3UE8A

Kynurenine aminotransferase ii inhibitors
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
427
structure length
410
Chain Sequence
MNYARFITAASAARNPISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 129
structure length 410
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3ue8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3ue8A03
3RCHA 4DGTA 2C44A 2G6WA 1X28A 3GETA 3FFRA 3GZDC 3PJ0A 3AEJC 4F5JA 2JISA 2JGTA 1WSTA 2Z9XA 4R5ZA 2W7JA 3A8UX 2CB1A 2W8TA 1BJOA 1WKHA 2VMPA 3MBBA 4KAMA 4CXRA 2VMZA 5E5IA 4XQ2A 3RCHB 1AHXA 2BWPA 3BC8A 3F0HA 1D2FA 3CAIA 1AY5A 2BI5A 4N0BA 1I41A 2ZY3A 1QJ3A 2WKAA 3I16A 4IW7A 1VJOA 5EUNA 1B5OA 1OHWA 4IYOA 3JZLA 1DFOA 4JEVA 3FKDA 1G7XA 2QB2A 4IXSA 3NU7A 4LW4A 4A6UA 3JU7A 3UWCA 4BHDA 3GJUA 3OKSA 3MAUA 1C7OA 1QISA 1J04A 3QBOA 3LVLB 4IYOB 4UHOA 1WYVB 1ZC9A 1CS1A 1TOGA 1XEYA 2BWNA 3ZZJA 4RAEA 1GEXA 1MDZA 3AOWA 2BYLA 2DGKA 3VAXA 1IVRA 3EI8A 4RM1A 3D6KA 3TCMA 4E3RA 2YRRA 2V0YA 3VK2A 4MQQA 4RJ0A 2DGMA 2D5YA 1D7RA 2AATA 1LW5A 1SZKA 5G4JA 1EQBA 1MAQA 1QJ5A 2CJGA 1WKGA 5LHAA 1QGNA 4MY5A 1LC8A 2VMTA 1JG8A 4UHNA 1C7GA 3E9KA 3EI5A 5HHYA 3RBFA 1YJZA 3NYUA 5DX5A 4OBUA 2ORDA 1O61A 2OGAA 4E1OA 2BI2A 1X0MA 2ZUKA 3K28A 4OC9A 4E77A 2ZY2A 2O1BA 2R2NA 2D7ZA 5DJ1A 2W8JA 3QM2A 3AOVA 2R5CA 4GE9A 4WB0A 2DR1A 5FT8A 4AOAA 1V2DA 3G0TA 1BT4A 1C7NA 2YCPA 3A9XA 1CQ6A 1AKCA 4R8DA 1AIBA 3ELPA 1BJWA 4JEZA 2CJHA 4MKJA 1MLYA 5E4ZA 3B46A 4MSOA 1M7YA 1RVUA 2HUFA 5TF5A 2C81A 3DXVA 1BW0A 3E2ZA 3K7YA 4WBTA 4WB0B 3IF2A 5FT6A 1UU1A 1ORDA 1LC7A 2HUIA 4WLHA 1BQDA 4WYCA 3BB8A 2W7LA 1DTYA 2D65A 3KKIA 5JAYA 4IXZA 1SZSA 2D7YA 2GQNA 2HOYA 4Y0HA 3DZZA 1AMQA 3FQAA 4JEYA 5FT4A 5AX8A 3MAFA 2OKKA 4ZAHA 3WCNA 4F4EA 3EUCA 3QI6A 1BJ4A 3W1JA 1B8GA 4CVQA 1D7VA 1GC3A 1YNUA 3FZ6A 1S06A 1DJ9A 4OBVA 1Z3ZA 2O7CA 1AMSA 3FVUA 1AMRA 2WK7A 1IJIA 2WK8A 1PFFA 1MDXA 2E7JA 1ASNA 3NDNA 3F6TA 2O0RA 1JF9A 1KMKA 3HLMA 3AATA 3QGUA 1TOJA 1AAWA 4ISYA 1X2AA 4WYAA 1D7UA 3UE8A 4WP0A 3FDDA 1I43A 2AY2A 1LK9A 3CQ4A 1YAAA 3CQ6A 3VK4A 3HVYA 4MQRA 4RJYA 5EIGA 3PIUA 4XEWA 1AIAA 2ZSLA 2CH1A 1MAPA 3NX3A 1VEFA 1W23A 1Z7DA 4P3MA 2JJGA 1M0OA 4CXQA 4XJMA 1OATA 1N2TA 4ADEA 3NYTA 2DOUA 1CQ8A 2YKYA 2HUUA 3GBXA 5G09A 2VGWA 2PB0A 1Y4IA 2CINA 4OMAA 2GMSA 2VMSA 4J8LA 1AJRA 4A0FA 4EFFA 3ZZKA 3PDBB 3RBLA 1W7LA 1I29A 4WYEA 4WYGA 1IX6A 2VGZA 2QBTA 3N5MA 4Q6RA 4M2JA 1RVYA 4GE4A 4JF0A 1PMOA 1KL2A 5EQCA 3PPLA 2C0RA 2EGYA 3MKJA 1ASAA 2D66A 4ZDLA 1MGVA 1TASA 1TPLA 3NTJA 5EFSA 2X5DA 4Q31A 1T3IA 4TMRA 4AH3A 1BQAA 3WKRA 3EI6A 3BWNA 4U2HA 2W7KA 2VMOA 5I92A 3HL2A 1BJOB 3ISLA 3VK3A 4A00A 4GDYA 3A9YA 2FQ6A 3LG0A 2HOXA 3MC6C 1AKAA 2E54A 3N0LA 4K2IA 4A72A 2HORA 2TPLA 1JS6A 3ZRRA 4ADCA 3WLXA 4ZM3A 1YJSA 3ATHA 3KGXA 4IXOA 3PD6A 4UHMA 3ZRQA 1AHGA 1TARA 5D95A 1B9IA 1IAYA 4H51A 4U1TA 3KE3A 5EUDA 4W1WA 4KXKA 4OYTA 1OXPA 3NNKA 3EZ1A 4M2MA 5LH9A 1TATA 3AEMA 1AMAA 3B1CA 4ZSWA 5HXXA 4AO9A 1GC2A 3JTXA 4A0GA 3TFTA 3LVKA 3A9ZA 2Q7WA 1BJNA 4I8AA 4QGRA 4F5HA 1M6SA 1B5PA 1OHYA 1O4SA 2Z1YA 5D5SA 4LNLA 4F5GA 4ZWVA 1B4XA 2VI8A 2VIAA 4JEXA 4RKCA 1TOKA 3E2YA 2VGUA 3A2BA 3L8AA 4Q76A 4UQVA 1C9CA 2Z67A 1O62A 1P3WA 5BJ4A 2NMPA 4DQ6A 2BIGA 3MEBA 2X3LA 2EH6A 2F8JA 5M46A 2JJEA 2CJDA 4MQPA 2CY8A 2W7IA 5BJ3A 1GC0A 2VMWA 4R5FA 1GDEA 4PVFA 4B98A 2Z1ZA 3QN6A 3WGBA 2YRIA 4MKKA 4NOGA 4L0OA 3FVSA 4ZWMA 3FSLA 4WYDA 5M4DA 3B1DA 2EZ1A 1OXOA 1X29A 1I48A 3P6KA 4KYOA 3FVXA 1CZEA 3LV2A 5F9SA 2R5CB 1IX7A 2QMAA 2D64A 3USFA 4A6TA 5M4BA 1KKPA 2JJHA 3P1TA 4F5FA 2BYJA 2R0TA 2V1PA 3G8MA 1W3UA 1GC4A 2FYFA 4DBCA 1DJUA 4EB5A 3B8XA 3TFUA 2VI9A 4ITXA 3M5UA 3WGCA 3E2ZB 3BN1A 1QIRA 3EIBA 3HT4A 1AICA 2HP2A 5EUEA 5HDMA 1M0QA 3FCRA 4ADDA 1M4NA 3DODA 5DB5A 5C6UA 1ARIA 1H0CA 4GE7A 8AATA 3ELEA 2ZC0A 2ZSMA 3K40A 5FT5A 3H14A 2ZP7A 1UKJA 4AO4A 3MAFB 3I5TA 5IWQA 4GSAA 3LVJA 4W1XA 5F8VA 1ASDA 4JEWA 1BS0A 2AY3A 1G7WA 4JE5A 1CL1A 3ZRPA 1S0AA 2VMXA 2AEUA 1ARGA 1IUGA 1YOOA 4F5MA 1N8PA 3CQ5A 1EG5A 2PO3A 2D61A 3AELA 3GZDA 1DKAA 3HQTA 3BWOA 3FQ7A 4MGRA 3EIAA 1WYTA 4ZASA 3RUYA 3N75A 4M2KA 1G4XA 2BHXA 3H7FA 1GEYA 2WK9A 4WD2A 1ASMA 1FG3A 1MLZA 1GBNA 2AY7A 3R4TA 4WXFA 2GMUA 4A0RA 5EIGB 1FC4A 1VP4A 4FL0A 1OHVA 3AV7A 1ASGA 1ARHA 1KMJA 2YHKA 3MADA 4W91A 1WYTB 2W7HA 1SZUA 2HOZA 4AZKA 1CJ0A 1O69A 1WYUA 4Y0DA 1CZCA 2OQXA 3WX9A 1XI9A 3ASAA 4EMYA 3AEOA 4F5IA 2VMQA 1DJEA 1ELQA 1EJIA 4A6RA 3QPGA 2W7DA 9AATA 1GEWA 2FNUA 1LS3A 1AJSA 3BCAA 2OKJA 2GB3A 2Z9WA 1WYUB 3QHXA 1ECXA 4Y0IA 3WZFA 3RQ1A 2VMNA 3R9AA 1S07A 1C0NA 3AENA 2YOBA 4OCAA 2HZPA 1AJSB 2VGVA 2Z9VA 1YIZA 1IAXA 1MDOA 1KL1A 1B9HA 3GWPA 4GEBA 3E6GA 4WXGA 4EU1A 5K8BA 1M32A 3BCXA 3IHJA 1JS3A 4W5KA 1AKBA 2YCNA 2QB3A 1ASLA 2QA3A 2VMUA 1QZ9A 3AENB 3PAAA 1J32A 3JWBA 1QITA 3RI6A 4IX8A 5M49A 4ZDPA 4LNMA 1AY4A 4JF1A 2CSTA 3NYSA 3NUBA 4IY7A 4XJOA 4P7YA 2AY5A 1AAMA 2X5FA 2VYCA 2RFVA 3NUIA 4E3QA 4PFNA 2BIAA 5DJ9A 1G4VA 2W7FA 3HBXA 3II0A 3DR4A 3PD6B 4XAUA 3VP6A 2BI9A 1SFFA 2D63A 2X8UA 3FQ8A 1W7NA 2E7IA 1WYVA 2FM1A 2AY9A 3DR7A 1CL2A 4PFFA 5G0AA 2YCTA 3VOMA 4F5LA 1S09A 1PG8A 1M0NA 2VLHA 4W8IA 1FG7A 4BA4A 1ASEA 2EO5A 2XH1A 4W1VA 1AHFA 4RITA 1ZOBA 4HVKA 3COGA 3GR9A 3BCBA 3L44A 3FZ8A 3JW9A 3BWNC 4AZJA 3ACZA 3FZ7A 1C4KA 3UAKA 4ZDOA 2ZJGA 3E2FA 4ATQA 2YKXA 3T32A 4XJLA 2VMRA 4WLJA 2YKVA 4LNJA 2VGTA 1V72A 1YIYA 1SF2A 4ATPA 2FNIA 3OP7A 1V2FA 1RV3A 3DC1A 2VIBA 1ASCA 1ELUA 4K2BA 3TATA 2GSAA 2AY8A 4XJPA 3B1EA 3JWAA 2W7GA 4Q75A 4R2NA 3HMUA 5EAAA 4ZM4A 3DYDA 2DKJA 3PDXA 3BS8A 5E3KA 3AEMC 3I4JA 2BI3A 2OGEA 4LW2A 4XK1A 2ZYJA 1D7SA 7AATA 2R5EA 3WCOA 2YKUA 2AEVA 1TOEA 2CFBA 2Z61A 4RIZA 2HP1A 3NRAA 3FD0A 3LWSA 2C7TA 4N0WA 2W8UA 3G7QA 4WYFA 2FN6A 2CH2A 3LY1A 1GCKA 1AX4A 3PA9A 4F5KA 1S08A 4FFCA 4K2MA 2VLFA 1IX8A 4ZLVA 5G2PA 1SPAA 3E77A 2AY1A 2CTZA 2DKBA 2EPJA 2EZ2A 3EI7A 3F9TA 4RLGA 5G2QA 3W1IA 1LC5A 2VGSA 4BMKA 1ASFA 1AY8A 1PMMA 5J8QA 4HF8A 4PIWA 5EAVA 1UU2A 4WXBA 1DGEA 2PB2A 4A0HA 1AHEA 4ADBA 1ZODA 1E5FA 2W8WA 3EI9A 2QLRA 1YJYA 3DXWA 1KKJA 1GD9A 4TV7A 2VMVA 4CBRA 4CBSA 2BWOA 3AEPA 3FDBA 3DU4A 4O6ZA 2E7UA 2DGLA 3KGWA 3AEJA 1N31A 2JJFA 2W7EA 2AY4A 1E5EA 4ITGA 1AHYA 3GSBA 1V2EA 1UU0A 2BKWA 2JG2A 3PGYA 2W7MA 4B9BA 3CBFA 1W7MA 3LVMA 4OTLA 1ARTA 1IBJA 1U08A 2W8VA 1SVVA 2OATA 2Z9UA 4EB7A 1M0PA 1BKGA 2CANA 3Q8NA 3W1HA 3WKSA 3ASBA 4TN4A 2BI1A 2Z20A 1RV4A 3GZCA 4OT8A 1H1CA 2XBNA 3BV0A 3HDOA 4UOYA 1DGDA 1ASBA 1ARSA 3NU8A 1LW4A 3ECDA 3FTBA 1TOIA 3TQXA 3MC6A 2VMYA 2AY6A 4ZSYA 2BIEA 4RKDA 4BQ0A 3FFHA 3PDBA 3WY7A 3DRDA 4BA5A 1LKCA 4JE5D 3EZSA 2ZY4A 5G4IA 4GRXA 3FRKA 4J5UA 2ZY5A 1CQ7A 4LC3A
