3UE2A

Crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 1.23 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'GSGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(U)-binding-splicing factor PUF60
molecule tags Rna binding protein
source organism Homo sapiens
publication title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.23 A resolution
rcsb
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ue2A01
1N8RT 2MSSA 2DH7A 5IM0B 4BS2A 1S79A 2J0SD 4QQBA 2L41A 1X4BA 2XB2D 2MKSA 1ZZFA 4CIOA 1SJQA 2DB1A 4PKDB 2MHNA 1D9AA 2MKCA 2LEBA 4WCEQ 3Q2TC 1OIAA 2G0CA 2K3KA 3UE2A 3THTA 2RQ4A 2DIVA 3BS9A 2U2FA 4WKRA 2X1AA 3P49B 2L08A 3CTRA 2CQGA 2Q79A 2RQCA 1FHTA 3EX7B 2RRBA 2KI2A 2BOPA 4LJMA 3MI7X 1NO8A 3H2VE 3HI9A 2A3JA 1WF1A 1H6KX 3TP2A 3SXLA 1B7FA 3U1MA 5BJRA 3DXBA 2OJ3A 1WF0A 1U1KA 1VQ9S 4W90B 2DISA 2DH8A 1S72S 1VQOS 2MQMA 4F26A 1QVFR 3DLLQ 1WHYA 4LIRA 4QPTA 1H2VZ 2MJNA 1K73T 1U1QA 1SJ3P 1X4DA 2JRSA 1DHMA 3NMRA 1XN9A 2ADCA 2MQNA 3G9CA 1HD1A 2LMIA 3B4DA 1VQMS 1NJIT 2DITA 1U1NA 2CPJA 5D78A 5IFMA 1N54B 2M0GB 1KOHA 2ZJRQ 3CUNA 1FXLA 2RVJA 2AYEA 1VQ6S 2LXIA 2DNOA 3CD6S 3CULA 2KXHA 5MLCV 2NZ4A 3N9UC 2YWKA 3SDEB 2KFYA 2CJKA 2DNLA 3NNAA 1KD1T 4UY8T 1F9FA 4C4WA 1X5PA 3CC2S 3VAJA 2OTLS 1U2FA 2DHAA 1G2EA 1X4CA 1M5PC 3PIOQ 2XS7A 2LA6A 2JX2A 1HA1A 1RK8A 5CA5A 2PEHA 1O0PA 1JMTA 2CPFA 2F3JA 2ZJPQ 2I38A 5GADU 3CF5Q 4IOCQ 1YWXA 2MXYA 3CC4S 4WFBQ 2LYVA 2LKZA 1Q7YT 1M5KC 1YJWS 2CPEA 4F25A 1VQLS 2G4BA 1P1TA 3Q2SC 1DRZA 3R1LA 5LSLA 2MGZA 5JVHQ 2DNYA 2B0GA 2MY7A 2HGMA 1L3KA 2MZRA 3BO2A 5GMKa 1YITS 4V19X 4YB1P 2MKHA 3HHNB 2FC9A 3IRWP 2QA4S 4CQ1A 4LMZA 5FJ4A 1PGZA 1U6FA 2YH1A 1UFWA 2OSRA 2E44A 2YKAA 2RUGA 2ZJQQ 3VAKA 1OWXA 4WFAQ 2RU3A 2LA4A 5IM0A 1WF2A 2DO4A 5LXRA 3US5A 3VAIA 1VQ5S 1X4EA 1WI8A 3G71S 2J76E 1H2UX 5CXTA 2LXUA 3CCRS 2AYMA 2OSQA 2CQ1A 1FO1A 1RKJA 3R1HA 3TO8A 3NS5A 3P6YC 3OW2R 2N3LA 1U1RA 1R8PA 1U1LA 2MZJA 5GAGU 1X4AA 1AUDA 4U67Q 1VC0A 1WEYA 3MXHP 4Z2XA 4ZKAA 3G8SA 2CQ3A 3CCSS 3CCJS 4Y0FA 1WI6A 1SJ4P 2ADBA 1Q86T 3EGNA 3ZZZA 2BZ2A 1OO0B 5DETA 2DGXA 5GAHU 3G6ES 4PRFA 2KXNB 1UAWA 1M5VC 1K8AT 3VAMA 3VAGA 5DM6Q 2XNQA 4YUDA 2FPHX 2F9JA 2JVOA 2MMYA 1VBYA 2HGNA 2DNNA 3NS6A 2N82B 2CPDA 1D8ZA 4C7QA 4TU9A 4F02A 1FJCA 1W2BR 2CPHA 1JJ4A 4TU8A 3VF0B 1YHQS 2MQQA 2L9WA 3ULHA 3NNCA 2EVZA 1FJEB 1A7GE 1BY9A 3J7ZT 2CQDA 3MUMP 2LCWA 2MZ1A 4FXVA 2M88A 2XNRA 3VALA 1WEZA 3G8TA 2KM8B 1VQPS 1JJHA 3V4MA 4IO9Q 5HO4A 3CMES 2LQ5A 2MZTA 4RU2A 2QEXS 1N88A 3BEGB 2DGTA 2DNRA 3D2WA 2RS2A 5DDQC 1DZ5A 2DNPA 2KVIA 2CPYA 2XS5A 2DGUA 2N3OA 2CQHA 2WBRA 2DGOA 2KN4A 2MKKA 2MB0B 3B4MA 1X5TA 2JWNA 2VOPA 2E5GA 5LSOA 2D3OR 5IQQA 1ZH5A 2VONA 2XSFA 1Q82T 2N7CA 3TYTA 1DBDA 1UW4A 3K0JA 3S7RA 2DGWA 3U1LA 5ITHA 3R27A 2MGZB 2YH0A 2DNZA 2DNQA 2CQBA 1YJNS 2FC8A 2MSTA 3MD3A 2CPXA 1URNA 1U6BA 3CXCR 3P5TL 2J0QD 3UWTA 2HYIB 1R8HA 4P6QA 2CQIA 1WELA 2GO9A 2KH9A 1X4GA 3H2UB 4WIIA 5DDOC 3UD3P 1QM9A 1VC6A 4YOEA 1ZZNA 1CVJA 1SXLA 2GHPA 5EN1A 3MUTP 2DGSA 3UCGA 2D9PA 2MKJA 1WG1A 1VC5A 2M70A 1FNXH 2KXFA 1SJRA 3S6EA 3UCUP 3LPYA 2AD9A 2KT5A 1U1OA 2UP1A 4OZ1A 1VQ4S 3EGZA 2E5HA 1WHWA 2PE8A 3S01A 1OPIA 2CQ4A 2KU7A 3CCQS 3IWNC 4J5OA 3BO3A 2M9KA 2LEAA 5LXYA 3G4SS 2HVZA 1YIJS 2M7SA 1N52B 2KHCA 3MOJB 1WHVA 1M5OC 2K8GA 2CPZA 1KQSR 1WHXA 1X4FA 4FXWA 3UD4P 1HL6A 4IOAQ 1PO6A 2DIUA 2DGVA 2MQOA 5JVGQ 2RT3A 1VQ8S 3P3DA 2CQPA 2MY8A 1VBZA 1U1PA 2QFJA 2DO0A 1VQNS 2RS8A 1YI2S 4ED5A 2M8HA 3NNHA 1IQTA 3G96A 2KRBA 3CCLS 1YJ9S 2MZSA 1WTBA 2OIHA 4UQTA 4WF9Q 4ERDA 2NLWA 3J7YU 3CCVS 2DK2A 3ZZYA 2OTJS 1U1MA 1FT8A 3LQVA 2CQCA 2LECA 4A8XA 1VQ7S 2MQPA 1NU4A 2KRRA 2MKIA 2MYFA 1WG4A 2FY1A 3FEXB 3CCES 1FJ7A 5DDRC 1Q81T 3CMAS 3VAHA 2VOOA 1KC8T 2MZQA 5LJ3Y 5LJ5Y 1X0FA 2X1BA 1M1KT 4OZ0A 1X4HA 2CQ0A 2DNHA 5DDPC 4CH0S 3MDFA 3CCUS 3S8SA 2RRAA 2O3DA 3L3CA 5GAEU 3CC7S 1K9MT 3I55S 4IUFA 2V94A 2M4MA 5HL7Q 1M90T 2X1FA 3MURP 2ERRA 3I56S 2G1DA 4PR6A 1P27B 3UCZP 2JVRA 4C0OC 3VAFA 1A9NB 2DHGA 5DM7Q 3PIPQ 2DGQA 2EK1A 2DNMA 2E5IA 2DNKA 3BO4A 1KOOA 2FHOB 1WEXA 4QU7A 1QVGR 2CPIA 2SXLA 1VBXA 5GVQA 1WG5A 3SMZA 1WWHA 2KG0A 2M8DB 2MJUA 5H1SV 2EK6A 2AYBA 1X5SA 2X1GA 4QU6A 5CYJA 1VQKS 2DH9A 3THPA 2KM8C 4EGLA 2MPUA 3MD1A 3JB9k 1YTYA 2VODA 4W92B 1H2TZ 4M5DB 3MUVP 2DHXA 2CQ2A 2RNEA 2J8AA 1SJFA 2F9DA 3SDEA 4WFNQ 3RW7A 1X5OA 2U1AA 2HGLA 4TLQA 2AYGA 2KYXA 2M2BA 1JJ2R 3RW6A 2DNGA 4CH1A 2YTCA 4TU7A 2XS2A 1HD0A 2E5JA 1UP1A 3CCMS 5D77A 3FEYB 2HZCA 3CPWR 2MQLA 2DHSA 2M52A 2D9OA 4Y00A 2I2YA 2KG1A
chains in the Genus database with same CATH superfamily
