3UE8A

Kynurenine aminotransferase ii inhibitors
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
427
structure length
410
Chain Sequence
b'MNYARFITAASAARNPISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 129
structure length 410
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3ue8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3ue8A03
1D7SA 4JEVA 4A0HA 1O61A 4AO4A 4AO9A 1TASA 4RIZA 4WYDA 2OKJA 3KE3A 4LNLA 3ZRRA 4ZDOA 1IAXA 2O0RA 3CQ4A 2AY6A 2WKAA 2ORDA 2C81A 2CH2A 2WK7A 1G4VA 3KGXA 4ATQA 2HOZA 1GEYA 2CTZA 2D65A 4WBTA 4LW2A 2VYCA 2ZY2A 1C9CA 1W7LA 4MKJA 1RV4A 3UWCA 2X8UA 3FSLA 4A0FA 3HQTA 4W91A 4R5ZA 1BW0A 2YCNA 1QISA 4XJPA 2NMPA 5BJ4A 2FN6A 2BI1A 2YKYA 5FT4A 2C7TA 3PAAA 2BI9A 4N0WA 4IXOA 1SZUA 1B5PA 5DJ9A 2JJFA 3NDNA 1ASGA 1MLZA 4W1XA 3CQ6A 4WYFA 2HP2A 1AY5A 2EH6A 1O69A 2PB0A 2D66A 2AY5A 2HUUA 2FNUA 4WP0A 4RITA 3JWAA 1AKCA 1ELUA 3I4JA 4JE5D 4A6UA 3COGA 4ZWVA 2W8TA 3ZRPA 1ASLA 9AATA 4NOGA 3DXWA 1AAMA 1BQDA 3NNKA 3W1IA 1V2FA 1AKAA 3AEMA 3PGYA 4EU1A 1GEWA 3N5MA 4GE7A 1PMMA 3CAIA 2CANA 3FQAA 2ZYJA 2HP1A 2FQ6A 1GCKA 3BV0A 3AELA 1S09A 3JW9A 3R4TA 1G7XA 2W8JA 5LH9A 3E2YA 1TARA 1DJ9A 3M5UA 1AJRA 1S07A 3AENA 4MGRA 2OGAA 4B98A 1MLYA 5G09A 4ATPA 4E77A 3ATHA 5LHAA 1XEYA 5M4DA 3FVXA 2W8UA 2YCPA 4TV7A 5EUEA 4K2IA 4BHDA 1SVVA 3MC6C 1M0QA 2PO3A 2YKVA 2X5DA 3CBFA 4L0OA 3AENB 3N0LA 1ASDA 3GWPA 3VP6A 3LVJA 2VGUA 3ASAA 5FT8A 4GEBA 1SF2A 4WYAA 4ZM3A 2VGSA 1B5OA 4FL0A 3H7FA 3UAKA 1YOOA 1O62A 4ZM4A 1TOIA 3GJUA 2QB3A 4ZDLA 1N31A 1DGDA 3BCXA 1SZSA 2BWPA 3GZCA 4OMAA 1CL1A 4W8IA 3B1CA 1EJIA 3IF2A 1OXPA 4K2MA 5D95A 2CSTA 1W23A 2YKXA 3VOMA 5HDMA 4CBSA 1LKCA 2BYJA 3DR7A 3G7QA 4ZSWA 2ZUKA 3FZ6A 4KYOA 4MQPA 1IBJA 4RAEA 3EI8A 3WCNA 4IX8A 3QI6A 1X28A 3HDOA 1YJSA 3E6GA 5F8VA 1QZ9A 1ZC9A 1WYUB 3FZ8A 5DB5A 3EIBA 2EO5A 3G0TA 1O4SA 2BKWA 1H0CA 1QIRA 3FKDA 3HMUA 3PPLA 4QGRA 4F5IA 2JJGA 8AATA 4ZDPA 1BKGA 5DJ1A 2CY8A 1I43A 4A6TA 1ASCA 4W1VA 2AY3A 2DGMA 2ZJGA 1DGEA 2D5YA 3PDBA 2ZY4A 5EFSA 5HXXA 3DZZA 4P3MA 5D5SA 3GR9A 2W8VA 3USFA 4UQVA 3QN6A 2VMUA 4RLGA 2D64A 1M7YA 2YOBA 4JEZA 3RCHA 3PDBB 2VGTA 1JS3A 2VIBA 3FFRA 1MDXA 3FVSA 4Y0DA 1RVYA 2O7CA 1MGVA 1TOKA 2YCTA 3NUIA 2FYFA 1AHGA 1E5EA 2R5CB 3RCHB 2VMYA 3LY1A 1YIZA 4F5FA 4A72A 3N75A 3H14A 2VGZA 4Q76A 2VMPA 4IXZA 2W7LA 2VLFA 2FNIA 4RJYA 2E7IA 2JJHA 3II0A 2GSAA 4PFNA 4J5UA 2CFBA 3WKSA 3DC1A 1FG7A 1XI9A 4EB5A 3DYDA 3GSBA 1ASMA 1MDZA 2BIAA 2EPJA 3NX3A 3E2FA 1OHVA 1KKJA 2CINA 1M32A 4GDYA 3R9AA 1LC7A 4F5KA 3WCOA 3AOWA 3JWBA 1OHYA 1ARHA 1ORDA 4EB7A 5DX5A 4A0GA 2Z61A 3ZZKA 4F4EA 5EUDA 1ZOBA 4JEWA 1YJZA 3B1EA 1AAWA 3A8UX 3DU4A 1ZODA 3PD6A 3TCMA 4GSAA 4WB0A 1X29A 4CXQA 1DTYA 2CH1A 2VMXA 3DODA 3VK4A 4JEYA 1EG5A 4UHOA 1I48A 3L44A 3E77A 1DJUA 3EI6A 3PD6B 3QPGA 1IX7A 1S06A 3EZSA 3G8MA 2VLHA 4R8DA 4WB0B 3AEOA 1C0NA 2YRIA 4WXBA 4F5JA 3AV7A 3NYUA 3UE8A 1H1CA 3K7YA 1TPLA 3MAUA 4O6ZA 4A00A 2ZSMA 4PVFA 3BS8A 3EI9A 1Y4IA 3HLMA 1JG8A 2AY1A 4CBRA 1FG3A 3F9TA 4Y0HA 1ARSA 3GBXA 1WYTA 1ARGA 4FFCA 1E5FA 4LW4A 4MQQA 2OGEA 3HT4A 3PIUA 5E5IA 5J8QA 4A0RA 4EFFA 3FZ7A 4DGTA 1AMSA 4HF8A 1C4KA 4J8LA 3W1JA 4F5GA 4Y0IA 4MY5A 1VP4A 1LW4A 1GD9A 1BT4A 1WYTB 2VMQA 2QB2A 3GZDC 4TMRA 3ZRQA 5M4BA 1J04A 3ISLA 2BIEA 1C7OA 2BWOA 2V1PA 3P6KA 3Q8NA 4WXGA 5M46A 5IWQA 1S08A 4OC9A 2G6WA 4B9BA 5JAYA 3WGCA 1VJOA 4ISYA 2D61A 1OATA 1SZKA 1U08A 3FRKA 1DJEA 2BHXA 4M2KA 3FDDA 1TATA 4UOYA 1AKBA 3BC8A 3IHJA 2Q7WA 2X5FA 1ARIA 1B9HA 4JEXA 4M2JA 4AH3A 3BWNC 2AATA 2HZPA 3B8XA 4RJ0A 4UHMA 1M4NA 1GEXA 4ITXA 4RKCA 3WLXA 3AEJC 3B46A 5M49A 3TFTA 1JF9A 3E2ZA 4W1WA 1GBNA 4WYGA 1W7NA 1AHXA 1EQBA 4MKKA 4BA5A 2DOUA 3DRDA 5AX8A 2Z20A 4ITGA 2AEUA 4XJLA 1AMQA 1WKGA 3AOVA 3E2ZB 3EIAA 2W7HA 1ASNA 1AMAA 1ASBA 3JU7A 2ZSLA 4BMKA 2W7DA 3MC6A 3ZZJA 2X3LA 1B9IA 5HHYA 3I5TA 4XK1A 3RQ1A 2Z1ZA 2ZC0A 5E4ZA 3FQ7A 1C7GA 4WYEA 3RI6A 2QLRA 1OHWA 3PDXA 3A2BA 5G4JA 4M2MA 4ADDA 5EQCA 4JF0A 4AZJA 5F9SA 3QHXA 2VMWA 2VMZA 4GE9A 1CZCA 3OP7A 2E7JA 3HBXA 1QJ3A 4MSOA 4I8AA 2W7KA 1AHFA 1IVRA 1MDOA 1P3WA 2VMSA 5BJ3A 3MADA 1I29A 1KKPA 4XJMA 1KL1A 2VMVA 1PMOA 4W5KA 1LK9A 1UKJA 2VGWA 3AEPA 4XJOA 3I16A 4IYOA 1W7MA 2VMTA 4OTLA 3RBLA 3TATA 3B1DA 2VI8A 2W7JA 4ZWMA 1QITA 4WLJA 1UU0A 1V72A 5C6UA 2BWNA 2YKUA 3LVLB 2VI9A 2WK8A 3HVYA 1PG8A 4IYOB 4MQRA 1IX8A 1B4XA 1QGNA 4OBVA 4E3RA 4LNJA 1T3IA 3ASBA 3A9ZA 4RM1A 2BIGA 3WZFA 4F5HA 1KL2A 4U1TA 1CQ6A 2HUFA 1ECXA 2ZY3A 2EZ2A 1W3UA 5FT5A 3F6TA 2W7GA 4BQ0A 1WKHA 3LV2A 3FDBA 3W1HA 3BN1A 3FTBA 3E9KA 2C44A 1GC2A 3NU7A 1SPAA 2Z9XA 2QMAA 1BJNA 1KMKA 1S0AA 3BCBA 5EIGA 3WGBA 2JGTA 3BB8A 4WYCA 5E3KA 1ASFA 1AMRA 4Q75A 1LS3A 3D6KA 1AJSA 1LW5A 3LG0A 2TPLA 3VK2A 1GC0A 4K2BA 2VGVA 1JS6A 3PJ0A 4BA4A 2JG2A 1J32A 5EIGB 2E7UA 3VAXA 1BQAA 4F5MA 3HL2A 1AJSB 3NRAA 4DBCA 3CQ5A 2D7ZA 1IJIA 1BJOA 3AEMC 3ACZA 2W7MA 1CS1A 1Z7DA 1V2EA 4DQ6A 4P7YA 1VEFA 4RKDA 1N8PA 2Z9VA 4AZKA 1TOGA 1TOJA 3FQ8A 1YIYA 1BJOB 1ELQA 1YNUA 2DKJA 1DFOA 2GB3A 2V0YA 2VMNA 4GE4A 3T32A 4ADBA 2W7FA 5G2PA 3JTXA 3QGUA 1ASEA 2R5EA 5K8BA 3NYTA 1AHEA 2VMOA 1AHYA 1DKAA 1X0MA 2BYLA 1YAAA 2JISA 4HVKA 3WX9A 4F5LA 3KGWA 1IAYA 3FD0A 4JF1A 3DXVA 1RV3A 1GC3A 4U2HA 2GMUA 2AY2A 3ECDA 2CB1A 1UU2A 2HOYA 1Z3ZA 4XQ2A 1ARTA 5EAVA 3OKSA 2EZ1A 3L8AA 5EUNA 2AEVA 2D63A 3FVUA 2XH1A 3TQXA 2HORA 1CL2A 2AY7A 1IUGA 2DKBA 2O1BA 2R2NA 1ASAA 3DR4A 2DR1A 4OCAA 4OT8A 4ZSYA 3BCAA 4CVQA 4LNMA 2CJHA 2D7YA 7AATA 4ZASA 2Z67A 3VK3A 1SFFA 3WY7A 1LC8A 1GC4A 1QJ5A 1TOEA 1MAPA 5FT6A 3F0HA 1AICA 3MKJA 1CJ0A 3RUYA 2OATA 2AY9A 4LC3A 4OYTA 3LVKA 1CQ7A 1IX6A 2AY8A 3WKRA 3MBBA 3GZDA 2RFVA 3A9YA 4IXSA 1C7NA 2OQXA 1G4XA 1BS0A 2C0RA 2OKKA 1B8GA 2W7EA 4WLHA 1D7VA 3NTJA 2BI2A 2EGYA 2QBTA 2CJDA 2YHKA 1N2TA 1PFFA 2F8JA 1MAQA 2Z9WA 2HOXA 3JZLA 4Q31A 4XEWA 5TF5A 4Q6RA 3K28A 1D2FA 2W7IA 4ZAHA 3P1TA 4OBUA 3BWNA 4E3QA 4ADCA 4WXFA 1WYUA 3A9XA 5I92A 3EZ1A 3NYSA 2ZP7A 1G7WA 2R0TA 1D7RA 3AEJA 3GETA 1AX4A 1D7UA 3MEBA 5G4IA 1UU1A 2E54A 2W8WA 3EI7A 5G2QA 1GDEA 1CQ8A 1M6SA 1I41A 4TN4A 1FC4A 2JJEA 4EMYA 4GRXA 2ZY5A 1M0OA 4A6RA 1KMJA 1V2DA 3QM2A 1AY4A 1BJWA 4IW7A 2AY4A 3LWSA 4KAMA 2YRRA 1WSTA 1BJ4A 3KKIA 3BWOA 4IY7A 2GMSA 3NUBA 3FFHA 3NU8A 1AIAA 4PFFA 3RBFA 4JE5A 1AY8A 4UHNA 2Z9UA 4WD2A 4CXRA 2GQNA 2XBNA 2QA3A 1CZEA 2CJGA 3LVMA 1LC5A 2HUIA 3AATA 4ZLVA 1RVUA 2Z1YA 2BI5A 4KXKA 4H51A 5EAAA 2DGKA 2R5CA 4ADEA 2VIAA 2WK9A 3MAFA 1OXOA 3ELEA 3PA9A 4R5FA 1M0PA 2VMRA 3FCRA 3K40A 5G0AA 4N0BA 4AOAA 3ELPA 4E1OA 1WYVA 2BI3A 2FM1A 4PIWA 3MAFB 4XAUA 1X2AA 1M0NA 3TFUA 3EUCA 2PB2A 4R2NA 3EI5A 3QBOA 1AIBA 1YJYA 2DGLA 1WYVB