chains in the Genus database with same CATH superfamily
3RCHA 4DGTA 2C44A 2G6WA 1X28A 3GETA 3FFRA 3GZDC 3PJ0A 3AEJC 4F5JA 2JISA 2JGTA 1WSTA 2Z9XA 4R5ZA 2W7JA 3A8UX 2CB1A 2W8TA 1BJOA 1WKHA 2VMPA 3MBBA 4KAMA 4CXRA 2VMZA 5E5IA 4XQ2A 3RCHB 1AHXA 2BWPA 3BC8A 3F0HA 1D2FA 3CAIA 1AY5A 2BI5A 4N0BA 1I41A 2ZY3A 1QJ3A 2WKAA 3I16A 4IW7A 1VJOA 5EUNA 1B5OA 1OHWA 4IYOA 3JZLA 1DFOA 4JEVA 3FKDA 1G7XA 2QB2A 4IXSA 3NU7A 4LW4A 4A6UA 3JU7A 3UWCA 4BHDA 3GJUA 3OKSA 2FKIA 3MAUA 1C7OA 1QISA 1J04A 3QBOA 3LVLB 4IYOB 4UHOA 1WYVB 1ZC9A 1CS1A 1TOGA 1XEYA 2BWNA 3ZZJA 4RAEA 1GEXA 1MDZA 3AOWA 2BYLA 2DGKA 3VAXA 1IVRA 3EI8A 4RM1A 3D6KA 3TCMA 4E3RA 2YRRA 2V0YA 3VK2A 4MQQA 4RJ0A 2DGMA 2D5YA 1D7RA 2AATA 1LW5A 1SZKA 5G4JA 1EQBA 1MAQA 1QJ5A 2CJGA 1WKGA 5LHAA 1QGNA 4MY5A 1LC8A 2VMTA 1JG8A 4UHNA 1C7GA 3E9KA 3EI5A 5HHYA 3RBFA 1YJZA 3NYUA 5DX5A 4OBUA 2ORDA 1O61A 2OGAA 4E1OA 2BI2A 1X0MA 2ZUKA 3K28A 4OC9A 4E77A 2ZY2A 2O1BA 2R2NA 2D7ZA 5DJ1A 2W8JA 3QM2A 3AOVA 2R5CA 4GE9A 4WB0A 2DR1A 5FT8A 4AOAA 1V2DA 3G0TA 1BT4A 1C7NA 2YCPA 3A9XA 1CQ6A 1AKCA 4R8DA 1AIBA 3ELPA 1BJWA 4JEZA 2CJHA 4MKJA 1MLYA 5E4ZA 3B46A 4MSOA 1M7YA 1RVUA 2HUFA 5TF5A 2C81A 3DXVA 1BW0A 3E2ZA 3K7YA 4WBTA 4WB0B 3IF2A 5FT6A 1UU1A 1ORDA 1LC7A 2HUIA 4WLHA 1BQDA 4WYCA 3BB8A 2W7LA 2A1VA 1DTYA 2D65A 3KKIA 5JAYA 4IXZA 1SZSA 2D7YA 2GQNA 2HOYA 4Y0HA 3DZZA 1AMQA 3FQAA 4JEYA 5FT4A 5AX8A 3MAFA 2OKKA 4ZAHA 3WCNA 4F4EA 3EUCA 3QI6A 1BJ4A 3W1JA 1B8GA 4CVQA 1D7VA 1GC3A 1YNUA 3FZ6A 1S06A 1DJ9A 4OBVA 1Z3ZA 2O7CA 1AMSA 2KFPA 3FVUA 1AMRA 2WK7A 1IJIA 2WK8A 1PFFA 1MDXA 3N4SA 2E7JA 1ASNA 3NDNA 3N4RA 3F6TA 2O0RA 1JF9A 1KMKA 3HLMA 3AATA 3QGUA 1TOJA 1AAWA 4ISYA 1X2AA 4WYAA 1D7UA 3UE8A 4WP0A 3FDDA 1I43A 2AY2A 1LK9A 3CQ4A 1YAAA 3CQ6A 3VK4A 3HVYA 4MQRA 4RJYA 5EIGA 3PIUA 4XEWA 1AIAA 2ZSLA 2CH1A 1MAPA 3NX3A 1VEFA 1W23A 1Z7DA 4P3MA 2JJGA 1M0OA 4CXQA 4XJMA 1OATA 1N2TA 4ADEA 3NYTA 2DOUA 1CQ8A 2YKYA 2HUUA 3GBXA 5G09A 2VGWA 2PB0A 1Y4IA 2CINA 4OMAA 2GMSA 2VMSA 4J8LA 1AJRA 4A0FA 4EFFA 3ZZKA 3PDBB 3RBLA 1W7LA 1I29A 4WYEA 4WYGA 1IX6A 2VGZA 2QBTA 3N5MA 4Q6RA 4M2JA 1RVYA 4GE4A 4JF0A 1PMOA 1KL2A 5EQCA 3PPLA 2C0RA 2EGYA 3MKJA 1ASAA 2D66A 4ZDLA 1MGVA 1TASA 1TPLA 3NTJA 5EFSA 2X5DA 4Q31A 1T3IA 4TMRA 4AH3A 1BQAA 3WKRA 3EI6A 3BWNA 4U2HA 2W7KA 2VMOA 5I92A 3HL2A 1BJOB 3ISLA 3VK3A 4A00A 4GDYA 3A9YA 2FQ6A 3LG0A 2HOXA 3MC6C 1AKAA 2E54A 3N0LA 4K2IA 4A72A 2HORA 2TPLA 1JS6A 3ZRRA 4ADCA 3WLXA 4ZM3A 1YJSA 3ATHA 3KGXA 4IXOA 3PD6A 4UHMA 3ZRQA 1AHGA 1TARA 5D95A 1B9IA 1IAYA 4H51A 4U1TA 3KE3A 5EUDA 4W1WA 4KXKA 4OYTA 1OXPA 3NNKA 4K05A 3EZ1A 4M2MA 5LH9A 1TATA 3AEMA 1AMAA 3B1CA 4H63Q 4ZSWA 5HXXA 4AO9A 1GC2A 3JTXA 4A0GA 3TFTA 3LVKA 3A9ZA 2Q7WA 1BJNA 4I8AA 4QGRA 4F5HA 1M6SA 1B5PA 1OHYA 1O4SA 2Z1YA 5D5SA 4LNLA 4F5GA 4ZWVA 1B4XA 2VI8A 2VIAA 4JEXA 4RKCA 1TOKA 3E2YA 2VGUA 3A2BA 3L8AA 4Q76A 4UQVA 1C9CA 2Z67A 1O62A 1P3WA 5BJ4A 2NMPA 4DQ6A 2BIGA 3MEBA 2X3LA 2EH6A 2F8JA 5M46A 2JJEA 2CJDA 4MQPA 2CY8A 2W7IA 5BJ3A 1GC0A 2VMWA 4R5FA 1GDEA 4PVFA 4B98A 2Z1ZA 3QN6A 3WGBA 2YRIA 4MKKA 4NOGA 4L0OA 3FVSA 4ZWMA 3FSLA 4WYDA 5M4DA 3B1DA 2EZ1A 1OXOA 1X29A 1I48A 3P6KA 4KYOA 3FVXA 1CZEA 3LV2A 5F9SA 2R5CB 1IX7A 2QMAA 2D64A 3USFA 4A6TA 5M4BA 1KKPA 2JJHA 3P1TA 4F5FA 2BYJA 2R0TA 2V1PA 3G8MA 1W3UA 1GC4A 2FYFA 4DBCA 1DJUA 4EB5A 3B8XA 3TFUA 2VI9A 4ITXA 3M5UA 3WGCA 3E2ZB 3BN1A 1QIRA 3EIBA 3HT4A 1AICA 2HP2A 5EUEA 5HDMA 1M0QA 3FCRA 4ADDA 1M4NA 3DODA 5DB5A 5C6UA 1ARIA 1H0CA 4GE7A 8AATA 3ELEA 2ZC0A 2ZSMA 3K40A 5FT5A 3H14A 2ZP7A 1UKJA 3H9XA 4AO4A 3MAFB 3I5TA 5IWQA 4GSAA 3LVJA 3N4XA 4W1XA 5F8VA 1ASDA 2QSRA 4JEWA 1BS0A 2AY3A 1G7WA 4JE5A 1CL1A 3ZRPA 1S0AA 2VMXA 2AEUA 1ARGA 1IUGA 1YOOA 4F5MA 1N8PA 3CQ5A 1EG5A 2PO3A 2D61A 3AELA 3GZDA 1DKAA 3HQTA 3BWOA 3FQ7A 4MGRA 3EIAA 1WYTA 4ZASA 3RUYA 3N75A 4M2KA 1G4XA 2BHXA 3H7FA 1GEYA 2WK9A 4WD2A 1ASMA 1FG3A 1MLZA 1GBNA 2AY7A 3R4TA 4WXFA 2GMUA 4A0RA 5EIGB 1FC4A 1VP4A 4FL0A 1OHVA 3AV7A 1ASGA 1ARHA 1KMJA 2YHKA 3MADA 4W91A 1WYTB 2W7HA 1SZUA 2HOZA 4AZKA 1CJ0A 1O69A 1WYUA 4Y0DA 1CZCA 2OQXA 3WX9A 1XI9A 3ASAA 4EMYA 3AEOA 4F5IA 2VMQA 1DJEA 1ELQA 1EJIA 4A6RA 3QPGA 2W7DA 9AATA 1GEWA 2FNUA 1LS3A 1AJSA 3BCAA 2OKJA 2GB3A 2Z9WA 1WYUB 3QHXA 1ECXA 4Y0IA 3WZFA 3RQ1A 2VMNA 3R9AA 1S07A 1C0NA 3AENA 2YOBA 4OCAA 2HZPA 1AJSB 2VGVA 2Z9VA 1YIZA 1IAXA 1MDOA 1KL1A 1B9HA 3GWPA 4GEBA 3E6GA 4WXGA 4EU1A 5K8BA 1M32A 3BCXA 3IHJA 1JS3A 4W5KA 1AKBA 2YCNA 2QB3A 1ASLA 2QA3A 2VMUA 1QZ9A 3AENB 3PAAA 1J32A 3JWBA 1QITA 3RI6A 4IX8A 5M49A 4ZDPA 4LNMA 1AY4A 4JF1A 2CSTA 3NYSA 3NUBA 4IY7A 4XJOA 4P7YA 2AY5A 1AAMA 2X5FA 5KTBA 2VYCA 2RFVA 3NUIA 4E3QA 4PFNA 2BIAA 5DJ9A 1G4VA 2W7FA 3HBXA 3II0A 3DR4A 3PD6B 4XAUA 3VP6A 2BI9A 1SFFA 2D63A 2X8UA 3FQ8A 1W7NA 2E7IA 1WYVA 2FM1A 2AY9A 3DR7A 1CL2A 4PFFA 5G0AA 2YCTA 3VOMA 4F5LA 1S09A 1PG8A 1M0NA 2VLHA 4W8IA 1FG7A 4BA4A 1ASEA 2EO5A 2XH1A 4W1VA 1AHFA 4RITA 1ZOBA 4HVKA 3COGA 3GR9A 3BCBA 3L44A 3FZ8A 3JW9A 3BWNC 4AZJA 3ACZA 3FZ7A 1C4KA 3UAKA 4ZDOA 2ZJGA 3E2FA 4ATQA 2YKXA 3T32A 4XJLA 2VMRA 4WLJA 2YKVA 4LNJA 3N7NA 2VGTA 1V72A 1YIYA 1SF2A 4ATPA 2FNIA 3OP7A 1V2FA 1RV3A 3DC1A 2VIBA 1ASCA 1ELUA 4K2BA 3TATA 2GSAA 2AY8A 4XJPA 3B1EA 3JWAA 2W7GA 4Q75A 4R2NA 3HMUA 5EAAA 4ZM4A 3DYDA 2DKJA 3PDXA 3BS8A 5E3KA 3AEMC 3I4JA 2BI3A 2OGEA 4LW2A 4XK1A 2ZYJA 1D7SA 7AATA 2R5EA 3WCOA 2YKUA 2AEVA 1TOEA 