3UEZA

Crystal structure of the human colony-stimulating factor 1 (hcsf-1) cytokine in complex with the viral receptor barf1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
199
structure length
185
Chain Sequence
VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protein BARF1
publication title Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Cytokine receptor/cytokine
total genus 34
structure length 185
sequence length 199
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uezA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uezA02
4M9PA 1A6ZA 1KLUB 5JORA 4ONGL 2IANE 3T1FB 4KV5E 2OMBA 3HRZB 5ID0A 1L6XA 4MSWA 5I1LB 3HI1B 3QIBA 4BSJA 1ORQA 4OLXH 3KYMA 4YO0A 4Y5XC 2FGWH 5DJYA 3MCKB 2MQ0A 4HWBH 5DFVD 4APQB 3MV9B 1V5JA 2WWKT 5H94A 4L8CA 4XI5D 4NRXA 1CFQA 5I8CB 2A0LC 4MYWB 3OB0K 4K3DH 1FSKB 4G42B 3LV3A 5HPMA 4MQ7B 2GFBB 4LOUC 2X2YA 1BHGA 4X6FA 4Z78A 3ARGD 5EUOE 2E7LA 5BW7C 3NGBC 4RFNB 3P30L 1NC4D 2P47B 4D0BA 3WN5A 2O26U 4BQCA 4K9EH 4Y5XB 1KIPB 4OTXH 1KLUA 2F53D 1CGTA 1TZIB 1IZKA 3HPJB 3HRZA 2YD4A 5I1LA 1WIUA 3SE8H 4JG0L 3EZJB 4KHTL 5FIEA 5MENE 1OPGL 2R4SL 2EDQA 3FO0H 4XX1G 4YHKL 5JXAL 3M45A 4LLYB 3MCKA 3ZDZF 5CZKA 4OCWL 5B38A 1GPOH 3MV9A 3O11B 5EOQL 5BJTA 4WY7H 2BFVH 2DI8A 4DCQB 4QKXB 4J3XA 1FNSL 2ZCKL 1WTLA 4YBLB 3NGBB 1LO3H 1NEZB 5IJVB 4G42A 3H9SD 1G7QB 4FQIH 1AFVH 3NIGE 4MQ7A 2GFBA 3BZFB 2JJWA 3MLZL 1KJ2H 1YEIL 2NY3D 3EO9H 2YN5A 3O4LE 1D9KD 1EUUA 3JUZA 3ES6B 1TFHA 1KIPA 4IS6B 4EN3C 4LMQI 1AXSB 3JBG7 3HUJE 4YEFA 1TZIA 1YEEH 2F54B 1IILE 4ZTOL 5K9KA 3PWJA 2EC9U 2P8PB 5T1DL 1XCQA 2PCPA 4LIQH 4CADB 2XYCA 4NQTA 1MHHA 1SQ2N 1A7PL 3C9NA 1G7HA 2X41A 3ULSB 4LLYA 3C8KA 4WHTB 3PDOB 3KPSB 3DX9B 4NM8H 2VXTH 3ZSTA 3O11A 1RMFL 1KELL 5E7BA 5FCSH 2DDQL 4M5ZH 1DUYA 3S37H 3P0GB 2AQ3A 2WLYA 4PJDF 5IJVA 1QBLL 1XGTA 3B2UC 4AIXA 5DD1H 1N6QL 3MRQB 4QXUH 4EI5C 4RZCB 5TE7L 2X1QA 5KVEH 4Y4KC 4OGYH 5D72H 3MOBH 4YIQA 4HKZB 2JF1A 1U8LB 4WWKC 5DD3L 3IKCB 2V2TB 4ZUSB 4IS6A 2BDNH 4GG8B 4CN6A 1AXSA 2CRYA 4F7PB 3ULVH 5EZIL 1FAIH 1YYLH 1ZVHA 2P8PA 3DPBA 2XG5A 5D2NA 5ICXA 4QLRA 4CADA 3K46A 3HE7C 1KFAL 1IEAB 1AGCB 1KLGB 4LQFH 3ULSA 3NOIA 2D9QB 4YDKH 4P9HH 1NCWL 3KPLA 3KPSA 3DX9A 4DFHA 3GNMH 1AE6H 1CE6B 1YEHL 1P7HL 3RL2A 4L9LB 4NCDA 1QFHA 5MEPA 4K9EC 4WWKB 3T04D 3REWA 3TM6A 3R0NA 2Y06L 3NAAH 2JK5B 5DFWH 1OAKH 3MRQA 1VGEL 2IGFL 4MXQD 3K1KC 4R4NC 3HE7B 2F5AH 1U8LA 2V2TA 3UPRB 4ZUSA 1A4KB 3BW9B 4K8RD 5CEYB 5SWSD 2FX7L 4PRHD 4XP1H 1FH5L 5FKAB 3QFDA 2I9LB 5D5ME 4MS8D 1CFSB 1LE5B 1X5GA 3B4NA 1IEAA 1YEKH 1KLGA 1JGUL 4HSQA 2H1PH 4ZFGH 5T33L 2EE3A 1KTDB 3T0XA 1WCQA 5TQ0L 4L8BB 2NTSP 4H88H 4OCNC 4QTIL 3ZDXF 2Q7NA 3G6JA 4YNYB 3TNMB 2X4UB 3TJEH 2JK5A 4XPAL 3O2WL 3FQTB 4WFHE 1KCVH 3PGDB 5DK0B 2PXYA 4MNQB 5H35B 1JN6B 1QYGH 2E3VA 1VGKB 5F88A 1AO7B 3UPRA 1IGMH 1A4KA 1S7WB 4R2GB 2XG4A 2HVKA 4POUB 5CEYA 1OOAA 3TO4D 5D7IA 4HUVB 3W39B 2ATKA 4LHQB 2Q87A 4Q97A 5FKAA 5JOFB 2I9LA 1LE5A 1CFSA 3EO0B 3MJ8B 3V7AG 4FMFA 3EYVB 2G9HB 3ARBB 1F4YH 5E6IB 5DI8B 5BXFB 1KTDA 1A21A 4NO5B 4L8BA 1UH4A 4LAQL 3LOWA 1DQJB 32C2B 3BDBA 4QXWA 1YDPB 1L9NA 5JHDE 5E24E 4YNYA 1JMXA 4FFZH 3U30B 1WBZB 3TNMA 1YECL 1MQ8A 2X4UA 4LRIA 2ICES 4P2RB 4I9WD 5CP7B 3QZWB 2MHAB 3FQTA 5KSAC 5DK0A 4ZFOB 4MNQA 4O2FB 2YD5A 1HHKA 1NUGA 4UDUB 4LLQB 1JN6A 2D7MA 5H35A 3GSNL 4ENEC 5D1XC 3FRUB 4P9HC 4PLKC 2PF6A 1R5VA 4RAUA 4K8RL 1S7WA 4BK5A 1K8IB 2UYLB 4QRQA 4PJHB 4L4TA 4HUVA 1OW0A 3W39A 1J05B 4O51B 1IE5A 3BXNB 3D3VB 2FO4A 4YDJB 3PJSB 3MJ8A 3RZCB 2HKFH 3O3EB 3VU2A 5IB4B 5EBMB 5B38G 2G9HA 1HHIB 3ARBA 3D85D 5BXFA 3WIHH 4Z18A 4XCCH 3IDYB 5CIPA 3HZMA 3TVMD 1A6VL 3QA3A 4FXLA 1YDPA 1U9KA 2C3WA 4UT6H 3IU3B 1FYTE 3S96B 5HXMA 4H0HB 4UUJB 1OCWH 5E9DB 4P2RA 5CP7A 4CVXA 2DQDL 4X6DF 2J6EA 3QZWA 1QRNE 5I1KH 4OKVB 4UT7H 5BZWA 4OB5L 2VKWA 1DN0B 1WK0A 4P46B 4UDUA 4LLQA 2EDRA 4CAGA 3QDJD 3MNWB 2OL3L 3QXAB 4HJGB 4JZJC 5JW5B 4J3WA 15C8L 3V6OC 1UM6H 3LEVH 1TCMA 1K8IA 2UYLA 1RUPL 1CTNA 5FM8A 1J05A 1HK6A 1WAAF 5B8CB 2A9NH 3BXNA 3DSFH 5IHUL 1MIMH 4MJIB 4YDJA 4JY4B 4L8SC 5KBNC 3DRTB 3RZCA 5DD5H 1CL7H 2Q20A 5IB4A 2AKRB 1HHIA 3U0WH 3ARVA 3SDAA 2XNAB 3EHBC 2YR3A 4KRMB 1NEZG 2YS4A 4P3CH 3O0RL 4FQCL 4MJ4A 5I6XB 3IU3A 4AYFA 4Z6AT 1GL4B 3FFDB 5FO7B 5IBUB 4LU5H 3WFEH 4HWUA 4OKVA 5C0CA 2VITB 2NXZD 1DN0A 2BNQE 4P46A 3BZ4A 4GRLC 4Q9RL 3MNWA 1HINL 3QXAA 5JW5A 1KF9B 4YDIH 2X70A 1NSNL 1Y6MR 4NCC1 2XA3A 2GQHA 1SYVB 5C0IA 5LWYL 4OZGB 1MI5D 4KV5F 1NMAH 1MLCB 4LARH 1F4HA 1I8IB 1LO2H 3DRTA 5T5NG 3VI4F 3L3GB 3G5ZB 3DYPA 1ZT4B 1P84K 2AKRA 3K2MC 5KAQG 3QUMH 2ZUXA 2XNAA 4L3EA 1OGAD 2ICWI 3P11L 4NQDB 4GRLB 3ULUF 1NGPL 3KXFB 1HIML 3LQAH 3FFDA 5FO7A 1F58H 3OMZA 3QEGL 2VITA 5C6PB 3V0WL 5EUOF 1CXFA 4U3XA 3BZEA 3GO1H 1YC8A 4RGOL 3QEQD 1F8TH 4GG6E 4JFDB 5B39B 1ES0B 2E6QA 4MXWH 2RGSA 3O45A 2VDQH 4RFOH 5HYIA 4LCWE 5GRVK 4YK4B 1MLCA 2P42B 3D48R 4JANB 3L3GA 3UZQA 3G5ZA 4DEPB 4CMHC 1ZT4A 2DIJA 4G7VL 3QCUL 3CSGA 4HJJL 1YPZB 1Q9WA 1DFBH 2E8YA 3KPRE 4NC0B 5GGSA 4PYGA 3TFKC 4JAMB 2OCFD 2ICWA 5F7KC 2QKIB 4DKFH 1TETL 2XKSA 3SE3A 4C83B 5DMIH 3VWJC 3WNNA 1BWWA 1YMHB 4L4VB 2CK0L 4K3GA 2NY2D 