chains in the Genus database with same CATH superfamily
1D7SA 4JEVA 4A0HA 1O61A 4AO4A 4AO9A 1TASA 4RIZA 4WYDA 2OKJA 3KE3A 4LNLA 3ZRRA 4ZDOA 1IAXA 2O0RA 3CQ4A 2AY6A 2WKAA 2ORDA 2C81A 2CH2A 2WK7A 1G4VA 3KGXA 4ATQA 2HOZA 1GEYA 2CTZA 2D65A 4WBTA 4LW2A 2VYCA 2ZY2A 1C9CA 1W7LA 4MKJA 1RV4A 3UWCA 2X8UA 3FSLA 4A0FA 3HQTA 4W91A 4R5ZA 1BW0A 2YCNA 1QISA 5KTBA 4XJPA 2NMPA 5BJ4A 2FN6A 2BI1A 2YKYA 5FT4A 2C7TA 3PAAA 2BI9A 4N0WA 4IXOA 1SZUA 1B5PA 5DJ9A 2JJFA 3NDNA 1ASGA 1MLZA 4W1XA 3CQ6A 4WYFA 2HP2A 1AY5A 2EH6A 1O69A 2PB0A 2D66A 2AY5A 2HUUA 2FNUA 4WP0A 4RITA 3JWAA 1AKCA 1ELUA 3I4JA 4JE5D 4A6UA 3COGA 4ZWVA 2W8TA 3ZRPA 1ASLA 9AATA 4NOGA 3DXWA 1AAMA 1BQDA 3NNKA 3W1IA 1V2FA 3N4XA 1AKAA 3AEMA 3PGYA 4EU1A 1GEWA 3N5MA 4GE7A 1PMMA 3CAIA 2CANA 3FQAA 2ZYJA 2HP1A 2FQ6A 1GCKA 3BV0A 3AELA 1S09A 3JW9A 3R4TA 1G7XA 2W8JA 5LH9A 3E2YA 1TARA 1DJ9A 3M5UA 1AJRA 1S07A 3AENA 4MGRA 2OGAA 4B98A 1MLYA 5G09A 4ATPA 4E77A 3ATHA 5LHAA 1XEYA 5M4DA 3FVXA 2W8UA 2YCPA 4TV7A 5EUEA 4K2IA 4BHDA 1SVVA 3MC6C 1M0QA 2PO3A 2YKVA 2X5DA 3CBFA 4L0OA 3AENB 3N0LA 1ASDA 3GWPA 3VP6A 3LVJA 2VGUA 3ASAA 5FT8A 4GEBA 1SF2A 2WB6A 4WYAA 4ZM3A 2VGSA 1B5OA 4FL0A 3H7FA 3UAKA 1YOOA 1O62A 4ZM4A 1TOIA 3GJUA 2QB3A 4ZDLA 1N31A 1DGDA 3BCXA 1SZSA 2BWPA 3GZCA 4OMAA 1CL1A 4W8IA 3B1CA 1EJIA 3IF2A 1OXPA 4K2MA 5D95A 2CSTA 1W23A 2YKXA 3VOMA 5HDMA 4CBSA 1LKCA 2BYJA 3DR7A 3G7QA 4ZSWA 2ZUKA 3FZ6A 4KYOA 4MQPA 1IBJA 4RAEA 3EI8A 4H63Q 3WCNA 4IX8A 3QI6A 1X28A 3HDOA 1YJSA 3E6GA 5F8VA 1QZ9A 1ZC9A 1WYUB 3FZ8A 5DB5A 3EIBA 2EO5A 3G0TA 1O4SA 2KFPA 2BKWA 1H0CA 1QIRA 3FKDA 3HMUA 3PPLA 4QGRA 4F5IA 2JJGA 8AATA 4ZDPA 1BKGA 5DJ1A 2CY8A 1I43A 4A6TA 1ASCA 4W1VA 2AY3A 2DGMA 2ZJGA 1DGEA 2D5YA 3PDBA 2ZY4A 5EFSA 5HXXA 3DZZA 4P3MA 5D5SA 3GR9A 2W8VA 3USFA 4UQVA 3QN6A 2VMUA 4RLGA 2D64A 1M7YA 2YOBA 4JEZA 3RCHA 3PDBB 2VGTA 1JS3A 2VIBA 3FFRA 1MDXA 3FVSA 4Y0DA 3H9XA 1RVYA 2O7CA 1MGVA 1TOKA 2YCTA 3NUIA 2FYFA 1AHGA 1E5EA 2R5CB 3RCHB 2VMYA 3LY1A 1YIZA 4F5FA 4A72A 3N75A 3H14A 2VGZA 4Q76A 2VMPA 4IXZA 2W7LA 2VLFA 2FNIA 4RJYA 2E7IA 2JJHA 3II0A 2GSAA 4PFNA 4J5UA 2CFBA 3WKSA 3DC1A 1FG7A 1XI9A 4EB5A 3DYDA 3GSBA 1ASMA 1MDZA 2BIAA 2EPJA 3NX3A 3E2FA 2QSRA 1OHVA 1KKJA 2CINA 1M32A 4GDYA 3R9AA 1LC7A 4F5KA 3WCOA 3AOWA 3JWBA 1OHYA 1ARHA 1ORDA 4EB7A 5DX5A 4A0GA 2Z61A 3ZZKA 4F4EA 5EUDA 1ZOBA 4JEWA 1YJZA 3B1EA 1AAWA 3A8UX 3DU4A 1ZODA 3PD6A 3TCMA 4GSAA 4WB0A 1X29A 4CXQA 1DTYA 2CH1A 2VMXA 3DODA 3VK4A 4JEYA 1EG5A 4UHOA 1I48A 3L44A 3E77A 1DJUA 3EI6A 3PD6B 3QPGA 1IX7A 1S06A 3EZSA 3G8MA 2VLHA 4R8DA 4WB0B 3AEOA 1C0NA 2YRIA 4WXBA 4F5JA 3AV7A 3NYUA 3UE8A 1H1CA 3K7YA 1TPLA 3MAUA 4O6ZA 4A00A 2ZSMA 4PVFA 3BS8A 3EI9A 2FKIA 1Y4IA 3HLMA 1JG8A 2AY1A 4CBRA 1FG3A 3F9TA 4Y0HA 1ARSA 3GBXA 3N7NA 1WYTA 1ARGA 4FFCA 1E5FA 4LW4A 4MQQA 2OGEA 3HT4A 3PIUA 5E5IA 5J8QA 4A0RA 4EFFA 3FZ7A 4DGTA 1AMSA 4HF8A 1C4KA 4J8LA 3W1JA 4F5GA 4Y0IA 4MY5A 1VP4A 1LW4A 1GD9A 1BT4A 1WYTB 2VMQA 2QB2A 3GZDC 4TMRA 3ZRQA 5M4BA 1J04A 3ISLA 2BIEA 1C7OA 2BWOA 2V1PA 3P6KA 3Q8NA 4WXGA 5M46A 5IWQA 1S08A 4OC9A 2G6WA 4B9BA 5JAYA 3WGCA 1VJOA 4ISYA 2EYQA 2D61A 1OATA 1SZKA 1U08A 3FRKA 1DJEA 2BHXA 4M2KA 3FDDA 1TATA 4UOYA 1AKBA 3BC8A 3IHJA 2Q7WA 2X5FA 1ARIA 1B9HA 4JEXA 4M2JA 4AH3A 3BWNC 2AATA 2HZPA 3B8XA 4RJ0A 4UHMA 1M4NA 1GEXA 4ITXA 4RKCA 3WLXA 3AEJC 3B46A 5M49A 3TFTA 1JF9A 3E2ZA 4W1WA 1GBNA 4WYGA 1W7NA 1AHXA 1EQBA 4MKKA 4BA5A 2DOUA 3DRDA 5AX8A 2Z20A 4ITGA 2AEUA 4XJLA 1AMQA 1WKGA 3AOVA 3E2ZB 3EIAA 2W7HA 1ASNA 1AMAA 1ASBA 3JU7A 2ZSLA 4BMKA 2W7DA 3MC6A 3ZZJA 2X3LA 1B9IA 5HHYA 3I5TA 2A1VA 4XK1A 3RQ1A 2Z1ZA 2ZC0A 5E4ZA 3FQ7A 1C7GA 4WYEA 3RI6A 2QLRA 1OHWA 3PDXA 3A2BA 5G4JA 4M2MA 4ADDA 5EQCA 4JF0A 4AZJA 5F9SA 3QHXA 2VMWA 2VMZA 4GE9A 1CZCA 3OP7A 2E7JA 3HBXA 1QJ3A 4MSOA 4I8AA 2W7KA 1AHFA 1IVRA 1MDOA 1P3WA 2VMSA 5BJ3A 3MADA 1I29A 1KKPA 4XJMA 1KL1A 2VMVA 1PMOA 4W5KA 1LK9A 1UKJA 2VGWA 3AEPA 4XJOA 3I16A 4IYOA 1W7MA 2VMTA 4OTLA 3RBLA 3TATA 3B1DA 2VI8A 2W7JA 4ZWMA 1QITA 4WLJA 1UU0A 1V72A 5C6UA 2BWNA 2YKUA 3LVLB 2VI9A 2WK8A 3HVYA 1PG8A 4IYOB 4MQRA 1IX8A 1B4XA 1QGNA 4OBVA 4E3RA 4LNJA 1T3IA 1KAFA 3ASBA 3A9ZA 4RM1A 2BIGA 3WZFA 4F5HA 1KL2A 4U1TA 1CQ6A 2HUFA 1ECXA 2ZY3A 2EZ2A 1W3UA 5FT5A 3F6TA 2W7GA 4BQ0A 1WKHA 3LV2A 3FDBA 3W1HA 3BN1A 3FTBA 3E9KA 2C44A 1GC2A 3NU7A 1SPAA 2Z9XA 2QMAA 1BJNA 1KMKA 1S0AA 3BCBA 5EIGA 3WGBA 2JGTA 3BB8A 4WYCA 5E3KA 1ASFA 1AMRA 4Q75A 1LS3A 3D6KA 1AJSA 1LW5A 3LG0A 2TPLA 3VK2A 1GC0A 4K2BA 2VGVA 1JS6A 3PJ0A 4BA4A 2JG2A 1J32A 5EIGB 2E7UA 3VAXA 1BQAA 4F5MA 4K05A 3HL2A 1AJSB 3NRAA 4DBCA 3CQ5A 2D7ZA 1IJIA 1BJOA 3AEMC 3ACZA 2W7MA 1CS1A 1Z7DA 1V2EA 4DQ6A 4P7YA 1VEFA 4RKDA 1N8PA 2Z9VA 4AZKA 1TOGA 1TOJA 3FQ8A 1YIYA 1BJOB 1ELQA 1YNUA 2DKJA 1DFOA 2GB3A 2V0YA 2VMNA 4GE4A 3T32A 4ADBA 2W7FA 5G2PA 3JTXA 3QGUA 1ASEA 2R5EA 5K8BA 3NYTA 1AHEA 2VMOA 1AHYA 1DKAA 1X0MA 2BYLA 1YAAA 2JISA 4HVKA 3WX9A 4F5LA 3KGWA 1IAYA 3FD0A 4JF1A 3DXVA 1RV3A 1GC3A 4U2HA 2GMUA 2AY2A 3ECDA 2CB1A 1UU2A 2HOYA 1Z3ZA 4XQ2A 1ARTA 5EAVA 3OKSA 2EZ1A 3L8AA 5EUNA 2AEVA 2D63A 3FVUA 2XH1A 3TQXA 2HORA 1CL2A 2AY7A 1IUGA 2DKBA 2O1BA 2R2NA 1ASAA 3DR4A 2DR1A 4OCAA 4OT8A 4ZSYA 3BCAA 4CVQA 4LNMA 2CJHA 2D7YA 7AATA 4ZASA 2Z67A 3VK3A 1SFFA 3WY7A 1LC8A 1GC4A 1QJ5A 2G7JA 1TOEA 1MAPA 5FT6A 3F0HA 1AICA 3MKJA 1CJ0A 3RUYA 2OATA 2AY9A 4LC3A 4OYTA 3LVKA 1CQ7A 1IX6A 2AY8A 