1T11A 5DO2A 1EZZB 2MSSA 5DG7A 5LL6d 1RBLA 3U7JA 5IM0B 1RT5B 3N6NA 4WE1A 1T05B 3MMCA 4A8MP 1C4AA 2HNYB 3DI6A 4FP9A 4M5NA 1HKAA 4QQBA 3UQSA 1FRJA 2B7BB 2MKSA 3OSNA 3KK3B 4A8WA 1M1GA 2DB1A 2J0WA 2ZITA 4PKDB 4RW4B 3EPGA 2OUGA 4X4VA 4GC7A 4GVBA 1D9AA 2ALYB 4QW9A 1S97A 4PG5A 4ZMMA 1JLEA 1EAYC 2G0CA 5E2QA 5IT0A 3AODA 4USUA 2AX0A 1HLWA 1PG5B 2DIVA 3LWLA 4ZLJA 2C3MA 5JMNA 1FKPB 3OTBA 2WK4A 3KLEB 3JAMY 2CQGA 2YX1A 1RHRB 1VHIA 2ZZTA 4ZVTB 2HFZA 5KG4A 2IAJA 2R7RA 1J5EJ 1FHTA 2Z30B 1VIXA 3T6JA 1CBKA 1NO8A 1W2IA 4A48A 1BLUA 1S1UA 2YKOA 3H2VE 3OFGA 4IFYA 4B02A 5HSPA 1WUUA 3I96A 3QT8A 4PUOB 2EFPA 1RZMA 2VL1A 2XULA 4NA1A 2DEIA 3PW5A 3KK3A 2BKNA 3U1MA 3DXBA 4DUTA 2BRLA 1VQ9S 2C2MB 1IBMJ 2B8QA 4X4OA 1H2VZ 4DS4A 1BWEA 3LGHA 2DY9A 4LVNP 5DZ6A 1Y5IB 2Z2ZA 4DUYF 4IKAA 2HBZB 3PKMA 4F3OA 2W4PA 2QA2A 3HD2A 2JRSA 4KGXB 1DHMA 3MM6B 4KPCA 4LRDA 5KFVA 1XN9A 5EX3A 2MQNA 5HVHA 2OFHX 4J37A 5JUMA 3R5BA 2W7PA 2ADCA 1HD1A 1QE1A 4BHQA 2C2NA 2Z57B 3QWPA 4EUVA 4RUBA 4Q0BB 4ED7A 3OR2A 1Y4ZB 2CPJA 2AQ4A 4WP8A 5D78A 4AFFA 1H73A 3ITHB 1DTTA 3MM5A 2JZ5A 1L3TA 3LO3A 2YWFA 1HR0J 2KO1A 3UN2A 4JI2J 3HFVA 4IDKA 4TKTA 4CLSA 3D1HA 1FXLA 4EZ6A 2W25A 3TUIC 1RT2B 1RLCL 5DLFA 2AYEA 5KG3A 3PHEA 1N5YA 4LFBF 4EI2A 2ABYA 3CD6S 3GU0A 4HI1A 4Y65A 4CCHA 5E3CA 5I42B 1N5VA 1FDNA 2YWKA 3N79A 1WKJA 2R7WA 5IXUA 1FRXA 1RT3B 3R3TA 1KVJA 1Z4UA 1TL7B 3RBXA 1KD1T 2IHR1 2Q1LA 1F9FA 2XLKA 3TOQA 3NGKA 2BE2B 3GJQB 3M8QA 3V4IA 3TAPA 4NXMF 4U8VA 2XCAA 2ALZA 1FI4A 5HBMA 5D0GA 4JI5F 3PW0A 4OJHA 2OAUA 4PQUA 1SCJB 2W9AA 6AT1B 4CLTA 2NYHA 3PIOQ 4NYOA 1NSQA 5F9LA 1XWLA 1R43A 2D3UA 2YNHA 3P8BB 4IRKA 1VISA 2C3PA 5CA5A 2HAFA 2B51A 1OQ6A 1RT6A 1O0PA 1JMTA 2ZC3A 2BJ9A 2CPFA 2Z0GA 3W9HA 5B09A 1UZHA 3BYPA 2C2DA 2I38A 1HHQA 2RMLA 4J9KA 4RW7B 4ECUA 4OX7A 3D67A 1YGYA 1JLCB 2MXYA 4YN3B 2ZH7A 2BQRA 4OI3A 4BCAA 2FJWA 4QR2A 1U09A 1AA1B 5IWAF 1RBAA 4RL1A 1M5KC 5U47A 2B6AB 1EETA 2CPEA 2PGCA 1VQLS 3KNAA 4DV6F 4K8RA 3DLGA 4B3RJ 3ENVA 2X3GA 1KFDA 1AXQA 3N6MA 4IG0A 2MGZA 4RWXA 5JVHQ 4J9QA 1L3VA 2JEJA 1TKZB 2F8EX 3RRGA 4ZP8A 2A2DA 4E98A 1TUVA 3OUYA 3FBBA 3MWBA 1RAGB 5GMKa 3ICLA 1QLNA 5K8MA 1FTCA 1H3DA 4HDGA 3J7YI 4CYUB 4RZRA 2XLJA 4K0KF 4ID8A 2BQ3A 5FJ4A 1X31C 3CW2C 1PGZA 2CJYB 4R8UB 2OFGX 2H3EB 2OSRA 4ICLB 1RABB 2HSEB 4LQ9A 3T9NA 4I2PA 1IBCB 3KMQA 1YI2S 3VAKA 4LF8J 3W5XA 1M0SA 4C11A 1XNRJ 4OX9J 2FUG9 3GJSB 2PN6A 3F44A 3TUJC 2LA4A 5I42A 2FB0A 2FVSA 1RADB 4R0JA 1UWBA 3US5A 4MKVA 2WVBA 3CJRA 1HR0F 5GADI 4KO0B 4FF4A 5MAOA 2HVIA 3UI3A 4I6YA 2JH3A 2VPZB 4GKKF 1CS4B 4ZVHA 2E1AA 5HMYA 2J76E 1H2UX 4Q44A 4NLYA 3G71S 2LXUA 4KGVB 4XIUA 3CCRS 5HQMA 4TQRA 1DQ8A 3RB0A 5F41A 2OSQA 1HNZF 1SL2A 2HQ3A 3AAWB 4IG3A 3KLGB 4C2MA 4ED3A 1SUQA 4CO1A 2C2ZB 3OPKA 1FX4A 1ZM3A 2KYZA 2N3LA 2CNLB 4NPOA 5KOWA 3HHLD 2FZGB 1PC5A 1VQSA 1ZA1B 2AZ3A 1WSRA 4URQU 4C0BA 2A2CA 4MKYA 2OELA 3CJSA 1SC6A 4K4XA 3GCWP 2V67A 3NWRA 1KDNA 5T41A 3B8HA 1Q86T 1MWYA 3GG0A 3ET6B 2UXDF 1OSDA 1XJWB 2BZ2A 2EEYA 3JSBA 3FZBA 3NRBA 5DETA 3KYLA 1NZAA 2FIUA 4LREA 4DL2A 2DR5A 1ICEB 2E29A 1Y0HA 2PFFB 2B4UA 3VAGA 5I3QA 2XNQA 3G6XA 4OI4A 5IV4A 5J2MA 2VF3A 3GYGA 2MMYA 3W5YA 1CEZA 3PJ9A 5ETNA 1ITPA 1YBUA 2V2QA 3I31A 4DV1F 1CJVA 2QT7A 3FFIA 2NXCA 2VD3A 3IC1A 3OL9A 4FKXA 4DV1J 3NS6A 1S6QA 1TKXA 5DJBA 3PTWA 4YHHJ 1DTTB 3MM5B 5DS7A 1GX5A 8AT1B 4GMKA 3GIIA 1U0HB 3BPDA 4TY8B 4Y3CA 1V3RA 4TU9A 1HIYA 1FJCA 4WKYA 4RBTA 3PO4A 5KG1A 3X3UA 3KKFA 2O1PA 1RAJA 2UXCF 4JOUA 3TQ1A 3K5OA 4QJVA 2ZHBA 4JYAJ 2CZVC 5C2GA 4E2FB 2ASLA 5KT5A 3LP2B 1YHQS 1VDHA 2VFTA 4C8OA 3JSMA 4DSLA 2K06A 5B0FA 3W2VB 1N5TA 1A7GE 2JLFA 3M2RA 2R4FA 4Z7YA 3D6HB 1HI0P 3IBCB 4OX8A 1MWZA 1U26A 3T1YJ 3M2VA 1J27A 3V81B 3CVKA 3OL8A 2M88A 2ZM6J 1FJGJ 2N4DA 1WEZA 3H59A 4QIVA 3TJ9A 4W4MA 1DARA 2Y3YA 5KG2A 2R2SA 2WVEA 1J5EF 3RRHA 1OSCA 2BJ1A 4HVZA 2BJ8A 3TA1A 2NPFA 2MQ8A 1N88A 1KN6A 3BEGB 3BKTA 4OI1A 4WU3A 3L7OA 2RS2A 3TVYA 4BLGA 1RTDA 1MW7A 2GIFA 2R2UA 4YS2A 2GVDB 5JXSA 4PYAA 3Q22A 3WZ0A 4NEYA 2KN4A 5F8MA 1HYSA 4NCGB 2WOMB 5FDLB 1RTIA 1E6VA 1X5TA 4BC9A 1UPPA 2B9YA 3M05A 4FS2A 5KFKA 5LSOA 1S7IA 1FXRA 4KV8B 1VCTA 2D3OR 1UTAA 3ZZUA 4K0KJ 1F3FA 1HQUA 3EXCX 1IKWA 1I51B 1Y9OA 2ACMA 3MEKA 3AQPA 4CLYA 1Q53A 3R2CJ 3HULA 2J7UA 2N7CA 2C28A 2RF2A 3PDNA 1BQNA 1YBTA 3EJMA 4ZP7A 3TYTA 2IC3A 3KXDA 3NS7B 4KGMA 2XQCA 2HHHJ 2HZVA 4B3MF 4P2FA 4GO5X 1UVLA 4LR7A 2RU9A 4I7FB 2DGWA 3S7RA 3U1LA 3WQPA 1PCAA 3R27A 5ITHA 5F8HA 2V4JA 4X65F 1T3NA 4B3MJ 3GG1A 1S5ZA 2MGZB 3BB5A 2FGOA 2BVZA 4DV4F 2DNZA 4OHYA 5KAKA 3HSDA 4ZJOA 2WRMA 1WC6A 5J2QB 3DLBA 3BSAA 4J7CA 2QYGA 4GKKJ 3FKBA 3DOMB 1EP4B 1UMJA 2GHWA 2OH2A 3BDEA 3K5MA 3N4WA 3CB4A 1URNA 1O5JA 3MEGB 1S9GB 2GZOA 3P5TL 5H9FJ 3CXCR 3UWTA 1S4FA 1VK3A 2GO8A 2MTLA 2YKQA 1NM2A 2CQIA 1WELA 2GO9A 2KH9A 3M8PA 5KFTA 4JI6J 4OLPA 1VRQC 1UJ6A 1VC6A 3TRGA 1NHKL 5DDOC 3CE8A 3PCOB 3OR1A 1ZZNA 4RJVA 1CVJA 4ELTA 4GC6A 5HMWA 2Q6CA 1Y00A 2GHPA 2HFOA 3T1AA 1N0UA 5FLXU 1ZOTA 4TLRA 4C98A 1KKHA 2VBZA 2OP5A 3K2YA 4LRAA 4PABA 3NCQA 4LSNB 4F50A 3U02A 4HHUA 1B3TA 4LFCJ 2VG6A 3RYLA 4FKYA 1T95A 1SJRA 4NLPA 3S6EA 2AD9A 1NH8A 1IR0A 3FDSA 5J2QA 1HNZJ 2JJ4D 1NNDA 2LDIA 2OPRA 2VC1A 3MMAB 5SZTA 4OYPA 1NK5A 1VRTA 4RW8A 1QAXA 1WHWA 2PE8A 4PWDA 2R7VA 4LRFA 3H5XA 4V19J 2V4RA 1N36F 4I68A 3CJKA 4KHRA 4CRJA 4QWEA 5F8LA 1GH8A 5ETSA 5D6GA 3BO3A 1Q8IA 3HLUA 5CH7B 3NBPB 3R6LB 1NUEA 1Q7LB 4I2QA 2VUGA 4IG3B 3BH6B 2EFVA 3VZIA 3KLGA 2C2RA 4B3TF 4OJ1A 1F2GA 3QFWA 5KT4A 1A0OB 2M7SA 3C66A 3LW5C 5IWAJ 1KQGB 3AY0A 4P73A 3RAQA 3VGTA 3GJRB 1N52B 3CDEA 4ECQA 2AGOA 4KR0B 4PQAA 1ZM2A 2FDNA 3NEKA 3NOGA 3OFEA 4ECSA 2K8GA 1HMVA 2H54B 1S1WB 4DFJA 1M5OC 1KQSR 2UUCF 1RGVA 2IMWP 3JQMA 3SQGB 9ATCB 1HL6A 2JNJA 1MMNA 3D4JA 1XQIA 1HQEB 3DYAB 4PYDA 