4PJ8D 2X4TB 4M1CC 2AXFB 1F3RB 3C5SB 3S88L 4ODSL 2FBJL 1ZHNA 4ZOEA 5GRVL 4JFDA 5B39A 3U82B 3LH2L 5ESQB 4GAYB 4A6YL 1ES0A 4N5UA 4Z7QE 3WSQH 5JQHC 1N3NB 4G6FB 3E3QC 1F13A 2GYSA 2AEIT 4S2SA 3RDTC 1J0IA 2C3VB 2HTLD 4JANA 4PY8I 3GSVB 1TQCB 1WV7T 3VWJB 4UIKH 4S1DD 1RVFL 3PP4L 2WQRA 3B3IB 4GKSB 4BH7B 2AQ2A 4JCLA 4D0DB 2A2QT 5FECA 4YHIB 4JAMA 5ALBL 1S8DB 3BGAA 3QCVL 5D96C 4LCYB 1F2XK 3I9GL 5IKCB 3I3BA 3EYOB 2IC2A 5K33A 1YMHA 4M4RA 4I8DA 4NO3B 4O58L 2VZTA 2EDHA 3CVIH 2AXFA 5I1GH 2HFEB 2BNUB 3C5SA 4UV4H 3V6FB 1G9NC 2EXWD 2DJUA 1PW3A 1JNNL 3GSXB 1RZGB 4U6VH 5ESQA 3FT2B 3P4OB 4MXVE 1U8HB 4IMKA 4ONGH 2W0FA 5KSUA 5CMAB 1Z9OA 4PJCB 5GGRA 1HYRC 3H3PL 5A2JH 2XQBL 3GB7B 3DJ9A 2C3VA 4OV6F 1QPPA 4EBQH 3CZJA 3GSVA 1L6ZA 2LTQC 3MFFA 1CIDA 1UB6B 1UJ3C 3G5YA 2C5DC 3B3IA 4GKSA 1ROWA 1F4XH 4D0DA 4HK3J 1KOAA 5L6YH 3CX5K 4LPYA 4YHIA 4RIRA 3FAWA 1S7TB 1BX2B 1S8DA 4GAFB 2EDWA 4C56B 4LCYA 3QZWG 3D9AL 2DIBA 5IKCA 1W0VB 4Y1AE 3EYOA 1KIUA 1NLDH 4N90E 3QJFB 4OZIF 2K7QA 4GT7A 5SWZE 4HKXB 3O3BB 5IMKB 1EAPB 2VZ3A 2BNUA 3V6FA 3P30H 4LVHB 1I8KB 3CLFL 3GSXA 2CDGB 2EE2A 3DX8B 3FT2A 3P4OA 3VD9A 3IETA 3T3ME 5CMAA 4PJCA 1J88A 1RZ8B 3G5VB 5FYJE 1PG7W 5D5MF 5FFLA 4KHTH 2AGJL 2R4SH 3CFEA 3HC0A 2LE9A 4FZ8L 1LO0L 1MCSA 4E41B 3QQ9C 2DQUL 1UB6A 4NZTL 2VZUA 1MFEH 5EOQH 4YXLL 2RR3A 2MSPA 5GISL 2ZCKH 4GRMB 1FVCA 1S7TA 1BX2A 3UPAA 2WWMC 2LABA 1JF1B 4HDIB 4LK4A 4LF3A 2IBZX 5F96H 1UQSB 3MLZH 1PSKH 5GSRA 3QJFA 4HK3N 4Y2DC 4HKXA 2VDML 4QRPA 5IMKA 1EAPA 5IF0B 4F9PC 2C26A 1I8KA 3VXRE 2DBJA 2Q3AA 2CDGA 4GFTB 1K3IA 5SWQB 5IB2B 1MH5A 1PYWB 2W9EL 2PYEE 3MLUL 2HKHH 4ZTOH 4M48H 2VIRB 1RZ8A 1EEYA 5I8EA 2IFFL 4NFBA 4JGJA 3EOTL 1WZLA 4PTTB 1OLZA 4K7FB 4E41A 5EBWA 2Q3ZA 1FQ9C 4AMKL 1R3JA 5GRUH 5LGKA 1U3HD 5HI4D 1KELH 1ND0A 2PR4L 2DDQH 3F7VB 2RAMA 4LEOB 3SEPA 1UZ6E 4S0TD 2AERT 4R97B 5JR1H 1MF2H 2QHRL 1JF1A 5IBUG 1QBLH 3FOLB 4NFCA 4JVWA 4RQQB 5FDYA 3X13B 1BQHB 3PWUB 5TE7H 3T0WA 3VFOB 3VXNB 5IF0A 4RAVA 5DEGB 5DD3H 3IDNA 1B90A 2VZVA 2YWYA 3VXMB 1NLBL 1CD1A 2ED9A 4ZYKB 2KKQA 5EZIH 4LRNL 5INCB 4DGIH 2AI0L 3GJEB 1K85A 3NFNB 4HEPG 4PTTA 5A43C 4UV7L 3T08A 1X4YA 4H8WH 4Y4FC 5E00B 1BWMA 2AJZB 4LEOA 2QSCH 4G7YH 5TH2B 3ZL4H 1DBKL 1H3PH 3NACL 4GBXD 5D7LB 3V4UL 1XH3B 3FOLA 4PJIA 5ELIA 1MFCL 1ZT1B 1CE1L 1T0PB 1FE8H 2VLRB 4M1GL 4WCYL 4FQ2L 2WUCL 4OQTL 1BQHA 1VGEH 3QO1B 4KK6D 3MBED 2GJJA 2NZ9C 2GKIA 3VXNA 4R6UA 5E2VL 1EFQA 5B39G 3DX7A 3FB6B 5DEGA 4UT9L 1QFWH 3VD7A 4DGVH 5ISZD 3VXMA 2E7HA 1CDHA 1R3IH 5INCA 2YXMA 1FH5H 3VFWB 1KXQE 3BP5A 3NFNA 4KMTL 4MA7L 1HQRB 4PFEA 1JGUH 3C8DA 4X4ME 4K3JL 5T33H 2BNRB 2V9QA 1U92B 2APTA 3NZHL 2NY4C 2XN9D 4ZAKD 5GGVY 1MSPA 2Z8VC 3BQUB 3AGVA 1MCEA 1EVTC 1A6WH 4MX7B 4QTIH 2W60B 3ROLB 1MFAL 4G43A 4OM1L 5D7LA 3THML 5FOJA 4KPHL 4QHUB 4XPAH 2FR4A 3O2WH 2FO1A 3RTQD 3QO1A 1KTKE 8CGTA 4OQ1A 1DTUA 4HXAL 5JIPA 3FB6A 4HUKB 5DFVC 3VCLA 4IRSD 4LSUH 2X42A 4NZRH 1H3VA 1T2JA 4XI5C 4O9HL 3MRBB 3QWRA 5KVGL 3U4BL 4S10A 2VSDA 3VFWA 1ACZA 1F3JB 1L7TL 4P2OD 1J9CT 3MV7D 4HFUL 3ARGC 1GGIH 1NCCH 2GJ6B 4NWTH 2BVUA 4RGNB 2BNRA 3WFHB 4ZUTB 1U92A 3BIKB 3DROB 3L7EB 4KVNH 4LAQH 3BQUA 4PB0L 5DHVH 4WNQB 1TLKA 3ROLA 5E2JA 5J4MA 4WU5B 2P5EE 3I2CH 5FKPB 4JKWA 1YECH 2CO6B 1JZ7A 3FTGB 4M6ML 1OAQH 3LKOB 2WUBH 1K8DB 2R23B 4FNLL 1M71B 3WIFA 1N59B 1J8HB 2V2WB 5TE4L 1OAXH 3GSNH 4M93C 3LZFL 5KTEH 4GG6F 1X6NA 3O9WB 2YA0A 1OVZA 2LU3A 3MRBA 5DUPH 3ESVF 1DVFB 4ELME 4PB9L 3T0VA 4Y4HD 3BP4B 3OAYH 3QUYD 4FQHB 4XHJD 1DQDH 3ZT5A 5T5FL 1ZA6B 3N9GL 3ARXA 1NAMH 4HPYL 4AL8H 3V5DB 2NY3C 4MGXA 4ZUTA 1D9KC 4HKJB 3NPSC 2AV1B 4YAQB 3BIKA 3DROA 1NGQH 1A6VH 3BPNC 4PJAE 2GK0B 1E4XL 2YPVL 4WNQA 1ETZB 4WU5A 3FTGA 4RMSA 3O3DB 3AM8C 3LKOA 2RQ8A 4IIQC 2R23A 1R3LB 4OB5H 1N59A 3QNXB 1A5FL 2OL3H 4FQ1L 4ISVB 1G84A 1WSST 3O9WA 1LE9B 5FYKE 5CEXA 1W0WB 4Z7QF 1DVFA 4I4WB 43CAB 1RUPH 2CGRL 4XNXL 3BP4A 3MLRL 4FQPA 3SGDH 3STZB 2PETA 1ZA6A 3UAJD 3DXAA 4OCLC 4QRRE 1BQUA 5E4EB 5JOPD 3IVKB 3HE6A 1XGYH 2BXZA 4HKJA 4YAQA 1UENA 4E0RB 3T0BA 2GK0A 4FQCH 4XC1L 1ETZA 3QFJB 5I19H 3EDDA 2WBKA 3OKNB 1R3LA 3A67L 1P1ZB 4PY7B 3QNXA 1P4LB 2KZ1B 4Q9RH 2SEBB 3C09C 4ISVA 2EH7L 5GS1A 2Z4QB 4I18C 4Z7UB 4G6AD 1LE9A 1RIVL 5DS8B 1RJCA 4HF5L 4MXVF 4HG4J 2CKBL 2W9DL 5LWYH 1DCLA 1HEZB 4HGMA 4I4WA 43CAA 4N0YL 3DO3A 1YC7A 4UTBH 12E8H 3VXOB 3T0EB 3ARTA 1WICA 4JM4L 3IJHB 1ACYL 4WUKH 3IVKA 4MXQC 1Q94B 3LN5A 4RMRA 2A6JB 1YEGL 3OBAA 5JOPE 3TYFB 3VGEA 3Q6GL 3HNSL 4XBGB 4E0RA 4BZ2L 4QGTA 3RWHB 3P11H 2X4SB 1LEGA 4X8JA 1NGPH 1HHGA 4PIRF 4K8RC 4LQ1A 1AXTL 1HIMH 3W9DB 1BQHG 4UMGA 3VXSD 1JWSB 1Q38A 4DTGH 2OTWB 3QEGH 4MS8C 1H0DB 4BFBD 1LK3L 1P1ZA 1OT2A 4QF1A 4JY5L 4OCYH 4IOSD 1P4LA 4KTEL 5I2IA 4JRYE 2SEBA 3NCCB 2Z4QA 3NVQA 1T4KB 3ARED 5EZLB 2VXVH 3W2DH 4M7LL 5I1DA 5DS8A 3RA7L 5CBAA 1G6RL 2CLVB 3BYTA 3T3MF 1TVBB 1GOGA 4M7LT 43C9B 3AROA 3VXOA 3KWWB 3T0EA 3RP1A 3L3DB 2Z91B 2ARJB 3QCUH 4Q9BA 4ETYA 2A6JA 4HJJH 3QI9A 1RFDL 5KSVA 3TYFA 3QR2A 4XBGA 3RWHA 4UU9B 2X4SA 1HXMA 4P0DA 5IVZB 1PEWA 1A3LL 3L3KB 1ZLUH 1OAYL 2BHYA 4C59B 4JJHA 3TO4C 3ZYIA 2IQ9L 1TETH 3UTSB 4YGAB 3FT3B 5FYLD 1N5AB 1JWSA 3L3IB 2K1MA 1H0DA 4WIQA 