2CFBA 2Z61A 4RIZA 2HP1A 3NRAA 3FD0A 3LWSA 2C7TA 4N0WA 2W8UA 3G7QA 4WYFA 2FN6A 2CH2A 3LY1A 1GCKA 1AX4A 2G7JA 3PA9A 4F5KA 1S08A 4FFCA 4K2MA 2VLFA 1IX8A 4ZLVA 5G2PA 1SPAA 3E77A 2AY1A 2CTZA 2DKBA 2EPJA 2EZ2A 3EI7A 3F9TA 4RLGA 5G2QA 3W1IA 1LC5A 2VGSA 4BMKA 1ASFA 1AY8A 1PMMA 5J8QA 4HF8A 4PIWA 5EAVA 1UU2A 4WXBA 1DGEA 2PB2A 4A0HA 1AHEA 4ADBA 2EYQA 1ZODA 1E5FA 2W8WA 3EI9A 2QLRA 1YJYA 3DXWA 1KKJA 1GD9A 4TV7A 2VMVA 4CBRA 4CBSA 2BWOA 3AEPA 3FDBA 2WB6A 3DU4A 4O6ZA 2E7UA 2DGLA 3KGWA 3AEJA 1N31A 2JJFA 2W7EA 2AY4A 1E5EA 4ITGA 1AHYA 3GSBA 1V2EA 1UU0A 2BKWA 2JG2A 3PGYA 2W7MA 1KAFA 4B9BA 3CBFA 1W7MA 3LVMA 4OTLA 1ARTA 1IBJA 1U08A 2W8VA 1SVVA 2OATA 2Z9UA 4EB7A 1M0PA 1BKGA 2CANA 3Q8NA 3W1HA 3WKSA 3ASBA 4TN4A 2BI1A 2Z20A 1RV4A 3GZCA 4OT8A 1H1CA 2XBNA 3BV0A 3HDOA 4UOYA 1DGDA 1ASBA 1ARSA 3NU8A 1LW4A 3ECDA 3FTBA 1TOIA 3TQXA 3MC6A 2VMYA 2AY6A 4ZSYA 2BIEA 4RKDA 4BQ0A 3FFHA 3PDBA 3WY7A 3DRDA 4BA5A 1LKCA 4JE5D 3EZSA 2ZY4A 5G4IA 4GRXA 3FRKA 4J5UA 2ZY5A 1CQ7A 4LC3A
chains in the Genus database with same CATH topology
3RCHA 4DGTA 2C44A 2G6WA 1X28A 3GETA 3FFRA 3GZDC 3PJ0A 3AEJC 4F5JA 2JISA 2JGTA 1WSTA 2Z9XA 4R5ZA 2W7JA 3A8UX 2CB1A 2W8TA 1BJOA 1WKHA 2VMPA 3MBBA 4KAMA 4CXRA 2VMZA 5E5IA 4XQ2A 3RCHB 1AHXA 2BWPA 3BC8A 3F0HA 1D2FA 3CAIA 1AY5A 2BI5A 4N0BA 1I41A 2ZY3A 1QJ3A 2WKAA 3I16A 4IW7A 1VJOA 5EUNA 1B5OA 1OHWA 4IYOA 3JZLA 1DFOA 4JEVA 3FKDA 1G7XA 2QB2A 4IXSA 3NU7A 4LW4A 4A6UA 3JU7A 3UWCA 4BHDA 3GJUA 3OKSA 2FKIA 3MAUA 1C7OA 1QISA 1J04A 3QBOA 3LVLB 4IYOB 4UHOA 1WYVB 1ZC9A 1CS1A 1TOGA 1XEYA 2BWNA 3ZZJA 4RAEA 1GEXA 1MDZA 3AOWA 2BYLA 2DGKA 3VAXA 1IVRA 3EI8A 4RM1A 3D6KA 3TCMA 4E3RA 2YRRA 2V0YA 3VK2A 4MQQA 4RJ0A 2DGMA 2D5YA 1D7RA 2AATA 1LW5A 1SZKA 5G4JA 1EQBA 1MAQA 1QJ5A 2CJGA 1WKGA 5LHAA 1QGNA 4MY5A 1LC8A 2VMTA 1JG8A 4UHNA 1C7GA 3E9KA 3EI5A 5HHYA 3RBFA 1YJZA 3NYUA 5DX5A 4OBUA 2ORDA 1O61A 2OGAA 4E1OA 2BI2A 1X0MA 2ZUKA 3K28A 4OC9A 4E77A 2ZY2A 2O1BA 2R2NA 2D7ZA 5DJ1A 2W8JA 3QM2A 3AOVA 2R5CA 4GE9A 4WB0A 2DR1A 5FT8A 4AOAA 1V2DA 3G0TA 1BT4A 1C7NA 2YCPA 3A9XA 1CQ6A 1AKCA 4R8DA 1AIBA 3ELPA 1BJWA 4JEZA 2CJHA 4MKJA 1MLYA 5E4ZA 3B46A 4MSOA 1M7YA 1RVUA 2HUFA 5TF5A 2C81A 3DXVA 1BW0A 3E2ZA 3K7YA 4WBTA 4WB0B 3IF2A 5FT6A 1UU1A 1ORDA 1LC7A 2HUIA 4WLHA 1BQDA 4WYCA 3BB8A 2W7LA 2A1VA 1DTYA 2D65A 3KKIA 5JAYA 4IXZA 1SZSA 2D7YA 2GQNA 2HOYA 4Y0HA 3DZZA 1AMQA 3FQAA 4JEYA 5FT4A 5AX8A 3MAFA 2OKKA 4ZAHA 3WCNA 4F4EA 3EUCA 3QI6A 1BJ4A 3W1JA 1B8GA 4CVQA 1D7VA 1GC3A 1YNUA 3FZ6A 1S06A 1DJ9A 4OBVA 1Z3ZA 2O7CA 1AMSA 2KFPA 3FVUA 1AMRA 2WK7A 1IJIA 2WK8A 1PFFA 1MDXA 3N4SA 2E7JA 1ASNA 3NDNA 3N4RA 3F6TA 2O0RA 1JF9A 1KMKA 3HLMA 3AATA 3QGUA 1TOJA 1AAWA 4ISYA 1X2AA 4WYAA 1D7UA 3UE8A 4WP0A 3FDDA 1I43A 2AY2A 1LK9A 3CQ4A 1YAAA 3CQ6A 3VK4A 3HVYA 4MQRA 4RJYA 5EIGA 3PIUA 4XEWA 1AIAA 2ZSLA 2CH1A 1MAPA 3NX3A 1VEFA 1W23A 1Z7DA 4P3MA 2JJGA 1M0OA 4CXQA 4XJMA 1OATA 1N2TA 4ADEA 3NYTA 2DOUA 1CQ8A 2YKYA 2HUUA 3GBXA 5G09A 2VGWA 2PB0A 1Y4IA 2CINA 4OMAA 2GMSA 2VMSA 4J8LA 1AJRA 4A0FA 4EFFA 3ZZKA 3PDBB 3RBLA 1W7LA 1I29A 4WYEA 4WYGA 1IX6A 2VGZA 2QBTA 3N5MA 4Q6RA 4M2JA 1RVYA 4GE4A 4JF0A 1PMOA 1KL2A 5EQCA 3PPLA 2C0RA 2EGYA 3MKJA 1ASAA 2D66A 4ZDLA 1MGVA 1TASA 1TPLA 3NTJA 5EFSA 2X5DA 4Q31A 1T3IA 4TMRA 4AH3A 1BQAA 3WKRA 3EI6A 3BWNA 4U2HA 2W7KA 2VMOA 5I92A 3HL2A 1BJOB 3ISLA 3VK3A 4A00A 4GDYA 3A9YA 2FQ6A 3LG0A 2HOXA 3MC6C 1AKAA 2E54A 3N0LA 4K2IA 4A72A 2HORA 2TPLA 1JS6A 3ZRRA 4ADCA 3WLXA 4ZM3A 1YJSA 3ATHA 3KGXA 4IXOA 3PD6A 4UHMA 3ZRQA 1AHGA 1TARA 5D95A 1B9IA 1IAYA 4H51A 4U1TA 3KE3A 5EUDA 4W1WA 4KXKA 4OYTA 1OXPA 3NNKA 4K05A 3EZ1A 4M2MA 5LH9A 1TATA 3AEMA 1AMAA 3B1CA 4H63Q 4ZSWA 5HXXA 4AO9A 1GC2A 3JTXA 4A0GA 3TFTA 3LVKA 3A9ZA 2Q7WA 1BJNA 4I8AA 4QGRA 4F5HA 1M6SA 1B5PA 1OHYA 1O4SA 2Z1YA 5D5SA 4LNLA 4F5GA 4ZWVA 1B4XA 2VI8A 2VIAA 4JEXA 4RKCA 1TOKA 3E2YA 2VGUA 3A2BA 3L8AA 4Q76A 4UQVA 1C9CA 2Z67A 1O62A 1P3WA 5BJ4A 2NMPA 4DQ6A 2BIGA 3MEBA 2X3LA 2EH6A 2F8JA 5M46A 2JJEA 2CJDA 4MQPA 2CY8A 2W7IA 5BJ3A 1GC0A 2VMWA 4R5FA 1GDEA 4PVFA 4B98A 2Z1ZA 3QN6A 3WGBA 2YRIA 4MKKA 4NOGA 4L0OA 3FVSA 4ZWMA 3FSLA 4WYDA 5M4DA 3B1DA 2EZ1A 1OXOA 1X29A 1I48A 3P6KA 4KYOA 3FVXA 1CZEA 3LV2A 5F9SA 2R5CB 1IX7A 2QMAA 2D64A 3USFA 4A6TA 5M4BA 1KKPA 2JJHA 3P1TA 4F5FA 2BYJA 2R0TA 2V1PA 3G8MA 1W3UA 1GC4A 2FYFA 4DBCA 1DJUA 4EB5A 3B8XA 3TFUA 2VI9A 4ITXA 3M5UA 3WGCA 3E2ZB 3BN1A 1QIRA 3EIBA 3HT4A 1AICA 2HP2A 5EUEA 5HDMA 1M0QA 3FCRA 4ADDA 1M4NA 3DODA 5DB5A 5C6UA 1ARIA 1H0CA 4GE7A 8AATA 3ELEA 2ZC0A 2ZSMA 3K40A 5FT5A 3H14A 2ZP7A 1UKJA 3H9XA 4AO4A 3MAFB 3I5TA 5IWQA 4GSAA 3LVJA 3N4XA 4W1XA 5F8VA 1ASDA 2QSRA 4JEWA 1BS0A 2AY3A 1G7WA 4JE5A 1CL1A 3ZRPA 1S0AA 2VMXA 2AEUA 1ARGA 1IUGA 1YOOA 4F5MA 1N8PA 3CQ5A 1EG5A 2PO3A 2D61A 3AELA 3GZDA 1DKAA 3HQTA 3BWOA 3FQ7A 4MGRA 3EIAA 1WYTA 4ZASA 3RUYA 3N75A 4M2KA 1G4XA 2BHXA 3H7FA 1GEYA 2WK9A 4WD2A 1ASMA 1FG3A 1MLZA 1GBNA 2AY7A 3R4TA 4WXFA 2GMUA 4A0RA 5EIGB 1FC4A 1VP4A 4FL0A 1OHVA 3AV7A 1ASGA 1ARHA 1KMJA 2YHKA 3MADA 4W91A 1WYTB 2W7HA 1SZUA 2HOZA 4AZKA 1CJ0A 1O69A 1WYUA 4Y0DA 1CZCA 2OQXA 3WX9A 1XI9A 3ASAA 4EMYA 3AEOA 4F5IA 2VMQA 1DJEA 1ELQA 1EJIA 4A6RA 3QPGA 2W7DA 9AATA 1GEWA 2FNUA 1LS3A 1AJSA 3BCAA 2OKJA 2GB3A 2Z9WA 1WYUB 3QHXA 1ECXA 4Y0IA 3WZFA 3RQ1A 2VMNA 3R9AA 1S07A 1C0NA 3AENA 2YOBA 4OCAA 2HZPA 1AJSB 2VGVA 2Z9VA 1YIZA 1IAXA 1MDOA 1KL1A 1B9HA 3GWPA 4GEBA 3E6GA 4WXGA 4EU1A 5K8BA 1M32A 3BCXA 3IHJA 1JS3A 4W5KA 1AKBA 2YCNA 2QB3A 1ASLA 2QA3A 2VMUA 1QZ9A 3AENB 3PAAA 1J32A 3JWBA 1QITA 3RI6A 4IX8A 5M49A 4ZDPA 4LNMA 1AY4A 4JF1A 2CSTA 3NYSA 3NUBA 4IY7A 4XJOA 4P7YA 2AY5A 1AAMA 2X5FA 5KTBA 2VYCA 2RFVA 3NUIA 4E3QA 4PFNA 2BIAA 5DJ9A 1G4VA 2W7FA 3HBXA 3II0A 3DR4A 3PD6B 4XAUA 3VP6A 2BI9A 1SFFA 2D63A 2X8UA 3FQ8A 1W7NA 2E7IA 1WYVA 2FM1A 2AY9A 3DR7A 1CL2A 4PFFA 5G0AA 2YCTA 3VOMA 4F5LA 1S09A 1PG8A 1M0NA 2VLHA 4W8IA 1FG7A 4BA4A 1ASEA 2EO5A 2XH1A 4W1VA 1AHFA 4RITA 1ZOBA 4HVKA 3COGA 3GR9A 3BCBA 3L44A 3FZ8A 3JW9A 3BWNC 