3UEJA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3uejA01
1KBFA 1TBNA 3UEJA 3UGLA 1PTQA 4FKDA 1XA6A 2QQEA 5FUWA 1RFHA 3CXLA 3KY9A 3BJIA 3E2IA 1W4RA 1FAQA 2J87A 2GVIA 2UZ3A 2DB6A 1R79A 1XX6A 1PTRA 2ENZA 2JA1A 2ELIA 2ORWA 1XBTA 2QQ0A 2FNFX 1FARA 2QPOA 2ENNA 3UFFA 2E73A 2J9RA 4UXHA 3UEYA 4UXIA 1Y8FA 2ORVA 4L9MA 5FUYA 2VRWB 2YUUA 5FUVA 5FUXA 2ROWA 2B8TA 1TBOA 3UGDA 4UXJA 3UGIA 4B6DA 1KBEA 2WVJA
chains in the Genus database with same CATH superfamily
1OMTA 2N52A 2OVOA 4MPIA 3VDUA 2QQEA 3OVOA 2SGEI 3HH2C 1Z7KB 2X3TA 3FSXA 2SGPI 2CWFA 2Y0MA 2GVIA 2B0UC 2F3CI 1Y1CA 2ENZA 1BUSA 2N71A 1R0RI 1IW4A 2QQ0A 1K7VA 2CWHA 2FNFX 1CE3A 2SGDI 1CGJI 1BMOA 2CJSC 1DS3I 1MJBA 4DNCA 1HEVA 4WP4A 1K7TA 1ULNA 1WGTA 3TO9A 5CCMA 3GOXA 2V1CA 3VDPA 4L9MA 1HDLA 1OMUA 2NU2I 1SGNI 2CWGA 1TBOA 3VE5A 2GIVA 3FC3A 1SGRI 2JXDA 1FYBA 2WVJA 3OXLA 5J8CA 3TO7A 1ULMA 3OL0A 3UEJA 3UGLA 3TJQA 1PTQA 2KMRA 2ODDA 7WGAA 2SGQI 3UOEA 1V1IA 1SGPI 4SGBI 1RFHA 1PCEA 5E3RA 1W4RA 3D00A 1V1HA 2XRCA 1CSOI 2J87A 5HQ8A 1R79A 1XX6A 1OVOA 1TOTA 2L8EA 1PTRA 1TIHA 2JA1A 1S20A 4E1PA 3SEKC 2GKVA 1P9ZA 2ERWA 2DKVA 1FY7A 1LR7A 1IY5A 2N17A 1IY6A 2ARPF 2GKTI 2ENNA 2LUYA 3R5AA 3QWPA 2KMOA 2J9RA 3TOBA 3UFFA 1TGSI 1PPFI 5FUYA 2VRWB 1CHOI 2OU2A 1SGYI 2V1CC 5FUVA 5FUXA 2ROWA 2B8TA 3RU0A 2V53A 5EX3A 1SGDI 2JW6A 1CT4I 2KMQA 2OZUA 1DS2I 3CXLA 1SGQI 3KY9A 2NU4I 1MJAA 3QTLD 4JCVE 3E59A 1TURA 2P6AC 1X4SA 2JZMA 2X52A 1HPTA 3TOAA 2KMPA 5FUWA 3R5BA 1FAQA 5CCLA 3E2IA 2L7XA 5EX0A 2NU3I 2UZ3A 1CT2I 1MJ9A 5J8FA 1Q9BA 1U5KA 1NXUA 1VDDA 3SGBI 1Z2IA 2QQDA 2PQ8A 1FARA 2E5RA 2K9HA 2QPOA 3QAHA 2E73A 2M5XA 1CT0I 1YU6C 1ULKA 1NUBA 2JYYA 4UXIA 4UXHA 1Y8FA 2ORVA 1W3SA 5HI7A 1P9GA 1UHAA 1TUSA 1WTJA 1OYVI 2UVOA 3B4VC 1N13A 4E1RA 1MT1A 2W0TA 1CGII 3SGQI 5E3QA 3UGDA 4B6DA 1TBQR 2DIPA 5JHWC 2WGCA 1PJUA 2NU0I 4OVOA 3OXGA 1LR9A 1TBNA 1H0ZA 1KBFA 1KMAA 4GI3C 4FKDA 2LEOA 3TO6A 9WGAA 1M8BA 1XA6A 2LB7A 3FSYA 2QQCA 1WGCA 3R5DA 3BJIA 2NU1I 2A20A 2DB6A 1HJAI 5DAEA 3MEKA 1LR8A 2ELIA 1YTPA 2ORWA 1XBTA 1TBRR 2OD1A 2RC4A 2SGFI 4AMLA 1UVGA 1X74A 5E3PA 3PDNA 3UEYA 1AN1I 2N1AB 2RIJA 2WCYA 1Y1BA 2GKRI 3OXFA 2KCXA 4A24A 4HGUA 1UVFA 1K7UA 1M8CA 1SGEI 2YQPA 3R5CA 4UXJA 1WKXA 1KBEA 3UGIA 2BUSA 2YUUA 1UUCA
chains in the Genus database with same CATH topology