1JFQH 5E1HB 2ZCHL 3X3FL 3HAEH 5DJZA 4ODSH 2FBJH 3HR6A 1G7MB 5ICZB 3TLRA 5EZLA 4NDMB 3LH2H 2FLBT 2BMKA 3IAQA 3HFML 4A6YH 3O3AA 5C09E 3TBYA 2CLVA 1BOYA 1F97A 5FGCE 43C9A 5AAWA 4WHYG 4LMQE 3QQ4B 5L9DH 2IPUK 3V79C 3KWWA 3L3DA 2E7BA 3TO4B 5JUEL 2Z91A 5HGHB 4G8GE 2ARJA 2AXHA 1CGYA 4DVRH 5AG8A 1RVFH 4DFIA 3PP4H 3BWAB 1B4RA 4N8VA 3B2VH 1C5BL 5IVZA 4KROD 4S1SL 3C8HA 4NRYB 2ZG1A 1L0XA 3SY0A 5ALBH 4Z7OE 2VLME 3NCYS 3VFSB 5FYJU 4NUGL 2YZ1A 3UTSA 3FB8B 3WDIA 3I9GH 1DBAL 3HZYB 4GUPB 3L3IA 1PGRB 4QRUA 2JJUA 4OZ4B 5ANMB 4HUUB 3BH8B 4KWUA 1ZLVK 2WNGA 1VEOA 4FP8L 4GRWF 3SGEI 3KPOB 2DQGL 3B9KD 1G7MA 5ICZA 3QUZB 1JNNH 3WEXA 1BGXH 1OWWA 4GW5A 3DARA 3TVMC 1H3TA 2YRZA 3QDGB 4ZS7L 1M6OB 3GHBL 1ZGLP 2HLAA 3H3PH 2OJEB 3F7PC 3QRFM 3LD8B 2XQBH 1DL7H 3FRPA 1E0OB 1TTFA 3T1WA 1BBJB 2P5WA 4KTYA 3UTTD 3C6LD 5IMLA 1C5DA 3BWAA 2CXGA 5F9DC 3SGKC 5T1KB 1S5IL 1EEZA 4P9ML 2CPCA 1DBBH 4NRYA 4I48B 2YPLD 4J3UA 4HK0B 5TDNB 4AM0B 2W0LA 3EYSL 1A6PA 4JPWL 2BHUA 4KY1H 5FYLL 3OV6A 3FB8A 2JCCB 3IF1B 3DI2B 1AKJD 3HZYA 3S7GA 3RUGB 3TVMB 1I85C 5ILTL 4PGJA 3FQXB 3EDKA 4OLUH 4OZ4A 5ANMA 2HLFD 4JZNB 4MNGE 3JSSA 5CINL 4B41A 3BH8A 1N5YH 4I77L 1V3MA 3BGMB 3KPOA 5E8NB 2FL5B 2QQKH 4F33A 5KW9H 3QUZA 1J8KA 2E5EA 3P4MB 4JFQB 1JNLL 4XPFL 4D9QE 2CR3A 5BV7H 1TNMA 3QDGA 3HG1D 2ITCB 2YC1B 3QDJB 5EG6C 1U36A 2N1KA 2HWZL 5EO0B 5ERWB 1NUNB 1MQKL 4ORGB 1AGBB 1LO0H 3B6SB 4H26A 3WLWD 2NXZC 1G1YA 2DQUH 2G2RB 4XPBL 2R69H 5DTFB 5CEZE 1AGFB 3VXUE 4YXLH 1P5VA 3PQYB 3ULUL 1O5DT 4QXGL 2R2CA 4J7RA 3T65B 4I48A 3NCJL 1XF2A 1C12B 5D1ZB 4AM0A 5JOEA 1KCRH 1LMKA 1SEQL 3WKNA 5IB5B 1FORL 2JCCA 3IF1A 4DN3L 2MKLC 1IM9B 1XGRA 1CGVA 4X5LA 4WW2A 1KC5H 4JZNA 2F74B 2VDMH 2DMCA 4HCRA 3BGMA 2QL1A 2DLHA 4GW4B 4NZUL 1WCBB 2FL5A 4DAGL 2DKUA 2IJ0C 3R8QA 5DFTA 1RJLB 3P4MA 2DBLH 5FHAH 4BQBA 4MJ2A 1JPFA 2YC1A 3WNKA 5EO0A 5ACMA 2IFFH 5ERWA 1KTRL 2CLRB 1QLEL 5DJ8B 5J3HD 4QYOB 3KS0H 1AGBA 3S34H 3BVNB 3B6SA 3ZE0E 2OBGA 3AB0B 5BOPA 3S9DB 5IEHB 1XGPB 2G2RA 4AMKH 3NH7L 5DTFA 4R7DB 1NL0L 3S4SA 5DQJB 2VZSA 1XIWD 2P1YA 3PQYA 5IMOA 3WJLA 1I1RA 1C12A 3RGVD 1EHXA 2QHRH 1OWRM 2XTJE 5IB5A 4Z7VE 4YHYC 3SPVB 1FZKA 3MJGX 3OR7B 4KDTA 4OD3L 3QAZB 5EO1B 1IM9A 3ZLQC 4PJ5A 5D6CB 5I74C 2E9WA 2IH3B 3F7YB 1PQZB 4G8EB 4XMPH 4MAYD 4GW4A 1QLRB 5IVXE 3CX2A 3DUSB 3VXPB 1TXKA 1AC6A 1RZFL 5A2KH 4LRNH 3L5JA 3Q2CA 3KPMB 4KKCD 4HT1L 1KG0B 1L9MA 3CVHL 2OYPA 5DJ8A 3RAJL 4QYOA 2J8UA 3LKPB 3BVNA 1VCAA 3QXDA 2NY2C 5IEHA 1XGPA 4PJ8C 3PGCB 3BP6B 4G8FA 4R7DA 5IROA 5CLTA 4JREB 3P4NA 3QHTC 4PJAF 5F3BB 1DBKH 3NACH 5KS9A 4PJ7E 4KRPD 3UXFA 5I75C 5HDBF 3SPVA 4P5KB 2GCYB 3OR7A 1MCKA 4OM0L 1AJ7H 4WCYH 4FQ2H 1YNTA 4OQTH 2HTLC 1WZMA 1WWWX 3N1QC 2IH3A 1PQZA 5CJXC 5E2VH 1QLRA 1VADA 2NX5D 2NY7H 4S1DC 3V6BR 3RHWF 4UT9H 3U9PL 5I0DA 5L2KA 3LB6D 3VXPA 5ADPL 2NY2B 5F1NB 1HXYB 4PJ8B 1P9MC 4GKNA 4JO4H 5E1AB 1K4DA 3IRPX 1DSFL 3KPMA 4OIIL 4EI6A 5D70L 2EO9A 1KG0A 4X6CE 4KMTH 3RY5A 5L2JB 2V7HB 5FA4B 1F42A 3GMNB 4HFWB 5I75B 2FD6H 3EYQD 3UBXB 3WNPA 3PGCA 4PJFB 4P5TD 1IFHL 2D0GA 3NZHH 2EXWC 1KB5L 1KBGH 4QCIB 1T1XB 5EC1B 4EI5A 2EYRB 4ODXA 1JZ4A 3THMH 4KPHH 2GCYA 3OR6B 3VI3E 4EDXA 2EE6A 4Y5VC 4HWBA 4OZHE 1JK8A 1C16B 2FJHB 1BQLH 3WL9B 2DLIA 3SDYL 1BAFL 4WFFD 2Q8BL 2ADGB 1U93A 5F1NA 1HXYA 5E1AA 2ZSWB 4ALAL 2E9JA 2XV6B 2YBRB 1CXEA 3FRPG 3GJFH 3U4BH 5HVFB 4OAWB 3GEWB 4NO2B 2C4FT 4FTVE 2NYYD 5L2JA 2V7HA 5FA4A 1JHTB 3GMNA 4HFWA 5IVNA 2ICEA 5DWUH 3UBXA 4PRAA 4PJFA 4JKLA 5LBSL 3MV11 4XP4L 3TWCH 5FYKU 1EAJA 4QCIA 1T1XA 5EC1A 1BIHA 4M6AA 2YRPA 5E2UH 3OR6A 5LXGH 2Z92B 1U58A 2PTUA 2V5MA 1LEIB 1TZGH 4FNLH 1H5BC 2GITB 2XKUA 3U4EB 1QQDB 3IFLL 5TE4H 5CZXD 3LN9A 3ARDA 3WL9A 3RJQB 1O0VA 5CD5D 3LZFH 1U8PB 1P7QA 1MCOH 2ADGA 3ZMRA 3I6LD 1GGCL 1KPUB 2ZSWA 2AV7B 1GZPB 4MAUL 2YBRA 2EYSB 1UA6H 3C60B 1KJ2A 1X7QB 4OAWA 3TIEB 4PB9H 2ZSVA 5T5FH 3OF6A 1XF5A 1JHTA 4M8VA 3LVEA 1AD0B 2VXUL 1YMMA 2HTKD 3HKFA 2CIIA 1HWHB 1BLNB 2DN7A 4E5XB 5DRXB 5J56B 2Z92A 3JWOH 1LEIA 3UYRH 1LD9B 2GITA 5B3JF 3UC0H 1Z9MA 3HS0B 3GSOB 5F7FA 1NFDE 4M7ZB 3FZUD 1U8PA 5ALCH 1U3HC 5HI4C 2MCPL 3QXTA 4KUZL 1JV5A 4KGJA 1KPUA 1Q0XH 4K94L 5DLMH 2AV7A 1GZPA 2CXKA 1UWGL 2HFTA 1X7QA 3TIEA 2CGRH 4XNXH 3MLRH 5IEKB 2ICWJ 3U9UB 3ZKND 3I6KB 2DWDB 1S9VB 2Y5EA 1HSAB 4MNHB 1AD0A 7FABL 5JW3L 1FRGL 3S4SG 1MHPL 1JHKL 2HFFB 4M61B 2R2BA 3O8XB 2AAVA 5C0FB 5C08E 5GRJH 4HQQH 5D1QA 5KJRH 3MX0A 1PX3A 3UTQA 4P23D 3GIVB 4XC1H 5KSAA 4X7FC 2DQCL 3NABH 4Z7OF 4E5XA 5DRXA 2QQLH 2XWTB 2FBOJ 3O4OC 3F6IA 2PW2B 4NN7C 4ODBD 3IFPB 1T7ZA 5FYKH 3STLB 3Q48A 2NY6D 2XY1A 4PJGE 4Z7WA 5EU6B 5CJBA 1REIA 2NR6D 4MQXD 2W9DH 2I25N 3V5HB 4N0YH 4GBXC 3KLAB 1Z0NA 5IEKA 3K8LA 3HC3L 2ZUWA 2DWDA 1S9VA 1HSAA 2X5PA 4KK6C 3MBEC 4XNZC 3LCYA 2HFFA 3LKSB 4M61A 4NM4H 5F7DB 3O8XA 1BF2A 3Q6GH 4NN7B 1X5YA 3G6JF 1P4BL 4P4KD 3VFMA 1MRCH 1UB5B 3DVFA 3C5ZB 3WS6C 4ZQKB 4U1NA 2FEEL 4LSSL 2Z0BA 3K4DA 2XWTA 4F2MA 5I16B 1MFDH 1LK3H 1NBZB 1YA5A 2CLZB 4WFED 3IFPA 4TVSa 4JY5H 1QSFD 5HDOA 3STLA 2HJFB 1ZLUK 4XP5H 3QDME 2D31B 4KKBD 4P57B 4HAFA 4OLZH 3PG2A 2B2XL 4ZSOA 4PGCA 4ZAKC 4NQCD 5EU6A 3MBEB 4M7LH 2D03L 4XNZB 5D7IF 5CHNA 1NBQA 3RA7H 5BVPL 