4DFPA 2CG4A 3MCSA 2DGVA 3OQ2A 2MQOA 5JVGQ 3DHWC 5B0CA 1VQ8S 3P3DA 2IDLA 2EI5A 4ELVA 4ZVEA 5HAOA 3UR3C 3GFXA 1U1PA 2DO0A 5KFBA 4UF4A 3QWUA 1N4LA 3DGPA 1GNKA 3IFEA 2QX0A 2VQFF 1TFWA 3PFOA 1HNIA 3GMGA 3JS9A 2CXEA 2KRBA 4LSLB 3VGVA 3TAQA 1F0XA 3GTYX 1YJ9S 3CD7A 4JI3F 4UY85 1ULRA 1AW0A 2HQCA 1LWEA 4Y34A 4TQSA 2DK2A 3W8GA 3CCVS 3ZZRA 4M5GA 3KG1A 3ZZYA 4A8QA 3MECB 2CQCA 2ZOMA 4OX6A 4Y2IA 7FD1A 5DQHA 2BANA 2LECA 4OI2A 1NSKL 4ZK7M 1IQZA 1S1TA 3IM9A 3AJDA 4LF5J 3FEXB 4RUAA 5F8JA 4QBUA 4UTGA 1ZAWA 1HNVB 2H4WB 3EM1A 3OT9A 1ACMB 1DURA 2QRRA 3MM6A 1V9OA 2HWHA 4C8MA 3CMAS 2WAQD 3SFGA 6FD1A 3VAHA 2I1RA 4EU0A 5C42B 2MZQA 4L72B 4MYTA 4WYWA 5F8IA 1FEEA 4NOHA 5HJXA 3KJFB 4M1KA 1X0FA 2X1BA 1M1KT 1UVMA 4JI1J 5ETMA 1K0VA 2XMTA 2XY7A 1X4HA 4KFBB 4WXWA 3VWSA 1JLAB 4I2QB 2Z56B 1FWPA 2HHWA 3LTOA 1SI9A 5A8RB 1OYDA 2O3DA 3L3CA 1REVB 3FK4A 2LVWA 2GNKA 3VHQA 2O66A 4IFYB 4O3PA 3Q8YA 1IKYB 3J80U 1SQFA 2XMUA 5LM7E 2AJ1A 4Y2KA 4G1PA 1R3NA 2C3OA 1XNQJ 2RDIA 1YVFA 5LSRA 1U47A 3BV8A 4G65A 4NLDA 1GXUA 2IC3B 2IPOB 3L9ZA 3MOZA 3RZAA 4LSNA 2BEFA 3IMQJ 2NYIA 1SV5A 2DHGA 5A76A 1LOUA 3D1QA 4HH1A 4Y2AA 3A3NB 3SQOP 2O01C 4CLFA 3PIPQ 2Z58B 2ZH6A 4A8SA 2EK1A 2HVEA 1KHWA 2HAIA 2XY6A 2YPZA 2J0XA 4U7UK 2VH7A 2E5IA 3IG1B 2VG5B 3TR5A 3C6UA 4Q8FA 3FBEA 4KFBA 1N34F 2DNKA 1YSJA 4ZPBA 2IVFB 3BO4A 3CCWA 3A3PB 4GKJF 1JLGB 4C3LA 4QU7A 5DQGA 4LFCF 3ITHA 5IV3A 1VBXA 1WG5A 1FE4A 1WDTA 1WWHA 2M8DB 2RRNA 3OR2B 2KZZA 4X2BA 2MJUA 2QSWA 3KDNA 1RYRA 2AYBA 2OLWA 2Y0BB 4N76A 2BM1A 1X9WA 5THWA 1B0TA 1JLCA 2X1GA 2KM8C 1RISA 3JQJA 2Y0SD 1R8BA 3EMTA 5L1IA 2MPUA 2F8HA 2ZH2A 2GQCA 2VODA 4DR6F 3RAXA 4YMEA 4DSFA 2UVRA 2ZUGA 2RE1A 3M8PB 1LWCA 4LRCA 2E9ZA 5DG8A 4KHPF 1SC3B 3SV4A 1SC4B 2J8AA 3HF5A 4A4JA 1C2PA 5HANA 4DUZJ 2CJXB 1NKEA 4B3SF 3SDEA 2DXDA 4NEZA 3ZNJ1 3ZZOA 4WFNQ 3MAAA 3RW7A 4K4TA 2QJ3A 3T5LA 1G1XA 2HGLA 4AL5A 3H8YA 1TKZA 3UPFA 2J6UA 1JJ2R 3RW6A 2CIMA 4CLKA 5C42A 4TU7A 1URRA 3BGUA 4NL5A 1DFDA 3I6PA 4CO5A 5A0YB 1BQMA 2HS3A 4QR1A 4MFBB 3O44A 1M5HA 3MM7A 3PVXA 1LW2B 2HZCA 1FKPA 3PW4A 3N01A 2D3O1 3I5CA 2EBEA 3U27A 4M5MA 1S12A 4X4TA 3NAHA 4C8NA 4HLBA 3MFHA 5D3GA 3KK1B 1NK7A 1TKTA 2J0SD 2QTWA 2KKHA 3QQCD 3RB3A 2IJRA 2RAQA 1X4BA 3ILJA 5CD4H 4DL4A 1EJ7L 4DV7J 1KSPA 5D0RA 1YRXA 4NLUA 3KLIA 4ZPAA 1IBLJ 3B78A 5A6WA 2ZDPA 2DR7A 4NA2A 4DV5J 1D09B 2BDPA 3THTA 4KH1B 3W64A 1B7YB 2RQ4A 1UPMB 3UDVA 1RWOB 1D3WA 4B9LA 1U02A 5DRKA 5C24B 2FJAB 2U2FA 2YNGB 2X1AA 4FBUA 4WKRA 2F63A 3TI0A 3RBDA 4F8RA 1SKWA 3R6GB 2L08A 1WOSA 1F6TA 1P9QC 2Q79A 3BN7A 3QLHB 1Q0NA 4ID5B 1S4EA 2Y9HA 2BOPA 4LJMA 3MI7X 5C5JA 2HQFA 1YBAA 2HHHF 5D3GB 2W24A 5HVGA 1ZM4A 2NQPA 4QR0A 3R97A 2AKWB 2A3JA 1UCNA 3MCOA 1U8WA 3OL7A 1WSVA 1DLOA 3FQLA 3RB6A 2PI4A 3TJ8A 3ZNUA 4IDKB 2V9KA 2KDOA 3C16A 3GFYA 2DISA 2AEJA 5K14A 2MQMA 2WSEC 3DLLQ 3W3SA 3MCNA 1UKUA 1FDAA 5J2MB 4ED1A 1TFYA 4HI2A 4WPAA 1S1VA 2G0JA 3PYEA 3MHYA 2RQMA 3H90A 1U1QA 3HFZB 4MTPA 4JI7J 1GFWB 1X4DA 2MLXA 5C7PA 3IG1A 3Q8RB 1WKKA 3CWJA 3HXMA 2XY5A 4NLXA 3UD5A 1CULB 4LF9J 2IY5B 3W2WB 2C3YA 1C0TB 4C8KA 1TL5A 2QYCA 4DLEA 1I94J 5HJYA 3ELHA 2M3DA 3PO5A 3P45B 1NJIT 2DITA 3AH6A 1NDCA 3MPDA 1U1NA 4OZNA 2H5JB 3M8QB 2AJ0A 4FYWB 1U0SA 2XO7A 1X8DA 1RP5A 1RHKB 3AD8C 4ECZA 5IFMA 4Y6IA 2M0GB 4L6V3 3UN3A 2WCXA 4XPEA 1W7WA 3LGMA 4MJKA 4Q5VA 3R9LA 4LIWA 5J1EB 4IR9A 1EKRA 1VQ6S 3UW1A 4Z7CA 2HURA 1JXLA 2YQ0A 4N77A 4RWWA 3GR1A 3I5BA 2BKPA 4HDHA 2B4OA 2PSZA 3D0HE 4I56A 4L73A 5AXNA 1C4CA 4ECXA 5L46A 2C2KB 2DY1A 2ZE2B 4N7TA 1BC6A 1CJUB 1JXVA 2R42A 3M6XA 2KVQE 4Q45A 4PG4A 4KAIA 2WBMA 5K20B 3DU5A 2ZVIA 1U7LA 1X5PA 2F8MA 3VAJA 2OTLS 4IRDA 4YHHF 4UUWA 1C0UB 3EZOA 4W98A 3IO1A 4KKOA 4L75A 4DV6J 2DHAA 1TP7A 4K5RA 1NMEB 3IGNA 4J9MA 1HWUA 1X4CA 1M5PC 1GQEA 2JX2A 4Q43A 4DZDA 2YQ3A 4U7CA 3NLCA 3EDRB 2PIIA 3T1HF 2F3JA 2ZJPQ 5KT2A 2HVDA 4B9MA 1TELA 3LANA 4AYBD 2ROEA 3TEHB 4LF4J 2JHEA 3CJ5A 4ZVQB 1WOOA 4FNIA 1HQUB 2EKYA 3L7UA 1E6YA 3P96A 1R31A 1SKSA 2LKZA 4DR6J 1EIYB 2YKNB 1QY7A 2RIJA 5K8NA 4F25A 3Q2SC 1U2CA 2QMUB 3R1LA 1DRZA 1RAAB 3BGRB 5KFRA 4F3QA 1NSAA 5LSLA 4N56A 3Q23A 4CDIA 1WKLA 2LP4A 3W2WA 4AXJA 4H4OA 1CJKB 2AZ1A 2HGMA 1UEKA 1Z1ZA 3V6DA 4J9UE 3T9ZA 2OMOA 1RWXB 1WJ9A 4IH6A 2E9RX 3HJVA 4P9SA 1IBLF 4P2XA 1KTQA 2FC9A 1RU1A 3E8OA 4TY8A 1UA0A 2QA4S 1QAIA 4LF5F 2EG1A 4DQPA 4CQ1A 4LMZA 1RT1A 3BSNA 4YB7A 1WC1A 4DZ6A 3HP6A 2JEIA 2UUBF 2L9NA 1KHVA 4RPFA 3GIKA 4N5SA 1E6YB 1S49A 3QO9B 5EGYA 1Q4RA 1JK9B 3KK1A 3C6TA 4C8LA 1SC1B 2IM0A 2RUGA 1EETB 2YY3A 4ZVGA 4MYUA 1YRUA 1T9XA 2ZJQQ 3VTIA 4F36A 2GV1A 2M5YA 4IG0B 1OWXA 1EQMA 2RU3A 3K59A 1FD2A 4PCQA 1PYOB 1S6PA 4NYPA 1N56A 5LXRA 2PO4A 3DDKA 1VRTB 2GQQA 4WIQA 1TK8A 3D54A 3AHPA 1VQ5S 3H5SA 1SQGA 1YJUA 4U96A 4ZA1A 2DCUB 5A8WB 5CXTA 1NK9A 5KFXA 2BW7A 2CAJA 1S0VA 2AYMA 3QFHA 1RHMB 2HKEA 4OX9F 1FO1A 3CDWA 5AE3A 4J9OA 3TO8A 1RTZA 4HEA9 4OI6A 3OW2R 1U1RA 1R8PA 3W66A 4YY3J 1U1LA 5IOLA 1SIZA 1W26A 4U67Q 2R9LA 4RKUC 2XWYA 2RKIA 1RAHB 2COLA 3OJSA 1S9GA 4Z2XA 5EWGA 1ROFA 1VFJA 4DJBA 3CCSS 3H20A 4TN2A 3GP9A 2XSJB 3A8JA 1RHUB 3CCJS 2IAJB 3TVKA 2ADBA 3C16B 5K14B 4NXNJ 1MNEA 3OHAA 5KOXA 1XMQF 3VVUA 5I4MA 2DGXA 5GAHU 1R0CB 