DBAH 4PJCF 2R0WL 4NPYB 1ONQB 4R0LC 5FUZH 3K8MA 1L4IA 4YBLC 4CVXA 5HDQL 3PV6A 4LVHC 1HZHL 1S7VA 1MFAL 3PWJB 2FBJH 3B9KB 2VE6B 3TBVB 2JB5L 4NHUB 2LV4A 2NY2B 3GK8H 4K9EL 3VXPA 4H5SA 4DCQA 5IVXA 4P5TA 3CFCH 3TPKA 1IKNA 4ZO7A 2XWJA 3NCYS 3B2UD 5BO1L 3RWIA 4G6KL 2X4OB 4HV8B 3TA3C 3KLDA 3CFEB 1EDQA 2DQFB 3KHQA 1ES0B 1CDHA 4FQQA 3I02B 2GEEA 2F9BT 4U1HB 1P9MC 3MOAL 4YHML 1WWBX 3F12A 4GH7B 3T1FA 4GAYA 1KPRA 4CDHA 4F8QA 1A7BA 5TDOA 2LABA 3P4MB 2DYPD 4OLVH 5HI4C 4UOJA 4ZS6C 4M1GH 4XVTL 3WSQH 1QFUH 3MOBL 4XC1H 5BVJB 2UZIH 2X1OA 5DJXA 2X1WL 4Z5RA 1AE6H 3QJFA 5JUEL 3WS6A 4J3VA 1K8IB 4LNRB 3RDTD 3QCVH 2BOCA 5L2KE 3DURA 3BDXA 3L3GB 4NO3B 2GIYA 3C9NB 5BZDB 2NLJB 1CE6B 3FONB 3MRIA 2F54E 4JZJC 2CXGA 2IANE 3DYOA 1M1SA 1ED3A 1CIDA 1U3HB 3FN0H 5CEZE 2CDGB 1FJ1A 3GM0A 3X11A 1GGIL 4P2RB 3W81A 3WO4B 3N1GC 1DBML 2GJ6A 3MO1A 1T21A 4MX7B 3QHTC 4PTUB 1JPGA 4M9OA 5F3BA 1S7WB 5EZLA 4NCC2 3UJTL 2YD5A 5GRZA 3QUZC 1JPTH 1UM5H 1GVIA 4MJIB 2FH8A 3OF6A 4J12A 5HYSG 4QRRE 4Q7DA 4OLWH 2X4UA 5CJXC 4NZTH 1F97A 1NMCC 2V9TA 1A6VH 1V3LA 1KFAH 4D94A 4XBPB 4XC3H 3H9SB 4ENED 5DMIL 4EOWL 2H1PL 1I7ZB 4F37K 5AZEL 3I50H 4X6EB 3VFWA 1S3KH 5ERWB 2VXSL 3TO2B 4F7EB 5GS2H 2YC1B 5SWZA 4FZEH 3VXMA 5F9AC 1XCQA 1YN6B 4IHOA 4NO0D 3BW9B 1CICD 4J6RL 3ARED 3SGDI 4LCIH 3E6FA 4ZNEE 5J3HD 3N0PB 1EXUB 4G6JL 2LU7A 4QRQB 3FHAA 5HGHA 1X6LA 2EIEA 4EI6B 4WTWA 4HLZG 1PYWA 2DBJA 3CPLB 2CLVA 2EZ0C 2C3WA 2C3XA 4NBZB 1A0QH 4KQ3H 2R56L 3SDAA 5C6WH 3ARGB 1N7ML 2JELH 5CSZB 1ZXQA 3RJQB 3T1WA 1VFMA 3QIWB 3V5KB 3IDMB 4KK8D 2VLRB 4TRPH 3VI3E 2DICA 3VXSE 5DMGD 3MV7A 4RFNC 4YPGB 4X4YA 3GSRB 1YEEH 3QUYD 5HDBF 3G5VA 4M3KB 3RHWF 4OTXL 1KYOK 5CILH 5EU4A 1KUMA 5TDPB 3DMMB 3V52L 2CRZA 1FV1B 3H7BB 3W11D 5HHQB 5J9PB 3K8LA 1G84A 4XXCC 3FOLB 4BKLA 4PRNA 1JGUL 5I8KL 5HGBA 2V5SA 1JWUA 3CFJB 4LEXL 3WXVL 4LLYA 2E7LA 3PDGA 2ATKB 2AJ3A 1NC4D 3OKNB 5CJ5A 1FVEB 5GQBA 3KS0J 3ZE1E 1Y6KR 2Z91A 2CKBL 5FM5O 5D8JH 4IIQA 2JJTA 3GMNB 4PJHF 5HD8D 3AUVA 4X9BA 3HZKB 1U2HA 5CEYB 3B8YA 3ARDC 1NBZA 1SYSB 2OMNA 4WJ5A 3RWHA 1JE6A 4NJ9H 4Y5VA 4X6BB 3U0TA 4D0CA 1M7DA 4JFQB 1CBVL 1GPOL 3GGWA 2A38A 4EQ3A 4Q6IA 2HH0L 3K46A 5E2UH 2XQYG 5I8CB 4CGTA 3O45A 3B6SA 1J0YA 4PGBA 3WUWA 3WIFB 1BD2E 2WBJC 4NM8L 1H8SA 1QRNB 2C7UB 2HRLA 2HFEA 4J2XA 1FAKT 1ZWIA 2EDYA 3K1DA 2V9QA 4QRTB 4L4VD 3WNOA 4FMKA 5F97E 5FYJE 3QNYA 1C5BH 2XZAH 3QXAA 5D1ZA 4FQLH 4RMTA 4PP1D 3HR6A 4JKMA 3GIVB 2QTEA 4UT9H 1D6EB 5L7XL 2VLLA 4JQIH 1B9ZA 1IGIH 3RWJA 1WCBB 1CI5A 1I1YA 1TJHH 3RVUD 2ZOLB 5ECJE 5KSAA 1TTUA 3VG9B 1BVKA 5D72L 3HC3H 4MA3A 3RUGE 1YC8A 1BF8A 3SKNB 1MCPH 1XH3B 4P5TD 3KGRA 5FGSA 4UV7L 1A6ZA 3N1QC 2DQUH 3NAAL 5F9WB 1SYVB 2EYSB 1OB1A 2P5EB 3O3DB 3WUZA 3M17A 4TVPE 3LV3B 2VLJA 4P5MB 5TDNB 5JW5B 5KVGL 1RUQH 2YOCA 4YHIB 1G7PB 1CFSB 3PP4L 2VDML 1KTKE 3AMKA 1GCFA 2PO6B 4KPHH 1LO3L 1E27A 1ZTXL 5CHNA 1A3LH 2VQTA 1HSBB 1YMMA 2UWEE 4JFZH 3WUWG 3BH9A 3LKSA 1BFVL 1RUAH 1U8QA 1ZAGA 4OKVA 3MACH 4MA8L 1FFPA 2VXVH 1EHLL 4P4KC 3ILPB 4D9LH 3MJ9H 3A6OA 4PJCB 5DJAA 1IGTB 1NCAL 5JXEC 3SGKC 3RA7L 5JIHA 1YEFH 4JM4L 4HJJL 1KN4L 4F7PB 5I76A 2IGFH 5CP3A 4UILH 4I0PA 4XZUA 2V5TA 3MYJA 4PREA 3IDNB 5DT1L 5AYUL 1QEWA 3GB7B 1JWMB 1L7IH 4P23B 4ZTPH 1INEH 2XQBL 2EIZB 1VPOH 3AS0A 1HIMH 2O5XH 2A74B 3QG6A 3QDJE 2P8PA 1QA9A 2YPKB 3JV4B 1FYTB 2XQYK 4APQA 1KEGH 1AXTL 1FCCA 3RVWD 3I6GA 4LF3A 1X9QA 2MKLC 4WWKA 3T09A 3GSNL 4NZUL 2VXTL 2AJVL 5E00A 2Y07H 4HPYH 1IM9B 2V5YA 3PQYE 4NN5B 1H3WM 1J8HB 3H3PL 3ZE2F 2JIXA 3MLVH 3FQRB 4D8PB 4JQVC 4TULL 4BFGA 4Y4HD 3OGCB 5T3XD 1ZVSA 4IMKA 3ZKNC 3GBLA 3BH8A 3MXWL 5MEPB 1KJVA 1BX2A 5HJ3A 4FNLH 2BNRD 4XTRD 3TVMA 2D4DA 4YXKL 3MRKB 4WEBH 3LN9A 3OG6B 3KPSB 4HEPG 2NNAA 5IQ7L 2X4QA 3RGHA 1CL7H 3HB3D 5GRUL 1DANT 1J18A 1KN2H 1N6VA 5HI5C 4H26B 1HNFA 3EFDL 5KVDL 1K6QL 3QEUA 4YX2H 2VDPL 3CFKA 2LFGA 3DBXB 4GUPA 4HUWA 4JLRB 3O4LB 3VXMD 2I25N 3RL2A 3VGAC 4MXWH 4X99B 1WK0A 3GRWL 