3WKRA 3MBBA 3GZDA 2RFVA 3A9YA 4IXSA 1C7NA 2OQXA 1G4XA 1BS0A 2C0RA 2OKKA 1B8GA 2W7EA 4WLHA 1D7VA 3NTJA 2BI2A 2EGYA 2QBTA 2CJDA 2YHKA 1N2TA 1PFFA 2F8JA 1MAQA 2Z9WA 2HOXA 3JZLA 4Q31A 4XEWA 5TF5A 4Q6RA 3K28A 1D2FA 2W7IA 4ZAHA 3P1TA 4OBUA 3BWNA 4E3QA 4ADCA 4WXFA 1WYUA 3A9XA 5I92A 3N4SA 3N4RA 3EZ1A 3NYSA 2ZP7A 1G7WA 2R0TA 1D7RA 3AEJA 3GETA 1AX4A 1D7UA 3MEBA 5G4IA 1UU1A 2E54A 2W8WA 3EI7A 5G2QA 1GDEA 1CQ8A 1M6SA 1I41A 4TN4A 1FC4A 2JJEA 4EMYA 4GRXA 2ZY5A 1M0OA 4A6RA 1KMJA 1V2DA 3QM2A 1AY4A 1BJWA 4IW7A 2AY4A 3LWSA 4KAMA 2YRRA 1WSTA 1BJ4A 3KKIA 3BWOA 4IY7A 2GMSA 3NUBA 3FFHA 3NU8A 1AIAA 4PFFA 3RBFA 4JE5A 1AY8A 4UHNA 2Z9UA 4WD2A 4CXRA 2GQNA 2XBNA 2QA3A 1CZEA 2CJGA 3LVMA 1LC5A 2HUIA 3AATA 4ZLVA 1RVUA 2Z1YA 2BI5A 4KXKA 4H51A 5EAAA 2DGKA 2R5CA 4ADEA 2VIAA 2WK9A 3MAFA 1OXOA 3ELEA 3PA9A 4R5FA 1M0PA 2VMRA 3FCRA 3K40A 5G0AA 4N0BA 4AOAA 3ELPA 4E1OA 1WYVA 2BI3A 2FM1A 4PIWA 3MAFB 4XAUA 1X2AA 1M0NA 3TFUA 3EUCA 2PB2A 4R2NA 3EI5A 3QBOA 1AIBA 1YJYA 2DGLA 1WYVB
chains in the Genus database with same CATH topology
1D7SA 4JEVA 4A0HA 1O61A 4AO4A 4AO9A 1TASA 4RIZA 4WYDA 2OKJA 3KE3A 4LNLA 3ZRRA 4ZDOA 1IAXA 2O0RA 3CQ4A 2AY6A 2WKAA 2ORDA 2C81A 2CH2A 2WK7A 1G4VA 3KGXA 4ATQA 2HOZA 1GEYA 2CTZA 2D65A 4WBTA 4LW2A 2VYCA 2ZY2A 1C9CA 1W7LA 4MKJA 1RV4A 3UWCA 2X8UA 3FSLA 4A0FA 3HQTA 4W91A 4R5ZA 1BW0A 2YCNA 1QISA 5KTBA 4XJPA 2NMPA 5BJ4A 2FN6A 2BI1A 2YKYA 5FT4A 2C7TA 3PAAA 2BI9A 4N0WA 4IXOA 1SZUA 1B5PA 5DJ9A 2JJFA 3NDNA 1ASGA 1MLZA 4W1XA 3CQ6A 4WYFA 2HP2A 1AY5A 2EH6A 1O69A 2PB0A 2D66A 2AY5A 2HUUA 2FNUA 4WP0A 4RITA 3JWAA 1AKCA 1ELUA 3I4JA 4JE5D 4A6UA 3COGA 4ZWVA 2W8TA 3ZRPA 1ASLA 9AATA 4NOGA 3DXWA 1AAMA 1BQDA 3NNKA 3W1IA 1V2FA 3N4XA 1AKAA 3AEMA 3PGYA 4EU1A 1GEWA 3N5MA 4GE7A 1PMMA 3CAIA 2CANA 3FQAA 2ZYJA 2HP1A 2FQ6A 1GCKA 3BV0A 3AELA 1S09A 3JW9A 3R4TA 1G7XA 2W8JA 5LH9A 3E2YA 1TARA 1DJ9A 3M5UA 1AJRA 1S07A 3AENA 4MGRA 2OGAA 4B98A 1MLYA 5G09A 4ATPA 4E77A 3ATHA 5LHAA 1XEYA 5M4DA 3FVXA 2W8UA 2YCPA 4TV7A 5EUEA 4K2IA 4BHDA 1SVVA 3MC6C 1M0QA 2PO3A 2YKVA 2X5DA 3CBFA 4L0OA 3AENB 3N0LA 1ASDA 3GWPA 3VP6A 3LVJA 2VGUA 3ASAA 5FT8A 4GEBA 1SF2A 2WB6A 4WYAA 4ZM3A 2VGSA 1B5OA 4FL0A 3H7FA 3UAKA 1YOOA 1O62A 4ZM4A 1TOIA 3GJUA 2QB3A 4ZDLA 1N31A 1DGDA 3BCXA 1SZSA 2BWPA 3GZCA 4OMAA 1CL1A 4W8IA 3B1CA 1EJIA 3IF2A 1OXPA 4K2MA 5D95A 2CSTA 1W23A 2YKXA 3VOMA 5HDMA 4CBSA 1LKCA 2BYJA 3DR7A 3G7QA 4ZSWA 2ZUKA 3FZ6A 4KYOA 4MQPA 1IBJA 4RAEA 3EI8A 4H63Q 3WCNA 4IX8A 3QI6A 1X28A 3HDOA 1YJSA 3E6GA 5F8VA 1QZ9A 1ZC9A 1WYUB 3FZ8A 5DB5A 3EIBA 2EO5A 3G0TA 1O4SA 2KFPA 2BKWA 1H0CA 1QIRA 3FKDA 3HMUA 3PPLA 4QGRA 4F5IA 2JJGA 8AATA 4ZDPA 1BKGA 5DJ1A 2CY8A 1I43A 4A6TA 1ASCA 4W1VA 2AY3A 2DGMA 2ZJGA 1DGEA 2D5YA 3PDBA 2ZY4A 5EFSA 5HXXA 3DZZA 4P3MA 5D5SA 3GR9A 2W8VA 3USFA 4UQVA 3QN6A 2VMUA 4RLGA 2D64A 1M7YA 2YOBA 4JEZA 3RCHA 3PDBB 2VGTA 1JS3A 2VIBA 3FFRA 1MDXA 3FVSA 4Y0DA 3H9XA 1RVYA 2O7CA 1MGVA 1TOKA 2YCTA 3NUIA 2FYFA 1AHGA 1E5EA 2R5CB 3RCHB 2VMYA 3LY1A 1YIZA 4F5FA 4A72A 3N75A 3H14A 2VGZA 4Q76A 2VMPA 4IXZA 2W7LA 2VLFA 2FNIA 4RJYA 2E7IA 2JJHA 3II0A 2GSAA 4PFNA 4J5UA 2CFBA 3WKSA 3DC1A 1FG7A 1XI9A 4EB5A 3DYDA 3GSBA 1ASMA 1MDZA 2BIAA 2EPJA 3NX3A 3E2FA 2QSRA 1OHVA 1KKJA 2CINA 1M32A 4GDYA 3R9AA 1LC7A 4F5KA 3WCOA 3AOWA 3JWBA 1OHYA 1ARHA 1ORDA 4EB7A 5DX5A 4A0GA 2Z61A 3ZZKA 4F4EA 5EUDA 1ZOBA 4JEWA 1YJZA 3B1EA 1AAWA 3A8UX 3DU4A 1ZODA 3PD6A 3TCMA 4GSAA 4WB0A 1X29A 4CXQA 1DTYA 2CH1A 2VMXA 3DODA 3VK4A 4JEYA 1EG5A 4UHOA 1I48A 3L44A 3E77A 1DJUA 3EI6A 3PD6B 3QPGA 1IX7A 1S06A 3EZSA 3G8MA 2VLHA 4R8DA 4WB0B 3AEOA 1C0NA 2YRIA 4WXBA 4F5JA 3AV7A 3NYUA 3UE8A 1H1CA 3K7YA 1TPLA 3MAUA 4O6ZA 4A00A 2ZSMA 4PVFA 3BS8A 3EI9A 2FKIA 1Y4IA 3HLMA 1JG8A 2AY1A 4CBRA 1FG3A 3F9TA 4Y0HA 1ARSA 3GBXA 3N7NA 1WYTA 1ARGA 4FFCA 1E5FA 4LW4A 4MQQA 2OGEA 3HT4A 3PIUA 5E5IA 5J8QA 4A0RA 4EFFA 3FZ7A 4DGTA 1AMSA 4HF8A 1C4KA 4J8LA 3W1JA 4F5GA 4Y0IA 4MY5A 1VP4A 1LW4A 1GD9A 1BT4A 1WYTB 2VMQA 2QB2A 3GZDC 4TMRA 3ZRQA 5M4BA 1J04A 3ISLA 2BIEA 1C7OA 2BWOA 2V1PA 3P6KA 3Q8NA 4WXGA 5M46A 5IWQA 1S08A 4OC9A 2G6WA 4B9BA 5JAYA 3WGCA 1VJOA 4ISYA 2EYQA 2D61A 1OATA 1SZKA 1U08A 3FRKA 1DJEA 2BHXA 4M2KA 3FDDA 1TATA 4UOYA 1AKBA 3BC8A 3IHJA 2Q7WA 2X5FA 1ARIA 1B9HA 4JEXA 4M2JA 4AH3A 3BWNC 2AATA 2HZPA 3B8XA 4RJ0A 4UHMA 1M4NA 1GEXA 4ITXA 4RKCA 3WLXA 3AEJC 3B46A 5M49A 3TFTA 1JF9A 3E2ZA 4W1WA 1GBNA 4WYGA 1W7NA 1AHXA 1EQBA 4MKKA 4BA5A 2DOUA 3DRDA 5AX8A 2Z20A 4ITGA 2AEUA 4XJLA 1AMQA 1WKGA 3AOVA 3E2ZB 3EIAA 2W7HA 1ASNA 1AMAA 1ASBA 3JU7A 2ZSLA 4BMKA 2W7DA 3MC6A 3ZZJA 2X3LA 1B9IA 5HHYA 3I5TA 2A1VA 4XK1A 3RQ1A 2Z1ZA 2ZC0A 5E4ZA 3FQ7A 1C7GA 4WYEA 3RI6A 2QLRA 1OHWA 3PDXA 3A2BA 5G4JA 4M2MA 4ADDA 5EQCA 4JF0A 4AZJA 5F9SA 3QHXA 2VMWA 2VMZA 4GE9A 1CZCA 3OP7A 2E7JA 3HBXA 1QJ3A 4MSOA 4I8AA 2W7KA 1AHFA 1IVRA 1MDOA 1P3WA 2VMSA 5BJ3A 3MADA 1I29A 1KKPA 4XJMA 1KL1A 2VMVA 1PMOA 4W5KA 1LK9A 1UKJA 2VGWA 3AEPA 4XJOA 3I16A 4IYOA 1W7MA 2VMTA 4OTLA 3RBLA 3TATA 3B1DA 2VI8A 2W7JA 4ZWMA 1QITA 4WLJA 1UU0A 1V72A 5C6UA 2BWNA 2YKUA 3LVLB 2VI9A 2WK8A 3HVYA 1PG8A 4IYOB 4MQRA 1IX8A 1B4XA 1QGNA 4OBVA 4E3RA 4LNJA 1T3IA 3ASBA 3A9ZA 4RM1A 2BIGA 3WZFA 4F5HA 1KL2A 4U1TA 1CQ6A 2HUFA 1ECXA 2ZY3A 2EZ2A 1W3UA 5FT5A 3F6TA 2W7GA 4BQ0A 1WKHA 3LV2A 3FDBA 3W1HA 3BN1A 3FTBA 3E9KA 2C44A 1GC2A 3NU7A 1SPAA 2Z9XA 2QMAA 1BJNA 1KMKA 1S0AA 3BCBA 5EIGA 3WGBA 2JGTA 3BB8A 4WYCA 5E3KA 1ASFA 1AMRA 4Q75A 1LS3A 3D6KA 1AJSA 1LW5A 3LG0A 2TPLA 3VK2A 1GC0A 4K2BA 2VGVA 1JS6A 3PJ0A 4BA4A 2JG2A 1J32A 5EIGB 2E7UA 3VAXA 1BQAA 4F5MA 4K05A 3HL2A 1AJSB 3NRAA 4DBCA 3CQ5A 2D7ZA 1IJIA 1BJOA 3AEMC 3ACZA 2W7MA 1CS1A 1Z7DA 1V2EA 4DQ6A 4P7YA 1VEFA 4RKDA 1N8PA 2Z9VA 4AZKA 1TOGA 1TOJA 3FQ8A 1YIYA 1BJOB 1ELQA 1YNUA 2DKJA 1DFOA 2GB3A 2V0YA 2VMNA 4GE4A 3T32A 4ADBA 2W7FA 5G2PA 3JTXA 3QGUA 1ASEA 2R5EA 5K8BA 3NYTA 1AHEA 2VMOA 1AHYA 1DKAA 1X0MA 2BYLA 1YAAA 2JISA 4HVKA 3WX9A 4F5LA 3KGWA 1IAYA 3FD0A 4JF1A 3DXVA 1RV3A 1GC3A 4U2HA 2GMUA 2AY2A 