3G6ES 3ZO7A 5G0RA 2BW2A 4OZJA 2RQKA 3QIDA 2DD8S 2D3ZA 1HPZB 4F2SA 2FPHX 1VBYA 2JVOA 1R7IA 1UWAA 3BGRA 2VDHA 4OV6A 2R7SA 1G3OA 3FQKA 1TVRA 2ATCB 2AJ4A 2GA7A 1JJCB 2BV3A 2PMHA 2VG6B 3HZGA 5EUHA 2N82B 4M5HA 5KFIA 2VB6A 3PJXA 3FMBA 1QAYA 2ASDA 3HCXA 4FYVB 1S76D 4DV0F 2FQQB 3FNNA 2QLBB 4WFYA 3ZZTA 4PPZA 4CTAA 3QYYA 2HK3A 1FTRA 1RCOB 4WJBA 4B17A 2K7KA 2HZAA 1X60A 3UR0A 3G6VA 1T03A 5KFPA 1W2BR 3MPWA 4Q0BA 2WVDA 2CVIA 3RR8A 3VF0B 1F60B 3IBFB 2WW4A 3IP0A 3LP0B 3TZWA 4F3MA 2MQQA 3HZEA 4DV3F 2L9WA 3ULHA 3KDOA 2EVZA 1ZAXA 5AT1B 1FJEB 1N5QA 1Y7PA 2VICA 4CZCA 3FSXA 4CI0B 3T1HJ 4I67A 2VQEF 3C8YA 1PJ6A 3MUMP 4FXVA 3OFFA 4C8ZA 1AYEA 1HW9A 4QPXA 2ATLA 3DXSX 4NRUA 3IM8A 1L3SA 1KTVA 3KJNB 4F4AA 1VQPS 1CPZA 1JJHA 2YWEA 2GCFA 3V4MA 3PX4A 2GJFA 4IO9Q 5HO4A 2UXBJ 1GAOA 2LQ5A 2MZTA 1HNVA 2QEXS 3NP5A 3QSIA 3QGIA 3MM9B 1NJXA 1AUSL 4DFKA 3KG4A 3QGGA 3D6MB 3TEGA 1HNWJ 2CRLA 1RCXB 2OMLA 2DNPA 2J5AA 4X62F 2OI2A 2CPYA 3NMAA 4I1TA 2ZEJA 2UUWA 1OYEA 5D4LA 2CQHA 3I0RA 2PDAA 1FA0A 1VQYA 2WBRA 4LBIA 4O44A 3RGIA 3PRDA 5A8RA 2E1MC 4USKA 1IJFB 5DQIA 1GK8A 2E5GA 3ETMA 2RDJA 4B9VA 1NJYA 2GIRA 1HBNB 2QV6A 2KL8A 3BQ1A 3BH7B 4O4RA 5L1JA 1XBWA 2W2PP 2ZZNA 1Y3JA 2DCLA 3D5MA 4DMZA 2EC0A 3OR1B 2KFNA 1APSA 2D41A 3OTEA 3QATA 4ZP6A 3PW7A 1KR4A 3GZ7A 3KMSA 1HNXF 2ZVSA 2NSBA 2EFOA 1EQ0A 4P2SA 2W2OP 3Q8VA 4I6WA 1KFSA 5EX0A 1S0MA 4L74A 4NRTA 4DPYA 4KKOB 4KB7A 4PG7A 2CQBA 2DR8A 1Q5YA 2YNFB 2FC8A 4C0HA 1HQ2A 1LW0B 5A8KB 2NXEA 2UUTA 4DR2F 4ZPVR 4DR5J 1BUXA 4RW8B 4HYKA 2R7QA 2KTQA 4F7VA 4DUYJ 1PC4A 3VQTA 4GO7X 3FC9A 5BYQA 4RBVA 4MT1A 2C2EA 2QLXA 3K8WA 2R7OA 2DKOB 1X4GA 3H2UB 3KLVA 3UD3P 3BR8A 4B3TJ 4QU6A 5E41A 2VG7B 1FWKA 3KLIB 3H40A 4PXDA 5EN1A 3DOKA 4YP3A 2QC3A 2DGSA 2C42A 4K59A 3DRXA 5G4DA 5KG5A 1ZTWA 4U6PA 3PW2A 2D9PA 2J7KA 5J1NA 1WG1A 4O0IA 2WVCA 2ZFHA 1OPZA 2M70A 2KXFA 2OHDA 4JI2F 4DI6A 3FFIB 4ZOSA 3NGDA 2B9XA 5CD4A 1SB6A 1XERA 3U1NA 1T9WA 3JSYA 1U1OA 4EWTA 3I82A 2UP1A 2HLUA 1GTHA 4OZ3A 2XYGB 2JC0A 4L3NA 4YDDB 1B70B 3L95X 3EICA 4DPOA 2CQ4A 3SYZA 3K89A 5A8WA 3MM7B 2RJZA 2YKMA 3CJ0A 3DLKB 2DYAA 5F3ZA 2UVWA 3J81j 5F9NA 2DXFA 3HSZA 4MAKA 1N0VC 3KJQB 4MFBA 2G2YA 2V0NA 3AA8A 1A6LA 5KFSA 1YIJS 2E5LF 4KIAA 1Y11A 1ZPVA 4OHZA 2V9WA 3RRKA 1WTFA 2KHCA 3QGHA 4USJC 5LMUF 4JV5J 3M7VA 3N5FA 1FRLA 4A8OA 2XCPA 4NYZA 2V8GA 2ZWOA 3MR3A 4AUKA 4M95A 3TZXA 3EGWB 1NHUA 2CJBA 3Q86A 4WP9A 2V68A 3WC0A 3UD4P 1PO6A 1K1SA 4PWDB 2HW3A 2K7JA 3HJFA 2XYPB 4ILRA 1RE1B 3TA0A 4HHJA 3VQSA 3V6JA 5L1LA 2I5JA 3DNCA 2WSCC 4KT0C 5KFZA 1VQNS 1IR2A 2DVIA 3KLEA 3CDAA 4DQIA 2YNGA 2M8HA 3M8SA 4DL7A 1R27B 1S7HA 3CJ3A 3NNHA 1IQTA 1BQMB 1FNMA 4ZS6A 3PV8A 3GSIA 2JC1A 2FZCB 2GQ2A 3R5GA 4QIGA 2PI5A 1KVIA 3KTQA 1RT2A 2XMWA 1TKXB 2DXEA 2VC0A 4FYXB 3TX0A 4JI4J 2ZBPA 2HFNA 1LWFA 3BSOA 2JFDA 5CCMA 3GV8B 2IFXA 4UQTA 1PKUA 3R2DJ 1HMVB 3M9NB 2AIRB 4ERDA 1S1XB 2LXFA 1BXNA 2E7WA 4NCGA 3DU6A 2XI2A 4P10A 5SUHA 4DV7F 2R7TA 3PNIA 3J7A1 2QE5A 3DI6B 2KB2A 4K7QA 4ZHRA 3M2VB 2JSXA 5CCLA 3IN5A 3D9BA 3HHKA 1T05A 1NU4A 3ZTOA 2UUBJ 3DMJA 2MKIA 1EHWA 2MYFA 3PX0A 3ISZA 2W9BA 4DR2J 4DR5F 3UDLA 3W2VA 4LF6F 2PFDA 1RT7A 3DLEB 3PZPA 3KNGA 3RR7A 2W4CA 1VIOA 2WB4A 3LH2S 1H98A 3DM2B 1WDDA 4WP3A 5C24A 2FJXA 1NCLA 1FKOB 1QUVA 3NCPA 4ED5A 5LJ3Y 3H25A 1GMWD 5HP1A 1TZ0A 2YNFA 5LJ5Y 4HL9A 4LUBA 1S1XA 1NBEB 2G2ZA 2CQ0A 3GIMA 1FVSA 3K8VA 2DNHA 1S59A 1CJTA 1TL3A 2HFUA 4KH0B 3HHEA 3MDFA 5F0WA 4M8LA 1GXTA 4Q2LA 2PMZD 4KE5A 1KLMA 2VU5A 3S8SA 5KFLA 1V3ZA 1FWLA 5HQ8A 3MMBA 3WIVA 2OEJA 2GJIA 3QJLA 1HBOA 1TAQA 2V94A 2ZH5A 4BC7A 5IQ6A 1DLOB 4USHA 1JX4A 1M90T 4NLVA 2X1FA 4FS1A 3I56S 3B6BA 1CC8A 1C0UA 3C15B 5L8RC 4A8KA 2G1DA 4RNOA 2JVRA 1RWPB 1VRUB 2CWKA 3A8KA 4DX5A 2HMIA 4MMOA 4DL5A 1JKHB 1FFWB 2HBYB 2LU1A 3OBIA 1YZ6A 2GFFA 4OYBA 4RBUA 3RG6A 4KGKA 1FD8A 1QAJA 1NLKL 4LR8A 4PXEA 2AV5A 2FHOB 3ENQA 3PG9A 1QVGR 2VFVA 2ZH4A 1RWVB 5HLFB 2E66A 1KLMB 2SXLA 2Z8QA 3SMZA 2KG0A 1Q95G 1V3SA 2CJAA 5H1SV 1NDPA 1S1UB 2EK6A 5F3TA 3W62A 2JEFA 4OJ3A 1XNQF 2F4VJ 1NEEA 2F65A 4DWIA 1REGX 3N5BA 4F2RA 1LWXA 3VZHA 5CYJA 2QG9B 3THPA 2VQEJ 3KJVB 3SCLE 1VQKS 5ETPA 3K5NA 2K3IA 4EGLA 2H1YA 3WHIA 3MEGA 4UZBA 2P9GA 5FDLA 3EDQB 3OLBA 1VRUA 2YNIB 1RU2A 3BF4A 3CO0P 3DRSA 1HQEA 3W60A 5IZHA 4N41A 2OO4A 2E1RA 2W9CB 4JI0F 4JP8A 2E7XA 4DR3J 1SJFA 1U25A 5JJBA 3B54A 4M5LA 3ZTSA 1CJUA 2MLYA 3GIJA 2O5DA 5KFAA 2HRYA 3CSKA 3DLHA 4OHXA 4IR1A 2B5JB 2R2RA 3C2PA 3KWMA 4ZPCA 1IUJA 2VKRA 1LFWA 3WBZA 4X4RA 4ED2A 4O3SA 1FRIA 2NPIA 3EGVA 3HKWA 3UDEA 3NBPA 3W65A 4DSEA 2YNHB 3LP1A 2H5IB 3CCMS 1U49A 2HNDA 4MK7A 1IKXA 5D77A 3H4DA 4OL8A 4LSZB 2GVZB 2M52A 2D9OA 3CJ4A 4WTYA 3J81Y 3W8PA 3IA0A 4JV0A 1YZ7A 4I2PB 3FJ2A 2DH7A 2H4YB 1MN9A 4AD6A 3I4PA 3M8RA 3QIPA 4BS2A 4FF1A 4JV5F 3BDPA 1HHSA 3I9V9 2A18A 4Q7AA 1PBUA 2Y8WA 4NZ6A 5B0EA 2BRKA 3NCRA 1ZZFA 2XB2D 4DQSA 2AGQA 2YQ1A 4CIOA 3J7AN 3PM9A 3DMJB 1S1WA 2QIFA 2MHNA 4NLOA 3VGUA 3UVJA 2MKCA 4K4ZA 2LEBA 5A2QU 1UL3A 2I5JB 3PRBA 3DRPB 3UE2A 2Q66A 4XDDA 1SKRA 3IRXA 3QPIA 3BS9A 4HT7A 2LQBA 1HBMB 3A4TA 5A6PA 4NMLA 2RKIB 2DBBA 3K17A 2CNKB 5AE1A 1L5UA 4QIEA 3V6DB 2CYYA 4LF6J 1MG7A 2DHHA 2RRBA 2MDAA 3EVMA 3MM8A 4ED6A 4LF8F 