4YDLB 1Q9WA 1ZHKB 3FRPG 5JORA 1FP5A 4JN2B 5INDB 1LO2H 5AUMB 2HKHH 1PEZA 1BLNB 2W0KA 5IW3A 2O5YL 3MGOB 3SDAD 4UQ3B 4KHXL 5F3HA 4PJIB 5IQ9A 4OI8A 1YNLL 2ORBH 5GGTA 1CLZL 1LD9A 3BJ91 5IB3A 1I3RB 3BPCB 5EUKB 1B0GA 3V4VL 2EYRA 5C0FA 3S34L 2YPVL 2QQLL 35C8H 1AGDA 2BNQD 5H2BB 4GXVL 4ZSOB 2RFXA 3GMOA 3SQBA 2Q8AH 5SX5H 3KPPB 2FCBA 4RFOL 4KTYA 1QTYT 2J5LB 5ISZD 2MPAL 3PL6A 4KQ4L 4PJ8A 1VKXA 1EHAA 3IDGB 3O4OC 1CDIA 5GGVY 1K85A 4L5FH 3G6DL 3PGCA 1OSPL 5HPMA 5CWSB 3HZVB 3DHMA 3PWVB 4ZO6A 2QR0A 4BQ6A 3KPLB 4NCDA 4X4XB 3QQ4B 5JO5A 3BP4A 3DTXA 4MJ6A 3KYKL 32C2B 4XVUD 4F37F 5GRYA 2XWBB 3U0WL 1CFNA 4MAUH 2E7CA 2O26U 2F19L 3OWEA 3BGFC 4JFOB 2IADB 5F44A 3IDJB 4XNUL 2VABB 1Q0YL 2AXFA 4ETYA 1D6VH 3MV9E 4IRSB 5JPNB 1YQVL 2XKNA 2MNUA 2KL6A 3V0AC 3IDIB 4DTGL 1WZMA 1MIML 2UUDH 3LD8C 4JY4A 4EUPB 4XMKL 5GS0L 1OAXL 4HGWB 2V5MA 3F5WB 5I8OL 5MEOA 2D0FA 4V2CB 3C6LA 2VDOH 1ZLVK 5KZCD 1UFUA 5I1IH 1YEIL 5SWSE 2QSCL 2GK2A 4PJXE 3SE9H 2G75B 2K1MA 5CEZL 5B38A 3FOMA 3CUPA 3CK0H 2OL3H 1MFBH 2B4CH 2FSEA 5EZOL 3KXFA 5I1HL 1MY5A 1JYVA 4CL7A 1FFQA 3L7EA 4DUXA 3SGEH 3O3BB 4DK3A 5H94A 1U58A 3BKYL 2Z35A 1JZ8A 1F4YH 2R2HA 1VEMA 4X80L 4PJHB 4F57H 3UDWA 4ZFOB 4E42A 3V5HA 4ZOBA 3WD5H 1ACYL 3MRNB 3CLEL 4U33A 4ODHH 1TQCB 3MXVL 4HC1L 2F8VA 4K7FA 3FCTB 3NIFF 4WUUB 4DOHB 3MC0A 4M6MH 4EN3B 3N06B 1BBJB 1AO7D 1RURL 2CKBB 2X4PA 1RK0B 3QR2A 1NGYB 1CICC 3C8HA 1MCKA 3AREC 5GXBB 5J8OA 4Q9QH 4PFEA 1JRHH 2GUOA 5I8EB 4WI5A 2Y9RT 1MRDL 4HT1H 5HBBA 1TTGA 4Z9KB 1CE1L 5F89B 1YMMD 4OFKA 4OGYL 3QA3B 1S7UA 1RIUH 4K23H 5E7FA 3H7LA 3D3VA 2E27L 1YECH 2ZSWA 2D31A 4MSWA 3OKMB 3TT3H 5EOQH 4KK8C 1Z2KA 5GGRA 4MJID 3ARBA 2YK1L 5B38G 4Q0XL 1GIGH 5IK3A 5D1QB 4ZUVA 3IFPB 1HH9B 2O61A 1W72B 1BVLB 3BVNA 1ZA3A 3DV6B 1A6UL 2BY2A 4FQIL 4UT6L 5GGUB 1YNKH 2YPLA 1E4XL 4XPHH 4G8EB 3W11C 3ULVD 3BP5A 3MCKB 3T2QA 3H9SD 4UUJB 4DN4L 5KVFL 1UH4A 3CH8A 5GJSL 2FO4B 5JPMB 4NM4H 3E3QC 1A4JB 1KT2A 5T33L 1FO0H 1DBBH 1AD9B 3VFPB 1H9VA 3FN9A 4LCWD 5FCSH 1CXEA 2J8OA 4C4KO 2NMSA 4W70A 4R9HA 1I8LA 5C7XL 1JZ2A 4YFLI 2APBA 1HWHB 1A9BB 4LQ1A 1FFNA 3C6SA 1ZSDB 1JBJA 2FIKB 5HD8C 1R24A 1FAIH 4JDZA 4X6CA 5IMMB 2IQ9H 2XA8H 5JMOC 3BKJL 5MERB 2BHZA 1TETH 2HFGH 4NQCA 1EO7A 5FYLD 2FO1A 3TJHD 3QWRA 4L8BB 3EDFA 3QIWD 4IMLB 4MS8D 1F11A 3V4UH 1I8IA 2VLRD 4M7LL 5DRXA 5E2WH 1YEKL 1MCWM 2VL5B 1TXKA 5FDYA 2AJYL 2PYEB 3T8XA 4K3JL 2OZ4L 5LAXB 2F8XC 4GRWB 1FIGH 1RULH 1AI1L 4S1QL 3DMMD 1PDKA 3BN9D 1IAKA 1ZANL 3QQ3B 4WCYL 4F33B 4LKCA 4ELKA 3FQTB 4S11A 4HDIB 3TF7C 4RNRB 4X4MA 1J0ZA 4RAVB 2AJSL 5IGXH 1OW0A 4PJ5B 1NPUA 4RGOL 4DFHA 1QSFE 1K4CA 4PP1C 3LEYH 2C9AA 4K7PH 3GHBH 3G5YA 1RJLB 4XNXH 1YEGL 2VZVA 1F3RB 2IALA 4FFYL 3SJVA 1NUDA 4IRJB 3LHPL 2A77H 2DOCA 1OPGH 2WINA 4FRWA 5FYJL 4JPVL 2A6IA 2VZSA 2BCKB 4P5TC 3RWGB 4P9HH 4PTTB 4HFUH 4HLJA 1E4WL 4LLUA 4I2XA 3GSNB 5KTEH 4NQED 1HHJA 2HFTA 3STLB 5BRZE 5E56A 1QG3A 5E1AB 3UTTB 3PABA 3U36B 3DROA 5AD0A 1RZFH 2J8UA 2VC2H 5DD1L 1QRND 4Y5XB 3GMQA 2X10A 3WN5C 1OAUL 3QG7L 3P3YA 3RAJH 2HT4D 1NCUA 2BVPB 2CPCA 2NR6D 4FFZL 2WUBH 4JGJA 3O2VL 2ZCKL 4N0UE 1BFOA 5CJBA 5IHUH 1UACL 4MNQA 2OR7A 5L88L 3WS6C 5C0IA 2FGWH 3P9WB 2AJUH 1I1AA 4RZCA 3Q6GH 4DZBA 2DQEH 5GGSY 4NBXB 2BFVH 2X4SB 3OQ3B 2I9LB 1T5XA 4G6AD 3HMXL 1IKFH 5FV1L 1XR9A 2R0ZH 4U1SA 4I18B 4OFYA 4LSQH 4LQFH 3S5LG 3GKWH 2UY7A 1CU4L 5E4EC 5JQHC 3MYZA 1QYGL 3BWAB 4RGND 1S5HB 3KPRA 1LP9F 3AAZA 2B7DT 3Q1SH 1B6UA 2CUHA 3B8SA 4M6NH 5DFVD 3J7HA 1MCOH 1JPST 1NCDH 1JZ6A 1H3VA 2VSCA 3RVWC 4X0KB 2P5ED 3C6LD 4F7MA 1RSFA 4U1GC 3P0VL 1KOAA 1ORSA 5HYEA 1UQSB 5I30L 4NQDA 3MMEA 3FTGA 3O11A 1RZ8B 5IESL 4K2UH 5FDWB 1OM3L 1BAFL 4AEHL 2A73A 4V2BA 2PO6D 4XBEL 3KXFD 4Y4HC 1T0MA 1WTLA 3IFOB 3MUY1 4ODWA 3EW3B 1DLHB 4RX4D 4YHNB 2DQIH 3E2HC 3TBSB 1G7LB 1Z0MA 5INCA 1L6ZA 4ZOAA 3KLAB 2VIRB 3O9WA 4XTRC 5D7KE 1ZHLA 5D7JA 1QNZH 5K9KA 4JG1H 4M1CD 5HVHC 1ITCA 3FFCE 3GMRB 5HTSA 1P7KB 3P9MA 