3ECDA 2CB1A 1UU2A 2HOYA 1Z3ZA 4XQ2A 1ARTA 5EAVA 3OKSA 2EZ1A 3L8AA 5EUNA 2AEVA 2D63A 3FVUA 2XH1A 3TQXA 2HORA 1CL2A 2AY7A 1IUGA 2DKBA 2O1BA 2R2NA 1ASAA 3DR4A 2DR1A 4OCAA 4OT8A 4ZSYA 3BCAA 4CVQA 4LNMA 2CJHA 2D7YA 7AATA 4ZASA 2Z67A 3VK3A 1SFFA 3WY7A 1LC8A 1GC4A 1QJ5A 2G7JA 1TOEA 1MAPA 5FT6A 3F0HA 1AICA 3MKJA 1CJ0A 3RUYA 2OATA 2AY9A 4LC3A 4OYTA 3LVKA 1CQ7A 1IX6A 2AY8A 3WKRA 3MBBA 3GZDA 2RFVA 3A9YA 4IXSA 1C7NA 2OQXA 1G4XA 1BS0A 2C0RA 2OKKA 1B8GA 2W7EA 4WLHA 1D7VA 3NTJA 2BI2A 2EGYA 2QBTA 2CJDA 2YHKA 1N2TA 1PFFA 2F8JA 1MAQA 2Z9WA 2HOXA 3JZLA 4Q31A 4XEWA 5TF5A 4Q6RA 3K28A 1D2FA 2W7IA 4ZAHA 3P1TA 4OBUA 3BWNA 4E3QA 4ADCA 4WXFA 1WYUA 3A9XA 5I92A 3N4SA 3N4RA 3EZ1A 3NYSA 2ZP7A 1G7WA 2R0TA 1D7RA 3AEJA 3GETA 1AX4A 1D7UA 3MEBA 5G4IA 1UU1A 2E54A 2W8WA 3EI7A 5G2QA 1GDEA 1CQ8A 1M6SA 1I41A 4TN4A 1FC4A 2JJEA 4EMYA 4GRXA 2ZY5A 1M0OA 4A6RA 1KMJA 1V2DA 3QM2A 1AY4A 1BJWA 4IW7A 2AY4A 3LWSA 4KAMA 2YRRA 1WSTA 1BJ4A 3KKIA 3BWOA 4IY7A 2GMSA 3NUBA 3FFHA 3NU8A 1AIAA 4PFFA 3RBFA 4JE5A 1AY8A 4UHNA 2Z9UA 4WD2A 4CXRA 2GQNA 2XBNA 2QA3A 1CZEA 2CJGA 3LVMA 1LC5A 2HUIA 3AATA 4ZLVA 1RVUA 2Z1YA 2BI5A 4KXKA 4H51A 5EAAA 2DGKA 2R5CA 4ADEA 2VIAA 2WK9A 3MAFA 1OXOA 3ELEA 3PA9A 4R5FA 1M0PA 2VMRA 3FCRA 3K40A 5G0AA 4N0BA 4AOAA 3ELPA 4E1OA 1WYVA 2BI3A 2FM1A 4PIWA 3MAFB 4XAUA 1X2AA 1M0NA 3TFUA 3EUCA 2PB2A 4R2NA 3EI5A 3QBOA 1AIBA 1YJYA 2DGLA 1WYVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7S A;  4JEV A;  4A0H A;  1O61 A;  4AO4 A;  4AO9 A;  1TAS A;  4RIZ A;  4WYD A;  2OKJ A;  3KE3 A;  4LNL A;  3ZRR A;  4ZDO A;  1IAX A;  2O0R A;  3CQ4 A;  2AY6 A;  2WKA A;  2ORD A;  2C81 A;  2CH2 A;  2WK7 A;  1G4V A;  3KGX A;  4ATQ A;  2HOZ A;  1GEY A;  2CTZ A;  2D65 A;  4WBT A;  4LW2 A;  2VYC A;  2ZY2 A;  1C9C A;  1W7L A;  4MKJ A;  1RV4 A;  3UWC A;  2X8U A;  3FSL A;  4A0F A;  3HQT A;  4W91 A;  4R5Z A;  1BW0 A;  2YCN A;  1QIS A;  4XJP A;  2NMP A;  5BJ4 A;  2FN6 A;  2BI1 A;  2YKY A;  5FT4 A;  2C7T A;  3PAA A;  2BI9 A;  4N0W A;  4IXO A;  1SZU A;  1B5P A;  5DJ9 A;  2JJF A;  3NDN A;  1ASG A;  1MLZ A;  4W1X A;  3CQ6 A;  4WYF A;  2HP2 A;  1AY5 A;  2EH6 A;  1O69 A;  2PB0 A;  2D66 A;  2AY5 A;  2HUU A;  2FNU A;  4WP0 A;  4RIT A;  3JWA A;  1AKC A;  1ELU A;  3I4J A;  4JE5 D;  4A6U A;  3COG A;  4ZWV A;  2W8T A;  3ZRP A;  1ASL A;  9AAT A;  4NOG A;  3DXW A;  1AAM A;  1BQD A;  3NNK A;  3W1I A;  1V2F A;  1AKA A;  3AEM A;  3PGY A;  4EU1 A;  1GEW A;  3N5M A;  4GE7 A;  1PMM A;  3CAI A;  2CAN A;  3FQA A;  2ZYJ A;  2HP1 A;  2FQ6 A;  1GCK A;  3BV0 A;  3AEL A;  1S09 A;  3JW9 A;  3R4T A;  1G7X A;  2W8J A;  5LH9 A;  3E2Y A;  1TAR A;  1DJ9 A;  3M5U A;  1AJR A;  1S07 A;  3AEN A;  4MGR A;  2OGA A;  4B98 A;  1MLY A;  5G09 A;  4ATP A;  4E77 A;  3ATH A;  5LHA A;  1XEY A;  5M4D A;  3FVX A;  2W8U A;  2YCP A;  4TV7 A;  5EUE A;  4K2I A;  4BHD A;  1SVV A;  3MC6 C;  1M0Q A;  2PO3 A;  2YKV A;  2X5D A;  3CBF A;  4L0O A;  3AEN B;  3N0L A;  1ASD A;  3GWP A;  3VP6 A;  3LVJ A;  2VGU A;  3ASA A;  5FT8 A;  4GEB A;  1SF2 A;  4WYA A;  4ZM3 A;  2VGS A;  1B5O A;  4FL0 A;  3H7F A;  3UAK A;  1YOO A;  1O62 A;  4ZM4 A;  1TOI A;  3GJU A;  2QB3 A;  4ZDL A;  1N31 A;  1DGD A;  3BCX A;  1SZS A;  2BWP A;  3GZC A;  4OMA A;  1CL1 A;  4W8I A;  3B1C A;  1EJI A;  3IF2 A;  1OXP A;  4K2M A;  5D95 A;  2CST A;  1W23 A;  2YKX A;  3VOM A;  5HDM A;  4CBS A;  1LKC A;  2BYJ A;  3DR7 A;  3G7Q A;  4ZSW A;  2ZUK A;  3FZ6 A;  4KYO A;  4MQP A;  1IBJ A;  4RAE A;  3EI8 A;  3WCN A;  4IX8 A;  3QI6 A;  1X28 A;  3HDO A;  1YJS A;  3E6G A;  5F8V A;  1QZ9 A;  1ZC9 A;  1WYU B;  3FZ8 A;  5DB5 A;  3EIB A;  2EO5 A;  3G0T A;  1O4S A;  2BKW A;  1H0C A;  1QIR A;  3FKD A;  3HMU A;  3PPL A;  4QGR A;  4F5I A;  2JJG A;  8AAT A;  4ZDP A;  1BKG A;  5DJ1 A;  2CY8 A;  1I43 A;  4A6T A;  1ASC A;  4W1V A;  2AY3 A;  2DGM A;  2ZJG A;  1DGE A;  2D5Y A;  3PDB A;  2ZY4 A;  5EFS A;  5HXX A;  3DZZ A;  4P3M A;  5D5S A;  3GR9 A;  2W8V A;  3USF A;  4UQV A;  3QN6 A;  2VMU A;  4RLG A;  2D64 A;  1M7Y A;  2YOB A;  4JEZ A;  3RCH A;  3PDB B;  2VGT A;  1JS3 A;  2VIB A;  3FFR A;  1MDX A;  3FVS A;  4Y0D A;  1RVY A;  2O7C A;  1MGV A;  1TOK A;  2YCT A;  3NUI A;  2FYF A;  1AHG A;  1E5E A;  2R5C B;  3RCH B;  2VMY A;  3LY1 A;  1YIZ A;  4F5F A;  4A72 A;  3N75 A;  3H14 A;  2VGZ A;  4Q76 A;  2VMP A;  4IXZ A;  2W7L A;  2VLF A;  2FNI A;  4RJY A;  2E7I A;  2JJH A;  3II0 A;  2GSA A;  4PFN A;  4J5U A;  2CFB A;  3WKS A;  3DC1 A;  1FG7 A;  1XI9 A;  4EB5 A;  3DYD A;  3GSB A;  1ASM A;  1MDZ A;  2BIA A;  2EPJ A;  3NX3 A;  3E2F A;  1OHV A;  1KKJ A;  2CIN A;  1M32 A;  4GDY A;  3R9A A;  1LC7 A;  4F5K A;  3WCO A;  3AOW A;  3JWB A;  1OHY A;  1ARH A;  1ORD A;  4EB7 A;  5DX5 A;  4A0G A;  2Z61 A;  3ZZK A;  4F4E A;  5EUD A;  1ZOB A;  4JEW A;  1YJZ A;  3B1E A;  1AAW A;  3A8U X;  3DU4 A;  1ZOD A;  3PD6 A;  3TCM A;  4GSA A;  4WB0 A;  1X29 A;  4CXQ A;  1DTY A;  2CH1 A;  2VMX A;  3DOD A;  3VK4 A;  4JEY A;  1EG5 A;  4UHO A;  1I48 A;  3L44 A;  3E77 A;  1DJU A;  3EI6 A;  3PD6 B;  3QPG A;  1IX7 A;  1S06 A;  3EZS A;  3G8M A;  2VLH A;  4R8D A;  4WB0 B;  3AEO A;  1C0N A;  2YRI A;  4WXB A;  4F5J A;  3AV7 A;  3NYU A;  3UE8 A;  1H1C A;  3K7Y A;  1TPL A;  3MAU A;  4O6Z A;  4A00 A;  2ZSM A;  4PVF A;  3BS8 A;  3EI9 A;  1Y4I A;  3HLM A;  1JG8 A;  2AY1 A;  4CBR A;  1FG3 A;  3F9T A;  4Y0H A;  1ARS A;  3GBX A;  1WYT A;  1ARG A;  4FFC A;  1E5F A;  4LW4 A;  4MQQ A;  2OGE A;  3HT4 A;  3PIU A;  5E5I A;  5J8Q A;  4A0R A;  4EFF A;  3FZ7 A;  4DGT A;  1AMS A;  4HF8 A;  1C4K A;  4J8L A;  3W1J A;  4F5G A;  4Y0I A;  4MY5 A;  1VP4 A;  1LW4 A;  1GD9 A;  1BT4 A;  1WYT B;  2VMQ A;  2QB2 A;  3GZD C;  4TMR A;  3ZRQ A;  5M4B A;  1J04 A;  3ISL A;  2BIE A;  1C7O A;  2BWO A;  2V1P A;  3P6K A;  3Q8N A;  4WXG A;  5M46 A;  5IWQ A;  1S08 A;  4OC9 A;  2G6W A;  4B9B A;  5JAY A;  3WGC A;  1VJO A;  4ISY A;  2D61 A;  1OAT A;  1SZK A;  