1OMTA 2N52A 2OVOA 3VDUA 2QQEA 3OVOA 2SGEI 3HH2C 1Z7KB 2SGPI 2GVIA 2B0UC 2F3CI 1Y1CA 2ENZA 1BUSA 2N71A 1R0RI 1IW4A 2QQ0A 1CE3A 2FNFX 2SGDI 1CGJI 1BMOA 2CJSC 1DS3I 5CCMA 3GOXA 2V1CA 3VDPA 4L9MA 1HDLA 1OMUA 2NU2I 1SGNI 1TBOA 3VE5A 3FC3A 1SGRI 2JXDA 1FYBA 2WVJA 3OXLA 3OL0A 3UEJA 3UGLA 3TJQA 1PTQA 2KMRA 2ODDA 2SGQI 1V1IA 1SGPI 4SGBI 1RFHA 1PCEA 1W4RA 3D00A 1V1HA 2XRCA 1CSOI 2J87A 5HQ8A 1R79A 1XX6A 1OVOA 1TOTA 2L8EA 1PTRA 1TIHA 2JA1A 4E1PA 3SEKC 2GKVA 2ERWA 1IY5A 1LR7A 1IY6A 2N17A 2ARPF 2GKTI 2ENNA 2LUYA 3QWPA 2KMOA 2J9RA 3UFFA 1TGSI 1PPFI 5FUYA 2VRWB 1CHOI 2V1CC 1SGYI 5FUVA 5FUXA 2ROWA 2B8TA 3RU0A 2V53A 5EX3A 1SGDI 2JW6A 1CT4I 2KMQA 1DS2I 3CXLA 1SGQI 3KY9A 2NU4I 3QTLD 4JCVE 3E59A 1TURA 2P6AC 1X4SA 2JZMA 1HPTA 2KMPA 5FUWA 1FAQA 5CCLA 3E2IA 2L7XA 5EX0A 2NU3I 2UZ3A 1CT2I 1U5KA 1VDDA 3SGBI 2QQDA 1FARA 2E5RA 2K9HA 2QPOA 2E73A 2M5XA 1CT0I 1YU6C 2JYYA 1NUBA 4UXIA 4UXHA 1Y8FA 2ORVA 1W3SA 5HI7A 1TUSA 1OYVI 3B4VC 1N13A 4E1RA 1MT1A 2W0TA 1CGII 3SGQI 3UGDA 4B6DA 1TBQR 2DIPA 5JHWC 1PJUA 2NU0I 4OVOA 3OXGA 1LR9A 1TBNA 1H0ZA 1KBFA 1KMAA 4GI3C 4FKDA 2LEOA 1M8BA 1XA6A 2QQCA 3BJIA 2NU1I 2A20A 2DB6A 1HJAI 5DAEA 3MEKA 1LR8A 2ELIA 1YTPA 2ORWA 1XBTA 1TBRR 2OD1A 2SGFI 1UVGA 1X74A 3PDNA 3UEYA 1AN1I 2N1AB 2WCYA 1Y1BA 2GKRI 3OXFA 2KCXA 4A24A 4HGUA 1UVFA 1M8CA 2YQPA 1SGEI 4UXJA 3UGIA 1KBEA 2BUSA 2YUUA 1UUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBF A;  1TBN A;  3UEJ A;  3UGL A;  1PTQ A;  4FKD A;  1XA6 A;  2QQE A;  5FUW A;  1RFH A;  3CXL A;  3KY9 A;  3BJI A;  3E2I A;  1W4R A;  1FAQ A;  2J87 A;  2GVI A;  2UZ3 A;  2DB6 A;  1R79 A;  1XX6 A;  1PTR A;  2ENZ A;  2JA1 A;  2ELI A;  2ORW A;  1XBT A;  2QQ0 A;  2FNF X;  1FAR A;  2QPO A;  2ENN A;  3UFF A;  2E73 A;  2J9R A;  4UXH A;  3UEY A;  4UXI A;  1Y8F A;  2ORV A;  4L9M A;  5FUY A;  2VRW B;  2YUU A;  5FUV A;  5FUX A;  2ROW A;  2B8T A;  1TBO A;  3UGD A;  4UXJ A;  3UGI A;  4B6D A;  1KBE A;  2WVJ A; 
#chains in the Genus database with same CATH topology