3BGMB 2F53A 5CJQH 1FL3A 3OL2A 1U3JA 1T66C 1P6FA 2DI8A 2VDQL 3VGBA 4P23D 3QFJD 3RIAF 3AB0C 2FECL 4LVEA 3K2UL 3CXDL 4KRPC 1NAKL 5HYFA 2BDNL 3DVFA 4GW1A 4NYLB 3G9AB 5JMRA 1FYTD 1IAOA 1Q9OB 4EVNB 3PWLA 1P4LB 3VWKD 1XT5A 1DQML 4JGUA 2OJZL 1PX3A 3SDAC 3L6FA 1SMOA 2O5ZH 1L0XA 5CMAA 3OJVC 4R7NB 1LEKA 2VUYA 1NFKA 3MUHL 3RTQA 1I3UA 2R2EB 4Z0BL 3T77B 2Y6SD 4W4NA 5HYJB 2BSTA 3DVNA 5J12B 4O58L 3L5XH 1A7OL 2H3NB 2HWZH 3ARBD 4CDGC 2F54B 5LWYL 1MEXL 4PLNC 1XGPA 3ROOA 1UVQB 4OGXH 4A6YH 4RMQA 3VW3H 4OFPA 2H32H 4MCYA 3T0EE 1NJ9A 3VXPB 4DCQB 5DJ2A 5I16A 2WMPA 2XZCL 3LN4B 4WHCA 2XWJB 3RWIB 4KI5D 5JOPD 5C92A 2MJWA 2VLKE 3RWCA 1CGSH 4YE4H 2VH5H 4F9LA 3TBYB 2E7LC 3SY0B 3DHJA 4R26L 3O4LD 4UT7L 5C0CD 3QDME 1Z9LA 2B8OT 4JRYE 5F1NB 2LTQC 2M26A 4M43L 4YHYC 5AEAA 1JYNA 3F12B 3SDCD 3T1FB 1KJ3H 3MX0A 4NCC1 1NFIA 3NA9L 3P40A 1JTPA 3QCTH 5TDOB 4IIQC 1F13A 2JJTC 3MFFB 4MA7H 4QXUL 2BHYA 1XCTB 3W9EA 1BJMA 1BIHA 4BZ2L 4P2QE 3ZKMD 5TE6L 3GSVA 3T4AB 3QJFB 4LSVH 3N1PC 1I9JH 3O6LL 3F8UB 3I9GH 1KEMH 3DURB 4Q6IC 4BFIA 2DIJA 3H8NA 2ZPKL 1QBMH 3VI4F 1CF8H 4L1HA 1U8OA 4R2GB 4RDQF 3MJ7A 4JY5H 3CMOL 3KJ6L 2DM3A 4MD0B 4HCRH 3TNMA 1BM3L 3FO1A 1GGBL 4LKXB 5ICXB 2GT9A 4U1MB 3T3MF 5E9DD 3LS4L 3FO9A 3TGXA 1X5AA 4UU9B 5I18H 2GI7A 3RWDB 3UPCA 4JR9L 1FGVL 2GJ6B 4P3DA 4KZDH 3FQWB 4OV5B 2E7HA 1JPGB 3B83A 1JI1A 1U93A 3LCYA 5TQ0L 4B50A 5ACZA 6FABH 5DEGA 4IRZL 3SJVD 1A4KA 3QXUA 3VFGL 4JB9L 5EU5B 3W39A 3IJSA 3VXSB 3UO1L 3PE9A 4YWGL 1QQDA 1CD8A 1WJ3A 4GAGL 2XNAA 5SV4A 4LDOB 2IPKB 4JFFA 2NTFB 1TZHA 1JNLL 3NCJL 4NSKA 3JWOL 4TNVF 4J3UA 4OD1H 3GRWA 1F42A 4LLWA 3BO8A 4R8WH 5DHYB 5BS0E 4HS3A 3TPUA 1J1PH 8CGTA 4QHKI 2NY3B 1NMBL 2QEJA 1I1FB 2VQ1B 4HIXL 5K59F 3WMSA 2D03H 4PLJD 1KV3A 4M5ZL 1IGJB 2EH8L 3JZ7A 5KS9E 1YA5A 3A6CL 5JDSA 1FFRA 1WZKA 2JTDA 3E6FB 2ZJSL 3ZDYE 4NQSB 1C5DA 3S98A 1VEPA 5I74C 3WL9B 3RZCA 1PYWB 2GSGB 4G42B 4JFXA 1PQZA 1Q1JL 4CJ1A 4XNZC 1I1AD 2LAGB 5DJ6B 4ODTH 3BP7A 1OAKL 2FJFB 5CLWA 4H20H 3HPJB 1CXKA 4JFPB 5I1JH 1EBAA 1MJJA 4F3FA 4HF5H 1BJ8A 4QTHA 5DD5L 1KELL 1WQVT 2F58L 4HKZB 1EEZB 1IAMA 3MV7B 2EIBA 2C5DC 4LSSH 3BHBA 3LKRA 4OJFL 3ULVC 3VD9A 4I3RH 1BD2B 4JFHD 3G5VB 4AIOA 1Q0XH 5C70A 4LSRH 4Y19E 3W2DL 2EDFA 5ANMA 3SDYH 3L1OH 3FMGL 5EU4B 4BQ8A 3RKPA 4LFHG 4YDVA 4YIQA 1MCRA 5JHLL 4PRDA 2GCYB 4OQ1A 5HVWA 4MLIA 3TWCH 3OKLB 4DAGL 3GHEL 2UVFA 3HMWH 4PRNB 4YLQT 5HGBB 5T3ZH 4NN7C 4ALAL 3C5JA 1JNJA 4MZ3A 2AJ3B 1U8LB 2J1KA 4N1EA 5ABDE 4EKXA 2X9WA 4TUJB 1MRFH 4P9MH 3V79C 2Z91B 2FEDD 2HJFA 1EJOL 2D7OA 2H8PA 2WWKO 3TJHC 4LRNL 5L2KA 1FPTL 3TVMC 3L7FB 1QUNA 5D7JD 4KVCL 4MS8C 1MFCL 5E2TH 4J8RA 4V1DA 3MRPA 1DEEA 3CVIH 1V3KA 2PTTB 4XP5H 5FK9A 4HUVB 2FEEI 3RWHB 4WJ5B 5D1QD 2F53D 4Y5VB 3QCUH 2ILLA 4XMLH 3U0TB 1WT5A 3UTOA 4D0CB 4X9FA 4PJFA 1N3NB 4MMXC 1WZLA 1HDMA 5HHMD 3PHQB 1E6OH 3U4BH 3THMH 5C08A 4MDJB 1IE5A 3DUUB 1X5ZA 4PGBB 3WUWB 2J8HA 1TVHA 1LP9B 4LCYB 3VDCA 4X8JA 1CFVL 1TDQA 4KTEH 5ICYA 3WHE0 3UPRA 1TJIL 2X89D 3QO0A 4H8WC 5CGYC 5D93B 3STBA 2CDFA 5TF0A 3L3JB 4M93B 4RISL 1DSFL 1XAUA 4J3TA 4EDWH 2PW1A 5IW1A 2IH3A 2ITDB 2APVA 3MGTB 3RTQD 3QXAB 4WFFD 3MV11 1VGKA 2AGJL 4QRRA 3ZE0E 4HXAH 1N64L 2JE8A 5ELIA 3GIZH 1GOFA 1WBZB 4NNXA 2GW5A 3D48R 2LU4A 5KSAB 4LAJH 5JW3L 5DYOA 1G0DA 4MA3B 3QXDB 5KANG 5E8NA 4LGRB 1LDPH 3RL1A 4Z7QE 4PJ8C 3L3HB 5JDJA 1DEDA 1A6ZB 4ZG1A 2X9XA 3F6LA 3WCYA 4M4RA 4L3CB 1HHGB 4N68A 4WFED 3SDDB 5SX4H 4D9QD 1MNUH 2V2WB 2CIKA 1DBAL 3FAWA 1OB1B 5ESAA 2BSED 5E24E 3BX7C 3S96A 3CSGA 1UXWA 2YKLH 3H9HB 2CLRA 3RGVD 2HT4C 4WFHE 2NR6C 3E6HA 2FBJL 4YZFF 4PJ5D 5TE7H 5EOCL 4LBEB 1Z6JT 4X6CF 5CHNB 3RVTD 3GK8L 2L7UA 1LK3L 3CFCL 4UNVA 3ME0A 5ILTH 3Q5YA 4G6AC 1FFPB 5D2NA 2XYCA 1QFWL 3BISA 1CTNA 4HS6A 2ZP0T 1OY3B 1UM4H 2YHGA 2HJKB 5FCUH 5A2LH 4DKFH 1JUFB 4RGNC 4QXWA 5CD3B 3TCLA 5I76B 4N8PA 3MRDB 4I0PB 4XZUB 3BUTA 3G5XB 3HI5H 2MOVA 4ZAKA 4IBLT 4Z7VE 2ZUXA 1QEWB 4RGMB 4JZOB 3ALWA 3D6GA 