1U08 A;  3FRK A;  1DJE A;  2BHX A;  4M2K A;  3FDD A;  1TAT A;  4UOY A;  1AKB A;  3BC8 A;  3IHJ A;  2Q7W A;  2X5F A;  1ARI A;  1B9H A;  4JEX A;  4M2J A;  4AH3 A;  3BWN C;  2AAT A;  2HZP A;  3B8X A;  4RJ0 A;  4UHM A;  1M4N A;  1GEX A;  4ITX A;  4RKC A;  3WLX A;  3AEJ C;  3B46 A;  5M49 A;  3TFT A;  1JF9 A;  3E2Z A;  4W1W A;  1GBN A;  4WYG A;  1W7N A;  1AHX A;  1EQB A;  4MKK A;  4BA5 A;  2DOU A;  3DRD A;  5AX8 A;  2Z20 A;  4ITG A;  2AEU A;  4XJL A;  1AMQ A;  1WKG A;  3AOV A;  3E2Z B;  3EIA A;  2W7H A;  1ASN A;  1AMA A;  1ASB A;  3JU7 A;  2ZSL A;  4BMK A;  2W7D A;  3MC6 A;  3ZZJ A;  2X3L A;  1B9I A;  5HHY A;  3I5T A;  4XK1 A;  3RQ1 A;  2Z1Z A;  2ZC0 A;  5E4Z A;  3FQ7 A;  1C7G A;  4WYE A;  3RI6 A;  2QLR A;  1OHW A;  3PDX A;  3A2B A;  5G4J A;  4M2M A;  4ADD A;  5EQC A;  4JF0 A;  4AZJ A;  5F9S A;  3QHX A;  2VMW A;  2VMZ A;  4GE9 A;  1CZC A;  3OP7 A;  2E7J A;  3HBX A;  1QJ3 A;  4MSO A;  4I8A A;  2W7K A;  1AHF A;  1IVR A;  1MDO A;  1P3W A;  2VMS A;  5BJ3 A;  3MAD A;  1I29 A;  1KKP A;  4XJM A;  1KL1 A;  2VMV A;  1PMO A;  4W5K A;  1LK9 A;  1UKJ A;  2VGW A;  3AEP A;  4XJO A;  3I16 A;  4IYO A;  1W7M A;  2VMT A;  4OTL A;  3RBL A;  3TAT A;  3B1D A;  2VI8 A;  2W7J A;  4ZWM A;  1QIT A;  4WLJ A;  1UU0 A;  1V72 A;  5C6U A;  2BWN A;  2YKU A;  3LVL B;  2VI9 A;  2WK8 A;  3HVY A;  1PG8 A;  4IYO B;  4MQR A;  1IX8 A;  1B4X A;  1QGN A;  4OBV A;  4E3R A;  4LNJ A;  1T3I A;  3ASB A;  3A9Z A;  4RM1 A;  2BIG A;  3WZF A;  4F5H A;  1KL2 A;  4U1T A;  1CQ6 A;  2HUF A;  1ECX A;  2ZY3 A;  2EZ2 A;  1W3U A;  5FT5 A;  3F6T A;  2W7G A;  4BQ0 A;  1WKH A;  3LV2 A;  3FDB A;  3W1H A;  3BN1 A;  3FTB A;  3E9K A;  2C44 A;  1GC2 A;  3NU7 A;  1SPA A;  2Z9X A;  2QMA A;  1BJN A;  1KMK A;  1S0A A;  3BCB A;  5EIG A;  3WGB A;  2JGT A;  3BB8 A;  4WYC A;  5E3K A;  1ASF A;  1AMR A;  4Q75 A;  1LS3 A;  3D6K A;  1AJS A;  1LW5 A;  3LG0 A;  2TPL A;  3VK2 A;  1GC0 A;  4K2B A;  2VGV A;  1JS6 A;  3PJ0 A;  4BA4 A;  2JG2 A;  1J32 A;  5EIG B;  2E7U A;  3VAX A;  1BQA A;  4F5M A;  3HL2 A;  1AJS B;  3NRA A;  4DBC A;  3CQ5 A;  2D7Z A;  1IJI A;  1BJO A;  3AEM C;  3ACZ A;  2W7M A;  1CS1 A;  1Z7D A;  1V2E A;  4DQ6 A;  4P7Y A;  1VEF A;  4RKD A;  1N8P A;  2Z9V A;  4AZK A;  1TOG A;  1TOJ A;  3FQ8 A;  1YIY A;  1BJO B;  1ELQ A;  1YNU A;  2DKJ A;  1DFO A;  2GB3 A;  2V0Y A;  2VMN A;  4GE4 A;  3T32 A;  4ADB A;  2W7F A;  5G2P A;  3JTX A;  3QGU A;  1ASE A;  2R5E A;  5K8B A;  3NYT A;  1AHE A;  2VMO A;  1AHY A;  1DKA A;  1X0M A;  2BYL A;  1YAA A;  2JIS A;  4HVK A;  3WX9 A;  4F5L A;  3KGW A;  1IAY A;  3FD0 A;  4JF1 A;  3DXV A;  1RV3 A;  1GC3 A;  4U2H A;  2GMU A;  2AY2 A;  3ECD A;  2CB1 A;  1UU2 A;  2HOY A;  1Z3Z A;  4XQ2 A;  1ART A;  5EAV A;  3OKS A;  2EZ1 A;  3L8A A;  5EUN A;  2AEV A;  2D63 A;  3FVU A;  2XH1 A;  3TQX A;  2HOR A;  1CL2 A;  2AY7 A;  1IUG A;  2DKB A;  2O1B A;  2R2N A;  1ASA A;  3DR4 A;  2DR1 A;  4OCA A;  4OT8 A;  4ZSY A;  3BCA A;  4CVQ A;  4LNM A;  2CJH A;  2D7Y A;  7AAT A;  4ZAS A;  2Z67 A;  3VK3 A;  1SFF A;  3WY7 A;  1LC8 A;  1GC4 A;  1QJ5 A;  1TOE A;  1MAP A;  5FT6 A;  3F0H A;  1AIC A;  3MKJ A;  1CJ0 A;  3RUY A;  2OAT A;  2AY9 A;  4LC3 A;  4OYT A;  3LVK A;  1CQ7 A;  1IX6 A;  2AY8 A;  3WKR A;  3MBB A;  3GZD A;  2RFV A;  3A9Y A;  4IXS A;  1C7N A;  2OQX A;  1G4X A;  1BS0 A;  2C0R A;  2OKK A;  1B8G A;  2W7E A;  4WLH A;  1D7V A;  3NTJ A;  2BI2 A;  2EGY A;  2QBT A;  2CJD A;  2YHK A;  1N2T A;  1PFF A;  2F8J A;  1MAQ A;  2Z9W A;  2HOX A;  3JZL A;  4Q31 A;  4XEW A;  5TF5 A;  4Q6R A;  3K28 A;  1D2F A;  2W7I A;  4ZAH A;  3P1T A;  4OBU A;  3BWN A;  4E3Q A;  4ADC A;  4WXF A;  1WYU A;  3A9X A;  5I92 A;  3EZ1 A;  3NYS A;  2ZP7 A;  1G7W A;  2R0T A;  1D7R A;  3AEJ A;  3GET A;  1AX4 A;  1D7U A;  3MEB A;  5G4I A;  1UU1 A;  2E54 A;  2W8W A;  3EI7 A;  5G2Q A;  1GDE A;  1CQ8 A;  1M6S A;  1I41 A;  4TN4 A;  1FC4 A;  2JJE A;  4EMY A;  4GRX A;  2ZY5 A;  1M0O A;  4A6R A;  1KMJ A;  1V2D A;  3QM2 A;  1AY4 A;  1BJW A;  4IW7 A;  2AY4 A;  3LWS A;  4KAM A;  2YRR A;  1WST A;  1BJ4 A;  3KKI A;  3BWO A;  4IY7 A;  2GMS A;  3NUB A;  3FFH A;  3NU8 A;  1AIA A;  4PFF A;  3RBF A;  4JE5 A;  1AY8 A;  4UHN A;  2Z9U A;  4WD2 A;  4CXR A;  2GQN A;  2XBN A;  2QA3 A;  1CZE A;  2CJG A;  3LVM A;  1LC5 A;  2HUI A;  3AAT A;  4ZLV A;  1RVU A;  2Z1Y A;  2BI5 A;  4KXK A;  4H51 A;  5EAA A;  2DGK A;  2R5C A;  4ADE A;  2VIA A;  2WK9 A;  3MAF A;  1OXO A;  3ELE A;  3PA9 A;  4R5F A;  1M0P A;  2VMR A;  3FCR A;  3K40 A;  5G0A A;  4N0B A;  4AOA A;  3ELP A;  4E1O A;  1WYV A;  2BI3 A;  2FM1 A;  4PIW A;  3MAF B;  4XAU A;  1X2A A;  1M0N A;  3TFU A;  3EUC A;  2PB2 A;  4R2N A;  3EI5 A;  3QBO A;  1AIB A;  1YJY A;  2DGL A;  1WYV B; 
#chains in the Genus database with same CATH topology
 1D7S A;  4JEV A;  4A0H A;  1O61 A;  4AO4 A;  4AO9 A;  1TAS A;  4RIZ A;  4WYD A;  2OKJ A;  3KE3 A;  4LNL A;  3ZRR A;  4ZDO A;  1IAX A;  2O0R A;  3CQ4 A;  2AY6 A;  2WKA A;  2ORD A;  2C81 A;  2CH2 A;  2WK7 A;  1G4V A;  3KGX A;  4ATQ A;  2HOZ A;  1GEY A;  2CTZ A;  2D65 A;  4WBT A;  4LW2 A;  2VYC A;  2ZY2 A;  1C9C A;  1W7L A;  4MKJ A;  1RV4 A;  3UWC A;  2X8U A;  3FSL A;  4A0F A;  3HQT A;  4W91 A;  4R5Z A;  1BW0 A;  2YCN A;  1QIS A;  5KTB A;  4XJP A;  2NMP A;  5BJ4 A;  2FN6 A;  2BI1 A;  2YKY A;  5FT4 A;  2C7T A;  3PAA A;  2BI9 A;  4N0W A;  4IXO A;  1SZU A;  1B5P A;  5DJ9 A;  2JJF A;  3NDN A;  1ASG A;  1MLZ A;  4W1X A;  3CQ6 A;  4WYF A;  2HP2 A;  1AY5 A;  2EH6 A;  1O69 A;  2PB0 A;  2D66 A;  2AY5 A;  2HUU A;  2FNU A;  4WP0 A;  4RIT A;  3JWA A;  1AKC A;  1ELU A;  3I4J A;  4JE5 D;  4A6U A;  3COG A;  4ZWV A;  2W8T A;  3ZRP A;  1ASL A;  9AAT A;  4NOG A;  3DXW A;  1AAM A;  1BQD A;  3NNK A;  3W1I A;  1V2F A;  3N4X A;  1AKA A;  3AEM A;  3PGY A;  4EU1 A;  1GEW A;  3N5M A;  4GE7 A;  1PMM A;  3CAI A;  2CAN A;  3FQA A;  2ZYJ A;  2HP1 A;  2FQ6 