2W2QP 4MKAA 1F3VA 3MMCB 5CAAA 1FNOA 1VBKA 2MLZA 4KQZA 3HI9A 3C14B 4J9LA 2AU0A 3G8QA 8RUCA 1WF1A 2BX6A 3G2XA 3LF0A 4U9RA 2WSFC 3ILIA 3TP2A 5C25B 1N33F 2V8DA 5BJRA 4DSKA 2P5VA 4IOAQ 1B99A 1U1KA 3T5HA 3AB2B 3M2UA 1S72S 1VI7A 1OJ4A 4A46A 3TZZA 4N8OA 1UEVA 3HVRA 1IBKJ 1KLNA 4HACB 3QZ7A 1NZ8A 3PYFA 4P71A 1K73T 2GJ2A 5L9NA 4RX6A 3DN9A 4UZCA 2IBOA 2IIHA 1RAIB 5IS2A 1XR7A 2HRUA 1SJ3P 1FK9A 3QBCA 1SL0A 1LKZA 3TW0A 3R5AA 2IJFA 3KLFA 4EO6A 1S0OA 4PPDA 1RTHA 2L9DA 1MU2B 4YY3F 3OFHA 1TUGB 1HWJA 1KEKA 3GSDA 3H2LA 3D0GE 3W5ZA 1VQMS 1S9FA 2EW9A 4M5KA 1VJQA 7FDRA 2H48B 3DDNA 3OTOF 3D1OA 3TZYA 2AP6A 2QA1A 4JI1F 1N54B 2GC8A 4WK3A 4LRBA 1FKAF 2FJEB 4NXNF 3CUNA 1VYAA 5EWEA 4DR3F 4PWUA 2UV8A 2UVVA 1H72C 2RVJA 1MROA 3EWGA 3Q8SB 2EC2A 1LNQA 3GV7B 3DRSB 2N4CA 2WTFA 4WXOA 4B9SA 2LXIA 4OYOA 2FVQA 1KWMA 4RLEA 1SKUB 3I0SB 3KK2A 1K47A 1XIQA 2NZ4A 1REVA 4PEOA 1SQEA 2VA2A 4JI6F 2AJFE 4URSA 4DCJB 3Q89A 3KHLA 3SDEB 4D3HA 2KFYA 4K4YA 2CJKA 2DNLA 5GMEA 4NI2B 3MM9A 4X64F 2P8IA 4CP5A 2J6TA 1S6UA 2NREA 3NNAA 3VGSA 3ZTRA 4S0MA 1RHQB 3CC2S 1QD1A 4DV2J 2A6OA 3AFGA 2DPJA 1H7XA 1T9YA 2YXLA 3QAUA 3K58A 1GT8A 2UXBF 4Q2MA 2NSCA 1IKVA 4E0DA 1G2EA 2V63A 4KJIA 2AJ2A 2VBXA 5ADZA 1T9VA 2JLEA 3O2IA 4J91A 2J7WA 4FNHA 4ED0A 1HA1A 2WONA 4ZDNA 1RK8A 3J7Z5 4CLWA 3IR7B 2PEHA 3LGNA 4NMXA 3BQ0A 3V6HA 2B4PA 1U0HA 3DC2A 3HSJA 1F5BA 1DAXA 4LFAJ 1JLAA 2HIQA 3T6BA 3CF5Q 1YKWA 3ZXWA 2BBEA 3H7HB 4IOCQ 1YWXA 2R8JA 1FERA 2RD5C 4RUHA 2B8PA 2HWIA 1WNEA 4GRSA 2LYVA 4A47A 3KJVA 5F8NA 2RDDA 1TUWA 3OD2A 4Y2CA 1Q7YT 1N36J 1YJWS 3SEOA 1L3UA 3AB4B 1AZSA 3DLJA 4YB6A 3D7SB 3Q8PB 4HACA 2OEMA 2VQFJ 2G4BA 3M2RB 2J6SA 1IM6A 3QRRA 1NHVA 2X7IA 2UXCJ 3M1VB 1RI7A 4QWAA 3UVJB 4F4YA 2BQUA 3P4UB 5D0HA 5HI7A 1VHFA 3MPUB 4ZPDA 4QW8A 3RBEA 1GMWA 2B0GA 3T3FA 2QO3A 1L3KA 2CFXA 3R5CA 4EYIB 3QSYB 5KFUA 4ZJQA 1TQLA 3BN4A 1FRHA 1YITS 4HT5A 4V19X 1RWWB 4F4WA 3IAM9 3HHNB 3IRWP 4IOBA 1XEZA 4EBDA 2Y1RI 1EKSA 3SI8A 5HVFA 1TK5A 1PIEA 2XLIA 1FDDA 2HHUA 1LFPA 2ZDOA 2OPPA 1RHJB 1SIWB 3LP1B 4ZCLA 1RTIB 1UJ4A 5E0OA 3UNGC 1Q1KA 3ZTPA 4WTOB 2R8HA 2EFQA 3QNWB 4O23A 3M32B 4DR7J 2AMCB 2C22A 3JTOA 3T41A 2PMWA 2BABA 3PJWA 5KG7A 7AT1B 3CT9A 3EZ5A 3ISND 1WF2A 2DO4A 4OYAA 1X9MA 4H4OB 4DV4J 2HPUA 5RUBA 2E1PA 4DR4F 4J9SA 1PSDA 4DN0A 1WI8A 1B4SA 3M8YA 1T9UA 3CJKB 4DPXA 5BYRA 4EFAC 4ZVRB 3HO1A 4TNOA 1Q8KA 2HBRB 4CH7A 1HW8A 3GQCA 2R3VA 3Q8QB 1M5VC 1RTJA 2QMWA 4MK8A 3R1HA 2QGFB 4R8UA 2BR0A 3UFCX 1JLFA 2ZKTA 4ZPWR 4ICLA 2MZJA 4ZP9A 4ECYA 4USVA 1AUDA 3R8YA 4CM2A 4OIXA 4ZVSB 3MMJA 1X0PA 5HROA 2UUAJ 3F0NA 4KY3A 4ZKAA 3OXFA 3I9ZA 1PYTA 5KFCA 1T03B 3BM7A 2GS8A 2V2ZA 3CIZA 4ZVOB 2CZ4A 4Y0FA 5J1EA 3J80Y 3AD7C 2UXDJ 3EGNA 4QIWD 4ZHRB 2YWGA 3OSPA 4NCAA 5ETVA 4KV8A 2V4QA 2KXNB 1UAWA 4CWBA 2B9EA 4UOGA 1BHNA 2NR0A 3VAMA 2CDQA 2H65B 4LBHA 3ZZPA 5C25A 2DR9A 5DM6Q 1F1BB 3QJJA 4OYIA 2YVSA 4GVLA 2AJQA 1D1UA 2VBWA 3EZUA 1QDUB 1TV6A 2W7OA 2HGNA 2YWHA 2HQGA 5BYSA 2Y1JA 2PA8D 2I6WA 2CADA 4QWBA 3NKYA 3TNVA 2CPDA 2IMOA 3SCIE 1D8ZA 3PX6A 2ZOFA 5J1PA 3D6FB 3MR7A 1IWAA 4OYMA 1HBMA 2F7VA 3CJQA 3O3LA 1T7PA 2VPXB 2NCKL 3R7BB 4C7QA 4OYZA 4EBCA 4F02A 2W2MP 2W4DA 1KRPA 2I0XA 4B9UA 4P7TA 4CT9A 2KJWA 1RT6B 3JTPA 1SH0A 1VOMA 3SV3A 5A2QY 4TU8A 5LMUJ 2HS4A 3C6TB 1S6OA 1YDLA 2ILYA 3BR9A 3Q83A 1PJ5A 2H51B 1RQ0A 1UW9A 2BUNA 4UOHA 2XGPA 3BREA 4PUOA 2BANB 4LFBJ 1DY3A 4EO8A 1XTZA 1RDRA 1U8SA 4ES1A 3DLGB 5BR8F 4P75A 1RKIA 1HYSB 3ZFVA 1BY9A 1YJTA 5BXIA 4ER8A 2B6AA 2CQDA 4E8UA 2C1EB 3J7ZT 2LCWA 1J2VA 1RXOB 2BJ3A 1WACA 4O4GB 5EWFA 5EDWA 1XMOJ 2WZ1A 2ILZA 2W9BB 3ILOA 4DV2F 5CYMA 1PBAA 2ZBIA 3CMES 2CVEA 1C1BB 3AA9A 5GAGI 4RU2A 4B3SJ 2DJWA 2FLOA 2XZTB 2QZ8A 1H74A 1JLBB 1VMBA 2DGTA 2ZBQA 3DGVA 2DNRA 3MPYA 4LVOP 3D2WA 5IT9U 5DDQC 1DZ5A 3TUPA 3E01A 4KTQA 3MPVA 1P1LA 2OPPB 2XS5A 4CO0A 1B64A 4CO2A 2QL9B 4O3OA 4AL6A 5FIIA 2HQDA 2MKKA 3GLJA 5DGBA 2MB0B 4RNFA 2F1FA 5M2UA 4X4SA 4F4ZA 1IBKF 2JWNA 2YNIA 3FCWA 2IA6A 2VOPA 4DL6A 1QUPA 1BMQB 4O4GA 3BYRA 4ZVPB 2W9CA 3SCKE 1S99A 1IN0A 5KFWA 4NZ7A 1Q82T 2FLNA 2RHSB 2VONA 1GMVA 2GHVC 4PZVA 3SIPB 4ZCIA 2FLPA 2BJDA 1M1HA 1HWKA 2F40A 2OPSA 4ZCMA 5J2NA 4JI3J 5LT5A 4LF7J 1NK0A 1NPPA 3AOCA 4LF1A 3IXQA 4D3GA 2DTJA 4JV2A 1Y10A 4X62J 1P8GA 1UVIA 3JSRA 3JYTB 4I69A 5D15A 4RNNA 3HK2A 1HBUA 1QTNB 4FPIA 4FDFA 4P2MA 5DZ7A 3BGLA 5K8OA 4X65J 2XMMA 2XMKA 1JNRB 2ASYA 2V34A 1RT1B 1YJNS 1IXKA 1FKOA 4I64A 2MSTA 3LALA 3ENAA 2QL7B 4PXBA 3MD3A 1NK4A 2FHKA 2CKWA 2JFKA 4M5JA 4EBEA 3K57A 3NXZA 4OHVA 2OD4A 3OV7A 2J0QD 3P5BP 4EZ9A 1GMUA 1UVJA 4FBTA 4AXIA 1RBOB 2QLFB 2GGPB 3AQOA 3POTB 3O1LA 2ZD1B 3MEDA 5I3PA 4CLLA 4YOEA 1QM9A 4P74A 5EHHA 4PWWA 2FLLA 3MMBB 3K5PA 2UUAF 3SSQA 2JLGA 1XMQJ 2AEFA 3CNQP 3MUTP 1JLEB 1H38A 2P6SA 3EYZA 3WX4A 2YBVA 1XK8A 3ADAC 2V4JB 3SSSA 2G13A 3TARA 3PACA 3HVTB 3N0VA 1HARA 1U45A 1FNXH 4K4VA 2XM3A 1K0TA 3UCUP 3LPYA 3M30B 2KT5A 2FY8A 4OZ1A 2FHJD 2E5HA 1CQMA 3S01A 4RW6B 3CD0A 3SCJE 1OPIA 3IWNC 2KU7A 3CCQS 1R8AA 1X9SA 2VBYA 4DN9A 3KLHA 2VKZG 4PXCA 4DEZA 2ZM6F 4DX7A 2C2OB 1XMOF 1VQOS 3PEHA 5KFYA 3PFEA 3RB4A 5T14A 5H9FK 3MTKA 4ZVFA 3M9MB 2OEKA 3FRYA 2XSJA 3ETOA 3FMWA 1I5OB 5G0RB 1TL4A 3OL6A 