3QUXA 2WIIB 3C6LC 2VLME 3HZYA 1BEYH 2Y36H 4M1GL 3WSQL 4Y8AA 3QG6B 4XC1L 1UCTA 2UZIL 5I19H 1WFNA 2EDQA 1AE6L 3GMLA 3TZVA 4APQB 4NQUA 1HOCA 3I6GB 1MWAH 2B1AH 3CSYB 4ZO8A 1UB6B 4Z8FH 3IETA 3QCVL 3LEXB 4WWKB 1G6RH 2CXKA 4XB8A 2YD3A 1OTUC 4LPVA 2F8OA 4M03A 3K74B 1GSMA 3SN6N 3TBTB 1JN6A 3LQAH 4HJGA 2CMRH 1LO4H 4G9FD 4M1CC 2Y1VA 3BH8B 3S4SB 1KJVB 2BSRB 4WU5B 3VA2C 2FHBA 3OXRA 1OGAA 2BVYA 2IBZY 2R1XA 3LQZA 2VXUL 1DQQB 1OAQH 3FQUA 4PV9B 1CFBA 2ADGB 5DC0A 4G6FB 2ADFH 2DLEA 3QAZC 1TTFA 1JPTL 4L8SC 1UM5L 1ND0A 1X6NA 2J8UF 4GRLD 5AWNH 5I0ZA 3VWKC 1EBPA 1IC4H 3OAZH 3HNVH 3ZT5A 1U92B 4OLWL 5DJCA 4MXVF 4EDXB 4Z77A 2W65A 4NZTL 5F7MC 6CGTA 2Y6SC 4Z7NE 4H1LH 4MJ4A 1KGCE 3BPOB 1KFAL 3MV9B 3ARBC 3VGHA 5F3HB 1YNTB 4XC3L 5IQ9B 3FQNA 4U2YA 5IB3B 3DVGA 4KKBD 3RUGA 1IM3B 2JLLA 2SEBA 2VB5A 3I50L 1WIOA 1S3KL 3RI5K 4OSUH 1RZ7H 5E8OB 4FZEL 1T2XA 5BXFB 1RZJL 1JNNH 4JFEE 4LCIL 4OZFB 2RFXB 3ESUF 5FIEA 2DQTH 2EO9A 1OF2A 2AABH 4PRAB 2L4OA 1TJGH 5DD6A 4OZIA 3PL6B 2GJZA 1V7NL 1A0QL 4KQ3L 4K7PY 1MJ8H 4TNWK 3HAEG 1I8LC 4HAGA 2JELL 3CFDB 4JPIB 3SDCC 4PGCA 5FUOL 2WW8A 3BP4B 4QRPA 3HMXA 4TRPL 2AV1B 1FZKA 3IAGC 1W0VA 3VRJB 1DQTA 1NMAH 3BMWA 3ZKMC 1HINH 2JCCF 3NFPB 1J1OH 5HI3D 5CILL 4PY8I 5L2KD 3P0YH 4GMTH 1O7SA 4U1KB 5GS0D 3AROA 4Z7WA 1N2RB 1R3LB 3NZ8B 5E6IA 2ZG1A 2F54D 2IAND 3RBGA 5JOFA 1UGNA 4O02H 2HLFC 2L0DA 2CQVA 4HWUA 5CEZD 1YUHA 2E5EA 5FYKH 4KUCD 1K8DB 1XGRA 3K7UA 3QDJA 3VU2A 1AGEA 2P24B 1N59B 3FJTA 5DRZA 5C0BA 5D8JL 3NIDF 4K71C 1OCWH 4OZGE 5MEOB 4OUOA 4O00A 3VXQB 3VFMB 2PW2A 1JGVH 3PQYA 3SGJA 1MVUA 3W82A 4JFDA 4AM0A 4HIJA 1HILA 4NJ9L 3QI9A 2W0FA 3H9ZA 4QRRD 1MOEA 1FVCA 1KIUA 1EUUA 3EAKA 3U9PH 3OGOE 4N5EC 5E2UL 4JANA 2H9GB 5FO7B 3H3BC 3D25A 3SCMB 1KBGH 1IL1A 2F5AH 3RWFB 5KANI 1ULVA 3X13A 3KLSA 2OK0H 1XR8A 1X5FA 4CVWA 1PW3A 1T2JA 4U49A 3RZWA 4IOSD 3C5ZB 2C4XA 4R2GD 1JWSA 4Q9BA 3VXNB 1C5BL 2XZAL 4YHOH 3DETD 4YXLH 4GG6E 4PLJC 1FNAA 1F4HA 2X4PB 3Q5TA 4UT9L 3V6BR 4GT7A 3OKDB 4JQIL 4J3WA 4JJHA 1PKQA 1TJHL 1HEZA 4JVUA 1DVFA 3HC3L 5AAMA 1G7JA 1MJ7H 3MBEB 1S7RA 4I9WE 4F58H 1I1AC 1MCPL 4OF8A 4XCEB 3QDGA 2DQUL 3D3VB 4Y2OA 3P30H 4MSWB 1AXSA 3VXSD 5IVZA 4LOUD 5IKCA 3BQUD 4Y5YB 2HRPH 1X4XA 3DX9A 4ZFFA 1RUQL 5DVMA 4ZUVB 3VG0H 2X1QA 4L3AA 4Z0XB 2BJMH 4O4YH 4M48H 4ZAKD 4QRUA 4YAQA 2ICWA 1ZA3B 4PRPE 3BZFB 4KPHL 1HH6A 5D7LE 3VXUE 4AIZA 2R15A 5TH2A 1UZ6F 4B7LA 3BP5B 1KG0A 3IU4H 1RZGA 4G80A 4JFZL 3D2UD 2MHAB 4MNGE 2NY3D 2VXVL 4GSDH 3ARWA 4D9LL 3STZA 4GXUM 4ZDHB 4YC2B 5HYQA 1CGWA 4CADA 5I1AB 1Y18B 2YEZB 1YEFL 3EBAA 2EEDA 2A6JB 4ODSH 5HVGB 3OKEB 3IS0X 3U7WH 4UILL 4P46D 4OF5A 3O9WC 4RAUA 2HJLA 3MLXH 5D7JC 1L7IL 2OM5A 3EDEA 4ZTPL 5ICZA 1INEL 4X6CB 1SVZA 2WSKA 2NY4B 5LG1A 2YUVA 1HIML 2O5XL 3VD7A 4R3SB 4NQCB 5CJ8A 4HUUA 5KOVC 4LLDB 5IV2A 5BRZB 1KEGL 2FJHA 2BVUA 1FE8H 1I7TA 3SDXF 5FGCB 1I8IB 5DRXB 5J06A 1T22B 2D7TH 3SHSA 3WEXA 4HWNA 1BD2D 1UWGL 2Y07L 4HPYL 3CZFA 4WENB 2ZCLL 3MLVL 1BREA 4HHAB 3KYNB 2BOBA 5SWSA 1GOGA 4YDIH 4PJXA 4N90E 4KXZH 4YJZL 1IAKB 4JRWA 1G0XA 1YYLH 3QUMH 5FYJD 4LKCB 4I0CC 3U82B 4QKXB 4LSUH 1FFOA 4IS6B 2V7NB 3RTQC 3DGCR 4FNLL 4WO4D 2ZG3A 3RVXD 4WEBL 3PWNB 4XX1E 3G5YB 5I9QC 5EPMA 1WWWX 4UNUA 4G8IA 1CL7L 2A83A 5IB1A 3CFBB 1KN2L 4BSVA 3O3AB 1CLOL 1B88A 1HWGB 3MFGB 5E4IA 5DRWB 4Z76A 9CGTA 4YX2L 4GRMB 2CUIA 1RUML 2YR3A 1S9YB 1SJHA 1JGLH 3WDHA 3BEVB 5LGJB 5JLZA 1D9KD 4MXWL 3ARTA 5D6DA 2W60B 1CFTB 2J4WH 2HKHL 2MSPA 1HHJB 3BT2H 4F9LC 1IILE 1Y0LB 1VDGA 1Q9LB 4U1NB 3NACL 3EYSL 4H0GA 3UEZA 4R90H 3PHSA 4M7KH 3RGVC 1RJYA 5BZWB 3CZJA 3PABB 4K55A 3WE6B 4WI8A 1NDMA 4QGYA 2QBWA 4NOFA 3RVTC 35C8L 1AD0A 1G7MB 4XAKE 1J7VR 4M62H 1KCRH 4QHUB 2YD7A 2ZZUT 2Q8AL 2VXQH 4X7TA 3TT1H 1I4FB 4MNQB 5CIPH 3VD3A 3RX7A 1N8ZA 4PJAA 5C0JB 4RZCB 3NGBC 4DZBB 5EU6B 1TPXC 1MI5B 1UJ3B 5EZJA 5E6ID 3NCCB 1WUNT 4NZDA 4L5FL 3P73A 1T5XB 1MIEH 3T0VA 1MHHA 2M8XA 1RQ5A 1UZ8A 1PBYA 4XNQB 5FHAH 