4AZJA 3ACZA 3FZ7A 1C4KA 3UAKA 4ZDOA 2ZJGA 3E2FA 4ATQA 2YKXA 3T32A 4XJLA 2VMRA 4WLJA 2YKVA 4LNJA 3N7NA 2VGTA 1V72A 1YIYA 1SF2A 4ATPA 2FNIA 3OP7A 1V2FA 1RV3A 3DC1A 2VIBA 1ASCA 1ELUA 4K2BA 3TATA 2GSAA 2AY8A 4XJPA 3B1EA 3JWAA 2W7GA 4Q75A 4R2NA 3HMUA 5EAAA 4ZM4A 3DYDA 2DKJA 3PDXA 3BS8A 5E3KA 3AEMC 3I4JA 2BI3A 2OGEA 4LW2A 4XK1A 2ZYJA 1D7SA 7AATA 2R5EA 3WCOA 2YKUA 2AEVA 1TOEA 2CFBA 2Z61A 4RIZA 2HP1A 3NRAA 3FD0A 3LWSA 2C7TA 4N0WA 2W8UA 3G7QA 4WYFA 2FN6A 2CH2A 3LY1A 1GCKA 1AX4A 2G7JA 3PA9A 4F5KA 1S08A 4FFCA 4K2MA 2VLFA 1IX8A 4ZLVA 5G2PA 1SPAA 3E77A 2AY1A 2CTZA 2DKBA 2EPJA 2EZ2A 3EI7A 3F9TA 4RLGA 5G2QA 3W1IA 1LC5A 2VGSA 4BMKA 1ASFA 1AY8A 1PMMA 5J8QA 4HF8A 4PIWA 5EAVA 1UU2A 4WXBA 1DGEA 2PB2A 4A0HA 1AHEA 4ADBA 2EYQA 1ZODA 1E5FA 2W8WA 3EI9A 2QLRA 1YJYA 3DXWA 1KKJA 1GD9A 4TV7A 2VMVA 4CBRA 4CBSA 2BWOA 3AEPA 3FDBA 2WB6A 3DU4A 4O6ZA 2E7UA 2DGLA 3KGWA 3AEJA 1N31A 2JJFA 2W7EA 2AY4A 1E5EA 4ITGA 1AHYA 3GSBA 1V2EA 1UU0A 2BKWA 2JG2A 3PGYA 2W7MA 4B9BA 3CBFA 1W7MA 3LVMA 4OTLA 1ARTA 1IBJA 1U08A 2W8VA 1SVVA 2OATA 2Z9UA 4EB7A 1M0PA 1BKGA 2CANA 3Q8NA 3W1HA 3WKSA 3ASBA 4TN4A 2BI1A 2Z20A 1RV4A 3GZCA 4OT8A 1H1CA 2XBNA 3BV0A 3HDOA 4UOYA 1DGDA 1ASBA 1ARSA 3NU8A 1LW4A 3ECDA 3FTBA 1TOIA 3TQXA 3MC6A 2VMYA 2AY6A 4ZSYA 2BIEA 4RKDA 4BQ0A 3FFHA 3PDBA 3WY7A 3DRDA 4BA5A 1LKCA 4JE5D 3EZSA 2ZY4A 5G4IA 4GRXA 3FRKA 4J5UA 2ZY5A 1CQ7A 4LC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCH A;  4DGT A;  2C44 A;  2G6W A;  1X28 A;  3GET A;  3FFR A;  3GZD C;  3PJ0 A;  3AEJ C;  4F5J A;  2JIS A;  2JGT A;  1WST A;  2Z9X A;  4R5Z A;  2W7J A;  3A8U X;  2CB1 A;  2W8T A;  1BJO A;  1WKH A;  2VMP A;  3MBB A;  4KAM A;  4CXR A;  2VMZ A;  5E5I A;  4XQ2 A;  3RCH B;  1AHX A;  2BWP A;  3BC8 A;  3F0H A;  1D2F A;  3CAI A;  1AY5 A;  2BI5 A;  4N0B A;  1I41 A;  2ZY3 A;  1QJ3 A;  2WKA A;  3I16 A;  4IW7 A;  1VJO A;  5EUN A;  1B5O A;  1OHW A;  4IYO A;  3JZL A;  1DFO A;  4JEV A;  3FKD A;  1G7X A;  2QB2 A;  4IXS A;  3NU7 A;  4LW4 A;  4A6U A;  3JU7 A;  3UWC A;  4BHD A;  3GJU A;  3OKS A;  3MAU A;  1C7O A;  1QIS A;  1J04 A;  3QBO A;  3LVL B;  4IYO B;  4UHO A;  1WYV B;  1ZC9 A;  1CS1 A;  1TOG A;  1XEY A;  2BWN A;  3ZZJ A;  4RAE A;  1GEX A;  1MDZ A;  3AOW A;  2BYL A;  2DGK A;  3VAX A;  1IVR A;  3EI8 A;  4RM1 A;  3D6K A;  3TCM A;  4E3R A;  2YRR A;  2V0Y A;  3VK2 A;  4MQQ A;  4RJ0 A;  2DGM A;  2D5Y A;  1D7R A;  2AAT A;  1LW5 A;  1SZK A;  5G4J A;  1EQB A;  1MAQ A;  1QJ5 A;  2CJG A;  1WKG A;  5LHA A;  1QGN A;  4MY5 A;  1LC8 A;  2VMT A;  1JG8 A;  4UHN A;  1C7G A;  3E9K A;  3EI5 A;  5HHY A;  3RBF A;  1YJZ A;  3NYU A;  5DX5 A;  4OBU A;  2ORD A;  1O61 A;  2OGA A;  4E1O A;  2BI2 A;  1X0M A;  2ZUK A;  3K28 A;  4OC9 A;  4E77 A;  2ZY2 A;  2O1B A;  2R2N A;  2D7Z A;  5DJ1 A;  2W8J A;  3QM2 A;  3AOV A;  2R5C A;  4GE9 A;  4WB0 A;  2DR1 A;  5FT8 A;  4AOA A;  1V2D A;  3G0T A;  1BT4 A;  1C7N A;  2YCP A;  3A9X A;  1CQ6 A;  1AKC A;  4R8D A;  1AIB A;  3ELP A;  1BJW A;  4JEZ A;  2CJH A;  4MKJ A;  1MLY A;  5E4Z A;  3B46 A;  4MSO A;  1M7Y A;  1RVU A;  2HUF A;  5TF5 A;  2C81 A;  3DXV A;  1BW0 A;  3E2Z A;  3K7Y A;  4WBT A;  4WB0 B;  3IF2 A;  5FT6 A;  1UU1 A;  1ORD A;  1LC7 A;  2HUI A;  4WLH A;  1BQD A;  4WYC A;  3BB8 A;  2W7L A;  1DTY A;  2D65 A;  3KKI A;  5JAY A;  4IXZ A;  1SZS A;  2D7Y A;  2GQN A;  2HOY A;  4Y0H A;  3DZZ A;  1AMQ A;  3FQA A;  4JEY A;  5FT4 A;  5AX8 A;  3MAF A;  2OKK A;  4ZAH A;  3WCN A;  4F4E A;  3EUC A;  3QI6 A;  1BJ4 A;  3W1J A;  1B8G A;  4CVQ A;  1D7V A;  1GC3 A;  1YNU A;  3FZ6 A;  1S06 A;  1DJ9 A;  4OBV A;  1Z3Z A;  2O7C A;  1AMS A;  3FVU A;  1AMR A;  2WK7 A;  1IJI A;  2WK8 A;  1PFF A;  1MDX A;  2E7J A;  1ASN A;  3NDN A;  3F6T A;  2O0R A;  1JF9 A;  1KMK A;  3HLM A;  3AAT A;  3QGU A;  1TOJ A;  1AAW A;  4ISY A;  1X2A A;  4WYA A;  1D7U A;  3UE8 A;  4WP0 A;  3FDD A;  1I43 A;  2AY2 A;  1LK9 A;  3CQ4 A;  1YAA A;  3CQ6 A;  3VK4 A;  3HVY A;  4MQR A;  4RJY A;  5EIG A;  3PIU A;  4XEW A;  1AIA A;  2ZSL A;  2CH1 A;  1MAP A;  3NX3 A;  1VEF A;  1W23 A;  1Z7D A;  4P3M A;  2JJG A;  1M0O A;  4CXQ A;  4XJM A;  1OAT A;  1N2T A;  4ADE A;  3NYT A;  2DOU A;  1CQ8 A;  2YKY A;  2HUU A;  3GBX A;  5G09 A;  2VGW A;  2PB0 A;  1Y4I A;  2CIN A;  4OMA A;  2GMS A;  2VMS A;  4J8L A;  1AJR A;  4A0F A;  4EFF A;  3ZZK A;  3PDB B;  3RBL A;  1W7L A;  1I29 A;  4WYE A;  4WYG A;  1IX6 A;  2VGZ A;  2QBT A;  3N5M A;  4Q6R A;  4M2J A;  1RVY A;  4GE4 A;  4JF0 A;  1PMO A;  1KL2 A;  5EQC A;  3PPL A;  2C0R A;  2EGY A;  3MKJ A;  1ASA A;  2D66 A;  4ZDL A;  1MGV A;  1TAS A;  1TPL A;  3NTJ A;  5EFS A;  2X5D A;  4Q31 A;  1T3I A;  4TMR A;  4AH3 A;  1BQA A;  3WKR A;  3EI6 A;  3BWN A;  4U2H A;  2W7K A;  2VMO A;  5I92 A;  3HL2 A;  1BJO B;  3ISL A;  3VK3 A;  4A00 A;  4GDY A;  3A9Y A;  2FQ6 A;  3LG0 A;  2HOX A;  3MC6 C;  1AKA A;  2E54 A;  3N0L A;  4K2I A;  4A72 A;  2HOR A;  2TPL A;  1JS6 A;  3ZRR A;  4ADC A;  3WLX A;  4ZM3 A;  1YJS A;  3ATH A;  3KGX A;  4IXO A;  3PD6 A;  4UHM A;  3ZRQ A;  1AHG A;  1TAR A;  5D95 A;  1B9I A;  1IAY A;  4H51 A;  4U1T A;  3KE3 A;  5EUD A;  4W1W A;  4KXK A;  4OYT A;  1OXP A;  3NNK A;  3EZ1 A;  4M2M A;  5LH9 A;  1TAT A;  3AEM A;  1AMA A;  3B1C A;  4ZSW A;  5HXX A;  4AO9 A;  1GC2 A;  3JTX A;  4A0G A;  3TFT A;  3LVK A;  3A9Z A;  2Q7W A;  1BJN A;  4I8A A;  4QGR A;  4F5H A;  1M6S A;  1B5P A;  1OHY A;  1O4S A;  2Z1Y A;  5D5S A;  4LNL A;  4F5G A;  4ZWV A;  1B4X A;  2VI8 A;  2VIA A;  4JEX A;  4RKC A;  1TOK A;  3E2Y A;  2VGU A;  3A2B A;  3L8A A;  4Q76 A;  4UQV A;  1C9C A;  2Z67 A;  1O62 A;  1P3W A;  5BJ4 A;  2NMP A;  4DQ6 A;  2BIG A;  3MEB A;  2X3L A;  2EH6 A;  2F8J A;  5M46 A;  2JJE A;  2CJD A;  4MQP A;  2CY8 A;  2W7I A;  5BJ3 A;  1GC0 A;  2VMW A;  4R5F A;  1GDE A;  4PVF A;  4B98 A;  2Z1Z A;  3QN6 A;  3WGB A;  2YRI A;  4MKK A;  4NOG A;  4L0O A;  3FVS A;  4ZWM A;  3FSL A;  4WYD A;  5M4D A;  