1DTQA 3WX8A 3MOJB 4K4SA 4DDFA 3KHHA 1LXNA 3W9JA 4JI4F 4C9DA 2A1BA 2CPZA 4AE5A 2J8SA 2X51A 4DV3J 1WHXA 3FCHA 4BWMA 1X4FA 4FXWA 4H4KA 4ECRA 2IYGA 2P9CA 1FF2A 3M9OB 2FVPA 1UZDA 4B3OB 4DLGA 2BE9B 4RO0A 3DRPA 1IM4A 2QFIA 2A6MA 4N8NA 3NGTA 3D6TB 2CJQA 1C1BA 1XMBA 1MWQA 3DKDA 1VBZA 1VS3A 3HVAA 1HBUB 2RS8A 2ZBRA 4DL0C 1TR0A 1TV6B 4WK1A 3DRRA 4RW9B 2XG8A 1O51A 4Y2MA 1BQXA 3HMJG 2G0IA 1P6TA 4X66F 2IM1A 3MR2A 3FGVA 3BGOP 2ZH1A 1RTDB 4TVAB 5D4NA 1AB8A 1QJHA 2KJVA 3WDOA 3C14A 2VV5A 4DUZF 5HK4A 3W9IA 3KG0A 1AFIA 2OIHA 1MN7A 4M63A 2AEMA 4WF9Q 2NLWA 4R25A 1RUSA 2OTJS 2HHSA 2JDJA 3OTCA 4CM0A 4DSIA 3K7RA 2IM2A 2QN6B 4A8XA 2MQPA 1VQ7S 2KRRA 2BE7D 2HWTA 3QJPA 5CYQA 4KC5A 2FY1A 2OGUA 1MMDA 2ZNYA 2ZH3A 1MU2A 2V69A 3CCES 4PG6A 1FJ7A 2XEXA 2HIYA 1NKCA 3R5DA 3CJTA 3MAAB 1S77D 3IRXB 5DDRC 1Q81T 4IRCA 1JLBA 1MSWD 3FBFA 2QLWA 4RU9A 4C6AA 5A8KA 4KPYA 4LFAF 1KC8T 1JLQB 2VFRA 4G3IA 1HNXJ 3HM9A 1OMSA 1HFEL 4M94A 2Z2LA 1OY9A 2APOA 1B0VA 4CLZA 3D3BJ 5ETKA 2XMAA 2FHJA 3V6KA 1I1GA 1WC5A 4EK2A 2CA9A 1G7CB 2GAHC 3RBZA 4CH0S 5DDPC 1D0EA 2VFSA 4YEAA 2RRAA 1KONA 2AT1B 2QA4G 2G1HA 2L48A 4DSJA 1XR5A 3GB0A 2UZAA 1KQKA 2XZWA 2YKNA 5B0DA 4R5PA 3I55S 2J9EA 1FRKA 4NI2A 4A8YA 3H98A 4DPWA 4IUFA 2MHEA 1I3OB 2HNZA 3NG8A 2F4FA 4OHWA 5GMDA 4M5IA 3UNYA 2BYCA 1CG2A 2LDYA 1IJEB 4OYXA 4XAKA 4F0MA 2ERRA 4TYAA 1V6HA 3I0SA 3KK2B 4PR6A 2IVMA 4C0OC 4LBPA 2EBGA 5ETQA 3LOUA 2W7AA 3M6UA 5J2NB 3TQEA 2H5EA 4R0EA 1FFGB 5L38A 1SL1A 2DNMA 4WFZA 3RUBL 2E9TA 4WZQA 2BJEA 1NK8A 1NKBA 3EVWA 1RAOA 5AJ3F 3MAHA 1AT1B 3G82A 3ONQA 1QE1B 4RW6A 5C2CA 4P52A 1UA1A 2QL5B 4UUXA 2DPIA 2CPIA 2EXUA 3D66A 4IH7A 5GVQA 3W63A 4KSEB 1BE4A 4NLSA 2ROPA 2EPIA 3RAMA 4JI7F 1RT4B 2QSFA 3HFKA 3SZ2A 1QTMA 3TX8A 2Q43A 4NWBA 4TY9A 2W8KA 1HWLA 4MIBA 2DRDA 2DH9A 3BQ2A 4ZITA 3RU0A 1GXLA 4JUZA 3A13A 3QT7A 2CNNB 4ZN1A 2VA3A 3R7SB 3C46A 3JB9k 3NL0A 1YTYA 5M2RA 2P2CB 5K9FA 4W92B 1H2TZ 2D69A 3JAMU 2VG7A 3POTA 4NCBA 2D1CA 3V5RA 4ELUA 2DHXA 4CNZA 2CQ2A 4PAAA 1KS2A 2P9EA 1AFJA 5HMXA 3PHTA 1NB2A 2F9DA 4PG8A 5I3UB 1V5VA 5AE2A 2ZKUA 4JI5J 4DR1J 2J9CA 2K2PA 1C0TA 4FF2A 3AD9C 3GYNA 4TLQA 4TYBA 1RTJB 2PC6A 3OXGA 3KHRA 2AYGA 1R8CA 1ZS6A 5KFJA 2YTCA 2H9ZA 5HATA 3GR0A 1HD0A 2CG8A 4YR0A 3OUYB 1UP1A 2IRYA 3TVZA 5T7LB 3QO9A 2W2NP 2BACA 2EG2A 1NDKA 2GAGC 2MQLA 4FPRA 4Y00A 2I2YA 2KG1A 3WIUA 4DG1B 4DQRA 1N8RT 3Q0AA 1WC3A 1RA7A 2F5GA 1W25A 3PY8A 3PR5B 1K1QA 1S79A 2IM3A 4C11B 1NK6A 4ZLLA 4KO0A 1NJZA 2L41A 2XMJA 1QSLA 4B3OA 4J9RA 1EX8A 2VPYB 2WHOA 4F04B 5KFGA 1SJQA 1YG0A 1V5IB 1S1TB 1RYSA 5KTQA 1N48A 3NWGA 1DTQB 3AT1B 3NY0A 3DRYA 3DLEA 2RH3A 3DYAA 4WCEQ 3Q2TC 1OIAA 1S0NA 2VPWB 4TXSA 2K3KA 5K8PA 5L1KA 1JKHA 3ENWA 1RWNB 1T94A 3DM2A 4LR9A 3HT0A 4DV5F 1J5OB 1KBRA 4CTAB 1YJ7A 4K50A 3P49B 4X66J 2GVZA 4UOFA 3AOAA 3CTRA 1T8EA 2LLZA 3D0IE 1T02A 2IVYA 4AT1B 4CT8A 2RQCA 3IWXA 1YLXA 2PD1A 2PT0A 2KI2A 4HTIA 3LAMA 3EX7B 1SUQB 3DFEA 3IS9B 4IYQA 2B43A 4OQJA 4LSLA 3PR4A 3HX9A 4YR3A 4DHVA 2FJBB 1H6KX 3AJ1A 4DR7F 3SXLA 5LMNF 2OPQB 1B7FA 2OJ3A 5ETTA 1WF0A 1R6YA 2BM0A 2YKPA 4W90B 1F9HA 2V6AA 4H54A 2DH8A 1S9EA 4NLWA 2VASA 5CZVA 4F26A 3ILLA 1WHYA 2EFNA 4LIRA 2BA9A 4QPTA 2XYHB 2MJNA 2RB7A 3FUYA 5AXKA 1BD6A 1LK7A 5HQLA 3TUZC 4ZPTR 1N5YB 2XHWA 3O6QA 2XO6A 4ZIVA 4AL7A 3SQGA 1SBRA 1Z2LA 4DPUA 3NMRA 2CUYA 3QLHA 4ID5A 5CYQB 3CDUA 1CJVB 2AW0A 1TL1A 2WB1D 2HFSA 3DOLB 2LMIA 3M6WA 4DU8A 2XGQA 3B4DA 1R0AB 1DJ0A 2CWXA 4DQQA 3EVOA 4I4BA 5F0UA 3PXGa 1I94F 1D9DA 3EXYA 5H9EK 1U48A 4QYZJ 1N5SA 2GMLA 3BBBA 1CJTB 1TL3B 1HNIB 3C19A 4WU2A 4HHHA 1WD6A 3S1TA 1JLFB 2VHGA 4PQUB 1KOHA 2LU2A 3W7BA 2ZJRQ 1VK8A 4ILMA 2JEGA 1IBMF 1VLOA 4RR5A 1E6VB 4CNYA 1IKYA 2RILA 3BKFA 5CABA 3OJUA 1LWFB 4DF8A 2HHVA 5B0BA 3VAFA 2HLTA 3C3LA 1VGYA 1TKTB 2DNOA 2LQ9A 3L09A 5KFNA 1FDBA 4EMDA 4QCLA 2DT9A 1TKDA 3CULA 2A0FB 2KXHA 5MLCV 5E3RA 3MEEB 5F8GA 3N9UC 5KFEA 2HHPA 3D3CJ 3MF5A 1CULA 3F56A 1OS5A 4LF2A 3T5JA 1N32J 1CSJA 1HBOB 3A1YG 4MIWA 4Z37A 4UY8T 2G2OA 4C4WA 3DDIA 2VG5A 4B08A 5HN0A 5D0EA 1GTEA 4KGZB 1U6ZA 4NX9A 4F4KA 1AROP 2B5JA 1ZAVA 1FEHA 1JLGA 1U2FA 5AJ3J 3K5LA 5KG0A 1SV5B 5KT6A 1WORA 2R8GA 3C6UB 3OHBA 1FCAA 2NZCA 1UVNA 2XS7A 1MLAA 2LA6A 1CJKA 3IR6B 3H4BA 3N6LA 1SVDA 3CJ8A 1UVKA 2Z2MA 4WBFA 3HHLC 4N47A 2DEJA 4JV1A 4NLGA 4HH0A 3I0RB 4O44B 2V5HG 4OFZA 2J9DE 4G1QA 4EEYA 1N6QB 4F67A 1R6VA 1NPRA 3AJ2A 3LP2A 5GADU 4NASA 3FVYA 2OPQA 2HFVA 2ZE2A 2X3DA 4ECWA 3CC4S 2RUSA 4OV1A 4OMFG 3QMQA 3RTVA 4WFBQ 4ED8A 1O6XA 3W1YC 3PRVA 3G87A 2E5LJ 4LF4F 3AXMA 2FGCA 2Z4PA 3BZQA 4ENOA 3AXKA 3CEDA 3OVAA 1P1TA 1BQNB 2HHQA 4QZVB 2HBQB 4ILLA 2XWXA 2RSQA 4V1Ak 1TK0A 4P72A 3VCDA 2DNYA 1VLYA 2V50A 2ZNZA 3BGFA 1UETA 3TAMA 4URGA 2EFGA 2MY7A 3V81A 1UWBB 2AGPA 4DXLA 1SPBP 2LQJA 2MZRA 1Y5NB 3SSRA 3BO2A 4XK8C 5ETLA 1UEUA 4YB1P 2MKHA 3N28A 3DOMA 3TANA 2OD6A 4KHPJ 2DRAA 3OVSA 2C3UA 2GGPA 1X7VA 2VZ9A 4MKBA 4X84A 2Y1IA 4ETXA 4FVCA 3O8WA 1U6FA 3KUGA 3RJMB 3B82A 2YH1A 1LW2A 1RWUA 1YK9A 1OY8A 1UFWA 1SH3A 2E44A 2YKAA 4J9VA 4F0HA 1Q8LA 4B9TA 2XMVA 4QYRA 1Q5VA 2B4VA 1AZSB 2XTJP 4X4QA 2ZBCA 4UQGA 3KUEA 1NDLA 3MTJA 3QIPB 1Y3KA 3M1VA 3CGIA 1N33J 2J9DA 2I9SA 3OTDA 4WFAQ 1IWGA 5IM0A 3G86A 