A;  1GCK A;  3BV0 A;  3AEL A;  1S09 A;  3JW9 A;  3R4T A;  1G7X A;  2W8J A;  5LH9 A;  3E2Y A;  1TAR A;  1DJ9 A;  3M5U A;  1AJR A;  1S07 A;  3AEN A;  4MGR A;  2OGA A;  4B98 A;  1MLY A;  5G09 A;  4ATP A;  4E77 A;  3ATH A;  5LHA A;  1XEY A;  5M4D A;  3FVX A;  2W8U A;  2YCP A;  4TV7 A;  5EUE A;  4K2I A;  4BHD A;  1SVV A;  3MC6 C;  1M0Q A;  2PO3 A;  2YKV A;  2X5D A;  3CBF A;  4L0O A;  3AEN B;  3N0L A;  1ASD A;  3GWP A;  3VP6 A;  3LVJ A;  2VGU A;  3ASA A;  5FT8 A;  4GEB A;  1SF2 A;  2WB6 A;  4WYA A;  4ZM3 A;  2VGS A;  1B5O A;  4FL0 A;  3H7F A;  3UAK A;  1YOO A;  1O62 A;  4ZM4 A;  1TOI A;  3GJU A;  2QB3 A;  4ZDL A;  1N31 A;  1DGD A;  3BCX A;  1SZS A;  2BWP A;  3GZC A;  4OMA A;  1CL1 A;  4W8I A;  3B1C A;  1EJI A;  3IF2 A;  1OXP A;  4K2M A;  5D95 A;  2CST A;  1W23 A;  2YKX A;  3VOM A;  5HDM A;  4CBS A;  1LKC A;  2BYJ A;  3DR7 A;  3G7Q A;  4ZSW A;  2ZUK A;  3FZ6 A;  4KYO A;  4MQP A;  1IBJ A;  4RAE A;  3EI8 A;  4H63 Q;  3WCN A;  4IX8 A;  3QI6 A;  1X28 A;  3HDO A;  1YJS A;  3E6G A;  5F8V A;  1QZ9 A;  1ZC9 A;  1WYU B;  3FZ8 A;  5DB5 A;  3EIB A;  2EO5 A;  3G0T A;  1O4S A;  2KFP A;  2BKW A;  1H0C A;  1QIR A;  3FKD A;  3HMU A;  3PPL A;  4QGR A;  4F5I A;  2JJG A;  8AAT A;  4ZDP A;  1BKG A;  5DJ1 A;  2CY8 A;  1I43 A;  4A6T A;  1ASC A;  4W1V A;  2AY3 A;  2DGM A;  2ZJG A;  1DGE A;  2D5Y A;  3PDB A;  2ZY4 A;  5EFS A;  5HXX A;  3DZZ A;  4P3M A;  5D5S A;  3GR9 A;  2W8V A;  3USF A;  4UQV A;  3QN6 A;  2VMU A;  4RLG A;  2D64 A;  1M7Y A;  2YOB A;  4JEZ A;  3RCH A;  3PDB B;  2VGT A;  1JS3 A;  2VIB A;  3FFR A;  1MDX A;  3FVS A;  4Y0D A;  3H9X A;  1RVY A;  2O7C A;  1MGV A;  1TOK A;  2YCT A;  3NUI A;  2FYF A;  1AHG A;  1E5E A;  2R5C B;  3RCH B;  2VMY A;  3LY1 A;  1YIZ A;  4F5F A;  4A72 A;  3N75 A;  3H14 A;  2VGZ A;  4Q76 A;  2VMP A;  4IXZ A;  2W7L A;  2VLF A;  2FNI A;  4RJY A;  2E7I A;  2JJH A;  3II0 A;  2GSA A;  4PFN A;  4J5U A;  2CFB A;  3WKS A;  3DC1 A;  1FG7 A;  1XI9 A;  4EB5 A;  3DYD A;  3GSB A;  1ASM A;  1MDZ A;  2BIA A;  2EPJ A;  3NX3 A;  3E2F A;  2QSR A;  1OHV A;  1KKJ A;  2CIN A;  1M32 A;  4GDY A;  3R9A A;  1LC7 A;  4F5K A;  3WCO A;  3AOW A;  3JWB A;  1OHY A;  1ARH A;  1ORD A;  4EB7 A;  5DX5 A;  4A0G A;  2Z61 A;  3ZZK A;  4F4E A;  5EUD A;  1ZOB A;  4JEW A;  1YJZ A;  3B1E A;  1AAW A;  3A8U X;  3DU4 A;  1ZOD A;  3PD6 A;  3TCM A;  4GSA A;  4WB0 A;  1X29 A;  4CXQ A;  1DTY A;  2CH1 A;  2VMX A;  3DOD A;  3VK4 A;  4JEY A;  1EG5 A;  4UHO A;  1I48 A;  3L44 A;  3E77 A;  1DJU A;  3EI6 A;  3PD6 B;  3QPG A;  1IX7 A;  1S06 A;  3EZS A;  3G8M A;  2VLH A;  4R8D A;  4WB0 B;  3AEO A;  1C0N A;  2YRI A;  4WXB A;  4F5J A;  3AV7 A;  3NYU A;  3UE8 A;  1H1C A;  3K7Y A;  1TPL A;  3MAU A;  4O6Z A;  4A00 A;  2ZSM A;  4PVF A;  3BS8 A;  3EI9 A;  2FKI A;  1Y4I A;  3HLM A;  1JG8 A;  2AY1 A;  4CBR A;  1FG3 A;  3F9T A;  4Y0H A;  1ARS A;  3GBX A;  3N7N A;  1WYT A;  1ARG A;  4FFC A;  1E5F A;  4LW4 A;  4MQQ A;  2OGE A;  3HT4 A;  3PIU A;  5E5I A;  5J8Q A;  4A0R A;  4EFF A;  3FZ7 A;  4DGT A;  1AMS A;  4HF8 A;  1C4K A;  4J8L A;  3W1J A;  4F5G A;  4Y0I A;  4MY5 A;  1VP4 A;  1LW4 A;  1GD9 A;  1BT4 A;  1WYT B;  2VMQ A;  2QB2 A;  3GZD C;  4TMR A;  3ZRQ A;  5M4B A;  1J04 A;  3ISL A;  2BIE A;  1C7O A;  2BWO A;  2V1P A;  3P6K A;  3Q8N A;  4WXG A;  5M46 A;  5IWQ A;  1S08 A;  4OC9 A;  2G6W A;  4B9B A;  5JAY A;  3WGC A;  1VJO A;  4ISY A;  2EYQ A;  2D61 A;  1OAT A;  1SZK A;  1U08 A;  3FRK A;  1DJE A;  2BHX A;  4M2K A;  3FDD A;  1TAT A;  4UOY A;  1AKB A;  3BC8 A;  3IHJ A;  2Q7W A;  2X5F A;  1ARI A;  1B9H A;  4JEX A;  4M2J A;  4AH3 A;  3BWN C;  2AAT A;  2HZP A;  3B8X A;  4RJ0 A;  4UHM A;  1M4N A;  1GEX A;  4ITX A;  4RKC A;  3WLX A;  3AEJ C;  3B46 A;  5M49 A;  3TFT A;  1JF9 A;  3E2Z A;  4W1W A;  1GBN A;  4WYG A;  1W7N A;  1AHX A;  1EQB A;  4MKK A;  4BA5 A;  2DOU A;  3DRD A;  5AX8 A;  2Z20 A;  4ITG A;  2AEU A;  4XJL A;  1AMQ A;  1WKG A;  3AOV A;  3E2Z B;  3EIA A;  2W7H A;  1ASN A;  1AMA A;  1ASB A;  3JU7 A;  2ZSL A;  4BMK A;  2W7D A;  3MC6 A;  3ZZJ A;  2X3L A;  1B9I A;  5HHY A;  3I5T A;  2A1V A;  4XK1 A;  3RQ1 A;  2Z1Z A;  2ZC0 A;  5E4Z A;  3FQ7 A;  1C7G A;  4WYE A;  3RI6 A;  2QLR A;  1OHW A;  3PDX A;  3A2B A;  5G4J A;  4M2M A;  4ADD A;  5EQC A;  4JF0 A;  4AZJ A;  5F9S A;  3QHX A;  2VMW A;  2VMZ A;  4GE9 A;  1CZC A;  3OP7 A;  2E7J A;  3HBX A;  1QJ3 A;  4MSO A;  4I8A A;  2W7K A;  1AHF A;  1IVR A;  1MDO A;  1P3W A;  2VMS A;  5BJ3 A;  3MAD A;  1I29 A;  1KKP A;  4XJM A;  1KL1 A;  2VMV A;  1PMO A;  4W5K A;  1LK9 A;  1UKJ A;  2VGW A;  3AEP A;  4XJO A;  3I16 A;  4IYO A;  1W7M A;  2VMT A;  4OTL A;  3RBL A;  3TAT A;  3B1D A;  2VI8 A;  2W7J A;  4ZWM A;  1QIT A;  4WLJ A;  1UU0 A;  1V72 A;  5C6U A;  2BWN A;  2YKU A;  3LVL B;  2VI9 A;  2WK8 A;  3HVY A;  1PG8 A;  4IYO B;  4MQR A;  1IX8 A;  1B4X A;  1QGN A;  4OBV A;  4E3R A;  4LNJ A;  1T3I A;  1KAF A;  3ASB A;  3A9Z A;  4RM1 A;  2BIG A;  3WZF A;  4F5H A;  1KL2 A;  4U1T A;  1CQ6 A;  2HUF A;  1ECX A;  2ZY3 A;  2EZ2 A;  1W3U A;  5FT5 A;  3F6T A;  2W7G A;  4BQ0 A;  1WKH A;  3LV2 A;  3FDB A;  3W1H A;  3BN1 A;  3FTB A;  3E9K A;  2C44 A;  1GC2 A;  3NU7 A;  1SPA A;  2Z9X A;  2QMA A;  1BJN A;  1KMK A;  1S0A A;  3BCB A;  5EIG A;  3WGB A;  2JGT A;  3BB8 A;  4WYC A;  5E3K A;  1ASF A;  1AMR A;  4Q75 A;  1LS3 A;  3D6K A;  1AJS A;  1LW5 A;  3LG0 A;  2TPL A;  3VK2 A;  1GC0 A;  4K2B A;  2VGV A;  1JS6 A;  3PJ0 A;  4BA4 A;  2JG2 A;  1J32 A;  5EIG B;  2E7U A;  3VAX A;  1BQA A;  4F5M A;  4K05 A;  3HL2 A;  1AJS B;  3NRA A;  4DBC A;  3CQ5 A;  2D7Z A;  1IJI A;  1BJO A;  3AEM C;  3ACZ A;  2W7M A;  1CS1 A;  1Z7D A;  1V2E A;  4DQ6 A;  4P7Y A;  1VEF A;  4RKD A;  1N8P A;  2Z9V A;  4AZK A;  1TOG A;  1TOJ A;  3FQ8 A;  1YIY A;  1BJO B;  1ELQ A;  1YNU A;  2DKJ A;  1DFO A;  2GB3 A;  2V0Y A;  2VMN A;  4GE4 A;  3T32 A;  4ADB A;  2W7F A;  5G2P