1SMAA 1OT1A 3D39E 3V5HA 1KEGH 5LGJB 3D5OF 2EDNA 1DEEA 1WT5C 3JWOC 3RTQC 1T3FB 4PP2B 4LLVB 2A6KB 1RSFA 3L7FA 4EJ1C 4KGLA 4RMTA 5F1OB 1RFDH 2X09A 4MMXC 4UAOB 4IRSC 3GUTA 1LEKB 1CCZA 1A3LH 4O2CA 2DF3A 4B50A 1OAYH 2VL4A 5C9JB 2XN9B 1WEJL 3UPCA 5I16A 3PHQB 4NNPL 4P2OC 2VERN 5I17A 1NBZA 1D6EA 1SMOA 4PJDB 5HPOA 4IJ3B 5HGGS 4M43L 4Y16D 3D2UB 1C1EH 3WJJA 3X3FH 4P57A 2C1PA 4JFHE 3RTQB 5BRZA 5HYQB 4D9LH 4D3CL 4XNYL 1AI1L 3FO9B 5C0JB 4BFIA 5LGJA 1IKNC 3QG7L 4WGVB 3L5WA 2IWGA 5I1HL 3CK0L 5D2LA 3T4AB 2YUWA 1JHLL 3UBXG 4YXHH 4CU8A 5JDJA 4PP2A 5JUEH 3ZE0F 5M7QA 1T1ZB 4J2XA 1U91B 2JELL 3CC5B 4HMCA 3SBWC 4XCNA 3VD4A 1C5BH 2FH8A 4JN2A 5TGBA 1CL7I 5BS0A 1IGCH 1LEKA 3MV7B 5DRWB 4XCYA 4FFVD 1U8QB 4F7EB 3RVTD 4YXKH 1WVZA 1CQKA 4NUGH 3E2HB 4Z7VF 4JFFD 1DBAH 4Y4HC 5HHVL 1CLZL 3PHQA 3LRGA 3QUYC 4XHJC 2ITDB 4ZUWB 4PRIE 4G9FD 2BY3A 2OS7A 1SJXA 3SGJC 3WIHA 1YQVL 1BVKB 4PGEA 4HBQA 4ZTPH 4CRPA 4N0UE 5T3ZE 3D2UA 2BSRA 5IVXF 1U6AL 2WP3T 5CWSB 4WTXA 3CH1B 5HYQA 1XMWA 3VFUB 3FO9A 1JGLL 5C0JA 3UTPD 4BM7A 4NN5C 5IJKA 2DQJL 1HHHB 2I26N 2AK4B 4OV5A 3X3GL 1NMBL 4I13B 1DQLH 1T20B 5J11B 1U91A 2C1OA 3CC5A 5IBTH 1N64H 4NQEB 4P9MH 4NC1E 2V5RA 4M62L 2IG2L 4F7EA 1U8QA 3BKYL 1CF8L 3R4DA 5FYLH 1WBYB 3MYZA 3TO2B 4GMTL 3ZZ1A 2ITDA 4ZUWA 3VFRB 5ILTH 4RAHA 3UAJC 4BQ6A 4IMLA 3FJTA 2DAVA 2G75A 4UQ2B 2X4QA 3AFLA 2VN7A 3MTRA 5CWSA 2EE9A 1JNLH 4XPFH 1I9RL 4WENB 1I3VA 1S9KC 1NCAL 1HHHA 1AGDB 4QOKE 2FECL 5C3TA 1YYMH 3HC4L 3BPOB 3V9FA 2AK4A 1MQKH 1ZWIB 5IIEB 3GIZL 3HNTL 5JXED 1JE6A 1SYSB 2CO7B 3EFDL 1CVRA 1QZ1A 1T20A 2KUTA 3HR5B 4PGDB 3CXHK 5C0AE 4NQEA 3T2NL 1MCNA 4G6AC 5JA9A 5TQ2L 1J0KA 4Y0GA 4ZO9A 1VESA 2BERA 5DD6B 1WBYA 4HKBB 1J1XH 1FORH 3I84A 3VI3F 1EZVY 4DN3H 3QUMA 4JO1L 4BZYA 2ARJQ 3MRRB 1UH3A 2XACC 1XR9B 1QSEA 4E42B 4WFGD 2APBA 4MA3B 1KPRB 4JRXB 5HHOD 2EDJA 4J4PA 1JTTA 1SY6L 2R0LH 1CS6A 1BM3H 1FJ1A 2NQCA 3MXVL 2R4RL 1ZWIA 1K2DB 5IIEA 1SYSA 4TRPL 1WGOA 2ED8A 2VXSH 5KVFL 4PGDA 1D3CA 2ADFL 3BUYA 1NL0H 2D0HA 4YHPA 4MD0B 2BVEA 3B8SA 3F5WB 3CFIC 5AYUL 4X7CC 3AREC 2DQHL 4N0CD 5DD6A 1TTGA 5DF0A 4HKBA 5I15H 4NKOB 4YWGL 3RKPA 2BOBA 2EDTA 4NBZB 4N9GB 5GGTL 3BMWA 1XR9A 2WBWB 5HVWA 4X6DB 4MA3A 2Q7YB 4I1NB 1KPRA 3H0TB 5TFSL 3D0VB 3PGFH 5A2IH 2FRGP 3AREB 4HT1H 4LKXB 3FFCD 3N1PC 3RAJH 5GRYA 3O2DH 1YEFH 2E8ZA 3CSYA 5BCAA 3GKWH 4D9RD 4PG2A 2HFGL 3R8BB 2ESVE 4XX1E 4H20L 4MD0A 4Y5YA 1F3DJ 3F5WA 4P2QB 4S11A 4NQXB 2DMBA 3MCLL 5GJSH 3PWPA 3MGTB 4KVCL 1FGNL 3SDDB 4NKOA 3UTZA 3HLAB 4OM0H 1P4IH 1QR4A 1D5ZB 4WUUA 4XCFL 4I5BB 5EZJA 2Y07L 1JPTH 2JJVA 1T1WB 3CFJB 1E27A 3LS5H 1UXWB 2B4CH 3DWTA 1ZLWH 4X6DA 2Q7YA 3WHE1 3FO2B 2KZWA 3U9PH 5C07D 1NJ9B 3GHEL 3MMEB 3D0VA 2OI9C 1BEYL 4KROC 5GJTL 3V4PH 3ULUC 4M6NL 1DSFH 5GIRB 4Y19A 1K5NB 1S7SA 4LKXA 3IDXL 1EMTH 4WVRA 5DT1H 2EDLA 2ZZUT 1OM3L 3GRWL 1GXEA 1H3XA 4XHQA 3V8OA 5LQBL 1J1PL 4HIJB 1OTUD 2H26B 1WAAA 4ZUVA 5K9OA 1DBJL 3M17B 2FJFB 3T77B 1KB5H 3RQ3A 3B9KC 3D1MC 2WV3A 4KI1A 3V0VB 4NQXA 1IT9H 2C3XA 3MGTA 1IAMA 4X4ZA 1U95A 3EOAA 3HLAA 3WNOA 1UM5H 2VAAA 5C0BA 5HHPA 3KLSA 4I5BA 1BOGA 1A02N 1B0RB 3KYKH 1WWCA 3C6LC 3O2VL 1UXWA 1BAFH 1OP3H 4PJGF 4Q9CA 2EH8H 2Q8BH 1NJ9A 3MMEA 4MD4B 1A9BB 2AEPH 3D87B 3ARFD 3GI8L 5EUOB 1T6VN 3FN9A 2VE6B 2K3TA 5GIRA 4ACPA 1MJ7L 2DIAA 4Y4FA 5A3ID 1YY9D 3FN0H 1B0WA 2NY1D 2HLFC 2IANA 4YHNB 4HIJA 4HIEA 2H26A 3L5XL 5LBSH 3M17A 3T77A 3TZVB 1EGJH 4XP4H 5C70A 4LSQH 3H7BB 2VR5A 3UTTB 4KTDL 2BP3A 4W4OC 1GC1L 4Z0BH 1RQ5A 4UIMB 2X7LB 2VAJA 3SJVE 2Y4SA 5K59E 3EDJA 3UJJL 2OZ4H 3W0WB 2Y6SD 3WLWC 1C7SA 3PWNB 2B1AH 4C4KO 3SDCD 2VR4A 4MD4A 4DW2L 1GGCH 3A6CL 5EUOA 3GBMH 3BEVA 3O4LB 2VE6A 4MAUH 4PTUB 4PV8B 1BFOB 4KK9D 3EW3B 4R0LA 1YN6A 3QIBD 1G7PB 2B0SL 1IGTB 5D7JB 4WEUD 3HG1B 4M7JH 1LO5B 1ZMYA 1H3WM 3MRKA 3RX7A 1MPAH 4XPHH 5H37G 4YHNA 3SCMA 3AY4A 3TZVA 2NY0D 5CP3H 3QULB 2AJUL 3H7BA 1D5MA 5MENA 5MI0B 3K8MA 4BQ9A 1X6LA 5BZDB 4U1JA 4PJXE 1OLLA 1J0HA 2WIIB 2X7LA 5DQ9B 1K9TA 4NNYB 3NZ8B 3WE6B 1MWAL 3FN3A 5J3HC 1FHGA 5C0GB 3PWNA 1KYOK 4F58L 1RURH 2GSGB 2FHFA 2FIRT 2KQMA 3G5XB 4F15C 3RU8L 1D6VH 2MCPH 1MCJA 3MCG1 1XIWC 4KZEH 3QHFH 1OARL 3O4LA 4U2YA 3Q1SL 5CGTA 2BOCB 2YZ8A 4PV8A 3RHWK 3CU7A 3RGVC 1QFWI 1G7PA 3IJYB 3AUVA 2Z9TA 3PE9A 5D7JA 2D0FA 1LO5A 4QTHA 3HUJA 4APQD 1QNZL 1MHPH 3MV9D 4MAYC 4JFPB 2CDFB 4RBPH 3FQWA 3M8OL 1OL0A 3QQ3B 3FT4A 4PJIF 1W72H 2DQCH 4JO2H 2DKSA 4WI6A 5DQ9A 4AIZA 1XIWB 4NNYA 5HGBB 4KKCC 4KJPD 5DJ2B 1Z9SA 1PG7L 4UBDD 2X4RB 1MCFA 3UEZA 1AQDB 4V2BA 4KZDL 4LVNC 4M1DL 5C0GA 2AXGB 4AY0A 4XBEL 1IC5H 1URLA 3G5XA 4XGZB 3PXHA 1JF6A 4V1DE 1CGWA 4AEIH 4JVPA 5JW4R 4OZIB 5HSFA 5ITBH 1F5WA 1RI8A 4KRPC 4H5SB 4XCEB 4U49A 4Z8FL 4O4YL 5MERB 4FXGA 1TTUA 1T83C 4HGWA 3OKMB 4TOYH 1JWUB 2GTWB 4ONOA 4JFPA 5D5MB 2JB6B 3RNQA 1A1NB 3V5KB 3QQ3A 3LB6C 2H32B 4IIQA 5DDHB 1P4BH 3CSBA 4X99B 3WXWH 1EEQA 4NUJB 4MHHG 3V4VH 3EOYG 4NHCL 5HGBA 3EYUL 4PJBE 2HT2D 4JFXA 1AQDA 2ZKHL 4K2UL 2AXGA 1NC2A 3EYQC 2RCSL 3KJ6L 4P5TC 5HYFA 1MFBH 2D03H 1NMCC 4PLJD 4WV1B 5BVPH 5J57B 5I8OH 1PD6A 4HPOH 5MEOB 1A3QA 2IPUG 1AR2A 3LSOA 1MJJB 5IW1A 3DGGB 5HVHC 3TIDB 1VHPA 3CD4A 3KPSD 3N1MC 1JWUA 1WFOA 2YD3A 