5C2UB 5EO9B 4PJFF 2ZSVA 4HK0A 4NN6B 1ZT7A 3QDJD 1NGZB 2D4FA 1BQLL 2PXYA 3A0OA 5H37H 2CDEA 3P9LB 2HKFH 4MAUL 3AAZB 4I5BA 2XRAH 4KJWD 3VA6A 5FOBB 3SDDD 4LLMB 4BH7A 3TV3L 3RKDD 5DURD 4F80A 5EO1A 1D6VL 1ORSB 5B8CA 4JRXB 3FTGB 4N0CD 4YFDB 3REWA 2NXYD 2HG5A 5J1SC 4TNWF 1T0MB 4U1JA 1O0VA 3WDJA 4DZ8B 3QFDB 2IBZX 4ZUTB 4FTVA 1OP5H 2EXWD 5INCB 3OX8B 2QHRL 1KLUA 4L3EE 2BERA 2JCCB 4FQHB 1QR1B 2VDOL 1L9MA 1A7PH 2VLKB 1EZVY 3U30B 3SE9L 3VWJA 1BGXH 1G9MC 4DKAA 3ULUF 1MFBL 2MCPH 4GRLC 1KB9J 1IEHA 4JGMA 1GZPA 1ETZB 3KPTA 2AS5M 2DD8H 4M6AA 1UEYA 1QSFA 4UZGA 4Z7OE 1F4YL 2ICEA 2AXGB 4Q9RH 2GK0B 3DI2B 2XG5A 3LRHA 4P2QB 4XP6H 5BQ7B 5KW9L 1YDPB 1QACA 2QKIB 4F57L 3EYQC 2QL1A 2VZ3A 4G8FB 1NLBH 4TPRH 1LEKB 3PWPE 5BOZG 4ZMAT 4ODHL 1X5GA 3KJ4B 4OT1H 1J5OH 4M6ML 1BIIA 3DVNB 1P6AB 3GNMH 5FKAB 4WNQA 4Q9QL 5BVPH 1JRHL 2ITCA 1S78C 2V17H 4U1IB 3OKYA 4K7PX 1J1XH 3ROOB 2RIKA 5DVOA 2NY1D 1D5ZA 1PEWA 4ZUWB 5I16B 5L6YH 1AKJB 2H26A 5MENE 4I77H 1LQSR 1H0DA 4G6FD 1RIUL 4K23L 1OP3K 3RWCB 1MQKH 1YECL 1CCZA 3WJLA 2HAZA 2L7JA 1RU9H 1TIUA 5EOQL 4NP4L 2A2QT 5DEFA 2A9MH 1GIGL 4OF7A 1FG2A 4WTZA 2WQ8A 4LSPH 1OLZA 5EFIB 4P4RB 1YNKL 1RUPH 4GKZA 4XPHL 3MV9D 5GS0C 1IEAA 1VFBA 1T1YB 3IXTA 5T3ZE 3W9EB 4ONGH 1DBJH 1JNHB 5K9JH 1AR2A 1RZKC 1UB5A 1FN4B 4NM4L 3GSVB 1TVBB 5FUCE 1ZLUK 4W6YB 2NX5E 1RY7B 1KJ2L 1WT5C 5C0EB 5BS0B 1DBBL 3JWNC 4M7ZC 3M8OH 3C2SA 1AY1H 1KPUB 4G43A 4XHQA 1J12A 1HHHB 3MJ7B 4WW2A 5KS9B 3JV0A 3P0GB 3TNMB 1CVRA 1FAIL 2IQ9L 2XA8L 4PJ9A 2BX5A 1ERNA 3L5WB 1TETL 8FABA 2HFGL 2ICWI 3QIBA 2EDEA 4BSWA 4L8DA 1QPPA 4UINL 4ZS7H 4OV6F 5IMKA 2IPUG 1AJ7H 3BOVA 3V4UL 4WVRA 1MCQA 4ORGA 5E2WL 4OF6A 5F1KC 4AL8H 1NGPH 5JW4Q 2E6JA 3D0VA 3DOSA 1NEZB 4WHDA 3HG1A 1U8PA 3LQMA 3IJSB 2MTPA 1FIGL 1QQDB 5DJYB 3BPLB 1RULL 2ZG2A 3O8XB 3AY4C 3H0TA 1NCBL 3Q6FA 1XF5B 1A21A 1HXYA 1E4JA 5AYQA 2WUCH 1INDH 2DDQH 5T3XE 3HE6A 5IGXL 4OZIF 4BJLA 3DETC 4LLWB 4ZUSA 3BO8B 4LHUA 3SDXB 4K7PL 3GHBL 1QOKA 1UWXH 3IXAB 3TPUB 3IDYB 3O2DH 5B39B 4O5LH 2FHFA 2Z31D 4M8VA 1OPGL 2AV7A 2KKQA 1UCBH 4QOKA 3TN0B 2P1YA 4P9HL 1BFTA 4EBQH 2EE6A 1C5DB 4DGVH 1XIWB 3RZCB 5KTEL 4Z78B 4JFXB 3VH8A 3B2VL 3L95B 4GKSA 4Z7WF 5EIIA 3BQUC 3U7YH 3QH3B 3BP7B 3VMPA 1QVOB 1JK8A 2ZNWA 4P2OD 2JJWA 3QULA 4NFBA 3U46B 2E7BA 4FMFA 1MJJB 2ZCHH 2IQAB 4ZAKC 1I3GH 5FO9A 4F3FB 3T0EA 4QTHB 3NTCH 1RZFL 3VGEA 5M94B 3QUXC 3BHBB 1MHEB 2PXYD 3RAJL 3SGDH 3MV01 2WUBL 1UENA 5ANMB 5IWLA 1WIPA 5IHUL 2DKMA 4CW1A 2EYTB 2N1KA 3JTSB 3OJDB 3QDMA 2FGWL 1KB5A 2AJUL 4H88L 1HNGA 4KRMB 2DQEL 5J11C 1AHWA 5GISH 1RHFA 2BFVL 4U4BA 5IFJA 4RSVA 4XHJD 1IKFL 4P46C 2R0ZL 3CC5B 3AXLA 4M5YH 4LSQL 4LQFL 5D70H 1NCNA 1XF4A 3GKWL 1L7TH 3MBED 5F1SA 1UM6L 3LSOA 1SEBA 3UBXI 4QYOA 2FJGA 2IPUK 1BMGA 1RFDH 4D0DA 3Q1SL 4M6NL 4K3HA 1Z3GH 1MCOL 4NFDA 1NCDL 5HHOE 4X7SL 3WNPA 4JREC 4OCRL 5LQBL 1S7XB 4PRBA 5F9OH 3WO3B 4V1DB 4PJEA 5FO8B 3MRPB 2FYYB 1A7NL 5LXGL 4Y2DD 4K2UL 3QIUB 3VH8G 3MRJA 3U4AA 1CS6A 5IEKA 1ZEAL 1HDMB 3EYOB 3QP3A 2RAMA 1D3CA 1IJ9A 2DQIL 4GBXB 4OGAC 1HHKA 1U8NB 2P5WA 4XWOD 2D0HA 2NY0B 1QSFD 4W4OA 2ERJB 1IAIH 2XN9E 1YJDH 2OI9C 4WO4C 3UPRB 1DN0B 4X9IA 3V7AE 1QNZL 2CDFB 5C09A 4JG1L 2OP4H 1AGCB 4FQCH 1XGUA 1XGTB 3FFDB 3EZ8A 4YBHA 3NIGE 3NFSH 5F72S 5IW1B 3MRHA 3PDOA 3ZMRA 2BVTA 2R23A 5CJQL 2PR4H 2W92A 3R06A 3LRGA 2VDLH 1CQKA 1A7QH 1B2WL 4YHLH 1HQ4A 3VCLB 5DSCA 3ET9F 4Y16B 1D9KC 3O6KL 4NNXB 3DIFB 4Z7VB 4JCMA 4D0BB 1EEUA 1NGXB 5I75B 5BRZD 2XPGA 2R0LL 2ADIB 5E8NB 1MJUL 1X7QB 1LE9B 1CLCA 1J9CT 3FT2B 5T1DH 2O5ZL 1EX0A 3LRSB 5D1XA 1T03H 2CIKB 5ESAB 3G04A 3L5XL 1G7IA 1KCSH 2HWZL 1C12A 5FHBH 3FB8A 3VRLF 2CLRB 3ETBF 4M93C 4URTB 1ADQA 5IBTL 1XF3A 1DUYA 4NRZA 5M7QA 2QLVB 3SBWA 3ZHKA 1PG7W 4E41E 4OGXL 3PIQB 4NKOB 2DMKA 3VW3L 3C5SA 5EBMB 2OL3B 4P2RE 1T0NA 5JW4M 2G9HB 4LL9A 5E6IC 4NWUH 3LB6C 5HHXH 3FHQA 1CGSL 4YE4L 2VH5L 3PGDA 1SY6A 3MRRA 1VFAA 2Y25A 4NKQB 2E9BA 5EC1A 5C0DA 4G8GA 