 1OMT A;  2N52 A;  2OVO A;  4MPI A;  3VDU A;  2QQE A;  3OVO A;  2SGE I;  3HH2 C;  1Z7K B;  2X3T A;  3FSX A;  2SGP I;  2CWF A;  2Y0M A;  2GVI A;  2B0U C;  2F3C I;  1Y1C A;  2ENZ A;  1BUS A;  2N71 A;  1R0R I;  1IW4 A;  2QQ0 A;  1K7V A;  2CWH A;  2FNF X;  1CE3 A;  2SGD I;  1CGJ I;  1BMO A;  2CJS C;  1DS3 I;  1MJB A;  4DNC A;  1HEV A;  4WP4 A;  1K7T A;  1ULN A;  1WGT A;  3TO9 A;  5CCM A;  3GOX A;  2V1C A;  3VDP A;  4L9M A;  1HDL A;  1OMU A;  2NU2 I;  1SGN I;  2CWG A;  1TBO A;  3VE5 A;  2GIV A;  3FC3 A;  1SGR I;  2JXD A;  1FYB A;  2WVJ A;  3OXL A;  5J8C A;  3TO7 A;  1ULM A;  3OL0 A;  3UEJ A;  3UGL A;  3TJQ A;  1PTQ A;  2KMR A;  2ODD A;  7WGA A;  2SGQ I;  3UOE A;  1V1I A;  1SGP I;  4SGB I;  1RFH A;  1PCE A;  5E3R A;  1W4R A;  3D00 A;  1V1H A;  2XRC A;  1CSO I;  2J87 A;  5HQ8 A;  1R79 A;  1XX6 A;  1OVO A;  1TOT A;  2L8E A;  1PTR A;  1TIH A;  2JA1 A;  1S20 A;  4E1P A;  3SEK C;  2GKV A;  1P9Z A;  2ERW A;  2DKV A;  1FY7 A;  1LR7 A;  1IY5 A;  2N17 A;  1IY6 A;  2ARP F;  2GKT I;  2ENN A;  2LUY A;  3R5A A;  3QWP A;  2KMO A;  2J9R A;  3TOB A;  3UFF A;  1TGS I;  1PPF I;  5FUY A;  2VRW B;  1CHO I;  2OU2 A;  1SGY I;  2V1C C;  5FUV A;  5FUX A;  2ROW A;  2B8T A;  3RU0 A;  2V53 A;  5EX3 A;  1SGD I;  2JW6 A;  1CT4 I;  2KMQ A;  2OZU A;  1DS2 I;  3CXL A;  1SGQ I;  3KY9 A;  2NU4 I;  1MJA A;  3QTL D;  4JCV E;  3E59 A;  1TUR A;  2P6A C;  1X4S A;  2JZM A;  2X52 A;  1HPT A;  3TOA A;  2KMP A;  5FUW A;  3R5B A;  1FAQ A;  5CCL A;  3E2I A;  2L7X A;  5EX0 A;  2NU3 I;  2UZ3 A;  1CT2 I;  1MJ9 A;  5J8F A;  1Q9B A;  1U5K A;  1NXU A;  1VDD A;  3SGB I;  1Z2I A;  2QQD A;  2PQ8 A;  1FAR A;  2E5R A;  2K9H A;  2QPO A;  3QAH A;  2E73 A;  2M5X A;  1CT0 I;  1YU6 C;  1ULK A;  1NUB A;  2JYY A;  4UXI A;  4UXH A;  1Y8F A;  2ORV A;  1W3S A;  5HI7 A;  1P9G A;  1UHA A;  1TUS A;  1WTJ A;  1OYV I;  2UVO A;  3B4V C;  1N13 A;  4E1R A;  1MT1 A;  2W0T A;  1CGI I;  3SGQ I;  5E3Q A;  3UGD A;  4B6D A;  1TBQ R;  2DIP A;  5JHW C;  2WGC A;  1PJU A;  2NU0 I;  4OVO A;  3OXG A;  1LR9 A;  1TBN A;  1H0Z A;  1KBF A;  1KMA A;  4GI3 C;  4FKD A;  2LEO A;  3TO6 A;  9WGA A;  1M8B A;  1XA6 A;  2LB7 A;  3FSY A;  2QQC A;  1WGC A;  3R5D A;  3BJI A;  2NU1 I;  2A20 A;  2DB6 A;  1HJA I;  5DAE A;  3MEK A;  1LR8 A;  2ELI A;  1YTP A;  2ORW A;  1XBT A;  1TBR R;  2OD1 A;  2RC4 A;  2SGF I;  4AML A;  1UVG A;  1X74 A;  5E3P A;  3PDN A;  3UEY A;  1AN1 I;  2N1A B;  2RIJ A;  2WCY A;  1Y1B A;  2GKR I;  3OXF A;  2KCX A;  4A24 A;  4HGU A;  1UVF A;  1K7U A;  1M8C A;  1SGE I;  2YQP A;  3R5C A;  4UXJ A;  1WKX A;  1KBE A;  3UGI A;  2BUS A;  2YUU A;  1UUC A; 