4ZNEE 3BPLB 3OZ9H 2GTWA 4HUWB 1T03H 4K71B 5D5MA 2JB6A 4F3FB 1Y6KR 3MACL 4U6TA 5DDHA 5AUMA 1E28B 3ZDYF 4NUJA 1ZHBB 2YKLL 3IXTB 5E2WL 4OFPA 5GRWA 1V7ML 5AWNL 1BZ7B 2Y36L 1WEJH 1NH6A 1NMCB 4JHBA 2MOVA 3FOMB 2IAMA 4FOMA 4NNPH 1SJVA 2NYYC 4RCAA 1KGCD 5JHDB 4LSRH 3UTOA 3AS1A 3OL2A 4M43H 3TA3B 1GGBL 3DX6B 3MBXH 5DHVA 1I8MB 2OMNA 5I73C 4HWZB 5F6IB 1E4KA 1P2CB 4WV1A 2RB8A 2F54E 3NA9L 5MEOA 3IAGC 4OLYH 4JN1H 1JI2A 1MJJA 3B2UD 3JTSB 5I1HH 1NCDH 5J13C 4EOWL 4F7MB 2C7UB 2JELH 3SGDI 4OKDA 5CZXC 5I18H 4PP1D 4Q9QH 4F3FA 5CD5C 1DDHB 3IXAB 3MJ9A 2AQ1A 4RGMC 1FFOB 1NAMA 3RWJB 3VRLE 2OLDA 5I76B 3FOMA 1UZ8B 1R5WB 5JHDA 4LDOB 5AAMA 1IBGH 5J89A 4FFWD 3TA3A 3DX6A 1I8MA 3FQUB 1C08B 2HTKC 4ONFL 1QRNB 1MJ8H 3MUZ1 1P84J 4HWZA 1PKOA 3Q0HA 4XVSL 3S36L 2XZZA 8FABB 3S98A 1NCNA 4F7MA 2C7UA 5CSZB 5GZOD 3O3UN 2VLJE 4HLJA 5I0ZA 1F6LL 5DUBA 3FZUC 4KI5F 1G9ML 3S97C 2VDRL 4XMKL 4M62H 2IG2H 4JO3H 4X80L 5DEFB 4ODUB 3BKYH 1BD2E 1NAKL 3GKZA 4OFKA 1CF8H 4EZMA 3C08L 3LPWA 4NN6C 1UZ8A 4MNQD 5E2TL 3ZKNC 3V52L 1RIHL 1R5WA 4LLUB 2MCG1 5DR5H 1ZS8B 1FYTA 5J1AB 5DMJB 1ODAA 4R2GD 3FQUA 1QRNA 3DVNB 1T66D 1T7XA 1I9RH 1R3KA 1P53A 2I24N 4P23C 4R90L 4YBQD 5EWIH 1NCAH 4PRPE 3A0OA 4XC3H 3ZKXC 4LCCC 5JHLL 1NBVL 2VC2L 4Q6IC 3GIZH 1A22B 3ARBD 3EFDH 2RBLA 3LPGA 5E6ID 3VGDA 3LQZA 5FXCH 4PD4K 5CSZA 2W1NA 1EXUA 2AK1L 1IRAY 4OIAA 2QHLA 5BMFL 2EDKA 1IGFH 1QSVA 2NY6C 4OLVL 5IUSA 3AU1A 6FABL 2NR6C 5DEFA 4LLWB 4MQXC 4ODUA 4CMMB 1MCPH 3L3JA 1CD0A 4P2RD 5B4MD 1FO0B 4JZOB 3BKJL 4LDEB 3IGAB 3WIIL 1CDJA 3RY6C 5GS0D 1GAFH 2VLLB 3BDXA 3PWLB 3QNYA 2R39A 4JFZL 3NIFE 5J1AA 5C7XL 4WWID 1AO7E 5EOCJ 4L1DA 3DVNA 4NSKB 4LEXH 2V6HA 2BNQA 5IW6B 4DN4L 2X9YA 2J5LC 4P4KC 2PYFB 3D3VD 1JL8A 3OXSB 4NOFA 3U7WL 1B0GB 4GG6B 3RZCD 2R4RH 3H3BC 4HUXB 5KVMC 2EIZB 4XAWH 3W81A 4TRPH 3ET9F 4OZFH 3WFZA 3SDAD 5KVFH 2C9AA 4JM2F 1INDL 1QFUL 4OCXL 2VLKE 4OJFL 2ADFH 4KKBC 2DQHH 3VRJB 4X9HA 1QG3A 2CUHA 5E9DD 4IEFB 2IPTL 3MR9B 4R9HA 3KPRB 1FO0A 5B3NA 4YWGH 3IGAA 2HRPH 5AZEL 2VLLA 1KXTB 3SKMB 4P46D 2J5LB 4MA1B 5GGTH 5K59F 3PWLA 3U2SB 4TQEL 3NCMA 4Y89A 4NKMB 4XH2B 1OSZA 2VR9A 5FDWB 1IKFH 4NSKA 5TFSH 3KHQA 4PJHE 2PYFA 3LEXB 3OXSA 4OI9A 4RA0C 3L1OL 1B0GA 3CMOL 4EEEA 4GG6A 3D3VE 1OTTD 3MLWH 3CX5J 1TQBB 4HUXA 1HH9B 3H42H 4JFEE 4L4JA 4L3ED 3D25A 3ZKSD 5ID1A 5DMYA 2BVTA 3BO8B 3KPQA 3VH8B 2HFGH 4LCWA 3VGBA 1KIRB 2G5RA 4Y16C 2H2PD 1OSPL 1RZJL 2XY2A 2JKXA 2Q86B 2YD9A 1DQMH 5HYJE 3MCLH 4GMSL 5I1IH 4PJXF 2J6EL 4KVCH 1YNKH 3P77A 3OWEA 3A6BL 4LLDB 4XPGL 4AIOA 4A2MA 3MR9A 5GS0L 3KPRA 5E9DE 4JQIL 3K81A 3SKMA 3U2SA 3ARWA 4XCFH 4PUBH 4H25A 2YOCA 4AENB 2DD8L 3BD5A 4RWYL 3NMEA 4NKMA 4XH2A 1GJIA 5EO9B 4YHOH 5FDWA 2DJ4A 2I5YL 3BKMH 5H2BB 4HIIB 5GJTH 1BEYH 4FFVC 3RVTC 3NIDE 1KCSH 4MJIE 1HH9A 4N9OB 1AC0A 3MA7B 2NCMA 4FFYH 1OM3H 3BO8A 5EIIB 1J1PH 3VH8A 1KIRA 5KVDL 5E7FA 4NQDD 4CW1B 1GOHA 5DMGD 5MEQB 3S35L 3KXFD 4ZFFB 1HI6A 1JUFB 3VG0L 2VRAA 1NANH 3V6OE 4HIXH 1RULL 3B43A 1EJ6A 1P7KB 5EO9A 4JFDD 3O2VH 4FQJL 4Y1AB 3KPPA 3WMSA 5KOVC 5H2BA 2IQAB 4HIIA 4J6RH 1OP5K 5SWZB 1I4FB 3ZHLA 4ONHB 2XOTA 3J8F7 4OZGE 1U3JA 4LHUB 1MJ7H 2XTLA 1M7DB 3L3OB 1EX0A 3MA7A 3I6GB 3MRHB 5EIIA 3QRGL 1KJVB 4DGYL 4CW1A 3RWGA 3GBLA 1VKXA 5JPNA 4IHOA 4NQDE 4KTDH 1R3HA 4ZFFA 1JUFA 3KXFE 1Q9OB 1Q8MA 3VFPA 3VMNA 4XB8A 4WW2F 1F4WL 1P7KA 5JXEC 1MELA 1JP5A 3UZEA 1EHLL 2GAZB 2X89A 1KJ3L 4Y1AA 3SDXE 4S1RL 1CXIA 4GAJH 2D4FA 2IQAA 5I71B 5SWZA 1I4FA 3A6CH 4ONHA 4G6FD 5HI3D 3GMLB 4QHLB 1DEDA 4LHUA 2DI9A 1B6UA 2DI7A 1JJUA 3VXRB 1M7DA 2B0SH 3L3OA 5C0EB 2H41A 4NQVB 5HY9B 2ICCA 4EXPX 3MRHA 2PYEB 4D0CA 1YPZE 2AJUH 4F9LC 3BDYL 3BH9A 4HWEL 4RWHA 1FG2A 5HBBA 4LASL 1CFVL 1Q9OA 3E6HB 2B1HL 3U7AA 2YPKB 5HHME 1MCLA 1MWAH 4RBPK 4L4VE 2X1XR 5CJ8A 5KZCB 1A7BA 5EBLB 3CPLB 4JQVC 1IQWL 2RHEA 4U33A 1WWBX 3NTCH 2UVFA 4KDWA 2EDXA 3KGRA 3Q1SH 4XP6H 4NNXA 2VUOA 1AIFB 4GRWB 4OF6A 5DGRA 4N0CC 4YPJA 5J8OA 1FC2D 3VXRA 2J8UF 5EUKB 2W9LA 5C0EA 3MLVH 1CZ8H 4MCYA 4LCUA 4O2EB 2PYEA 2BCKB 3LPFA 5EB9A 5KS9F 3M8OH 5D7KE 1ZEAL 3TV3L 1AHWC 1MUJA 1MREL 4TVPE 5D93C 2FJGB 1HQ4A 2VNCA 3WKML 4BK4A 2YPKA 5HYEA 4NIKB 1PG7H 3MLYH 4UTAL 4QRPD 2BY2A 2FDBP 5CJOL 3MYJB 2Z8RA 4XBEH 3CPLA 3LN4B 1CDIA 3P2TA 3QG6B 1OGTB 1MCWW 4HC1H 1N6VA 1PY4A 3GSWB 1EO5A 3FL7A 3ZTJH 4OF7A 3MODH 5IR1B 1A1OB 1AIFA 4FHBD 4NQSA 2C3GA 4KJYB 2FIKB 4Z8FH 1AHWB 4GQ9L 4E41D 1HHJA 5E8OB 2GEEA 4F37F 2BCKA 1MHCB 4JKMA 3BGFC 1PZ5B 2D7TH 4LNRB 2ENYA 5IFHL 3BSZH 1OQXA 5DC4B 1MRDH 1TMCB 2FSEB 4C56E 3QPXH 4YGVB 3TBTA 2ZG2A 4NHCH 3EYUH 3OKKB 2R2HB 4PRBA 3ZE2F 1F02I 1F11B 1T7WA 2A9ML 3EO1B 4G9DB 4MDIA 2ZKHH 1MCQA 4K2UH 5EH1A 4KXZH 3MYJA 3KJ6H 1OTUC 1I3GL 1ZVYA 4GXUN 2A73B 4X6BB 3GSWA 1EH9A 3RWCB 1U8MA 1A1OA 2QJDA 2Z93B 3U36A 2VTFA 4ETQB 4KJYA 5C07B 1JGVH 2FIKA 5BO1L 2OSLB 5E8OA 3VH8G 3V0AC 4U3CA 3T8XB 2DWEB 5BVJA 1IM3B 4HMDA 1WZKA 1NDGA 1MHCA 4AG4H 4HV8A 2W38A 4LNRA 1OTSD 5F8QC 4PV9B 3GJFA 1NGWB 2FX8H 3GFUA 4X4MA 3ARFC 2FSEA 4J23A 3N50A 1V7MH 4YGVA 5AWNH 3MLSL 2Y36H 3DECA 5M95B 3OKKA 2R2HA 3MRCA 4IRZL 1YY9C 5A3IC 1F11A 3EO1A 4G9DA 1TVHA 3NPZB 3NIFF 1XFPA 2NY1C 2P5EB 1FLRH 4BA8A 4L3AA 4K7PX 1GGBH 