3B1D A;  2EZ1 A;  1OXO A;  1X29 A;  1I48 A;  3P6K A;  4KYO A;  3FVX A;  1CZE A;  3LV2 A;  5F9S A;  2R5C B;  1IX7 A;  2QMA A;  2D64 A;  3USF A;  4A6T A;  5M4B A;  1KKP A;  2JJH A;  3P1T A;  4F5F A;  2BYJ A;  2R0T A;  2V1P A;  3G8M A;  1W3U A;  1GC4 A;  2FYF A;  4DBC A;  1DJU A;  4EB5 A;  3B8X A;  3TFU A;  2VI9 A;  4ITX A;  3M5U A;  3WGC A;  3E2Z B;  3BN1 A;  1QIR A;  3EIB A;  3HT4 A;  1AIC A;  2HP2 A;  5EUE A;  5HDM A;  1M0Q A;  3FCR A;  4ADD A;  1M4N A;  3DOD A;  5DB5 A;  5C6U A;  1ARI A;  1H0C A;  4GE7 A;  8AAT A;  3ELE A;  2ZC0 A;  2ZSM A;  3K40 A;  5FT5 A;  3H14 A;  2ZP7 A;  1UKJ A;  4AO4 A;  3MAF B;  3I5T A;  5IWQ A;  4GSA A;  3LVJ A;  4W1X A;  5F8V A;  1ASD A;  4JEW A;  1BS0 A;  2AY3 A;  1G7W A;  4JE5 A;  1CL1 A;  3ZRP A;  1S0A A;  2VMX A;  2AEU A;  1ARG A;  1IUG A;  1YOO A;  4F5M A;  1N8P A;  3CQ5 A;  1EG5 A;  2PO3 A;  2D61 A;  3AEL A;  3GZD A;  1DKA A;  3HQT A;  3BWO A;  3FQ7 A;  4MGR A;  3EIA A;  1WYT A;  4ZAS A;  3RUY A;  3N75 A;  4M2K A;  1G4X A;  2BHX A;  3H7F A;  1GEY A;  2WK9 A;  4WD2 A;  1ASM A;  1FG3 A;  1MLZ A;  1GBN A;  2AY7 A;  3R4T A;  4WXF A;  2GMU A;  4A0R A;  5EIG B;  1FC4 A;  1VP4 A;  4FL0 A;  1OHV A;  3AV7 A;  1ASG A;  1ARH A;  1KMJ A;  2YHK A;  3MAD A;  4W91 A;  1WYT B;  2W7H A;  1SZU A;  2HOZ A;  4AZK A;  1CJ0 A;  1O69 A;  1WYU A;  4Y0D A;  1CZC A;  2OQX A;  3WX9 A;  1XI9 A;  3ASA A;  4EMY A;  3AEO A;  4F5I A;  2VMQ A;  1DJE A;  1ELQ A;  1EJI A;  4A6R A;  3QPG A;  2W7D A;  9AAT A;  1GEW A;  2FNU A;  1LS3 A;  1AJS A;  3BCA A;  2OKJ A;  2GB3 A;  2Z9W A;  1WYU B;  3QHX A;  1ECX A;  4Y0I A;  3WZF A;  3RQ1 A;  2VMN A;  3R9A A;  1S07 A;  1C0N A;  3AEN A;  2YOB A;  4OCA A;  2HZP A;  1AJS B;  2VGV A;  2Z9V A;  1YIZ A;  1IAX A;  1MDO A;  1KL1 A;  1B9H A;  3GWP A;  4GEB A;  3E6G A;  4WXG A;  4EU1 A;  5K8B A;  1M32 A;  3BCX A;  3IHJ A;  1JS3 A;  4W5K A;  1AKB A;  2YCN A;  2QB3 A;  1ASL A;  2QA3 A;  2VMU A;  1QZ9 A;  3AEN B;  3PAA A;  1J32 A;  3JWB A;  1QIT A;  3RI6 A;  4IX8 A;  5M49 A;  4ZDP A;  4LNM A;  1AY4 A;  4JF1 A;  2CST A;  3NYS A;  3NUB A;  4IY7 A;  4XJO A;  4P7Y A;  2AY5 A;  1AAM A;  2X5F A;  2VYC A;  2RFV A;  3NUI A;  4E3Q A;  4PFN A;  2BIA A;  5DJ9 A;  1G4V A;  2W7F A;  3HBX A;  3II0 A;  3DR4 A;  3PD6 B;  4XAU A;  3VP6 A;  2BI9 A;  1SFF A;  2D63 A;  2X8U A;  3FQ8 A;  1W7N A;  2E7I A;  1WYV A;  2FM1 A;  2AY9 A;  3DR7 A;  1CL2 A;  4PFF A;  5G0A A;  2YCT A;  3VOM A;  4F5L A;  1S09 A;  1PG8 A;  1M0N A;  2VLH A;  4W8I A;  1FG7 A;  4BA4 A;  1ASE A;  2EO5 A;  2XH1 A;  4W1V A;  1AHF A;  4RIT A;  1ZOB A;  4HVK A;  3COG A;  3GR9 A;  3BCB A;  3L44 A;  3FZ8 A;  3JW9 A;  3BWN C;  4AZJ A;  3ACZ A;  3FZ7 A;  1C4K A;  3UAK A;  4ZDO A;  2ZJG A;  3E2F A;  4ATQ A;  2YKX A;  3T32 A;  4XJL A;  2VMR A;  4WLJ A;  2YKV A;  4LNJ A;  2VGT A;  1V72 A;  1YIY A;  1SF2 A;  4ATP A;  2FNI A;  3OP7 A;  1V2F A;  1RV3 A;  3DC1 A;  2VIB A;  1ASC A;  1ELU A;  4K2B A;  3TAT A;  2GSA A;  2AY8 A;  4XJP A;  3B1E A;  3JWA A;  2W7G A;  4Q75 A;  4R2N A;  3HMU A;  5EAA A;  4ZM4 A;  3DYD A;  2DKJ A;  3PDX A;  3BS8 A;  5E3K A;  3AEM C;  3I4J A;  2BI3 A;  2OGE A;  4LW2 A;  4XK1 A;  2ZYJ A;  1D7S A;  7AAT A;  2R5E A;  3WCO A;  2YKU A;  2AEV A;  1TOE A;  2CFB A;  2Z61 A;  4RIZ A;  2HP1 A;  3NRA A;  3FD0 A;  3LWS A;  2C7T A;  4N0W A;  2W8U A;  3G7Q A;  4WYF A;  2FN6 A;  2CH2 A;  3LY1 A;  1GCK A;  1AX4 A;  3PA9 A;  4F5K A;  1S08 A;  4FFC A;  4K2M A;  2VLF A;  1IX8 A;  4ZLV A;  5G2P A;  1SPA A;  3E77 A;  2AY1 A;  2CTZ A;  2DKB A;  2EPJ A;  2EZ2 A;  3EI7 A;  3F9T A;  4RLG A;  5G2Q A;  3W1I A;  1LC5 A;  2VGS A;  4BMK A;  1ASF A;  1AY8 A;  1PMM A;  5J8Q A;  4HF8 A;  4PIW A;  5EAV A;  1UU2 A;  4WXB A;  1DGE A;  2PB2 A;  4A0H A;  1AHE A;  4ADB A;  1ZOD A;  1E5F A;  2W8W A;  3EI9 A;  2QLR A;  1YJY A;  3DXW A;  1KKJ A;  1GD9 A;  4TV7 A;  2VMV A;  4CBR A;  4CBS A;  2BWO A;  3AEP A;  3FDB A;  3DU4 A;  4O6Z A;  2E7U A;  2DGL A;  3KGW A;  3AEJ A;  1N31 A;  2JJF A;  2W7E A;  2AY4 A;  1E5E A;  4ITG A;  1AHY A;  3GSB A;  1V2E A;  1UU0 A;  2BKW A;  2JG2 A;  3PGY A;  2W7M A;  4B9B A;  3CBF A;  1W7M A;  3LVM A;  4OTL A;  1ART A;  1IBJ A;  1U08 A;  2W8V A;  1SVV A;  2OAT A;  2Z9U A;  4EB7 A;  1M0P A;  1BKG A;  2CAN A;  3Q8N A;  3W1H A;  3WKS A;  3ASB A;  4TN4 A;  2BI1 A;  2Z20 A;  1RV4 A;  3GZC A;  4OT8 A;  1H1C A;  2XBN A;  3BV0 A;  3HDO A;  4UOY A;  1DGD A;  1ASB A;  1ARS A;  3NU8 A;  1LW4 A;  3ECD A;  3FTB A;  1TOI A;  3TQX A;  3MC6 A;  2VMY A;  2AY6 A;  4ZSY A;  2BIE A;  4RKD A;  4BQ0 A;  3FFH A;  3PDB A;  3WY7 A;  3DRD A;  4BA5 A;  1LKC A;  4JE5 D;  3EZS A;  2ZY4 A;  5G4I A;  4GRX A;  3FRK A;  4J5U A;  2ZY5 A;  1CQ7 A;  4LC3 A; 
#chains in the Genus database with same CATH topology
 3RCH A;  4DGT A;  2C44 A;  2G6W A;  1X28 A;  3GET A;  3FFR A;  3GZD C;  3PJ0 A;  3AEJ C;  4F5J A;  2JIS A;  2JGT A;  1WST A;  2Z9X A;  4R5Z A;  2W7J A;  3A8U X;  2CB1 A;  2W8T A;  1BJO A;  1WKH A;  2VMP A;  3MBB A;  4KAM A;  4CXR A;  2VMZ A;  5E5I A;  4XQ2 A;  3RCH B;  1AHX A;  2BWP A;  3BC8 A;  3F0H A;  1D2F A;  3CAI A;  1AY5 A;  2BI5 A;  4N0B A;  1I41 A;  2ZY3 A;  1QJ3 A;  2WKA A;  3I16 A;  4IW7 A;  1VJO A;  5EUN A;  1B5O A;  1OHW A;  4IYO A;  3JZL A;  1DFO A;  4JEV A;  3FKD A;  1G7X A;  2QB2 A;  4IXS A;  3NU7 A;  4LW4 A;  4A6U A;  3JU7 A;  3UWC A;  4BHD A;  3GJU A;  3OKS A;  2FKI A;  3MAU A;  1C7O A;  1QIS A;  1J04 A;  3QBO A;  3LVL B;  4IYO B;  4UHO A;  1WYV B;  1ZC9 A;  1CS1 A;  1TOG A;  1XEY A;  2BWN A;  3ZZJ A;  4RAE A;  1GEX A;  1MDZ A;  3AOW A;  2BYL A;  2DGK A;  3VAX A;  1IVR A;  3EI8 A;  4RM1 A;  3D6K A;  3TCM A;  4E3R A;  2YRR A;  2V0Y A;  3VK2 A;  4MQQ A;  4RJ0 A;  2DGM A;  2D5Y A;  1D7R A;  2AAT A;  1LW5 A;  1SZK A;  5G4J A;  1EQB A;  1MAQ A;  1QJ5 A;  2CJG A;  1WKG A;  5LHA A;  1QGN A;  4MY5 A;  1LC8 A;  2VMT A;  