#chains in the Genus database with same CATH homology
 1OMT A;  2N52 A;  2OVO A;  3VDU A;  2QQE A;  3OVO A;  2SGE I;  3HH2 C;  1Z7K B;  2SGP I;  2GVI A;  2B0U C;  2F3C I;  1Y1C A;  2ENZ A;  1BUS A;  2N71 A;  1R0R I;  1IW4 A;  2QQ0 A;  1CE3 A;  2FNF X;  2SGD I;  1CGJ I;  1BMO A;  2CJS C;  1DS3 I;  5CCM A;  3GOX A;  2V1C A;  3VDP A;  4L9M A;  1HDL A;  1OMU A;  2NU2 I;  1SGN I;  1TBO A;  3VE5 A;  3FC3 A;  1SGR I;  2JXD A;  1FYB A;  2WVJ A;  3OXL A;  3OL0 A;  3UEJ A;  3UGL A;  3TJQ A;  1PTQ A;  2KMR A;  2ODD A;  2SGQ I;  1V1I A;  1SGP I;  4SGB I;  1RFH A;  1PCE A;  1W4R A;  3D00 A;  1V1H A;  2XRC A;  1CSO I;  2J87 A;  5HQ8 A;  1R79 A;  1XX6 A;  1OVO A;  1TOT A;  2L8E A;  1PTR A;  1TIH A;  2JA1 A;  4E1P A;  3SEK C;  2GKV A;  2ERW A;  1IY5 A;  1LR7 A;  1IY6 A;  2N17 A;  2ARP F;  2GKT I;  2ENN A;  2LUY A;  3QWP A;  2KMO A;  2J9R A;  3UFF A;  1TGS I;  1PPF I;  5FUY A;  2VRW B;  1CHO I;  2V1C C;  1SGY I;  5FUV A;  5FUX A;  2ROW A;  2B8T A;  3RU0 A;  2V53 A;  5EX3 A;  1SGD I;  2JW6 A;  1CT4 I;  2KMQ A;  1DS2 I;  3CXL A;  1SGQ I;  3KY9 A;  2NU4 I;  3QTL D;  4JCV E;  3E59 A;  1TUR A;  2P6A C;  1X4S A;  2JZM A;  1HPT A;  2KMP A;  5FUW A;  1FAQ A;  5CCL A;  3E2I A;  2L7X A;  5EX0 A;  2NU3 I;  2UZ3 A;  1CT2 I;  1U5K A;  1VDD A;  3SGB I;  2QQD A;  1FAR A;  2E5R A;  2K9H A;  2QPO A;  2E73 A;  2M5X A;  1CT0 I;  1YU6 C;  2JYY A;  1NUB A;  4UXI A;  4UXH A;  1Y8F A;  2ORV A;  1W3S A;  5HI7 A;  1TUS A;  1OYV I;  3B4V C;  1N13 A;  4E1R A;  1MT1 A;  2W0T A;  1CGI I;  3SGQ I;  3UGD A;  4B6D A;  1TBQ R;  2DIP A;  5JHW C;  1PJU A;  2NU0 I;  4OVO A;  3OXG A;  1LR9 A;  1TBN A;  1H0Z A;  1KBF A;  1KMA A;  4GI3 C;  4FKD A;  2LEO A;  1M8B A;  1XA6 A;  2QQC A;  3BJI A;  2NU1 I;  2A20 A;  2DB6 A;  1HJA I;  5DAE A;  3MEK A;  1LR8 A;  2ELI A;  1YTP A;  2ORW A;  1XBT A;  1TBR R;  2OD1 A;  2SGF I;  1UVG A;  1X74 A;  3PDN A;  3UEY A;  1AN1 I;  2N1A B;  2WCY A;  1Y1B A;  2GKR I;  3OXF A;  2KCX A;  4A24 A;  4HGU A;  1UVF A;  1M8C A;  2YQP A;  1SGE I;  4UXJ A;  3UGI A;  1KBE A;  2BUS A;  2YUU A;  1UUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...