2R2EB 3VXMD 2A73A 5T1LB 2A77L 1TNNA 4K3EH 2X4NB 1FNGA 2EEDA 1S7UB 4ETQA 3NA9H 3LKRB 4R4BA 3ARPA 2D7PA 2FATL 2OSLA 4QHKJ 3LKQA 4XNUL 2A6DB 3SO3B 2W91A 3T8XA 2QR0B 1HH6A 1C5CH 2DWEA 2Y6SC 3O6KL 1IM3A 4DK6A 3WS6A 1ONQB 1RUKL 3RX5A 3ORJA 1INQA 3HI6L 5HHXL 5SV3A 3BN3B 2E7CA 3DUHA 4K7PY 3SDCC 4PV9A 1HZHL 4EUPB 4H1LB 5D7LD 4Z9KB 1TJHL 5FUZH 4OGZA 1PG7X 3C2AL 2E27L 4KK9C 1FGVL 3QIBC 5EOTB 3HZVB 4FG6D 3B5GA 4PJAB 1M1SA 4JDZA 2GK2A 5DJAA 2P5EA 1S7XB 4Z7NE 3PL6A 5HDQL 2R2EA 2NY0C 3TT1H 4ONFH 4KKNA 4LKCB 2AP2A 2NXYB 5FO8B 4LHUG 3QWRD 4JCMA 5F8RC 1S7UA 2EEAA 3WUZA 2AJXL 1XAUA 4YDLB 1A6ZB 5C2BL 2Y5TA 1KN2L 3N06B 4IRSA 2A6DA 2BNRD 3VFGH 2QR0A 5ID0B 2E7LC 1T89A 4ELMA 5AD0A 5F9WC 4TUJA 3WN5C 4KJQD 1U42A 3BQUD 1I1FB 1NGZA 2N56A 2O5ZL 1KV3A 4XVJL 4EUPA 4QRRB 1MY7A 2VDRH 4H1LA 4XMKH 3OKOB 1IAKB 2BRRH 2R8SL 4YUEH 3C08H 5SX4H 2VLRE 4FZEL 4YH6A 5DYOB 3NA4A 5HD8D 1MIEH 4PJAA 3T2QA 2XI9A 5HPMB 1BP3B 5K93A 3GMMB 3DSNA 4XZUA 2OP4L 4LSDA 4JHAH 4Z7WF 5IT2H 4APQC 1DANU 3OKEB 3WXVL 1AD9A 1JZ2A 3BKCL 4UOW1 5DXWA 3QISA 4LKCA 1MJUL 1Q1JH 3D18A 5F93C 1DR9A 1FSKC 2R1XA 3S3PA 1FDLH 4CJ1A 5CD3B 1G0DA 2O61A 3NIDF 5C8JB 4WHCA 5HTSA 3SBWA 2KQNA 5DURB 1CGSH 4LSVL 4KJPC 2GJ6D 4RGND 4F80A 1Z3GL 4UBDC 1CDGA 2R0WH 2H6PB 4WTZA 3CAFA 2XRAL 4RFNC 2GIYA 2AK1H 3PF2A 5BMFH 4U1GC 1I1FA 4H0IA 4OLVH 3ME0A 4QRRA 3JWDL 5B38B 1R0AL 4X4XA 3OKOA 5BJTB 1IAKA 5T3XD 3JTTB 2KH2B 3BKJH 4U1LB 5DMKA 3WIIH 5DYOA 1KCLA 1J8HD 2XT1B 4U6YA 5FA3B 3GZKA 3VWKB 3VXQB 3MV8E 3GMMA 1CIUA 1K6QL 1RPQA 4AEFA 4X7SL 3OKEA 3O9WD 5C7XH 1WZ1H 4U2ZA 3OAZH 4YBLC 1N7MH 2XWJB 1DVFD 3EBAA 5DJCA 5CD3A 5GGVL 4U1GB 4YX2L 1NCBL 5C8JA 4U1KA 3VJ6A 5J12B 4WEBL 2IH1A 1FL6B 3QIWA 3PWJB 5K9KB 2HT2C 2H6PA 1OP9A 3HE6D 1A7QL 1XCQB 2PCPB 3UJIL 5KANI 2GJ6E 4I3RH 4G6JL 5D7SH 1MHHB 1QFUH 4OCXH 4OJFH 3C9NB 1P6AB 1G7HB 5B21A 2R56L 1H15B 4W68A 3PXJA 3C8KB 4KI5D 4JHZA 4PLJC 4R96B 2IPTH 1DUYB 5D2NC 2B8OT 3JTTA 4U1LA 1JPSL 5BOZG 1XGTB 5FA3A 3VWKA 3VXQA 1J8HE 2XA8H 4DUVA 5FHBH 4KUCD 3DLQR 3LDBB 5CUSH 3SDXF 1L7IL 5E5RB 25C8L 1MRFL 35C8L 4EKXA 2XWJA 4YIQB 3S36X 5E70A 2EECA 2L4OA 1G9MC 4JRYA 3CLEL 3QT2A 3QIUB 3DMMA 5D2LF 3SOBL 4YHLH 3VGGA 3G9AB 4U1MA 4RMWA 1FL6A 3DI3B 2F53E 5C09B 4J3VA 2ZUYA 4LPUA 5D2NB 4BSWA 5ICXB 3IU4H 2PO6B 3MOQA 1CWVA 4JPKL 1TJGL 1H15A 2MFNA 4J1UA 3KPLB 1UWXK 4ODVL 3QFJD 4G8GB 4OSUL 4R96A 4GMSH 5T3XL 4OGAD 4BZ1L 3RL2B 1A1MB 1CR9H 5MEPB 4I3SL 5K9QG 3REWB 4JR9L 4BFEA 3FQRB 4ODWA 1R5IB 4GXUM 3H9SE 1ZHKA 3JXAA 1BREA 4PP1C 2I5YH 4L9LC 4YE4H 3FAXA 2ZJSL 3SE4A 2P46B 4W6XB 3VRIB 3QIUA 3T0ED 2MJWA 1T22B 5C09A 4DUXA 1RUMH 5TF1H 2R0ZH 3QFDB 3QUXB 4OUUB 1CBVL 2PO6A 4PLOB 4FFWC 4H0GA 4G8GA 2FX9L 5E0QA 1U8NB 5GGQL 4MMZC 3VG0H 5FM5O 3QFJE 5EA0L 1A1MA 3N0PB 4JKKA 3BD4A 3G6JB 3ALPA 3FQRA 3KLHD 1R5IA 3VFNB 1HWGB 2NY5L 2O5XH 2R1YB 1KTLA 5GZOC 1SBSL 4FQJH 4X83A 2PXYB 4Z7UE 5F88B 4MNGB 4QHMA 1VFUA 3INUH 5DA4A 4Y7MA 1J11A 2VYRE 3VRIA 4LRIC 1BFTA 1G9EA 2VABB 4XWGL 2HVKB 2EC8A 1LHZA 3UJTL 3TH4T 2CJUL 1IJ9A 5D7IB 1BECA 1LDPH 1T22A 3CH8A 2ATKB 1UCBH 3QUXA 4OUUA 4P59L 5JQ6H 3BAEH 3QRGH 4DGYH 4EUPG 2W65A 4H1LG 4IRJB 2HN7B 4R26L 4R2GC 1T66C 3T2OA 4PJ9B 1Z9LA 1G1CA 1OW0C 1U8NA 3UTSD 4TSCL 5A1AA 4YBQC 4P49A 3C6SB 3VW3L 1G6VK 3ALXA 3OAUL 3VXUB 5L8LB 4YLQT 4HHAB 3SQOL 3LQMA 4WI9A 1F4WH 1J86A 3CXDL 3ARBC 3VFNA 2ADIB 2MQCA 5E6IC 5IHLB 3KJ4B 4N1EA 1EHLH 2R1YA 4TPRH 2WINA 1U3YA 4EDWH 4LFHG 3MUHL 4WEMB 1HHKB 1OAUH 2B5IB 1S3KL 4MNGA 1RZJC 1ZE3C 3O6FB 4KJWD 3U30C 1R5VB 4RAUB 5E6ZA 1O7SA 4QY8B 5B4MC 2VABA 4QRQB 4L4TB 4WTZG 5GS0C 3NCEB 4UI2A 5SWSE 1RUAL 5J9PA 4WO4B 4PRHE 2FO4B 2AJVL 2Z31A 1CDBA 3RVWD 2V17L 2VDOL 4IRJA 4I0PB 1FBIH 2HN7A 3TC9A 4LASH 4PJ9A 3D6GA 3RWEB 1CFVH 1S7RB 5EC2B 4P99A 4OD1L 4DVBA 3C6SA 3HZMB 5CIPB 3BWUC 2YRLA 3VXUA 3QA3B 4HHAA 3RZCC 2P4AB 2HYMA 1FNAA 2DKMA 4NGHL 2ADIA 5BQ7B 4CVXB 2QQNH 3SDAC 2XTJB 1YEJL 3QUZD 4Z7VB 1F90L 1JIBA 5BZWB 3IDYC 3QDGD 5DZOA 5D4QA 1AKJA 3O6FA 3IKKA 4TULL 4QY8A 3OGOE 5IVXB 1NQBA 3MRGB 4LL9A 1WLHA 3WHXB 4P46C 2F19L 4WO4A 5T1KD 3S35X 4HS8L 4I0PA 1VEMA 3OB8A 2ZUTA 2NW3A 5MHSD 3SDAB 3PABB 3RWEA 5JW4Q 1S7RA 1BMGA 5EC2A 1MREH 1EFXA 3QXUA 1Q9KA 5B8CC 4F8QA 2F5BL 3O2DA 1ZTXL 5J1SC 2VB5A 3CCHA 2FLRT 4GS7B 1OTTC 4UTAH 4MZ2A 3DIFA 5BQ7A 3EYFA 1VACA 4NBXB 2GUOB 4Z7VA 5L7XH 4G6KL 5C0CB 1QR1A 4I9WE 1RIUH 1GSMA 2H2PC 3T0AA 1ZVSB 3BZ4B 2WAHA 3BESR 2H8PB 5I6XC 3OJDA 5F3HA 2X70B 5IVXA 3CFBB 1UKTA 5IB1B 1RHFA 3MRGA 4GQ9H 5C0IB 5LJYH 1FCCA 3WHXA 1HCVA 2FZ3B 1S78D 3PQYD 1EK3A 5KANG 1JTOA 3IDUA 4TVPH 4YQXL 3GBNH 1WTGT 3CFCH 3AXLB 5D1ZD 4L3EB 3PABA 1T21B 5IFHH 4X9BA 4CVWA 3DTXA 1IM9D 1CVSC 4PJ5D 3RUGE 2W07A 2BXYA 4G5ZL 4OFIA 4PJ7A 4HX1B 2GUOA 5E99H 1I3GH 1U8KB 4FXKB 5FB8A 2DQTL 1ZVSA 5DMGC 3BZEB 5TE6H 5F97E 2H8PA 1IQDB 1I1AB 2BVPB 3GM0A 3RVXD 3QDJE 3SE3C 3BOVA 1J0YA 3CFBA 4MAYA 3TBWB 4F7CB 3HMWL 3O45B 5IB1A 2DTMH 5ITFA 2IADA 3GK8H 3U1SL 4M7KL 1UM4L 3K8KA 2QQQA 1FV1B 2FZ3A 4YHMH 3EDFA 4X6CA 1G9NH 4FTVB 2GT9B 3T09A 3AXLA 4WHDA 3IS0X 1A8JH 3F7RA 1T21A 1Q9WB 1I9EA 3LEYL 4GQPH 5GGSB 5F9OL 1GIGL 1NBYA 4YK4C 3MLSH 1N0XH 4Q2ZA 2GW5A 2J1KA 4HCRL 