1JG8 A;  4UHN A;  1C7G A;  3E9K A;  3EI5 A;  5HHY A;  3RBF A;  1YJZ A;  3NYU A;  5DX5 A;  4OBU A;  2ORD A;  1O61 A;  2OGA A;  4E1O A;  2BI2 A;  1X0M A;  2ZUK A;  3K28 A;  4OC9 A;  4E77 A;  2ZY2 A;  2O1B A;  2R2N A;  2D7Z A;  5DJ1 A;  2W8J A;  3QM2 A;  3AOV A;  2R5C A;  4GE9 A;  4WB0 A;  2DR1 A;  5FT8 A;  4AOA A;  1V2D A;  3G0T A;  1BT4 A;  1C7N A;  2YCP A;  3A9X A;  1CQ6 A;  1AKC A;  4R8D A;  1AIB A;  3ELP A;  1BJW A;  4JEZ A;  2CJH A;  4MKJ A;  1MLY A;  5E4Z A;  3B46 A;  4MSO A;  1M7Y A;  1RVU A;  2HUF A;  5TF5 A;  2C81 A;  3DXV A;  1BW0 A;  3E2Z A;  3K7Y A;  4WBT A;  4WB0 B;  3IF2 A;  5FT6 A;  1UU1 A;  1ORD A;  1LC7 A;  2HUI A;  4WLH A;  1BQD A;  4WYC A;  3BB8 A;  2W7L A;  2A1V A;  1DTY A;  2D65 A;  3KKI A;  5JAY A;  4IXZ A;  1SZS A;  2D7Y A;  2GQN A;  2HOY A;  4Y0H A;  3DZZ A;  1AMQ A;  3FQA A;  4JEY A;  5FT4 A;  5AX8 A;  3MAF A;  2OKK A;  4ZAH A;  3WCN A;  4F4E A;  3EUC A;  3QI6 A;  1BJ4 A;  3W1J A;  1B8G A;  4CVQ A;  1D7V A;  1GC3 A;  1YNU A;  3FZ6 A;  1S06 A;  1DJ9 A;  4OBV A;  1Z3Z A;  2O7C A;  1AMS A;  2KFP A;  3FVU A;  1AMR A;  2WK7 A;  1IJI A;  2WK8 A;  1PFF A;  1MDX A;  3N4S A;  2E7J A;  1ASN A;  3NDN A;  3N4R A;  3F6T A;  2O0R A;  1JF9 A;  1KMK A;  3HLM A;  3AAT A;  3QGU A;  1TOJ A;  1AAW A;  4ISY A;  1X2A A;  4WYA A;  1D7U A;  3UE8 A;  4WP0 A;  3FDD A;  1I43 A;  2AY2 A;  1LK9 A;  3CQ4 A;  1YAA A;  3CQ6 A;  3VK4 A;  3HVY A;  4MQR A;  4RJY A;  5EIG A;  3PIU A;  4XEW A;  1AIA A;  2ZSL A;  2CH1 A;  1MAP A;  3NX3 A;  1VEF A;  1W23 A;  1Z7D A;  4P3M A;  2JJG A;  1M0O A;  4CXQ A;  4XJM A;  1OAT A;  1N2T A;  4ADE A;  3NYT A;  2DOU A;  1CQ8 A;  2YKY A;  2HUU A;  3GBX A;  5G09 A;  2VGW A;  2PB0 A;  1Y4I A;  2CIN A;  4OMA A;  2GMS A;  2VMS A;  4J8L A;  1AJR A;  4A0F A;  4EFF A;  3ZZK A;  3PDB B;  3RBL A;  1W7L A;  1I29 A;  4WYE A;  4WYG A;  1IX6 A;  2VGZ A;  2QBT A;  3N5M A;  4Q6R A;  4M2J A;  1RVY A;  4GE4 A;  4JF0 A;  1PMO A;  1KL2 A;  5EQC A;  3PPL A;  2C0R A;  2EGY A;  3MKJ A;  1ASA A;  2D66 A;  4ZDL A;  1MGV A;  1TAS A;  1TPL A;  3NTJ A;  5EFS A;  2X5D A;  4Q31 A;  1T3I A;  4TMR A;  4AH3 A;  1BQA A;  3WKR A;  3EI6 A;  3BWN A;  4U2H A;  2W7K A;  2VMO A;  5I92 A;  3HL2 A;  1BJO B;  3ISL A;  3VK3 A;  4A00 A;  4GDY A;  3A9Y A;  2FQ6 A;  3LG0 A;  2HOX A;  3MC6 C;  1AKA A;  2E54 A;  3N0L A;  4K2I A;  4A72 A;  2HOR A;  2TPL A;  1JS6 A;  3ZRR A;  4ADC A;  3WLX A;  4ZM3 A;  1YJS A;  3ATH A;  3KGX A;  4IXO A;  3PD6 A;  4UHM A;  3ZRQ A;  1AHG A;  1TAR A;  5D95 A;  1B9I A;  1IAY A;  4H51 A;  4U1T A;  3KE3 A;  5EUD A;  4W1W A;  4KXK A;  4OYT A;  1OXP A;  3NNK A;  4K05 A;  3EZ1 A;  4M2M A;  5LH9 A;  1TAT A;  3AEM A;  1AMA A;  3B1C A;  4H63 Q;  4ZSW A;  5HXX A;  4AO9 A;  1GC2 A;  3JTX A;  4A0G A;  3TFT A;  3LVK A;  3A9Z A;  2Q7W A;  1BJN A;  4I8A A;  4QGR A;  4F5H A;  1M6S A;  1B5P A;  1OHY A;  1O4S A;  2Z1Y A;  5D5S A;  4LNL A;  4F5G A;  4ZWV A;  1B4X A;  2VI8 A;  2VIA A;  4JEX A;  4RKC A;  1TOK A;  3E2Y A;  2VGU A;  3A2B A;  3L8A A;  4Q76 A;  4UQV A;  1C9C A;  2Z67 A;  1O62 A;  1P3W A;  5BJ4 A;  2NMP A;  4DQ6 A;  2BIG A;  3MEB A;  2X3L A;  2EH6 A;  2F8J A;  5M46 A;  2JJE A;  2CJD A;  4MQP A;  2CY8 A;  2W7I A;  5BJ3 A;  1GC0 A;  2VMW A;  4R5F A;  1GDE A;  4PVF A;  4B98 A;  2Z1Z A;  3QN6 A;  3WGB A;  2YRI A;  4MKK A;  4NOG A;  4L0O A;  3FVS A;  4ZWM A;  3FSL A;  4WYD A;  5M4D A;  3B1D A;  2EZ1 A;  1OXO A;  1X29 A;  1I48 A;  3P6K A;  4KYO A;  3FVX A;  1CZE A;  3LV2 A;  5F9S A;  2R5C B;  1IX7 A;  2QMA A;  2D64 A;  3USF A;  4A6T A;  5M4B A;  1KKP A;  2JJH A;  3P1T A;  4F5F A;  2BYJ A;  2R0T A;  2V1P A;  3G8M A;  1W3U A;  1GC4 A;  2FYF A;  4DBC A;  1DJU A;  4EB5 A;  3B8X A;  3TFU A;  2VI9 A;  4ITX A;  3M5U A;  3WGC A;  3E2Z B;  3BN1 A;  1QIR A;  3EIB A;  3HT4 A;  1AIC A;  2HP2 A;  5EUE A;  5HDM A;  1M0Q A;  3FCR A;  4ADD A;  1M4N A;  3DOD A;  5DB5 A;  5C6U A;  1ARI A;  1H0C A;  4GE7 A;  8AAT A;  3ELE A;  2ZC0 A;  2ZSM A;  3K40 A;  5FT5 A;  3H14 A;  2ZP7 A;  1UKJ A;  3H9X A;  4AO4 A;  3MAF B;  3I5T A;  5IWQ A;  4GSA A;  3LVJ A;  3N4X A;  4W1X A;  5F8V A;  1ASD A;  2QSR A;  4JEW A;  1BS0 A;  2AY3 A;  1G7W A;  4JE5 A;  1CL1 A;  3ZRP A;  1S0A A;  2VMX A;  2AEU A;  1ARG A;  1IUG A;  1YOO A;  4F5M A;  1N8P A;  3CQ5 A;  1EG5 A;  2PO3 A;  2D61 A;  3AEL A;  3GZD A;  1DKA A;  3HQT A;  3BWO A;  3FQ7 A;  4MGR A;  3EIA A;  1WYT A;  4ZAS A;  3RUY A;  3N75 A;  4M2K A;  1G4X A;  2BHX A;  3H7F A;  1GEY A;  2WK9 A;  4WD2 A;  1ASM A;  1FG3 A;  1MLZ A;  1GBN A;  2AY7 A;  3R4T A;  4WXF A;  2GMU A;  4A0R A;  5EIG B;  1FC4 A;  1VP4 A;  4FL0 A;  1OHV A;  3AV7 A;  1ASG A;  1ARH A;  1KMJ A;  2YHK A;  3MAD A;  4W91 A;  1WYT B;  2W7H A;  1SZU A;  2HOZ A;  4AZK A;  1CJ0 A;  1O69 A;  1WYU A;  4Y0D A;  1CZC A;  2OQX A;  3WX9 A;  1XI9 A;  3ASA A;  4EMY A;  3AEO A;  4F5I A;  2VMQ A;  1DJE A;  1ELQ A;  1EJI A;  4A6R A;  3QPG A;  2W7D A;  9AAT A;  1GEW A;  2FNU A;  1LS3 A;  1AJS A;  3BCA A;  2OKJ A;  2GB3 A;  2Z9W A;  1WYU B;  3QHX A;  1ECX A;  4Y0I A;  3WZF A;  3RQ1 A;  2VMN A;  3R9A A;  1S07 A;  1C0N A;  3AEN A;  2YOB A;  4OCA A;  2HZP A;  1AJS B;  2VGV A;  2Z9V A;  1YIZ A;  1IAX A;  1MDO A;  1KL1 A;  1B9H A;  3GWP A;  4GEB A;  3E6G A;  4WXG A;  4EU1 A;  5K8B A;  1M32 A;  3BCX A;  3IHJ A;  1JS3 A;  4W5K A;  1AKB A;  2YCN A;  2QB3 A;  1ASL A;  2QA3 A;  2VMU A;  1QZ9 A;  3AEN B;  3PAA A;  1J32 A;  3JWB A;  1QIT A;  3RI6 A;  4IX8 A;  5M49 A;  4ZDP A;  4LNM A;  1AY4 A;  4JF1 A;  2CST A;  3NYS A;  3NUB A;  4IY7 A;  4XJO A;  4P7Y A;  2AY5 A;  1AAM A;  2X5F A;  5KTB A;  2VYC A;  2RFV A;  3NUI A;  4E3Q A;  4PFN A;  2BIA A;  5DJ9 A;  1G4V A;  2W7F A;  3HBX A;  3II0 A;  3DR4 A;  3PD6 B;  4XAU A;  3VP6 A;  2BI9 A;  1SFF A;  2D63 A;  2X8U A;  3FQ8 A;  1W7N A;  2E7I A;  1WYV A;  2FM1 A;  2AY9 A;  3DR7 A;  1CL2 A;  4PFF