1GRWA 3DECA 5T5FL 3TCLB 4L8CA 1DE4B 1KJ3L 4KJWC 3F62A 4NC1C 3QCTL 2XTJB 1QBBA 4AT6A 3EYVA 3FO2A 4PJXF 3UTSE 3HZYB 1HXMA 4M7JH 4N0YH 4I48A 4MA7L 4N1HB 4PJ9D 3SGJC 4GAFB 3HC0A 4HWBH 4PD4J 1W0YT 4H0IA 1U95A 4U6XA 5EUOE 5T1KA 2NXYC 5ALBH 3TZVB 4LSVL 1XZ0A 1HOCB 1I9JL 3BKMH 3QI9C 4OCMC 3IETB 3I9GL 5I1EH 3FRUA 5DQJA 3EJJX 3VJ6A 3LKPB 1R3IH 3NCBB 1P9MA 1QBML 2EXWC 5D7KD 3QJHA 1CF8L 5A16B 2ADJA 2HT3D 3MLZH 4JY5L 4K94H 2B2XH 4J3OC 1EZVX 4Y4KA 4ZUUB 1CD0A 5JZ7D 3KNBA 4U31A 4HCRL 1NQBA 3FFCD 1DQDH 1DUZB 1VACA 3MUGB 4FQXB 4C83B 1I7RA 5I18L 3E0GA 3TNNB 2AK4B 3F7YA 2VSDA 4EZMA 4KZDL 4RMRA 3TIDA 3NPZB 4TSBH 6FABL 1RMFH 2AK1H 2W9DH 4TUOA 5EOTB 2NY5H 2R1YA 4HZLA 1WCQA 3TO4B 3ARZA 4JZJA 5E94A 4HK3N 5JR1H 2BNUB 5FA4B 1BWWA 1FO0B 3NPSC 5GS2D 3O6FA 4JRXD 1OSZA 5DJCB 4FXGA 3UC0L 2PNDA 2PN5A 2I07A 3QO1B 3BKCH 4OD1L 5IBUB 4PJAF 5L0QC 4MNHB 5SX4I 3V6ZB 5DQDH 3REVA 5B3JE 1F45A 3B5GA 4R8WL 1MAMH 2AEPH 3HUJE 4XCNA 3BPNC 3GUTA 2DM7A 4XCFH 2QQKH 5B4MD 5BW7C 4MLSA 4F7CB 1CZ8H 4GJTB 2YRLA 3PHOB 2Y7QA 3T0ED 2D03L 5KN5B 4KY1H 4MCZA 2NY1C 2VLKD 2C1OB 2JB6B 2R0KH 4XWGH 1T4KA 4L29B 4WW1B 1T1ZA 3D69A 1IGYA 4OZIB 1P84J 2QSTA 3QDMD 5CJXA 4JRYD 2OJEA 4HLZH 2DN7A 4C59B 2BY3A 3RPIA 4I3GA 4ODTL 2ZUSA 5IMLA 5I1JL 2JJUA 3DJ9A 1T1XA 4PGCB 3WFDH 3P4NA 4HF5L 1ZHNB 1KIQA 4QRPB 4P2QD 4Q74A 4QHNA 4LSSL 4XB7A 3W0WB 3BZEA 1W0VB 4LLQA 4I3RL 5C07A 5IB4A 3I85A 2W9EH 2ZUVA 4CN1A 1M7XA 2YD4A 4JQXA 4BQ9A 1Q0XL 5HY9B 4LSRL 3SDYL 3L1OL 2X4RB 1L0YA 3V0VB 4OM1H 4PJDB 1GH7A 4RBPH 4Z7WB 1F58H 5DZOA 3T4YA 3TWCL 1SQ2N 3WFHB 3HMWL 5DD0H 1ZGLM 5T3ZL 3B4NA 4NKMB 2HMIC 4YDJA 2BXZA 4P57A 1YUHB 4Y1AE 1H3PH 1UXSA 3B9EA 4IJ3B 5E6ZA 3V0WH 4UTAH 3KPMA 1AGEB 4OZHA 5IJVB 1C16B 3C8DA 2DRUA 1AKJD 3KYMA 5C0BB 2WWMD 1G7HB 3QEQE 4XP9H 3K80A 3ZO0A 1X5JA 3JWOC 3W9DA 5GZOD 2PW2B 3WIIL 2DM2A 5E2TL 4PV8B 4CU6A 3O2WH 4XP5L 4XXCA 1CXFA 1DDHB 1MCSA 1WGOA 4KKAC 3QCUL 5IOPB 3MROA 4XMLL 2YD8A 5DK0B 2ID5A 3K8KA 1BOYA 3OTTA 1E6OL 1I9IL 3SKOB 3THML 2VYRE 1B3JA 2Q8BH 2VQUA 4CMHB 5I2IB 4A2MA 4WFGD 1JI2A 4KMTH 1QFHA 2EDXA 5BS0D 1EHXA 4PS4H 4MNGB 5TFSL 1JV5A 3I2CH 1LEGA 4L4TA 4PRIA 3U9UA 2AQ3A 2EICA 2HTLD 1MCNA 3QZWA 3ARDA 1JWSB 2Z31C 4PJCE 2WM0A 4HXAL 1S7QB 3P77A 4MQXD 4YEEA 2ESVA 1HSAA 3GIZL 2DWEA 4ESKA 1PKQB 5DD3H 2MWCA 4QTIL 4UMGA 1MF2H 4MMZC 1DVFB 2FNBA 2HVJB 4HPOH 4QXTA 1F3JB 1G7JB 1A02N 1FVDB 3DXAA 1LDPL 1S7RB 1CTOA 1ZS8A 1H3UA 2JK5B 3GSXA 3GZKA 1QHPA 4C56A 1CT8B 1DQLH 3B9AA 2C3VA 1J05A 1ZOXA 3QDGB 4P2OC 1N4XL 3CDGA 5JHDA 1BF2A 1MNUL 4I8DA 5IFAH 3O8XD 4UAOC 3IJYA 2PXYC 2YKLL 4Y19D 4H25A 1J8HE 4ZFFB 3RIFK 1JYXA 1S8DB 3LS5H 3BD4A 4WW2F 4RMSA 1A7RH 1ZGLA 4QRUB 4R96A 4O9HH 2FBOJ 1PVHA 5TE7L 1HH6B 4X4ZA 4AIZB 4KZEH 1U9KA 3VFRA 1RD6A 4YR6A 3PG2A 2MMXA 4S1RL 5ILTL 4AQ1B 4PY7B 3LKOA 4DWHA 4XHJC 2KBGA 2VAJA 3K4ZA 3NFNA 3KPSE 1H15B 3VXRA 3WYRA 3ZTJG 1UM4L 1U8KA 5FCUL 2NY6C 3TN0D 4DKFL 2X4TA 1KJ2A 3QZWG 2FRGP 4OD2B 5T1MB 2J12B 1XIWD 3HI5L 1YY8A 2HJLB 4KHTH 2HTKC 5TQ2H 2BRQA 1CYGA 5ICZB 3CX2A 3D39E 2EDHA 1EO8H 1BEYL 2Y36L 3E1F1 5DQ9A 3FO0H 3VWJC 3I75B 4HUUB 4Y2DC 2DL9A 3WIHA 3EYFA 2FJHB 1LEIA 1X5KA 4PRHE 2AERT 1MWAL 2R1WA 4XP4H 4P4KA 4Z8FL 4D9RE 2ATPA 1LK2A 4FXLA 4GW5A 4A6YB 5FV2A 1G6RL 3SKJH 3WEXB 5D5MF 2BP3A 4NKDB 2H32B 4PJBF 4XWOC 4KROB 5E1HB 4WHTB 1N6QH 1UYWL 2BOBB 1YMHA 3LQAL 3P4OA 4X7CC 2GJJA 5C0NC 1GC1H 1G7QB 5DWUH 1T04B 1FFOB 2IFFL 2OR8A 3DX8A 3C60B 1EJ6A 4JVWA 3CAFA 2IWGA 3T2PA 1Q94A 1OAQL 3UX9B 4XPTH 1NCWH 5EPMB 2EXYD 3O81A 4WHYG 2H41A 1T20A 2ADFL 4ZOCA 3MR9A 1NBQA 1MFEH 1GAFH 1UKTA 5H35A 3NABH 2AP2A 2XOTA 5AWNL 5KSBA 1H8NA 5T1LA 1U8HB 1IC4L 4U3HA 1ZKAA 4HIHB 2FX7H 3H3KA 5CP3H 4GG6A 2VITA 3WJLC 1XGQB 5HHNA 2NYYD 3ULVH 1II4E 4WFHD 1MFNA 2R4RH 1DJSA 3BRGC 2G2RA 4G7YL 5IMOA 4GBXD 1M6OB 3UBXB 5I1LB 1NDMB 4LASH 4OSUL 1D5BA 5EWIH 1KPVB 5J13B 5AG8A 4ZTOH 1AD0B 5GHWH 4FS0A 5HDBE 1JNNL 1KTDB 4LMQE 5HHVH 3LDBB 