4JJ5B 2ICWB 5FCUL 4IRZH 4DEPC 1EGJA 1RZIB 1T2QL 3N85L 4S1QL 1RZ7H 5GGSY 4HX1A 4PBVC 3ARQA 1W8OA 2D3VA 2FYYA 1U8KA 5FEBA 4FXKA 5IQ7L 2UUDK 3WDHA 4OZHA 5DGQA 5ETUB 1VPOL 2UY7A 1IQDA 3P0VH 1NCUA 1I1AA 1ZHNB 2BVPA 4EXKA 2OZ4A 5CAYB 3QUKB 3TBWA 4F7CA 1RK0A 2OXHA 2AVGA 4TSAL 4BH8B 1MEXH 1JGDB 3H9ZA 4UILH 1ZANL 1FV1A 1MI5E 4S2SB 1HYSD 5HVGB 5HHXH 4LP5A 4ORZC 3O6MH 3MJ7B 4FTVA 2GT9A 4KK8D 4IMKC 3H2WA 1Y18A 1I9IH 4F57L 3T3PE 5HI3C 1OGAE 3C2AH 5FECB 2Q8AH 2FB4L 4JJ5A 2A1WL 4U7MA 2WP3O 1RZIA 1TQCC 3NIGF 5C2UB 4OLWL 1A6AB 1BPVA 1FVDB 2AEQH 2JIXB 3MXWH 2HAZA 1G7LA 4XNQA 3RIFF 4KC3B 2YD2A 5ETUA 1HKLH 3ZT6A 4LVEA 2AJXH 3QEQE 3QUKA 2B7DT 5GZND 3LMJH 2W0FB 3HUJF 5KSUB 4BH8A 5GGRB 1EJOH 1JGDA 4NJAL 5DQDL 2YHGA 4OT1L 4IOIB 3MJ7A 4N5ED 5GGRY 3MFFB 3P9WB 4R3SB 1EO8L 1FN4A 3G5YB 4XVJH 4F37K 4JY6B 3SKNA 3HPLA 4R4FH 1I9JL 3ZYOA 2UVEA 5ICYB 4RIRB 2J88L 1S9YA 1UACH 4Z0XB 1YNLL 3ARDD 5C86A 1D7FA 1A6AA 1FVDA 1P7QD 5DHYA 5E8DH 1L0YA 2JIXA 3TESA 1W72A 3BKCH 4DQOH 4X5WA 4KFZC 1MJUH 1RUQL 1X5FA 3F62A 3E8UL 4L5FH 2DQIH 1NFDA 3MLXL 5GGUA 3OF6D 4PJGB 5F7NC 3IETB 3B9VA 5EOCL 3OAZK 3WDJA 1YMMD 4LVHC 3CFEB 3HC0B 1RAMA 4IOIA 2EYTA 3OSKA 4MA8L 4R3SA 4CL7A 4JY6A 3JWDH 1R0AH 4XVUD 2FGWL 1M4KA 4HWBL 5ICYA 2F8XC 5C08A 1FVCB 3VDAA 1LWRA 4Z0XA 4LF3B 4K3DL 1K6QH 1W0YT 2AJ3B 3UCRA 2MKWA 1IGJB 1VFAA 5GSRB 4X7SH 1H3UA 3Q5TA 4QRPB 1P5UA 1A7NL 2OTUB 4CDHA 4Q7DA 2ADJA 3C60D 3TN0B 3DYOA 5GGVH 4WHYH 4ZMAT 3QDMB 3DVGB 4PJGA 1MH5B 1QSZA 4WEBH 4CDGC 4OTXL 5CILL 2ZOKA 1EEYB 5I8EB 3UJIH 3D39B 4JG0H 2BSTA 4G6JH 3ULVD 5JNYB 1UGNA 1OPGH 5D1QD 3RJDA 4YHKH 5JXAH 1X9QA 5EBWB 3UDWA 1MCDA 1R3JB 3OB0H 4OCWH 3FO0L 5GS2H 1ND0B 2GSIB 1GPOL 1FNSH 3V8CA 1FL5A 1CFBA 1F3DH 4WY7L 2BFVL 5E56A 2VO5A 3S5LB 1LO3L 2FHCA 4JGUA 4P23A 2AJ3A 1J1OL 1IGJA 1AFVL 4YBHA 1YEIH 4Q6IA 3LS4L 2OTUA 1OTSC 4PGZA 1KJ2L 4RAVB 2WBJB 4R97C 3EO9L 3TN0A 1SJHB 1U8IA 3IDNB 3QDMA 3DVGA 5EDXA 5IW3A 3SOBH 1CD1B 1U2CA 5F6HJ 3CDYA 1HOCA 5DK2B 1F45A 5T1DH 3D39A 3O8XD 1YEEL 4RA3A 3EUUA 5JNYA 1A7PH 4JPKH 3H3KA 3FHQA 4LIQL 2DYPA 4IOFD 3MNZA 4K23L 4ZDHB 2NZIA 5JMRA 3DURB 1CICA 1RMFH 3MRJB 5F1IB 4NM8L 4BZ1H 1I7ZA 1S7QB 1KJMA 1XR8B 2GSIA 2VXTL 4JEGB 1BBDL 5E08L 4G3YL 3U4AA 4I3SH 4M5ZL 4Y88A 2J8OA 4OF0A 4PJIB 5DC0A 3S5LA 1CDYA 4OFDA 1ZKAA 1N6QH 1LGVA 5EU6D 2WMPA 4PRIB 3PNWA 5IVOA 5D6DA 2WBJA 3UMTA 3DX7B 5KVEL 1ZA3A 1SJHA 1JBJA 4OGYL 4N0UB 2EKJA 3QDHA 2ZUQB 3CXHJ 1WJ3A 5D72L 4J3TA 3JWDC 3BFOA 6CGTA 5JO5B 2BDNL 1FYHB 2E6PA 4FG6C 5DK2A 2D4DA 4L29B 5JIKA 4OF8A 3BP5B 3ULVL 1FAIL 1KFAH 1YYLL 1IVLA 3BHBB 4ZDHA 1S7VB 1NCWH 3C5ZD 5I30L 2AXJA 3DURA 2JJSA 4YDKL 1T1YB 3MRJA 1YEHH 5GGQH 5F1IA 5LGHL 1HILB 1S7QA 1XR8A 2QLVB 1QLFB 4B0MM 3RZWA 4RMQA 4U7KA 5FGBA 4G43B 2Y06H 4DOHE 2NY5H 4O00A 2ARWA 2FR4B 2O5YL 2IGFH 4KJQC 1OAKL 4PRIA 3BQUC 4RX4D 4N0UA 3VCLB 2C4XA 3VFTB 2LU4A 3U0TA 2F5AL 3MRNA 3QWQB 4XAKD 2FX7H 5JO5A 5HD8C 4L29A 1CFTB 2GJZB 4B7IA 4P59H 4XP1L 1X3DA 5BS0D 1QBAA 1UYWL 3K3QA 4R26H 3V2AR 1I8LA 3BHBA 1S7VA 4P5MA 3HHRB 2YWZA 3FQNB 1UFUA 2H1PL 1T1YA 5TQ0H 4TSCH 4ZFGL 5F72S 1HILA 3VW3H 4O02L 3OAUH 1QLFA 4BFGA 3SQOH 4H88L 4JHWL 4RGNC 3HTLX 4ZXBB 3D2UD 5IWLA 3TJEL 3WIFB 4C54A 2EC9T 4UQ3A 1G7IB 3MZGB 1KCVL 4L9DA 1XF4B 1Q72L 1QYGL 3VFTA 2OM5A 1AH1A 2KDGA 3QQNA 4HLZH 3UYPA 5IGXL 1IGML 2DTSA 5ISZE 2BZDA 5TDOB 1RUAH 3RX8A 1CFTA 2GJZA 3VGHA 4QOKA 1FPTL 2AJVH 2V17H 1G7JB 2VDOH 1SVCP 3O9WC 4CN4A 3FQNA 3JV4B 3ILQD 5FUOL 1DVFC 1J87A 1F4YL 3P3YA 4ZOCA 4FABL 4OZFA 2XN9E 1KXVC 3AS2A 5C0AA 4NQUA 5IG7B 4NPYB 2F8VA 2YEZB 4ZXBA 4NGHH 4OBSA 1NKOA 3HE6C 4I3GA 3GSQB 1BJ1J 4PJDE 3QSKB 1YEJH 4EQ3A 1F90H 4MB4A 4I0CC 4CVUA 4WI5A 2W0KA 1G7IA 4Z95L 4YZFE 2W59A 5DJ6B 2DM3A 3OJ2C 4KI5C 2J7LA 1XF4A 4K55A 4X9IA 4ZG1A 3I3DA 3O6LL 4K8RH 4TULH 2AK4D 5CEXB 3OKYA 3V95A 1M7IA 5TDOA 4XT1C 2F19H 5I66B 1BIIB 4U7SA 4NQED 5GS1C 3DXAB 4X9FA 1G7JA 2ERJB 2NY5C 4HS8H 1XZ0B 5DJXA 4EQ2A 3RWFB 1J10A 3HE6B 3MV7E 2XICA 3JV4A 4U1SA 2F5BH 3WIHL 1ZSDA 1TCRB 1AR1D 2PTTA 5IG7A 3JV6B 4NPYA 4XMLL 5E4EC 2YEZA 1MFNA 5F7MC 1QSED 1NANI 2DQDH 3GSQA 4UT6L 2V7NB 7CGTA 3MC0A 1OCWL 4G6KH 2P8LB 4J4PD 5I1KL 5DJ6A 3BI9X 2HP4A 4XXCA 1ZOXA 5GS1B 4NKIL 15C8H 4JRWA 1JPGB 3MRPB 4OGAC 5ESVA 2IMNA 1UM6L 4XP9L 4F9LA 5HHNB 2ZUUA 2QTEA 1OY3B 2W92A 5IHUH 5I66A 1BIIA 4HUMB 5F9AC 2OQJB 5B22A 2A9NL 3I75B 1XZ0A 2K9UA 4YQXH 1U8JA 2BY1A 3LN5B 3RWFA 1CL7L 4W81A 1ERNA 1ZXQA 5KSBE 4ZODA 3U0WL 2ESVA 1LEGB 4X8JB 2NLJB 3PUCA 1TCRA 3KPNB 3O0RH 1FCGA 1HHGB 4TTDD 3S5LG 4JQVA 3T0EC 4M8QB 3JV6A 1J12A 4P3CL 3MROA 1MVUB 4J3SA 3ZDXE 2V7NA 3KPTA 3RNKB 4JRXD 3KNBB 3MFGB 4QF1B 2DQTH 2P8LA 4LU5L 3WFEL 5I2IB 5DC9B 1HINH 3PDGA 5CBEA 1II4E 3HI5L 1YY8A 3NFPA 5I1DB 1JPGA 3MRPA 2COQA 1NSNH 3W11D 5CBAB 2BVQA 4YDIL 5HHNA 3HCVB 3U1SH 2FHBA 2APXA 1UM4H 3KLHC 1F4AA 2OQJA 4FQXB 1NMAL 5DK3A 3I75A 1JTPA 1HDMA 5AYQA 5L0QB 1KYOJ 1XF1A 3QI9B 4Q58C 4JM2B 5KSVB 3UP1A 3QUML 1GIGH 1HXMB 3ESUF 2NLJA 2CUMA 3KPNA 2HMID 4HBCL 4HCRH 4M8QA 1CGXA 5FCUH 1T2QH 3N85H 4S1QH 1MVUA 4YHZL 1A4JB 3SJVB 3AVEA 3LQAL 3RNKA 3KNBA 2H2SD 3V0WH 4JRXE 3S3SA 1VPOH 3ETBF 4RGOH 5I9QB 5DJZB 4Y19D 1JWMA 