A;  5G0A A;  2YCT A;  3VOM A;  4F5L A;  1S09 A;  1PG8 A;  1M0N A;  2VLH A;  4W8I A;  1FG7 A;  4BA4 A;  1ASE A;  2EO5 A;  2XH1 A;  4W1V A;  1AHF A;  4RIT A;  1ZOB A;  4HVK A;  3COG A;  3GR9 A;  3BCB A;  3L44 A;  3FZ8 A;  3JW9 A;  3BWN C;  4AZJ A;  3ACZ A;  3FZ7 A;  1C4K A;  3UAK A;  4ZDO A;  2ZJG A;  3E2F A;  4ATQ A;  2YKX A;  3T32 A;  4XJL A;  2VMR A;  4WLJ A;  2YKV A;  4LNJ A;  3N7N A;  2VGT A;  1V72 A;  1YIY A;  1SF2 A;  4ATP A;  2FNI A;  3OP7 A;  1V2F A;  1RV3 A;  3DC1 A;  2VIB A;  1ASC A;  1ELU A;  4K2B A;  3TAT A;  2GSA A;  2AY8 A;  4XJP A;  3B1E A;  3JWA A;  2W7G A;  4Q75 A;  4R2N A;  3HMU A;  5EAA A;  4ZM4 A;  3DYD A;  2DKJ A;  3PDX A;  3BS8 A;  5E3K A;  3AEM C;  3I4J A;  2BI3 A;  2OGE A;  4LW2 A;  4XK1 A;  2ZYJ A;  1D7S A;  7AAT A;  2R5E A;  3WCO A;  2YKU A;  2AEV A;  1TOE A;  2CFB A;  2Z61 A;  4RIZ A;  2HP1 A;  3NRA A;  3FD0 A;  3LWS A;  2C7T A;  4N0W A;  2W8U A;  3G7Q A;  4WYF A;  2FN6 A;  2CH2 A;  3LY1 A;  1GCK A;  1AX4 A;  2G7J A;  3PA9 A;  4F5K A;  1S08 A;  4FFC A;  4K2M A;  2VLF A;  1IX8 A;  4ZLV A;  5G2P A;  1SPA A;  3E77 A;  2AY1 A;  2CTZ A;  2DKB A;  2EPJ A;  2EZ2 A;  3EI7 A;  3F9T A;  4RLG A;  5G2Q A;  3W1I A;  1LC5 A;  2VGS A;  4BMK A;  1ASF A;  1AY8 A;  1PMM A;  5J8Q A;  4HF8 A;  4PIW A;  5EAV A;  1UU2 A;  4WXB A;  1DGE A;  2PB2 A;  4A0H A;  1AHE A;  4ADB A;  2EYQ A;  1ZOD A;  1E5F A;  2W8W A;  3EI9 A;  2QLR A;  1YJY A;  3DXW A;  1KKJ A;  1GD9 A;  4TV7 A;  2VMV A;  4CBR A;  4CBS A;  2BWO A;  3AEP A;  3FDB A;  2WB6 A;  3DU4 A;  4O6Z A;  2E7U A;  2DGL A;  3KGW A;  3AEJ A;  1N31 A;  2JJF A;  2W7E A;  2AY4 A;  1E5E A;  4ITG A;  1AHY A;  3GSB A;  1V2E A;  1UU0 A;  2BKW A;  2JG2 A;  3PGY A;  2W7M A;  1KAF A;  4B9B A;  3CBF A;  1W7M A;  3LVM A;  4OTL A;  1ART A;  1IBJ A;  1U08 A;  2W8V A;  1SVV A;  2OAT A;  2Z9U A;  4EB7 A;  1M0P A;  1BKG A;  2CAN A;  3Q8N A;  3W1H A;  3WKS A;  3ASB A;  4TN4 A;  2BI1 A;  2Z20 A;  1RV4 A;  3GZC A;  4OT8 A;  1H1C A;  2XBN A;  3BV0 A;  3HDO A;  4UOY A;  1DGD A;  1ASB A;  1ARS A;  3NU8 A;  1LW4 A;  3ECD A;  3FTB A;  1TOI A;  3TQX A;  3MC6 A;  2VMY A;  2AY6 A;  4ZSY A;  2BIE A;  4RKD A;  4BQ0 A;  3FFH A;  3PDB A;  3WY7 A;  3DRD A;  4BA5 A;  1LKC A;  4JE5 D;  3EZS A;  2ZY4 A;  5G4I A;  4GRX A;  3FRK A;  4J5U A;  2ZY5 A;  1CQ7 A;  4LC3 A; 
#chains in the Genus database with same CATH homology
 3RCH A;  4DGT A;  2C44 A;  2G6W A;  1X28 A;  3GET A;  3FFR A;  3GZD C;  3PJ0 A;  3AEJ C;  4F5J A;  2JIS A;  2JGT A;  1WST A;  2Z9X A;  4R5Z A;  2W7J A;  3A8U X;  2CB1 A;  2W8T A;  1BJO A;  1WKH A;  2VMP A;  3MBB A;  4KAM A;  4CXR A;  2VMZ A;  5E5I A;  4XQ2 A;  3RCH B;  1AHX A;  2BWP A;  3BC8 A;  3F0H A;  1D2F A;  3CAI A;  1AY5 A;  2BI5 A;  4N0B A;  1I41 A;  2ZY3 A;  1QJ3 A;  2WKA A;  3I16 A;  4IW7 A;  1VJO A;  5EUN A;  1B5O A;  1OHW A;  4IYO A;  3JZL A;  1DFO A;  4JEV A;  3FKD A;  1G7X A;  2QB2 A;  4IXS A;  3NU7 A;  4LW4 A;  4A6U A;  3JU7 A;  3UWC A;  4BHD A;  3GJU A;  3OKS A;  2FKI A;  3MAU A;  1C7O A;  1QIS A;  1J04 A;  3QBO A;  3LVL B;  4IYO B;  4UHO A;  1WYV B;  1ZC9 A;  1CS1 A;  1TOG A;  1XEY A;  2BWN A;  3ZZJ A;  4RAE A;  1GEX A;  1MDZ A;  3AOW A;  2BYL A;  2DGK A;  3VAX A;  1IVR A;  3EI8 A;  4RM1 A;  3D6K A;  3TCM A;  4E3R A;  2YRR A;  2V0Y A;  3VK2 A;  4MQQ A;  4RJ0 A;  2DGM A;  2D5Y A;  1D7R A;  2AAT A;  1LW5 A;  1SZK A;  5G4J A;  1EQB A;  1MAQ A;  1QJ5 A;  2CJG A;  1WKG A;  5LHA A;  1QGN A;  4MY5 A;  1LC8 A;  2VMT A;  1JG8 A;  4UHN A;  1C7G A;  3E9K A;  3EI5 A;  5HHY A;  3RBF A;  1YJZ A;  3NYU A;  5DX5 A;  4OBU A;  2ORD A;  1O61 A;  2OGA A;  4E1O A;  2BI2 A;  1X0M A;  2ZUK A;  3K28 A;  4OC9 A;  4E77 A;  2ZY2 A;  2O1B A;  2R2N A;  2D7Z A;  5DJ1 A;  2W8J A;  3QM2 A;  3AOV A;  2R5C A;  4GE9 A;  4WB0 A;  2DR1 A;  5FT8 A;  4AOA A;  1V2D A;  3G0T A;  1BT4 A;  1C7N A;  2YCP A;  3A9X A;  1CQ6 A;  1AKC A;  4R8D A;  1AIB A;  3ELP A;  1BJW A;  4JEZ A;  2CJH A;  4MKJ A;  1MLY A;  5E4Z A;  3B46 A;  4MSO A;  1M7Y A;  1RVU A;  2HUF A;  5TF5 A;  2C81 A;  3DXV A;  1BW0 A;  3E2Z A;  3K7Y A;  4WBT A;  4WB0 B;  3IF2 A;  5FT6 A;  1UU1 A;  1ORD A;  1LC7 A;  2HUI A;  4WLH A;  1BQD A;  4WYC A;  3BB8 A;  2W7L A;  2A1V A;  1DTY A;  2D65 A;  3KKI A;  5JAY A;  4IXZ A;  1SZS A;  2D7Y A;  2GQN A;  2HOY A;  4Y0H A;  3DZZ A;  1AMQ A;  3FQA A;  4JEY A;  5FT4 A;  5AX8 A;  3MAF A;  2OKK A;  4ZAH A;  3WCN A;  4F4E A;  3EUC A;  3QI6 A;  1BJ4 A;  3W1J A;  1B8G A;  4CVQ A;  1D7V A;  1GC3 A;  1YNU A;  3FZ6 A;  1S06 A;  1DJ9 A;  4OBV A;  1Z3Z A;  2O7C A;  1AMS A;  2KFP A;  3FVU A;  1AMR A;  2WK7 A;  1IJI A;  2WK8 A;  1PFF A;  1MDX A;  3N4S A;  2E7J A;  1ASN A;  3NDN A;  3N4R A;  3F6T A;  2O0R A;  1JF9 A;  1KMK A;  3HLM A;  3AAT A;  3QGU A;  1TOJ A;  1AAW A;  4ISY A;  1X2A A;  4WYA A;  1D7U A;  3UE8 A;  4WP0 A;  3FDD A;  1I43 A;  2AY2 A;  1LK9 A;  3CQ4 A;  1YAA A;  3CQ6 A;  3VK4 A;  3HVY A;  4MQR A;  4RJY A;  5EIG A;  3PIU A;  4XEW A;  1AIA A;  2ZSL A;  2CH1 A;  1MAP A;  3NX3 A;  1VEF A;  1W23 A;  1Z7D A;  4P3M A;  2JJG A;  1M0O A;  4CXQ A;  4XJM A;  1OAT A;  1N2T A;  4ADE A;  3NYT A;  2DOU A;  1CQ8 A;  2YKY A;  2HUU A;  3GBX A;  5G09 A;  2VGW A;  2PB0 A;  1Y4I A;  2CIN A;  4OMA A;  2GMS A;  2VMS A;  4J8L A;  1AJR A;  4A0F A;  4EFF A;  3ZZK A;  3PDB B;  3RBL A;  1W7L A;  1I29 A;  4WYE A;  4WYG A;  1IX6 A;  2VGZ A;  2QBT A;  3N5M A;  4Q6R A;  4M2J A;  1RVY A;  4GE4 A;  4JF0 A;  1PMO A;  1KL2 A;  5EQC A;  3PPL A;  2C0R A;  2EGY A;  3MKJ A;  1ASA A;  2D66 A;  4ZDL A;  1MGV A;  1TAS A;  1TPL A;  3NTJ A;  5EFS A;  2X5D A;  4Q31 A;  1T3I A;  4TMR A;  4AH3 A;  1BQA A;  3WKR A;  3EI6 A;  3BWN A;  4U2H A;  2W7K A;  2VMO A;  5I92 A;  3HL2 A;  1BJO B;  3ISL A;  3VK3 A;  4A00 A;  4GDY A;  3A9Y A;  2FQ6 A;  3LG0 A;  2HOX A;  3MC6 C;  1AKA A;  2E54 A;  3N0L A;  4K2I A;  4A72 A;  2HOR