1IRAY 3VFTA 2DQTL 1IQWL 3PV7A 2AABL 1TJGL 2IAMA 1P53A 2J6EA 1A1OB 4EXKA 1N8ZB 4MD4B 4PJAB 4HKJA 5DO2D 3VFVA 3GSQA 3MRLA 1MJ8L 4PJEF 2E8YA 4N0FA 3NN8B 3I3BA 5I6XB 4Y16D 1DL7H 5D7LA 1UZ8B 4MQ7A 2VLMD 3SKMB 1DBKH 2A6DB 2ZSVB 5EC2B 1NBYB 1ZT7B 5E6YA 3PJSA 4PJ9C 3KLHD 2CDEB 1NMAL 1WAAA 1JPFB 5KSUB 3G5ZA 3ULSA 1HINL 2GITA 2F74A 1J1OL 3QIBC 3VRIA 4PJHE 3ZZ1A 1IAIM 3P0YL 1AC0A 1NUFA 3GM8A 4GMTL 4KTDH 2B5IB 3QHFH 3OJMB 4XVJH 5B8CB 2OR9H 4DOHE 4WUUE 5C8JA 2XY1A 5LCVH 2HLAA 3WHXB 4O02L 4H8WH 4RMWA 4XI5D 3RNQA 4UBDD 2DYPA 1HN1A 1R5VA 1UJ3C 2GY7B 5GGTH 4DUWA 3BXNA 4FTVB 4PB9H 2P7TA 1OGTB 4RA0C 4AZ8A 4O2FA 1KLUB 1OCWL 2B0SH 5IVOA 4WU7B 3ROLA 4X98A 1PLGH 4HAFA 2X42A 4NO5A 1JGVL 3RWEA 5DJ0A 1FC2D 3U6RA 1U2CA 2Y06H 3RDTA 4NFCA 3D0LB 3U48A 2XWTB 1FZOA 3DRTA 4UV4H 4Z6AT 2HFFA 2R39A 3HR5B 5F1IA 2EKSB 4DK6A 1KGCD 1RZJC 2YUXA 2ZUQB 4WRLA 1D5IH 3U0PA 1KBGL 5E08H 3MV8E 4F15B 3MRMA 2J88H 3IKCA 3VMNA 4YO0A 2OK0L 3UMTA 2OTUA 3C2AL 5GSVA 3BAEL 5GZND 5CS7A 1JZ7A 5B4MC 3S35H 4R4NC 4GKNA 3GJFA 3S36H 3TBWA 4YHOL 1MCCA 3T0EC 2R69L 5D7IA 4JFED 5KVEL 4DEPC 3PWUB 4PIRF 3D85A 2ED7A 3TYFA 2ITCB 4FQXD 2EDOA 3UYOD 1BBDH 5FKPA 1MLBB 3V6FA 3TC9A 5IWLC 3WNKA 4Z7UA 1MLCB 4FFVC 2FL5B 1MJ7L 3AGVA 2W59A 1NAMA 4F58L 4GAJH 5HSFA 4R4BA 1N5AA 2H26B 2VZTA 5F7YC 3MPCA 2HYMA 1H0DB 3EJYD 3OG4B 5TE4H 3QHZH 1P5UA 3CLFH 4GS7C 4NDMB 3P30L 1R3HB 3TIEA 2AKRA 1PD6A 2PYEE 2FATH 4FN0A 3TO4D 1R5WA 3ZDXF 2V2XA 4NO0A 3JBG7 1CICA 5E99L 1AP2A 2VN7A 3AREA 1JMZA 2BJML 4HH9A 4M48L 5SWQB 5EBLB 4GKZB 4K8RH 2VNCA 3IU4L 3IXTB 4MAYB 3N85H 4E9LA 5C1MB 4NQTA 4XT1C 4F7TA 4NGHH 4YPJA 3S3PA 4GSDL 4D3CH 3WXWH 1YYML 4XXDB 5I66A 1TQBC 3CMGA 3OR6B 5J56B 3DV4A 3BIBX 5C0AB 1INQB 4ODSL 4M3JA 3ZE2E 5IIEA 3U4EB 1LO5A 4ZXBD 2VUOA 4W4OC 2WWMC 3U7WL 5IT2H 4WW2B 3QUYA 4JM2D 2X4NA 2UV3A 3X12A 4ETQA 1MH5B 2QSVA 2XV6B 1QSEE 3B5HA 3ZTNH 2P42B 4M1DH 1P7QB 2B1HH 1FE8L 1P2CA 1T3FB 3CU1A 4ZFZA 4L9LC 1NC4A 2D7TL 3O3UN 3UTTE 4L3EA 3D0VB 3ES6A 3OHXB 5IF0A 5FOJA 5F6IB 5IHZB 4LLVA 4G6KH 4FG6D 3VFUA 3Q6FB 2A6KA 1I85A 1HXYB 3QUML 4LCUA 1IBGH 3X14A 4HZAA 5GIRB 4X5XA 4LSUL 1R5IA 2VR4A 1RJZA 2RR3A 5IM7A 3HE6B 1JF6A 3INUH 5D1XC 4JO1H 5HHPB 2EEBA 4ZUSB 1DR9A 3QPQC 4MQXC 4LHUB 4UOW1 5C71A 1N5YH 3KPQA 4OGZA 2ZOKA 5I1DB 5D5MB 3RFZC 4PJBB 1UA6L 1G9NH 4I9WD 3TFKC 4ONOA 1KTRL 2AQ2A 1JGLL 1FSKC 4E5XA 3PWPA 4U1LB 4ZPTA 2R8SH 1MWAB 1CD1B 2UYLA 2J4WL 3WLBB 4L4VA 1G6RB 3VXTB 1WIUA 2IAMD 3BT2L 1JVKA 4YNYA 3ARFB 5EIIB 4DVBA 3OAYK 5J6HA 4M7KL 3E3QE 1JK8B 1KLGB 4PRPD 2N7BA 4WV1A 5D7LD 3VXUD 5FO9B 3DWTA 5IB5B 5MENA 2Z8SA 3BZDA 3EGSB 4OZHF 4LVOC 4X6DA 4M62L 1JTTA 1KCRL 2XN9B 3L3KA 3QNXB 1Y6MR 4OQTA 3HI1A 4XBGA 1FDLH 1A1NB 3TT1L 3HFMH 3JV6A 3BD3A 3GJFK 1ZT1B 4OF3A 1AHWB 5CZXC 3IDXH 1NDGB 2BK8A 3IGAB 3HLAA 5FHAL 5HYSA 2OSLA 5FA3A 3GMMB 4Y4KC 2DQCH 5EO0A 3FT4B 5DFTA 2V2TA 4QXGH 2VAAA 3EO0A 1SEBB 1EAJA 4H1LB 5BV7C 4QYOB 4GO6B 3WN5A 2HKFL 2OTWB 2XRAL 1RK1B 5DMIH 1SJEA 5AZEH 3R0MA 3OAUH 4N9GB 2XZZA 1E28B 1OD9A 4PJEB 1D7FA 4LEOA 5HYJE 4J6RH 5K9QG 4S2SB 3EIFA 3DUSA 3MRJB 4N90D 3GMPA 4JFYA 2Q87A 5IEKB 4LVNC 3I6KA 4QF1A 5DHVA 4PGDB 3VXOB 4EI5B 3O6FC 4E41B 3WDIA 5KG9A 5FYKU 4O51B 3HKFA 3F7VA 1JHTB 5C09B 1A7PL 3QRGL 3UPAA 2EXYC 3GSOA 3LKNB 3QQ9C 1AQDA 3NIFE 3MRHB 1BGXL 3PDOB 4QNPF 1B0RA 2MCPL 4MHHG 4YGVB 1ZHBA 5C9KA 1R3JA 2GFBB 3D85D 4JHAL 3V52H 2DD8L 4X8XA 4Y4HA 3BRFA 2DL2A 4N9OB 3UTSB 4WY7H 2YA1A 4Y4FB 4OCWL 4Q9RL 4R97C 3VFNB 2BNRA 4XP6L 5DS8A 2YBRA 4N8VG 5EUOB 3CDCA 2AQ1A 1CK0H 4WI3A 1NFDA 4TPRL 5EU3A 1BQHA 2PYFB 3CH1B 4OAWB 2CO6B 4XAKD 2UZYB 2DAVA 3G04B 4POZD 3GNML 3L5JA 3FB8B 5BVPL 3KDMA 1BJ1H 1XF3B 1EEQA 4JQXC 2V17L 5LGHH 1J1XL 3C60D 4WI4A 1JGEB 2OQJA 4QRSB 1H5BA 5ESQB 1R6VA 5L6YL 1N0LA 3LH2L 2GJ6E 4J23A 2HH0H 3CCHA 1MQKL 5EORL 5F7NC 5J6GA 3PGDB 4LCCA 1H3GA 4MQTB 1VFAB 1RU9L 3Q3GA 4PG2A 2OYPA 2H2PD 4G8GB 3LOWA 3KLHC 4GW4A 1CXLA 1X4ZA 