4LVOB 3GO1L 3C2SA 2BMKB 5A16B 3O3AB 3DHJA 1F8TL 3TBYB 5CSBA 3HCVA 3LHPL 5IV2A 4MXWL 4P3WA 1NFIA 4FQXA 4P2QD 3JV0A 2V5TA 4G7VH 5IB3A 5IESL 5F44A 3SDDD 3VGAB 4JM2A 4N8VB 4KJWC 1EBPA 5C0BD 2C3HA 1CI5A 1V3LA 4ODTL 3SY0B 1ADQA 3RGHA 1N0LA 2PN5A 4PJXB 3AAZB 3OQ3B 1A4JA 4OLWH 4DKFL 3SJVA 3BRDA 4QRUB 2CK0H 4RDQF 5DMIL 3RVWC 3VXSE 2CQVA 2MWCA 3S88H 5F7UA 3WEXB 1YUHA 2LVEA 4GW5B 3JVGA 3UO1L 5A16A 1N8ZA 5GHWL 1RJYA 1TENA 2HLAB 1BJMA 3IFOA 4NJAH 1JYVA 2EICA 3ARYA 3U7YL 3WSQL 3I50L 3QUZC 2P5WB 5IMLB 4P2QE 4PJEE 1C5DB 1I9JH 5DSCB 2E9IA 3MUGB 4UIKL 1EEZB 1T7YA 1HNFA 1X5ZA 1UZ6F 3LD8C 5E4IA 4BYHA 2J88H 5JPMA 3ULUD 3KYOB 3BIAX 3BIBX 3QCVH 1SEBB 1YN7A 4PJXA 3AAZA 3WLBB 2CRMA 2HJLB 5AG9A 2R29L 4O58H 5FYLE 4JE4B 4TSBL 1A0QL 2JJTA 2HVJA 1RUQH 4KXZI 1GH7A 4F33B 1OQOA 3UYOD 5I1GL 4UV4L 4X7DC 4U6VL 5EOCH 1I7RA 4V1DB 3RY4A 2GI7A 4WW2C 2PTVA 3X17A 1F6AB 3SCMD 4ZS6D 3TZVD 4HC1A 5MEND 5TF0A 4H26B 4MA8H 3VI4E 4EBQL 1CN4A 5LCVL 4QWWD 5DSCA 3KYAA 3MUGA 1OD9A 5FM4A 4W4NA 4CVZB 1F4XL 1JRHL 1XF2B 3W0WD 3KYOA 5L6YL 3ULUE 1SJEB 3D9AH 1SEBA 4CGTA 2XKNB 3REVB 2XWBB 3WLBA 2HJLA 1KIQB 4QRSB 3CUPA 1S78C 1XGRB 4NO0B 4WW2B 4PJBB 1NLDL 3O4LD 3O41A 1A7NH 3WJLC 2BSSB 4NHUA 5D1ZC 3CLFH 5IK3B 1PLGL 2HT4D 4P4RB 4KDTC 5D7JD 1T7VA 4V1DA 1JPFB 1CLCA 1NDMA 1LK2B 5CILH 5CLWA 1BFSA 1F6AA 4M3JA 2YN3A 3T1FA 4ZO8A 2B20A 2AGJH 2XXCB 4FZ8H 1ZGLM 3HI1A 3IDMB 4XWOD 1XF3B 3UTTE 4NZTH 1TVDA 1PKQE 3S4SB 5GPRA 2WZPD 5IMOB 3RVXC 3MGOB 4CVZA 4APQA 5GISH 1MFEL 4PS4L 1SJEA 2YPLE 2ENSA 3AB0C 5A2FA 5I8CA 2XKNA 4MQTB 3REVA 2R9HD 1FZKB 2XWBA 3W0WE 1KIQA 4QRSA 2KBGA 1J1OH 4MVBD 4PJ5B 4NO0A 5IROC 3TH3T 2D2OA 2DS4A 4PJBA 5F96L 4CUCA 3LS4H 1PSKL 2XXMB 2M8XA 2BSSA 2WIMA 4UOJA 4PGBB 3RIFK 5IK3A 4P4RA 3QAZC 5HI5D 2W9EH 3MLUH 4Y5XA 1LK2A 3HG1E 4GOSA 4OF5A 4HULB 4HEME 3TH2T 2HKHL 4M48L 3HPJA 3EOTH 2V5YA 2J8UB 4GSDL 4JQXC 5J6GB 4LGPB 3QXDB 3FCTB 4K23H 3IDMA 4G8FB 1XF3A 4ZNEA 2PR4H 5GRUL 3MGOA 4TUKL 3LY6A 4Q6YA 3P4NB 4U0QB 5E8PB 1BBDH 4RFEB 5E08H 1IAIM 4M02A 5KS9B 4G3YH 1MLBB 4DCQA 5BW7A 1NC2D 3K0WA 5JR1L 1NEZA 1MF2L 3G04B 5SX4I 2GTZB 1G7QA 1YNTB 1HYSC 4JREC 3P4LA 3BZFA 4EN3B 4YZFF 4KK8C 1CXLA 1VADB 4PD4J 4PGBA 4LPTA 1YJDL 5L2KB 1YEDB 1NLBH 3ES6A 4GKNB 1K4DB 2QBWA 4ELMF 2AI0H 4EI6B 1JI1A 2F54A 5LG1A 4DGIL 1Q0YL 1SBBA 5J6GA 3FCTA 4ZNCD 2X1WL 4UV7H 5I30H 1TDQA 2DL2A 5LGHH 4WHTA 3PDOA 2VLJB 4H8WL 5E8PA 2IAMD 4RFEA 4EI5B 5C6WH 4ODXB 5GZNC 1MLBA 4NOBA 4Y4KB 1V3JA 3V4UH 3L95B 2QSCL 4G7YL 3ZL4L 1H3PL 1MFCH 1BD2B 1CE1H 2OXGA 3G04A 4L8DB 4M1GH 5EZOL 4EDXB 3OJVC 5HHQB 2GTZA 2WUCH 2O5YH 4WFHD 1JK8B 1FE8L 3UZVB 3IAPA 4EN3A 4N5EC 1KN4L 4RZCA 4OZIE 3H9HB 2A74B 1YEDA 3HMXA 1U93B 4HKZA 1QFWL 5FOBB 3IKCA 1IZJA 4DGVL 4Q74A 3OXRB 4GG8A 2P43B 1TPXC 4F7PA 1R3IL 4PRPB 3ARDC 4U0RC 4MA7H 3VGFA 1UYWH 3DO7B 2ICEB 4N8VG 2DM2A 4K3JH 4PRAB 4YC2C 1AGCA 1BZ9B 1FZJB 1WWAX 5KSBF 1MCBA 2VLJA 4CNIB 3AS0A 3EAKA 4O02H 1CE6A 4Y4KA 1MFAH 4L9LA 4PBWD 4OM1H 5JHDD 3L95A 3MV01 1A6WL 1MCHA 4JHWH 4KKLD 1BD2A 4L8DA 3TA3D 1U58B 3RIAF 5HHQA 4WWKA 2Y23A 1UT9A 1LP9E 1TPXB 4YFLI 4HXAH 4QEGA 3ARDB 4U0RB 3LIZL 3H9HA 2A74A 4OI8A 1P7QB 1Q72H 2NX5E 1MCCA 4XVUC 3ZO0A 3HE7A 5C0RL 4O9HH 5FOBA 1K4CB 4LSUL 5IGXH 4NZRL 4YC2B 3BW9A 3QNZB 1MNUL 5HYSB 3BMVA 3OXRA 5KVGH 1KJ2B 2ZSVB 1OD7A 4PRPA 1KNOB 2X05A 1L7TH 3ZTJG 1FPTH 1XGQB 2UWEE 1XF5B 4DZ8B 4HFUH 3DO7A 1QTYT 1YMMB 1BZ9A 1FZJA 3TBSB 1GGIL 1NCCL 4NWTL 5FUOH 3C60C 1VSCA 2VLKB 3OAYK 4CNIA 3E6FB 3JZ7A 4FABH 4PB0H 3S37X 3S8WA 2G5BB 2CIIB 4KVNL 3CFDB 1FYTD 1IC4L 4M6MH 3SQBA 3I2CL 4JB9L 3SN6N 3PHSA 1QRND 1I3RB 2ID5A 3HB3D 3OKDB 3ULVC 1OAQL 5D1QC 2WUBL 4Z95H 2A6IB 3PGDA 2JLLA 4TN9A 5A2LH 1OAXL 1VGKA 3O6LH 1JV5B 1AO7A 1RU9L 4NBYB 5KTEL 1UCTA 4WFFE 5EU7C 1K4CA 1IC1A 1T2XA 3QNZA 5HYSA 1V05A 3MRLB 3DETD 1YZZA 5DUPL 1EIBA 1KNOA 4FA8A 3WNLA 4C4KT 2IBBA 2EDBA 4M7ZC 1XGQA 3N9GH 3QWOB 1I7UB 4DZ8A 5JOFA 4HPYH 1DQDL 3MJ9L 4JFEB 3EO0A 4M5YL 2R2BB 1NAML 4AL8L 2WANA 3QCTL 3TBSA 3EYVA 3BRFA 5E6IA 2VLKA 3ZYJA 5DI8A 5D1QB 3E6FA 3WHE0 3UTQB 1E4XH 1DLFL 2YPVH 2G5BA 4NO5A 5KSAB 1NGQL 3CFDA 1DQJA 32C2A 4XMLH 3RPKA 3V7MA 5HYJB 4OIBA 1FFRA 4W6YB 5D1XB 3FO1B 3ZT7A 3O8XC 1WBZA 1I3RA 3OKDA 1HE7A 2BNQD 3GI9L 2MHAA 4IOFC 2A6IA 4ZFOA 1A5FH 4FQ1H 4O2FA 4Z7WB 2EDYA 1A7OL 2AEWA 4NKIH 4WW1B 3FRUA 1KPVB 1HSBB 3I6LE 4XP9H 3MRLA 4PJHA 2YUZA 2HH0L 3QWOA 4O51A 1I7UA 3D3VA 4IDJL 4B5EA 2CMRL 5CKGA 2YA2A 4JFEA 1EV2E 3PJSA 4PJEF 4NJ9L 3O3EA 5LVEA 5EBMA 1XGYL 3VFMB 5HYJA 4U1NB 2Q6WB 4JKPL 4JZJB 4KK5D 5D1XA 3FO1A 4F2MB 2Y1VA 3S96A 4LLMB 4MLIA 5I19L 1TITA 4UUJA 5E9DA 1XCTB 3A67H 3DUUB 1LQSR 3HN3A 3TPKA 1FAKT 2FGZA 3C5ZC 2EH7H 2BX5A 3HI5H 2FEDD 4PGCB 4ZSOB 4WW1A 4HJGA 1RIVH 4L8SB 5ADOL 5CHNB 4GKOA 4HF5H 1KPVA 2XIDA 1HSBA 1KT2B 2CKBH 2VL5B 4LCWD 4XRCB 5H37H 1DEEB 2D7QA 3WJJC 3L9RB 3RRQA 4UTBL 5B8CA 2CRZA 2LVCA 4MJIA 12E8L 5FGSA 4JM4H 4JY4A 1ACYH 3L7FB 3ZYZA 1LVEA 1YEGH 1DJSA 2CDEB 4WUKL 3HNSH 3KPRD 1I1YB 4BZ2H 1NEUA 3GUTB 4O2CB 2V9TA 3K4AA 4HBCH 1AXTH 4BKLB 2Q6WA 4JZJA 4YHZH 4JPVL 4LLMA 3G6AB 3V6OA 2OK0L 4UAOC 2EIEA 5I17B 1XCTA 1D6EB 3DUUA 4DTGL 4KTEH 1T80A 4OCYL 4UINL 2C1PB