A;  3JTX A;  3QGU A;  1ASE A;  2R5E A;  5K8B A;  3NYT A;  1AHE A;  2VMO A;  1AHY A;  1DKA A;  1X0M A;  2BYL A;  1YAA A;  2JIS A;  4HVK A;  3WX9 A;  4F5L A;  3KGW A;  1IAY A;  3FD0 A;  4JF1 A;  3DXV A;  1RV3 A;  1GC3 A;  4U2H A;  2GMU A;  2AY2 A;  3ECD A;  2CB1 A;  1UU2 A;  2HOY A;  1Z3Z A;  4XQ2 A;  1ART A;  5EAV A;  3OKS A;  2EZ1 A;  3L8A A;  5EUN A;  2AEV A;  2D63 A;  3FVU A;  2XH1 A;  3TQX A;  2HOR A;  1CL2 A;  2AY7 A;  1IUG A;  2DKB A;  2O1B A;  2R2N A;  1ASA A;  3DR4 A;  2DR1 A;  4OCA A;  4OT8 A;  4ZSY A;  3BCA A;  4CVQ A;  4LNM A;  2CJH A;  2D7Y A;  7AAT A;  4ZAS A;  2Z67 A;  3VK3 A;  1SFF A;  3WY7 A;  1LC8 A;  1GC4 A;  1QJ5 A;  2G7J A;  1TOE A;  1MAP A;  5FT6 A;  3F0H A;  1AIC A;  3MKJ A;  1CJ0 A;  3RUY A;  2OAT A;  2AY9 A;  4LC3 A;  4OYT A;  3LVK A;  1CQ7 A;  1IX6 A;  2AY8 A;  3WKR A;  3MBB A;  3GZD A;  2RFV A;  3A9Y A;  4IXS A;  1C7N A;  2OQX A;  1G4X A;  1BS0 A;  2C0R A;  2OKK A;  1B8G A;  2W7E A;  4WLH A;  1D7V A;  3NTJ A;  2BI2 A;  2EGY A;  2QBT A;  2CJD A;  2YHK A;  1N2T A;  1PFF A;  2F8J A;  1MAQ A;  2Z9W A;  2HOX A;  3JZL A;  4Q31 A;  4XEW A;  5TF5 A;  4Q6R A;  3K28 A;  1D2F A;  2W7I A;  4ZAH A;  3P1T A;  4OBU A;  3BWN A;  4E3Q A;  4ADC A;  4WXF A;  1WYU A;  3A9X A;  5I92 A;  3N4S A;  3N4R A;  3EZ1 A;  3NYS A;  2ZP7 A;  1G7W A;  2R0T A;  1D7R A;  3AEJ A;  3GET A;  1AX4 A;  1D7U A;  3MEB A;  5G4I A;  1UU1 A;  2E54 A;  2W8W A;  3EI7 A;  5G2Q A;  1GDE A;  1CQ8 A;  1M6S A;  1I41 A;  4TN4 A;  1FC4 A;  2JJE A;  4EMY A;  4GRX A;  2ZY5 A;  1M0O A;  4A6R A;  1KMJ A;  1V2D A;  3QM2 A;  1AY4 A;  1BJW A;  4IW7 A;  2AY4 A;  3LWS A;  4KAM A;  2YRR A;  1WST A;  1BJ4 A;  3KKI A;  3BWO A;  4IY7 A;  2GMS A;  3NUB A;  3FFH A;  3NU8 A;  1AIA A;  4PFF A;  3RBF A;  4JE5 A;  1AY8 A;  4UHN A;  2Z9U A;  4WD2 A;  4CXR A;  2GQN A;  2XBN A;  2QA3 A;  1CZE A;  2CJG A;  3LVM A;  1LC5 A;  2HUI A;  3AAT A;  4ZLV A;  1RVU A;  2Z1Y A;  2BI5 A;  4KXK A;  4H51 A;  5EAA A;  2DGK A;  2R5C A;  4ADE A;  2VIA A;  2WK9 A;  3MAF A;  1OXO A;  3ELE A;  3PA9 A;  4R5F A;  1M0P A;  2VMR A;  3FCR A;  3K40 A;  5G0A A;  4N0B A;  4AOA A;  3ELP A;  4E1O A;  1WYV A;  2BI3 A;  2FM1 A;  4PIW A;  3MAF B;  4XAU A;  1X2A A;  1M0N A;  3TFU A;  3EUC A;  2PB2 A;  4R2N A;  3EI5 A;  3QBO A;  1AIB A;  1YJY A;  2DGL A;  1WYV B; 
#chains in the Genus database with same CATH homology
 1D7S A;  4JEV A;  4A0H A;  1O61 A;  4AO4 A;  4AO9 A;  1TAS A;  4RIZ A;  4WYD A;  2OKJ A;  3KE3 A;  4LNL A;  3ZRR A;  4ZDO A;  1IAX A;  2O0R A;  3CQ4 A;  2AY6 A;  2WKA A;  2ORD A;  2C81 A;  2CH2 A;  2WK7 A;  1G4V A;  3KGX A;  4ATQ A;  2HOZ A;  1GEY A;  2CTZ A;  2D65 A;  4WBT A;  4LW2 A;  2VYC A;  2ZY2 A;  1C9C A;  1W7L A;  4MKJ A;  1RV4 A;  3UWC A;  2X8U A;  3FSL A;  4A0F A;  3HQT A;  4W91 A;  4R5Z A;  1BW0 A;  2YCN A;  1QIS A;  5KTB A;  4XJP A;  2NMP A;  5BJ4 A;  2FN6 A;  2BI1 A;  2YKY A;  5FT4 A;  2C7T A;  3PAA A;  2BI9 A;  4N0W A;  4IXO A;  1SZU A;  1B5P A;  5DJ9 A;  2JJF A;  3NDN A;  1ASG A;  1MLZ A;  4W1X A;  3CQ6 A;  4WYF A;  2HP2 A;  1AY5 A;  2EH6 A;  1O69 A;  2PB0 A;  2D66 A;  2AY5 A;  2HUU A;  2FNU A;  4WP0 A;  4RIT A;  3JWA A;  1AKC A;  1ELU A;  3I4J A;  4JE5 D;  4A6U A;  3COG A;  4ZWV A;  2W8T A;  3ZRP A;  1ASL A;  9AAT A;  4NOG A;  3DXW A;  1AAM A;  1BQD A;  3NNK A;  3W1I A;  1V2F A;  3N4X A;  1AKA A;  3AEM A;  3PGY A;  4EU1 A;  1GEW A;  3N5M A;  4GE7 A;  1PMM A;  3CAI A;  2CAN A;  3FQA A;  2ZYJ A;  2HP1 A;  2FQ6 A;  1GCK A;  3BV0 A;  3AEL A;  1S09 A;  3JW9 A;  3R4T A;  1G7X A;  2W8J A;  5LH9 A;  3E2Y A;  1TAR A;  1DJ9 A;  3M5U A;  1AJR A;  1S07 A;  3AEN A;  4MGR A;  2OGA A;  4B98 A;  1MLY A;  5G09 A;  4ATP A;  4E77 A;  3ATH A;  5LHA A;  1XEY A;  5M4D A;  3FVX A;  2W8U A;  2YCP A;  4TV7 A;  5EUE A;  4K2I A;  4BHD A;  1SVV A;  3MC6 C;  1M0Q A;  2PO3 A;  2YKV A;  2X5D A;  3CBF A;  4L0O A;  3AEN B;  3N0L A;  1ASD A;  3GWP A;  3VP6 A;  3LVJ A;  2VGU A;  3ASA A;  5FT8 A;  4GEB A;  1SF2 A;  2WB6 A;  4WYA A;  4ZM3 A;  2VGS A;  1B5O A;  4FL0 A;  3H7F A;  3UAK A;  1YOO A;  1O62 A;  4ZM4 A;  1TOI A;  3GJU A;  2QB3 A;  4ZDL A;  1N31 A;  1DGD A;  3BCX A;  1SZS A;  2BWP A;  3GZC A;  4OMA A;  1CL1 A;  4W8I A;  3B1C A;  1EJI A;  3IF2 A;  1OXP A;  4K2M A;  5D95 A;  2CST A;  1W23 A;  2YKX A;  3VOM A;  5HDM A;  4CBS A;  1LKC A;  2BYJ A;  3DR7 A;  3G7Q A;  4ZSW A;  2ZUK A;  3FZ6 A;  4KYO A;  4MQP A;  1IBJ A;  4RAE A;  3EI8 A;  4H63 Q;  3WCN A;  4IX8 A;  3QI6 A;  1X28 A;  3HDO A;  1YJS A;  3E6G A;  5F8V A;  1QZ9 A;  1ZC9 A;  1WYU B;  3FZ8 A;  5DB5 A;  3EIB A;  2EO5 A;  3G0T A;  1O4S A;  2KFP A;  2BKW A;  1H0C A;  1QIR A;  3FKD A;  3HMU A;  3PPL A;  4QGR A;  4F5I A;  2JJG A;  8AAT A;  4ZDP A;  1BKG A;  5DJ1 A;  2CY8 A;  1I43 A;  4A6T A;  1ASC A;  4W1V A;  2AY3 A;  2DGM A;  2ZJG A;  1DGE A;  2D5Y A;  3PDB A;  2ZY4 A;  5EFS A;  5HXX A;  3DZZ A;  4P3M A;  5D5S A;  3GR9 A;  2W8V A;  3USF A;  4UQV A;  3QN6 A;  2VMU A;  4RLG A;  2D64 A;  1M7Y A;  2YOB A;  4JEZ A;  3RCH A;  3PDB B;  2VGT A;  1JS3 A;  2VIB A;  3FFR A;  1MDX A;  3FVS A;  4Y0D A;  3H9X A;  1RVY A;  2O7C A;  1MGV A;  1TOK A;  2YCT A;  3NUI A;  2FYF A;  1AHG A;  1E5E A;  2R5C B;  3RCH B;  2VMY A;  3LY1 A;  1YIZ A;  4F5F A;  4A72 A;  3N75 A;  3H14 A;  2VGZ A;  4Q76 A;  2VMP A;  4IXZ A;  2W7L A;  2VLF A;  2FNI A;  4RJY A;  2E7I A;  2JJH A;  3II0 A;  2GSA A;  4PFN A;  4J5U A;  2CFB A;  3WKS A;  3DC1 A;  1FG7 A;  1XI9 A;  4EB5 A;  3DYD A;  3GSB A;  1ASM A;  1MDZ A;  2BIA A;  2EPJ A;  3NX3 A;  3E2F A;  2QSR A;  1OHV A;  1KKJ A;  2CIN A;  1M32 A;  4GDY A;  3R9A A;  1LC7 A;  4F5K A;  3WCO A;  3AOW A;  3JWB A;  1OHY A;  1ARH A;  1ORD A;  4EB7 A;  5DX5 A;  4A0G A;  2Z61 A;  3ZZK A;  4F4E A;  5EUD A;  1ZOB A;  4JEW A;  1YJZ A;  3B1E A;  1AAW A;  3A8U X;  3DU4 A;  1ZOD A;  3PD6 A;  3TCM A;  4GSA A;  4WB0 