3OLAA 3JXOA 1ELOA 3PEJA 3HVTA 1G4CA 3KFWX 4B9NA 3VAIA 1BGXT 2QMXA 1X4EA 2L3MA 1I6JA 1J5OA 3M30A 4GKJJ 1O8BA 1UFLA 1ZA2B 1HPZA 2K1RA 3GJTB 4OI0A 1HI8A 2Y1LB 1RWKB 2CQ1A 3CO9A 3DOLA 1RKJA 2R8KA 2ACYA 2KHDA 4KRWA 4ECTA 4C3MA 4DX8H 1JXEA 3NS5A 3P6YC 1T0TV 2KZMA 4WWSA 1IVZA 4KHMA 5GAGU 1X4AA 2WONB 4O3QA 4FVMA 1G6BA 3E3XA 3GILA 5A0YA 1WEYA 1SH2A 2XI3A 1VC0A 2BJ7A 4OZLA 5B0AA 4LF9F 3MXHP 4DPTA 3G8SA 1RACB 2FVCA 1N32F 2CQ3A 2W8LA 4X4NA 5LMNJ 4HR2A 1WI6A 3LPEA 3THVA 1SJ4P 2V2KA 3MGJA 2JOQA 4I0WA 4QWCA 2KT3A 4DG1A 2CZ9A 3ZZZA 1OO0B 1RAEB 3H0PA 1PILA 5KT3A 1FESA 1S57A 2VFUA 4PRFA 4U8YA 4HTJA 1NXIA 1S1VB 2NXUA 4O3NA 3VR1A 5L39A 1K8AT 2P6TA 2IYIA 3OVBA 4J90A 6FDRA 1CC7A 2WW8A 5E3QA 4YUDA 5HROB 2BE2A 1RA6A 1R89A 2F9JA 3V4IB 3H5UA 2HK2A 3ISNC 3M2UB 2DNNA 4JB8B 4FYDA 3EPIA 4ED4A 3ZZ0A 4YR2A 3DGPB 4NZ0A 1KP6A 2VDIA 3SBMA 1KNZA 1QVFR 2UV8G 2R7XA 4DL3A 2OPRB 3MMAA 3I5AA 2GMHA 4BDPA 1JQGA 3KLFB 2RHQB 5AXLA 4F0KA 2CPHA 3CCZA 3HSGA 5LOQA 3PKYA 1QSYA 1JJ4A 4JI8F 3MM8B 4JI0J 1JWWA 4A8FA 2Q6BA 4XPCA 3E51A 3NNCA 1GX6A 1T3OA 3M32A 2F4VF 1UJ5A 4H4KC 1F5CA 3H5YA 4QOTA 4UT4A 2MZ1A 2XNRA 3VALA 4ANDA 1HBNA 1NAQA 4CLUA 1NJWA 1TMMA 2GW8A 3G8TA 5D8HB 2KM8B 3FSIA 2NXNA 1NPKA 3HHDA 3PYDA 5E5NA 2VJUA 4J9NA 5HP1B 4K2XA 5K5MA 1NH7A 2IBKA 2FYXA 2K1RB 4H4MA 1HI1A 2YX7A 1S48A 5DLGA 2AF6A 2ZOGA 4YDXA 2LQ8A 1TL7A 4YQWA 1HNWF 4C8YA 2HHXA 4LF7F 3F73A 1RTHB 3E2EA 4UW2A 4LT6A 3M8WA 3VV2B 4KBIA 2KVIA 4CYUA 3DRRB 4RW9A 4QWDA 3HPOA 4ITSA 2DGUA 3LWMA 5BR8J 4JBCA 4DX6A 3JQKA 4K2JA 1FVQA 2N3OA 4X4PA 1XC9A 3QRQA 3T5KA 3NGSA 2DGOA 3T1YF 1FJGF 2HQIA 3B4MA 3PYGA 4CO3A 3GYXB 3R7NB 2POKA 5CQGA 2BMBA 4Y28C 5IC6B 4BBYA 2XC9A 5FLXY 5IQQA 4IFVA 5J2PB 1LWCB 1ZH5A 3I32A 5KFHA 2DRBA 3VVTA 2JL9A 2XSFA 4QIFA 2ZUAA 3TJAA 4DCOB 4EYHB 2ASJA 3D28A 2FD2A 2CDRB 1P9YA 4DOZA 1ZYQA 2HMIB 1YJVA 4OZ5A 3HVWA 1FXDA 4ZVUB 1RT3A 5AXMA 1DBDA 1WC4A 2V2VA 1UW4A 5ETOA 2HG4A 2VJVA 4L3KA 3K0JA 3IR5B 1DQ9A 4LQ3A 2YWWA 3E01B 1CLFA 4USWA 2IDEA 3L4BC 2W1BA 2YH0A 2DNQA 1IKXB 2UVUA 2ZH8A 3GFHA 1VR6A 1Z2ZA 5B7WA 5IT4A 4CLPA 2CPXA 2MKYA 2NS1B 4USTA 5E3AA 5HLFA 1U6BA 1DQAA 2FTRA 5KFMA 2LEPA 2HYIB 2CJ9A 2IRXA 1R8HA 1U4BA 2FJVA 4P6QA 2B56A 1ZM9A 1NRKA 2B7CB 1Y5LB 3DCAA 4ANEA 4U95A 4WIIA 4R5PB 2O67A 4XO0A 1RLDA 3FCVA 2OPSB 3A12A 1R0BG 3NGRA 1IR1A 1SXLA 4OLOA 3G6YA 1WOPA 2HVHA 5KFFA 1FE0A 4DF4A 4ATNA 1QSSA 5I3UA 3UCGA 1RT7B 1S6PB 2MKJA 3M8ZA 1UFKA 3C15A 1VC5A 2EKNA 2OKQA 2D74B 3M4XA 4J9PA 5M2PA 3GWCA 5IC4B 3QGPA 3I87A 1VQ4S 2Y8YA 4USIA 3EGZA 2A10A 1S6QB 3GFZA 3V2UC 5E3PA 4YFUA 5H9EJ 3IS9A 4FZVA 3BBFA 3R5JB 2BOAA 4IH5A 5T7LA 2BKOA 1T9TA 4J5OA 2HS0A 3UN5A 2EWHA 1RAFB 2Q3PA 2CNOB 3Q24A 4U7UD 3HKZD 4I6AA 2M9KA 3F41A 2LEAA 1RT4A 4WYLA 5LXYA 2HNYA 5ETRA 3EUNA 3G4SS 1PYSB 2HVZA 1Q8BA 4C3KA 1RT5A 4WE1B 1WC0A 4G6VB 1C1CA 3FEZA 1ZETA 4MH8A 3LP0A 1S9EB 3G9CA 4JYAF 4O3RA 2ROGA 4NE9C 5KT7A 1WHVA 3JSMB 1KVKA 1F5AA 1H0HB 4DU7A 5KFOA 3QT5A 3NOCA 4C48A 4ES3A 5D4PA 3ZC4A 2HRTA 2V8PA 1TTHB 4FYYB 1YQHA 2XZDB 4RUCA 4USMA 4RNMA 4DS5A 1D8YA 4OZ2A 3BBCA 2HHTA 3MECA 2KFZA 2DIUA 2AX1A 2RF2B 3QZ8A 2B3TB 1RB0A 2RT3A 3A8EA 1EB0A 3H42A 1LXJA 4GVBB 3CMQA 4H4MB 2CQPA 2LFVA 2MY8A 4XTTA 4RNHA 3M6VA 4IQMA 5GAEI 1R0AA 2QFJA 3BSCA 3JYTA 5DGAA 1KQFB 4F4XA 5D4OA 5B0GA 4X64J 4C97A 4KYZA 4DV0J 1ZTTA 2IA0A 3D68A 3QT6A 3EE3A 2FZKB 3IBWA 4ES2A 5KFQA 4MK9A 3G96A 2R8IA 1LQ9A 3AOBA 4NXMJ 1BWVA 3QAEA 1RJJA 3L7PA 2MEWA 3CCLS 4ECVA 1JNZB 2MZSA 1WTBA 3TWZA 2GVDA 4IO1A 3ZTQA 4B3RF 2I8EA 2UUCJ 4NLQA 2GIQA 2QLJB 3GONA 4MIAA 3J7YU 4ZLPA 3GCXP 1F2HA 3KHGA 1U1MA 1FT8A 1H7WA 3ET6A 2IJNA 3LQVA 1U24A 5KG6A 1GEHA 5CHCB 5L9XA 3MFIA 4HKQA 3CJ2A 2UU9F 1VJWA 8ATCB 3HDSA 1XNRF 3HD1A 1WG4A 3UDCA 1ZBTA 4FF3A 4FN5A 4ZLNA 1NB7A 3NGUA 2Z2YB 1NSPA 2HNZB 2NUUG 4NA3A 4RW4A 2FHMA 2AHOB 2HEKA 3NAIA 1M5SA 2KT2A 3MR6A 4DFMA 2BXJA 3SFUA 1TVRB 1OQ3A 3CDBA 5CYMB 2VOOA 1JB0C 3HHLB 3FZ2A 4O0NA 5HMZA 4WZMA 1TL1B 3CIMA 3KOAA 2XBPA 3MR5A 4NLRA 5FD1A 4K4UA 3KUHA 4OZ0A 1PJ7A 2GMJA 3GE9A 4DCPB 2DR6A 3G82B 4IQXA 1HWIA 2R2TA 4K5SA 4YB5A 3CCUS 3IGVA 3BKUA 4DR4J 3MEEA 1C1CB 1PAUB 3CD5A 3FSYA 4P7VA 5GAEU 1K9MT 3CC7S 3UO0A 2FVRA 1CQNA 3MEDB 5E7OB 2R7UA 4NLTA 3HT3A 2ZH9A 5IT9Y 1Q79A 2M4MA 5HL7Q 1FFSB 2V8VA 1D9FA 3A3OB 3MZIA 3MURP 2G9OA 2WOMA 4IFVB 1K44A 3DOKB 4ZCKA 5J2PA 4FXDA 1P27B 3TAMB 3UCZP 1IKVB 9RUBA 1MMLA 3I4HX 5GAHI 2NXJA 3HHLA 2E1CA 3X1LB 1A9NB 5DM7Q 1TAUA 2DGQA 2PEBA 4M5DA 1Q16B 1HHTP 2AWZA 4OJGA 1FK9B 2E7VA 1B0PA 1JIHA 1RSCA 2W01A 3GIRA 2YPYA 4ETZA 4X4UA 1KOOA 2ZHOA 1FX2A 1EP4A 1WEXA 4CO4A 3BPSP 5DG9A 3A8IA 3LAKA 4I7FA 2IRUA 2YKMB 3DLKA 5CZXA 4DR1F 1EARA 1TMJA 1LW0A 4G1QB 1N6QA 3JTNA 3OXLA 2GX8A 4QYZK 3FRZA 1LK5A 3IAS9 3LA0A 2PA3A 3FBCA 2ZD1A 1X5SA 1MROB 4UOCA 2WVFA 5E33A 2VIHA 3GPAA 2HNDB 3LUYA 1TU0B 5KFDA 3WC2A 4ZN3A 1FRMA 3Q8UA 3W61A 1ZPWX 4OYWA 1Q78A 4AQYJ 2YX4A 1OY6A 3MD1A 4RW7A 4K4WA 1LV5A 4ALZA 3T19A 1U2RA 4ZJLA 4ANCA 4M5DB 3OTOJ 4AQYF 4G1IA 4JI8J 2D7SA 3O5TB 3MUVP 1IKWB 1CS4A 1N34J 3TA2A 4DBQA 2RNEA 1YX2A 5B08A 1SJ1A 4L76A 4Q8EA 1PAEX 2B9WA 2NUHA 1X5OA 2U1AA 2ZWPA 3J81U 2KYXA 1LEOA 2M2BA 5HBMB 1YRTA 2DNGA 4CH1A 1S10A 1JLQA 3MCMA 1RWMB 2XS2A 2N7YA 3IWLA 2V8HA 3CCTA 2E5JA 3DHXA 3KLHB 1XR6A 3BJYA 4WFXA 3MAQA 1YJRA 2UU9J 3QRPA 1F9EB 2ZC4A 3FEYB 1LWEB 3CPWR 4XDCA 3GV5B 2DHSA 2XHCA 4ZIWA 4BWJA 2ZHAA 2ZZMA 2FJDB