5CBEB 2BNQA 1NC2B 3HPLA 4R0LB 1JGDA 4YBLB 2Q3ZA 4LVHB 3VE0A 3I3DA 5JXAH 3EYVB 4X9GA 3OKOA 2HVKB 1HXMB 2K9UA 5ISZA 5JA8B 1WTGT 4ONGL 3U7AA 5K9JL 3L9RA 1U95B 3ZYIA 2NCMA 4KJYA 4C4KT 1LWRA 3ECBB 4O2EA 4WI2A 1XZ0B 2R9HD 3IVKA 3TA3B 1TZIA 3HUJB 1ORQA 4OM0H 3IF1A 4UBDC 3M8OL 5DQJB 1AY1L 2W0PA 4ZFOL 3OR7B 1BQHG 3VJ6B 4L3ED 2H6PA 5HHOA 2NXZD 1S7SA 4YK4C 3SOBL 1RZIB 5SWZE 2ADJB 1ZLSH 1PFCA 3BI9X 3SO5A 1IAII 2JJSA 5KSBF 1PX4A 4ODXB 4UDTA 4GG6F 1I7RB 2MQ0A 5C3LD 4OIIH 3ZDZF 1TCMA 4X5WA 4PJ7A 5DTFA 3F7YB 1AIFA 3TCXA 4YQXH 25C8H 4IDJH 1YC7A 4ZS7L 2KPNA 1AJ7L 4DKDC 1NGWB 3PWJA 3PP4H 1CDBA 2VE6A 1IC5H 3TBVA 4AL8L 5F7WC 1NGPL 4NHUA 1LO3H 1NEUA 5HGDB 3L3IA 2P49B 1BFVH 2R1YB 4BZ1H 3MV7E 4HZLB 2X4OA 3LZFH 4HV8A 3QPXH 3CFEA 5BJTB 4JZJB 5E94B 2DQFA 3MZTA 1ES0A 3HHRB 3PWPD 3GI8H 3I02A 5GZNC 4U1HA 1FNSH 2WUCL 1M71A 7FABH 4DN3H 2DDQL 1QD0A 1W72L 2E3VA 3GJEB 3LVEA 4FP8H 1V8HA 3REVB 1C5CL 5C3TA 4OCSL 5CD5D 3P4MA 3HE7D 1NBVL 4K3GA 3O2DL 1AR1D 4MA1C 3N9GH 3WS3B 4HULB 4Y1AB 1C7TA 1DFBH 3QUZB 5BVJA 3FB5B 1UCBL 2X5PA 5MEND 5D2LB 1OAZH 4GLRI 2O93L 1CG9A 3ORJA 1WAAF 2NW2B 4LLAA 1K8IA 3QEQB 4LNRA 3EJYC 2DI7A 3AMLA 1T4KB 3SO3C 3MREB 4EBQL 4DGVL 2YWYA 4NZUH 5L2JA 4ZYKA 3L3GA 4FQJH 4NO3A 4NNPH 3C9NA 3N1MC 5BZDA 2NLJA 1OVZA 1CE6A 4KK9C 4XPFH 3MNZB 5IB2B 3UTZB 1AO7A 2LE9A 5IMLB 4A2LA 3C8KB 1TNNA 1T1XB 3QUMB 2ZCHL 3C09C 3P4NB 4CMMB 3HRZB 3NTCL 4NKIH 1KIQB 4P2RA 3MA9H 5T3ZD 2CK2A 3LAFA 3BZEB 1HHIB 4LLQB 3HCVA 1LP9E 4PTUA 3EYUH 5F7KC 5C07B 5IB4B 2MFNA 1S7WA 2NX5D 5ENWA 1U8JB 1YN7B 5DR5H 1I9RL 4XRCB 2P8LB 3T4YB 5IEHA 4MJIA 2WBWB 2P48B 5GISL 4ZXBC 3HS0B 4JPWH 4JM2C 3BEWA 3GRWH 4M5YL 4P57B 5D70L 3KG5A 1UXSB 1L7TL 2Q3AA 2WP3O 3SKUD 3FRPA 3KVQA 3LKQA 3PUCA 2X9YA 5EBWA 4C57C 4RFNB 1G9MH 3T3PF 2YZ1A 1RFDL 4XBPA 3H9SA 4JDVB 2G5RA 1Z3GL 5I71C 3W9DB 3MJ6A 2A1WH 5ERWA 3TO2A 1WBXB 3S34H 2VOTA 4F7EA 2BMKB 2YC1A 4LCWA 3ALXA 2X44D 3CVHA 3HNSL 4QHKJ 1QBLH 1N6UA 5D7IF 3DPBA 2PTUA 3BIKB 2D2OA 4QRQA 43C9B 2VLJE 3B3IA 4GQ9H 4EI6A 1EFXB 5CIPB 3OSKA 1MHCB 4PLKC 3CPLA 4LU5H 3BZ4B 3MLSH 4MAYD 4Z7UF 4KMLB 1YJDL 5DK2B 1OHQA 5CSZA 3TESA 2C1PB 5IP4A 3L3OB 2Y5TB 2OP4L 3QIWA 3V5KA 3IDMA 4FQCL 3U9UB 2VLRA 2GTZB 2XI9A 3NFSL 5GJTH 1IEBB 4YPGA 3U0WH 2PR4L 3TLRA 2EDDA 2VL4A 3P77B 3F58H 2VDLL 4JY6B 1A7QL 1T6VN 4ZD3H 3TM6A 1YEHH 3IT8D 5TDPA 3DMMA 4JG0H 4YHLL 5MI0C 3H7BA 3QT2A 3DRQB 3QNZB 5HHQA 5J9PA 2YMXH 3D39B 4P59H 4LSTH 3FOLA 5IUSA 2IAMC 3DXAB 1F6AB 2WBJB 4LPWA 4PR5B 4C56B 1YQVH 4NUGH 2ATKA 3OKNA 2DJSA 5DJZB 2XACC 3GFUA 5T1DL 2IPTH 1FVEA 4PRHB 3CDGB 2NY7H 1EGJA 3ILQD 3S6CA 1T03L 2DM4A 4KK5D 4XMKH 5GS0H 4ZPVB 3S97C 1KCSL 4YUEH 3H42H 3IJYB 5FHBL 2GHWB 4KMQA 1RZKH 3HZKA 5DMYA 2X05A 5CEYA 3QWOA 3B2UC 5DI8B 3X3GH 4XAWH 3VFRB 4NQEA 4X6BA 1HCFX 5D9SB 1DLFH 4NWUL 5HHXL 1FQ9C 4BA8A 4RWYH 1I75A 5I8CA 3QISA 4KK6D 5EZIH 4KGJA 2X4TB 2VISB 1QRNA 2C7UA 3K4DA 4CNIA 5CINL 2UY6A 5HHOD 3V4PH 1FNEA 5TGBB 4QRTA 1YY8B 1YPZA 1WBYB 3T3ME 1FZMA 3ARFD 3TH2T 3R0NA 4N0YL 4P0DA 2NW3B 5DJ8B 4KV5F 3GIVA 3RDTC 1D6EA 1DANU 1RIVH 5ALBL 1WCBA 1LEIB 2WQRA 1WFOA 3BKML 2R1WB 2ZOLA 1S9VA 4P4KB 1LK2B 3B9KD 5I1EL 4GW5B 2AJZA 1MRDH 5CGTA 5A2IH 2XN9D 1R3IL 2NY2D 1BJ1J 3SKNA 4JKPH 1XH3A 4WDIB 3UTQA 3MLZL 3ULUH 4OGYH 4K94L 2B2XL 3ZT7A 2DBLH 4KUZH 3BRDA 1SYVA 1U41A 2EYSA 2P5EA 4JHBA 4IOFD 2X41A 1OARH 3LV3A 2WLZA 4ODUB 4P5MA 5TDNA 1LILA 4JZNB 4YHIA 1B4JH 1G7PA 2D7NA 2Q7YB 1W0WB 4HG4J 1CFSA 1DTUA 4LDEB 3DX7B 1MREH 1DCLA 2PO6A 4TSBL 1RMFL 1A6UH 2AK1L 2W9DL 3V8CA 4CN4A 1E4XH 4NNYB 5K59E 4RX4A 1HSBA 2NY5L 5H35B 4DN4H 1CXIA 1TCRB 3ARQA 5L9DH 4X6DF 3ILPA 5JR1L 4QT5B 3ZKXC 3S8WA 1FBIL 2BVEA 3KPOB 5IVXF 4PJCA 1OTTD 3FT3A 4M61A 1IGTA 3ARYA 2CD0A 3BDYH 2HN7B 4ENEC 4N5UA 2J3SA 5EDXA 4F7PA 3BKCL 4U6YB 5C6PB 5DQDL 1JPSL 5LGKA 3IDNA 3GB7A 1JWMA 5DJDA 1MAML 4P23A 2AEPL 4F2MB 1JF1A 3QFJA 5DUPH 4AY0A 2DKSA 2QQKL 1U3HD 4E41D 4EI5D 4KDWA 2EIZA