A;  1X29 A;  4CXQ A;  1DTY A;  2CH1 A;  2VMX A;  3DOD A;  3VK4 A;  4JEY A;  1EG5 A;  4UHO A;  1I48 A;  3L44 A;  3E77 A;  1DJU A;  3EI6 A;  3PD6 B;  3QPG A;  1IX7 A;  1S06 A;  3EZS A;  3G8M A;  2VLH A;  4R8D A;  4WB0 B;  3AEO A;  1C0N A;  2YRI A;  4WXB A;  4F5J A;  3AV7 A;  3NYU A;  3UE8 A;  1H1C A;  3K7Y A;  1TPL A;  3MAU A;  4O6Z A;  4A00 A;  2ZSM A;  4PVF A;  3BS8 A;  3EI9 A;  2FKI A;  1Y4I A;  3HLM A;  1JG8 A;  2AY1 A;  4CBR A;  1FG3 A;  3F9T A;  4Y0H A;  1ARS A;  3GBX A;  3N7N A;  1WYT A;  1ARG A;  4FFC A;  1E5F A;  4LW4 A;  4MQQ A;  2OGE A;  3HT4 A;  3PIU A;  5E5I A;  5J8Q A;  4A0R A;  4EFF A;  3FZ7 A;  4DGT A;  1AMS A;  4HF8 A;  1C4K A;  4J8L A;  3W1J A;  4F5G A;  4Y0I A;  4MY5 A;  1VP4 A;  1LW4 A;  1GD9 A;  1BT4 A;  1WYT B;  2VMQ A;  2QB2 A;  3GZD C;  4TMR A;  3ZRQ A;  5M4B A;  1J04 A;  3ISL A;  2BIE A;  1C7O A;  2BWO A;  2V1P A;  3P6K A;  3Q8N A;  4WXG A;  5M46 A;  5IWQ A;  1S08 A;  4OC9 A;  2G6W A;  4B9B A;  5JAY A;  3WGC A;  1VJO A;  4ISY A;  2EYQ A;  2D61 A;  1OAT A;  1SZK A;  1U08 A;  3FRK A;  1DJE A;  2BHX A;  4M2K A;  3FDD A;  1TAT A;  4UOY A;  1AKB A;  3BC8 A;  3IHJ A;  2Q7W A;  2X5F A;  1ARI A;  1B9H A;  4JEX A;  4M2J A;  4AH3 A;  3BWN C;  2AAT A;  2HZP A;  3B8X A;  4RJ0 A;  4UHM A;  1M4N A;  1GEX A;  4ITX A;  4RKC A;  3WLX A;  3AEJ C;  3B46 A;  5M49 A;  3TFT A;  1JF9 A;  3E2Z A;  4W1W A;  1GBN A;  4WYG A;  1W7N A;  1AHX A;  1EQB A;  4MKK A;  4BA5 A;  2DOU A;  3DRD A;  5AX8 A;  2Z20 A;  4ITG A;  2AEU A;  4XJL A;  1AMQ A;  1WKG A;  3AOV A;  3E2Z B;  3EIA A;  2W7H A;  1ASN A;  1AMA A;  1ASB A;  3JU7 A;  2ZSL A;  4BMK A;  2W7D A;  3MC6 A;  3ZZJ A;  2X3L A;  1B9I A;  5HHY A;  3I5T A;  2A1V A;  4XK1 A;  3RQ1 A;  2Z1Z A;  2ZC0 A;  5E4Z A;  3FQ7 A;  1C7G A;  4WYE A;  3RI6 A;  2QLR A;  1OHW A;  3PDX A;  3A2B A;  5G4J A;  4M2M A;  4ADD A;  5EQC A;  4JF0 A;  4AZJ A;  5F9S A;  3QHX A;  2VMW A;  2VMZ A;  4GE9 A;  1CZC A;  3OP7 A;  2E7J A;  3HBX A;  1QJ3 A;  4MSO A;  4I8A A;  2W7K A;  1AHF A;  1IVR A;  1MDO A;  1P3W A;  2VMS A;  5BJ3 A;  3MAD A;  1I29 A;  1KKP A;  4XJM A;  1KL1 A;  2VMV A;  1PMO A;  4W5K A;  1LK9 A;  1UKJ A;  2VGW A;  3AEP A;  4XJO A;  3I16 A;  4IYO A;  1W7M A;  2VMT A;  4OTL A;  3RBL A;  3TAT A;  3B1D A;  2VI8 A;  2W7J A;  4ZWM A;  1QIT A;  4WLJ A;  1UU0 A;  1V72 A;  5C6U A;  2BWN A;  2YKU A;  3LVL B;  2VI9 A;  2WK8 A;  3HVY A;  1PG8 A;  4IYO B;  4MQR A;  1IX8 A;  1B4X A;  1QGN A;  4OBV A;  4E3R A;  4LNJ A;  1T3I A;  3ASB A;  3A9Z A;  4RM1 A;  2BIG A;  3WZF A;  4F5H A;  1KL2 A;  4U1T A;  1CQ6 A;  2HUF A;  1ECX A;  2ZY3 A;  2EZ2 A;  1W3U A;  5FT5 A;  3F6T A;  2W7G A;  4BQ0 A;  1WKH A;  3LV2 A;  3FDB A;  3W1H A;  3BN1 A;  3FTB A;  3E9K A;  2C44 A;  1GC2 A;  3NU7 A;  1SPA A;  2Z9X A;  2QMA A;  1BJN A;  1KMK A;  1S0A A;  3BCB A;  5EIG A;  3WGB A;  2JGT A;  3BB8 A;  4WYC A;  5E3K A;  1ASF A;  1AMR A;  4Q75 A;  1LS3 A;  3D6K A;  1AJS A;  1LW5 A;  3LG0 A;  2TPL A;  3VK2 A;  1GC0 A;  4K2B A;  2VGV A;  1JS6 A;  3PJ0 A;  4BA4 A;  2JG2 A;  1J32 A;  5EIG B;  2E7U A;  3VAX A;  1BQA A;  4F5M A;  4K05 A;  3HL2 A;  1AJS B;  3NRA A;  4DBC A;  3CQ5 A;  2D7Z A;  1IJI A;  1BJO A;  3AEM C;  3ACZ A;  2W7M A;  1CS1 A;  1Z7D A;  1V2E A;  4DQ6 A;  4P7Y A;  1VEF A;  4RKD A;  1N8P A;  2Z9V A;  4AZK A;  1TOG A;  1TOJ A;  3FQ8 A;  1YIY A;  1BJO B;  1ELQ A;  1YNU A;  2DKJ A;  1DFO A;  2GB3 A;  2V0Y A;  2VMN A;  4GE4 A;  3T32 A;  4ADB A;  2W7F A;  5G2P A;  3JTX A;  3QGU A;  1ASE A;  2R5E A;  5K8B A;  3NYT A;  1AHE A;  2VMO A;  1AHY A;  1DKA A;  1X0M A;  2BYL A;  1YAA A;  2JIS A;  4HVK A;  3WX9 A;  4F5L A;  3KGW A;  1IAY A;  3FD0 A;  4JF1 A;  3DXV A;  1RV3 A;  1GC3 A;  4U2H A;  2GMU A;  2AY2 A;  3ECD A;  2CB1 A;  1UU2 A;  2HOY A;  1Z3Z A;  4XQ2 A;  1ART A;  5EAV A;  3OKS A;  2EZ1 A;  3L8A A;  5EUN A;  2AEV A;  2D63 A;  3FVU A;  2XH1 A;  3TQX A;  2HOR A;  1CL2 A;  2AY7 A;  1IUG A;  2DKB A;  2O1B A;  2R2N A;  1ASA A;  3DR4 A;  2DR1 A;  4OCA A;  4OT8 A;  4ZSY A;  3BCA A;  4CVQ A;  4LNM A;  2CJH A;  2D7Y A;  7AAT A;  4ZAS A;  2Z67 A;  3VK3 A;  1SFF A;  3WY7 A;  1LC8 A;  1GC4 A;  1QJ5 A;  2G7J A;  1TOE A;  1MAP A;  5FT6 A;  3F0H A;  1AIC A;  3MKJ A;  1CJ0 A;  3RUY A;  2OAT A;  2AY9 A;  4LC3 A;  4OYT A;  3LVK A;  1CQ7 A;  1IX6 A;  2AY8 A;  3WKR A;  3MBB A;  3GZD A;  2RFV A;  3A9Y A;  4IXS A;  1C7N A;  2OQX A;  1G4X A;  1BS0 A;  2C0R A;  2OKK A;  1B8G A;  2W7E A;  4WLH A;  1D7V A;  3NTJ A;  2BI2 A;  2EGY A;  2QBT A;  2CJD A;  2YHK A;  1N2T A;  1PFF A;  2F8J A;  1MAQ A;  2Z9W A;  2HOX A;  3JZL A;  4Q31 A;  4XEW A;  5TF5 A;  4Q6R A;  3K28 A;  1D2F A;  2W7I A;  4ZAH A;  3P1T A;  4OBU A;  3BWN A;  4E3Q A;  4ADC A;  4WXF A;  1WYU A;  3A9X A;  5I92 A;  3N4S A;  3N4R A;  3EZ1 A;  3NYS A;  2ZP7 A;  1G7W A;  2R0T A;  1D7R A;  3AEJ A;  3GET A;  1AX4 A;  1D7U A;  3MEB A;  5G4I A;  1UU1 A;  2E54 A;  2W8W A;  3EI7 A;  5G2Q A;  1GDE A;  1CQ8 A;  1M6S A;  1I41 A;  4TN4 A;  1FC4 A;  2JJE A;  4EMY A;  4GRX A;  2ZY5 A;  1M0O A;  4A6R A;  1KMJ A;  1V2D A;  3QM2 A;  1AY4 A;  1BJW A;  4IW7 A;  2AY4 A;  3LWS A;  4KAM A;  2YRR A;  1WST A;  1BJ4 A;  3KKI A;  3BWO A;  4IY7 A;  2GMS A;  3NUB A;  3FFH A;  3NU8 A;  1AIA A;  4PFF A;  3RBF A;  4JE5 A;  1AY8 A;  4UHN A;  2Z9U A;  4WD2 A;  4CXR A;  2GQN A;  2XBN A;  2QA3 A;  1CZE A;  2CJG A;  3LVM A;  1LC5 A;  2HUI A;  3AAT A;  4ZLV A;  1RVU A;  2Z1Y A;  2BI5 A;  4KXK A;  4H51 A;  5EAA A;  2DGK A;  2R5C A;  4ADE A;  2VIA A;  2WK9 A;  3MAF A;  1OXO A;  3ELE A;  3PA9 A;  4R5F A;  1M0P A;  2VMR A;  3FCR A;  3K40 A;  5G0A A;  4N0B A;  4AOA A;  3ELP A;  4E1O A;  1WYV A;  2BI3 A;  2FM1 A;  4PIW A;  3MAF B;  4XAU A;  1X2A A;  1M0N A;  3TFU A;  3EUC A;  2PB2 A;  4R2N A;  3EI5 A;  3QBO A;  1AIB A;  1YJY A;  2DGL A;  1WYV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...