chains in the Genus database with same CATH topology
5DO2A 2MSSA 5DG7A 5LL6d 3U7JA 5IM0B 1RT5B 3N6NA 4WE1A 1T05B 3MMCA 4A8MP 1C4AA 2HNYB 3DI6A 4FP9A 4QQBA 3UQSA 1FRJA 2B7BB 2MKSA 3OSNA 3KK3B 4A8WA 2J0WA 2DB1A 3EPGA 2ZITA 4PKDB 4RW4B 4X4VA 4GC7A 1D9AA 4QW9A 1S97A 4PG5A 4ZMMA 1JLEA 2G0CA 5E2QA 5IT0A 2AX0A 2DIVA 3LWLA 2C3MA 1FKPB 3OTBA 2WK4A 3KLEB 3JAMY 2CQGA 2YX1A 1FHTA 2R7RA 5KG4A 2HFZA 2IAJA 1VIXA 3T6JA 1NO8A 1W2IA 4A48A 1BLUA 1S1UA 2YKOA 3H2VE 3OFGA 4IFYA 4B02A 3I96A 4PUOB 2EFPA 2VL1A 2XULA 4NA1A 3PW5A 3KK3A 3U1MA 3DXBA 2BRLA 1VQ9S 4X4OA 1H2VZ 4DS4A 1BWEA 4LVNP 1Y5IB 4DUYF 4IKAA 3PKMA 4F3OA 2W4PA 2QA2A 2JRSA 1DHMA 3MM6B 5KFVA 1XN9A 5EX3A 2MQNA 2ADCA 2OFHX 4J37A 5JUMA 3R5BA 2W7PA 3G9CA 1HD1A 1QE1A 4BHQA 3QWPA 4EUVA 4Q0BB 4ED7A 3OR2A 1Y4ZB 2CPJA 2AQ4A 5D78A 4AFFA 3ITHB 1L3TA 1DTTA 3MM5A 2JZ5A 3LO3A 2YWFA 2KO1A 4IDKA 4TKTA 3D1HA 1FXLA 4EZ6A 2W25A 3TUIC 1RT2B 5DLFA 2AYEA 5KG3A 3PHEA 1N5YA 4LFBF 2ABYA 3CD6S 4HI1A 4Y65A 4CCHA 5E3CA 5I42B 1N5VA 1FDNA 2YWKA 3N79A 2R7WA 5IXUA 1FRXA 1RT3B 3R3TA 1KVJA 1Z4UA 1KD1T 2IHR1 2Q1LA 1F9FA 2XLKA 3TOQA 3NGKA 2BE2B 3V4IA 3M8QA 3TAPA 4NXMF 2XCAA 2ALZA 5HBMA 4JI5F 3PW0A 4OJHA 2OAUA 4PQUA 2W9AA 3PIOQ 4NYOA 5F9LA 1XWLA 1R43A 2D3UA 2YNHA 4IRKA 2C3PA 5CA5A 2B51A 1OQ6A 1RT6A 1O0PA 1JMTA 2ZC3A 5B09A 2CPFA 2Z0GA 2C2DA 2I38A 2RMLA 4J9KA 4RW7B 4ECUA 4OX7A 4LFAF 1YGYA 1JLCB 2MXYA 2BQRA 2ZH7A 4OI3A 4BCAA 2FJWA 4QR2A 1U09A 5IWAF 1M5KC 5U47A 2B6AB 1EETA 2CPEA 2PGCA 1VQLS 3KNAA 4DV6F 3DLGA 3ENVA 2X3GA 1KFDA 1AXQA 3N6MA 4IG0A 2MGZA 4RWXA 5JVHQ 4J9QA 1L3VA 2JEJA 1TKZB 2F8EX 3RRGA 4ZP8A 2A2DA 4E98A 1TUVA 3OUYA 3MWBA 5GMKa 3ICLA 1QLNA 5K8MA 1FTCA 1H3DA 4HDGA 3J7YI 4RZRA 2XLJA 4K0KF 4ID8A 2BQ3A 5FJ4A 1PGZA 4R8UB 2OFGX 2OSRA 4ICLB 4LQ9A 3T9NA 4I2PA 3KMQA 1YI2S 3VAKA 1M0SA 4C11A 2FUG9 2PN6A 3F44A 3TUJC 2LA4A 5I42A 2FB0A 2FVSA 4R0JA 1UWBA 3US5A 4FF4A 1HR0F 5GADI 4KO0B 2HVIA 5MAOA 3UI3A 4I6YA 2JH3A 2VPZB 4GKKF 4ZVHA 2E1AA 5HMYA 2J76E 1H2UX 4Q44A 4NLYA 3G71S 2LXUA 4XIUA 3CCRS 3RB0A 1HNZF 4TQRA 1DQ8A 5F41A 2OSQA 1SL2A 2HQ3A 3AAWB 4IG3A 3KLGB 4C2MA 4ED3A 1SUQA 4CO1A 3OPKA 2N3LA 1ZM3A 2KYZA 4NPOA 5KOWA 3HHLD 1PC5A 1VQSA 4URQU 4C0BA 2A2CA 4MKYA 1SC6A 4K4XA 5T41A 3B8HA 1Q86T 1MWYA 3GG0A 2UXDF 1OSDA 2BZ2A 3JSBA 3NRBA 5DETA 3FZBA 3KYLA 4DL2A 1NZAA 2FIUA 2DR5A 2E29A 1Y0HA 2PFFB 2B4UA 3VAGA 5I3QA 2XNQA 3G6XA 4OI4A 5J2MA 1CEZA 2MMYA 3I31A 4DV1F 2QT7A 3FFIA 3IC1A 2VD3A 3OL9A 3NS6A 1S6QA 1TKXA 5DJBA 1DTTB 3MM5B 5DS7A 1GX5A 4GMKA 3GIIA 4TY8B 4Y3CA 1V3RA 4TU9A 1FJCA 4WKYA 4RBTA 3PO4A 5KG1A 3X3UA 3KKFA 2O1PA 1RAJA 2UXCF 4JOUA 3TQ1A 3K5OA 4QJVA 2ZHBA 2CZVC 2ASLA 5KT5A 3LP2B 1YHQS 2VFTA 4C8OA 3JSMA 4DSLA 3W2VB 5B0FA 1N5TA 1A7GE 2JLFA 3M2RA 2R4FA 1HI0P 4OX8A 1MWZA 1U26A 3M2VA 3V81B 3CVKA 3OL8A 2M88A 2N4DA 1WEZA 3H59A 4QIVA 5KG2A 1DARA 2R2SA 1J5EF 3RRHA 1OSCA 4HVZA 3TA1A 2NPFA 1N88A 1KN6A 3BEGB 4OI1A 4WU3A 3L7OA 2RS2A 3TVYA 1RTDA 1MW7A 2R2UA 5JXSA 3Q22A 3WZ0A 2KN4A 5F8MA 1HYSA 4NCGB 2WOMB 5FDLB 1RTIA 1E6VA 1X5TA 4BC9A 4FS2A 2B9YA 3M05A 5KFKA 5LSOA 1FXRA 4KV8B 2D3OR 3ZZUA 1HQUA 3EXCX 1IKWA 1Y9OA 3MEKA 3AQPA 1Q53A 2J7UA 2N7CA 2C28A 2RF2A 3PDNA 1BQNA 4ZP7A 3TYTA 2IC3A 4JI1F 4KGMA 4B3MF 4GO5X 5DGBA 2RU9A 4I7FB 2DGWA 3S7RA 3U1LA 5ITHA 5F8HA 3R27A 4X65F 1T3NA 2V4JA 3GG1A 2MGZB 3BB5A 2FGOA 2BVZA 4DV4F 2DNZA 4OHYA 5KAKA 2WRMA 5J2QB 3DLBA 3BSAA 1EP4B 1UMJA 2GHWA 2OH2A 3BDEA 3K5MA 3N4WA 3CB4A 1URNA 1O5JA 3MEGB 1S9GB 3P5TL 5H9FJ 3CXCR 3UWTA 1S4FA 1VK3A 2GO8A 2YKQA 2CQIA 1WELA 2GO9A 2KH9A 3M8PA 5KFTA 4OLPA 1UJ6A 1VC6A 3TRGA 5DDOC 3CE8A 1ZZNA 3OR1A 1CVJA 4ELTA 4GC6A 5HMWA 2Q6CA 1Y00A 2GHPA 2HFOA 3T1AA 1N0UA 1ZOTA 4TLRA 4C98A 2VBZA 2OP5A 3K2YA 3NCQA 4LSNB 4F50A 3U02A 2VG6A 3RYLA 1T95A 1SJRA 4NLPA 3S6EA 2AD9A 1NH8A 1IR0A 3FDSA 5J2QA 2JJ4D 1NNDA 2LDIA 2OPRA 2VC1A 3MMAB 5SZTA 1NK5A 1VRTA 4RW8A 1QAXA 1WHWA 2PE8A 4PWDA 3H5XA 4V19J 2V4RA 1N36F 4I68A 3CJKA 4KHRA 4QWEA 5F8LA 1GH8A 5D6GA 3BO3A 1Q8IA 3HLUA 5CH7B 3NBPB 3VZIA 4I2QA 1Q7LB 2EFVA 2VUGA 4IG3B 3KLGA 2ASDA 4B3TF 1F2GA 2C2RA 4OJ1A 5KT4A 2M7SA 3C66A 3LW5C 1KQGB 3AY0A 3RAQA 1N52B 3CDEA 4ECQA 2AGOA 4KR0B 4PQAA 1ZM2A 2FDNA 4ECSA 3PX6A 3OFEA 4DFJA 2K8GA 1HMVA 1M5OC 1S1WB 1KQSR 2UUCF 1RGVA 2IMWP 3SQGB 1HL6A 1MMNA 3DYAB 4IOAQ 1HQEB 4DFPA 2CG4A 3MCSA 2DGVA 3OQ2A 2MQOA 5JVGQ 3DHWC 5B0CA 1VQ8S 3P3DA 2EI5A 4ELVA 4ZVEA 3UR3C 3GFXA 1U1PA 2DO0A 5KFBA 3QWUA 1N4LA 3DGPA 1GNKA 3IFEA 2VQFF 1TFWA 3PFOA 1HNIA 3GMGA 2KRBA 4LSLB 3TAQA 1F0XA 1YJ9S 3CD7A 4JI3F 4UY85 1ULRA 1AW0A 1LWEA 4Y34A 4TQSA 2DK2A 3CCVS 3ZZRA 3KG1A 3ZZYA 4A8QA 3MECB 2CQCA 2ZOMA 4OX6A 4Y2IA 7FD1A 5DQHA 2BANA 2LECA 4OI2A 2V9WA 4ZK7M 1IQZA 1S1TA 3FEXB 4RUAA 4QBUA 1ZAWA 1HNVB 1DURA 2QRRA 3MM6A 1V9OA 2HWHA 4C8MA 3CMAS 2WAQD 3SFGA 6FD1A 3VAHA 2I1RA 4EU0A 5C42B 2MZQA 4L72B 4MYTA 4WYWA 5F8IA 1FEEA 4NOHA 4M1KA 1X0FA 2X1BA 1M1KT 1UVMA 1K0VA 2XMTA 2XY7A 1X4HA 4KFBB 4WXWA 3VWSA 1JLAB 4I2QB