A;  2TPL A;  1JS6 A;  3ZRR A;  4ADC A;  3WLX A;  4ZM3 A;  1YJS A;  3ATH A;  3KGX A;  4IXO A;  3PD6 A;  4UHM A;  3ZRQ A;  1AHG A;  1TAR A;  5D95 A;  1B9I A;  1IAY A;  4H51 A;  4U1T A;  3KE3 A;  5EUD A;  4W1W A;  4KXK A;  4OYT A;  1OXP A;  3NNK A;  4K05 A;  3EZ1 A;  4M2M A;  5LH9 A;  1TAT A;  3AEM A;  1AMA A;  3B1C A;  4H63 Q;  4ZSW A;  5HXX A;  4AO9 A;  1GC2 A;  3JTX A;  4A0G A;  3TFT A;  3LVK A;  3A9Z A;  2Q7W A;  1BJN A;  4I8A A;  4QGR A;  4F5H A;  1M6S A;  1B5P A;  1OHY A;  1O4S A;  2Z1Y A;  5D5S A;  4LNL A;  4F5G A;  4ZWV A;  1B4X A;  2VI8 A;  2VIA A;  4JEX A;  4RKC A;  1TOK A;  3E2Y A;  2VGU A;  3A2B A;  3L8A A;  4Q76 A;  4UQV A;  1C9C A;  2Z67 A;  1O62 A;  1P3W A;  5BJ4 A;  2NMP A;  4DQ6 A;  2BIG A;  3MEB A;  2X3L A;  2EH6 A;  2F8J A;  5M46 A;  2JJE A;  2CJD A;  4MQP A;  2CY8 A;  2W7I A;  5BJ3 A;  1GC0 A;  2VMW A;  4R5F A;  1GDE A;  4PVF A;  4B98 A;  2Z1Z A;  3QN6 A;  3WGB A;  2YRI A;  4MKK A;  4NOG A;  4L0O A;  3FVS A;  4ZWM A;  3FSL A;  4WYD A;  5M4D A;  3B1D A;  2EZ1 A;  1OXO A;  1X29 A;  1I48 A;  3P6K A;  4KYO A;  3FVX A;  1CZE A;  3LV2 A;  5F9S A;  2R5C B;  1IX7 A;  2QMA A;  2D64 A;  3USF A;  4A6T A;  5M4B A;  1KKP A;  2JJH A;  3P1T A;  4F5F A;  2BYJ A;  2R0T A;  2V1P A;  3G8M A;  1W3U A;  1GC4 A;  2FYF A;  4DBC A;  1DJU A;  4EB5 A;  3B8X A;  3TFU A;  2VI9 A;  4ITX A;  3M5U A;  3WGC A;  3E2Z B;  3BN1 A;  1QIR A;  3EIB A;  3HT4 A;  1AIC A;  2HP2 A;  5EUE A;  5HDM A;  1M0Q A;  3FCR A;  4ADD A;  1M4N A;  3DOD A;  5DB5 A;  5C6U A;  1ARI A;  1H0C A;  4GE7 A;  8AAT A;  3ELE A;  2ZC0 A;  2ZSM A;  3K40 A;  5FT5 A;  3H14 A;  2ZP7 A;  1UKJ A;  3H9X A;  4AO4 A;  3MAF B;  3I5T A;  5IWQ A;  4GSA A;  3LVJ A;  3N4X A;  4W1X A;  5F8V A;  1ASD A;  2QSR A;  4JEW A;  1BS0 A;  2AY3 A;  1G7W A;  4JE5 A;  1CL1 A;  3ZRP A;  1S0A A;  2VMX A;  2AEU A;  1ARG A;  1IUG A;  1YOO A;  4F5M A;  1N8P A;  3CQ5 A;  1EG5 A;  2PO3 A;  2D61 A;  3AEL A;  3GZD A;  1DKA A;  3HQT A;  3BWO A;  3FQ7 A;  4MGR A;  3EIA A;  1WYT A;  4ZAS A;  3RUY A;  3N75 A;  4M2K A;  1G4X A;  2BHX A;  3H7F A;  1GEY A;  2WK9 A;  4WD2 A;  1ASM A;  1FG3 A;  1MLZ A;  1GBN A;  2AY7 A;  3R4T A;  4WXF A;  2GMU A;  4A0R A;  5EIG B;  1FC4 A;  1VP4 A;  4FL0 A;  1OHV A;  3AV7 A;  1ASG A;  1ARH A;  1KMJ A;  2YHK A;  3MAD A;  4W91 A;  1WYT B;  2W7H A;  1SZU A;  2HOZ A;  4AZK A;  1CJ0 A;  1O69 A;  1WYU A;  4Y0D A;  1CZC A;  2OQX A;  3WX9 A;  1XI9 A;  3ASA A;  4EMY A;  3AEO A;  4F5I A;  2VMQ A;  1DJE A;  1ELQ A;  1EJI A;  4A6R A;  3QPG A;  2W7D A;  9AAT A;  1GEW A;  2FNU A;  1LS3 A;  1AJS A;  3BCA A;  2OKJ A;  2GB3 A;  2Z9W A;  1WYU B;  3QHX A;  1ECX A;  4Y0I A;  3WZF A;  3RQ1 A;  2VMN A;  3R9A A;  1S07 A;  1C0N A;  3AEN A;  2YOB A;  4OCA A;  2HZP A;  1AJS B;  2VGV A;  2Z9V A;  1YIZ A;  1IAX A;  1MDO A;  1KL1 A;  1B9H A;  3GWP A;  4GEB A;  3E6G A;  4WXG A;  4EU1 A;  5K8B A;  1M32 A;  3BCX A;  3IHJ A;  1JS3 A;  4W5K A;  1AKB A;  2YCN A;  2QB3 A;  1ASL A;  2QA3 A;  2VMU A;  1QZ9 A;  3AEN B;  3PAA A;  1J32 A;  3JWB A;  1QIT A;  3RI6 A;  4IX8 A;  5M49 A;  4ZDP A;  4LNM A;  1AY4 A;  4JF1 A;  2CST A;  3NYS A;  3NUB A;  4IY7 A;  4XJO A;  4P7Y A;  2AY5 A;  1AAM A;  2X5F A;  5KTB A;  2VYC A;  2RFV A;  3NUI A;  4E3Q A;  4PFN A;  2BIA A;  5DJ9 A;  1G4V A;  2W7F A;  3HBX A;  3II0 A;  3DR4 A;  3PD6 B;  4XAU A;  3VP6 A;  2BI9 A;  1SFF A;  2D63 A;  2X8U A;  3FQ8 A;  1W7N A;  2E7I A;  1WYV A;  2FM1 A;  2AY9 A;  3DR7 A;  1CL2 A;  4PFF A;  5G0A A;  2YCT A;  3VOM A;  4F5L A;  1S09 A;  1PG8 A;  1M0N A;  2VLH A;  4W8I A;  1FG7 A;  4BA4 A;  1ASE A;  2EO5 A;  2XH1 A;  4W1V A;  1AHF A;  4RIT A;  1ZOB A;  4HVK A;  3COG A;  3GR9 A;  3BCB A;  3L44 A;  3FZ8 A;  3JW9 A;  3BWN C;  4AZJ A;  3ACZ A;  3FZ7 A;  1C4K A;  3UAK A;  4ZDO A;  2ZJG A;  3E2F A;  4ATQ A;  2YKX A;  3T32 A;  4XJL A;  2VMR A;  4WLJ A;  2YKV A;  4LNJ A;  3N7N A;  2VGT A;  1V72 A;  1YIY A;  1SF2 A;  4ATP A;  2FNI A;  3OP7 A;  1V2F A;  1RV3 A;  3DC1 A;  2VIB A;  1ASC A;  1ELU A;  4K2B A;  3TAT A;  2GSA A;  2AY8 A;  4XJP A;  3B1E A;  3JWA A;  2W7G A;  4Q75 A;  4R2N A;  3HMU A;  5EAA A;  4ZM4 A;  3DYD A;  2DKJ A;  3PDX A;  3BS8 A;  5E3K A;  3AEM C;  3I4J A;  2BI3 A;  2OGE A;  4LW2 A;  4XK1 A;  2ZYJ A;  1D7S A;  7AAT A;  2R5E A;  3WCO A;  2YKU A;  2AEV A;  1TOE A;  2CFB A;  2Z61 A;  4RIZ A;  2HP1 A;  3NRA A;  3FD0 A;  3LWS A;  2C7T A;  4N0W A;  2W8U A;  3G7Q A;  4WYF A;  2FN6 A;  2CH2 A;  3LY1 A;  1GCK A;  1AX4 A;  2G7J A;  3PA9 A;  4F5K A;  1S08 A;  4FFC A;  4K2M A;  2VLF A;  1IX8 A;  4ZLV A;  5G2P A;  1SPA A;  3E77 A;  2AY1 A;  2CTZ A;  2DKB A;  2EPJ A;  2EZ2 A;  3EI7 A;  3F9T A;  4RLG A;  5G2Q A;  3W1I A;  1LC5 A;  2VGS A;  4BMK A;  1ASF A;  1AY8 A;  1PMM A;  5J8Q A;  4HF8 A;  4PIW A;  5EAV A;  1UU2 A;  4WXB A;  1DGE A;  2PB2 A;  4A0H A;  1AHE A;  4ADB A;  2EYQ A;  1ZOD A;  1E5F A;  2W8W A;  3EI9 A;  2QLR A;  1YJY A;  3DXW A;  1KKJ A;  1GD9 A;  4TV7 A;  2VMV A;  4CBR A;  4CBS A;  2BWO A;  3AEP A;  3FDB A;  2WB6 A;  3DU4 A;  4O6Z A;  2E7U A;  2DGL A;  3KGW A;  3AEJ A;  1N31 A;  2JJF A;  2W7E A;  2AY4 A;  1E5E A;  4ITG A;  1AHY A;  3GSB A;  1V2E A;  1UU0 A;  2BKW A;  2JG2 A;  3PGY A;  2W7M A;  4B9B A;  3CBF A;  1W7M A;  3LVM A;  4OTL A;  1ART A;  1IBJ A;  1U08 A;  2W8V A;  1SVV A;  2OAT A;  2Z9U A;  4EB7 A;  1M0P A;  1BKG A;  2CAN A;  3Q8N A;  3W1H A;  3WKS A;  3ASB A;  4TN4 A;  2BI1 A;  2Z20 A;  1RV4 A;  3GZC A;  4OT8 A;  1H1C A;  2XBN A;  3BV0 A;  3HDO A;  4UOY A;  1DGD A;  1ASB A;  1ARS A;  3NU8 A;  1LW4 A;  3ECD A;  3FTB A;  1TOI A;  3TQX A;  3MC6 A;  2VMY A;  2AY6 A;  4ZSY A;  2BIE A;  4RKD A;  4BQ0 A;  3FFH A;  3PDB A;  3WY7 A;  3DRD A;  4BA5 A;  1LKC A;  4JE5 D;  3EZS A;  2ZY4 A;  5G4I A;  4GRX A;  3FRK A;  4J5U A;  2ZY5 A;  1CQ7 A;  4LC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...