3UEZA

Crystal structure of the human colony-stimulating factor 1 (hcsf-1) cytokine in complex with the viral receptor barf1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
199
structure length
185
Chain Sequence
b'VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protein BARF1
publication title Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Cytokine receptor/cytokine
total genus 34
structure length 185
sequence length 199
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uezA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uezA02
4OLWL 3JV6B 4UDUA 5ESAB 4BSWA 1KXVC 1I8MA 4FQJL 4CMMA 1ZVSA 4I9WE 1PD6A 2QR0A 1KG0A 2DD8H 4JKPL 4PJIE 1TETL 1G6RH 4JANB 2CKBL 1HKLH 2DQIH 4WI2A 2AK1H 2P8LA 1JF1B 3MRPA 4Z7OF 4BZ2H 3ZTNH 2EYTB 4EQ3A 2E7LA 4MJIE 4M6NH 4LOUD 3CJJA 4YAQB 4JFFA 5A16A 4D8PA 4PS4H 3H3KA 1WBXA 1OGAE 3MMEA 5A2KH 3O6FA 1FL5B 5F70A 5I1KH 3V4PH 5I30H 3O41A 1ZA3B 4HLZH 4PLJD 4MJ5B 3O6LL 2O5YH 1I9RL 1Q0XH 4PJ9B 5K9QI 1I1YA 3MLUH 2MJWA 4F7TB 1W8OA 4PP2B 4U1MB 5JZ7C 1DUYB 1CFNA 1BJ8A 4F2MB 5HY9B 2DI7A 2WMPA 1DBAH 5AD0B 5DVKA 3LEVL 3FB8B 3MGOB 5LGKA 1RIUH 4LCWA 5FGCE 4GRWB 5T3ZL 4Y4HA 3LDBC 1NGYA 5JXEC 3CLFH 3E8UL 4NRYA 2Y7QA 4CW1B 3GMLB 5TE6L 4E0RB 2F19L 1NCAH 1WSST 1NMAL 1A1OB 1IAOA 2IBGA 2VLME 3AMKA 4JAMA 1HSBB 2VDNH 1HCFX 4UB0H 4KMTL 2VDLL 5E2VH 1T22A 2K9UA 4YBQD 5T33L 2NX5B 2X2YA 2RB8A 2VDMH 1B90A 3FOLA 1JHKL 1LQSR 1KELH 1KCSL 4LK4A 3MRBB 3X3FL 3LN4A 1G9NH 2H9GB 5GQBA 1XGRB 5T1KA 2BXYA 3TBSA 2VAAB 2LFGA 3O9WC 4LEOA 1QVOA 4G8EA 4PJCB 4FQLH 4PRHB 4PJDF 3WFZA 4ONGL 4TSAH 2JB6A 4NUGH 2NY2B 5IVXE 1CT8A 3R4DA 1ZA6A 5C6WH 2X1XR 4P2RB 5FYJE 4Z7WA 3TYGL 4XAKE 5FHAH 4LLAA 3UAJD 3MLYH 2W9LA 3EJYC 3V6BR 5EUOA 3G5XB 2RR3A 2ZCKH 3B3IA 4ZPTB 3AFLA 2J6EL 4PIRF 2XZZA 4I2XA 2VC2L 3BGMA 1MCOH 4QY8B 3V0WH 5D7LA 5I74B 3EYUH 5KSBA 4Z8FL 3V5HA 3BP7A 5ICYB 4OAWB 2FIKB 4PG9B 5E9DA 5D2NB 5CSZA 3S35X 1N64L 3C6LC 3HNVH 1WFUA 1FL6A 3NZ8B 4H8WL 3TA3D 2Y4SA 1OHQA 2OCFD 5ESVA 1CFSB 5MI0C 5HI4D 4YBLB 5DF0A 1K2DB 4I8DA 5HSFA 1YUHA 4OI7A 1U8PB 1A0QH 1CF8H 4YGAB 5E8DL 2X4NB 2HJLA 4PJFB 3AUVA 1I9IH 5ISZE 3NPZB 1NBZB 1BEYL 4HF5H 5D7JB 1PVHA 4HQQH 4G7YL 4M6OL 4NO0D 3IJSB 5T5FL 2APXA 3VXMD 3U1SL 1BIIB 4P59L 1CR9H 3GSWB 5D7IE 2X4OA 2NY1C 3DX6B 3QBTB 4IDLA 4K94C 1PKOA 3QEUA 4MLIA 5MEQB 5AAMA 3TBYA 2BVOB 1I1FB 5EC1A 4U6XB 4Z6AT 1UKQA 2ZSWA 3FO0L 1T21B 2GUOA 5MHSE 3MRQA 3O4LD 5JDSA 3V0AC 3D85B 4HIXL 3CH8A 5DR5H 3CFDB 1AO7D 1CZ8L 5CEXB 2VABB 4OGZA 1F4HA 3QI9C 5DJXA 3ZTJG 1GGCH 4J4PD 3OKMB 3QJHA 3SDAB 3JUYA 3FCTB 2F54D 3SKMB 3TWCL 4APQB 4YDKL 3DMMD 4G6FD 3H0TA 3KPQB 5IB3A 1RIVL 1VEOA 1CBVH 1E4WH 1DSFL 2AGJH 3ZYJA 5I2IA 1CGWA 3LB6C 3BUTA 3DUSA 4JHAL 4OB5L 1JHTB 4EI6B 1W0YT 1I3UA 4L4VA 3CX5K 4JRYB 3WD5L 3CFKA 4UT7H 3EOYG 2DQGL 4GKSA 5CIPH 3SE3C 4ONFH 4ZOEA 1VADB 1FLTX 2PO6B 1F4XL 3DSFL 3QFDB 4RRPG 1BOGA 2LTQC 1AKJD 3R0MA 3GMMB 4P57A 3WN5C 3CVHB 1EBAA 5FECB 3BQUD 3IFPA 1CCZA 4HULB 2ADFL 1KJ2H 3O81A 5E8OB 2EXYD 4DVBB 3H7BA 3QXUA 1VFOA 3KHQA 2YC1B 1LMKA 1M05A 3D3VA 3BPNB 3C5SA 2FZ3B 3ZT7A 4YPGA 1MPAL 2FO1A 5IK3B 3VCLA 3OXSB 1I75A 3IDNB 1F2XK 3ELAT 4ZD3L 1INEL 1WBZA 5T5NF 2FSEA 5CP3H 5KVGL 5TE4L 3B9KA 3GEWB 3ULVD 3U7WH 3EAKA 1LVEA 4DOHE 1B88A 3K2UH 3RJQB 4O9HH 2CIKA 3MREA 2AQ3A 4E41D 4JFDB 5EOTA 1ZHLA 1SHMA 1ZHKA 1FJ1A 1YN7B 4U1LB 1ERNA 1RULH 4PGZA 3QUMA 3QFJB 2GJZA 4LPYA 1DN0B 2CUMA 4NQDE 2I5YL 5CUSH 3PGCA 3HB3D 1CXHA 1KIRA 2FEEI 1INDH 1NCNA 2B1AL 4FQ1H 4UTBL 4MGXA 4KJWD 1AP2B 2CDEB 3P4NA 1J1XL 5C07D 4P48A 4GKNB 5DRNB 1Z3GH 1LILA 5FA4A 3NBNA 3UROR 2ZOLA 4JPWH 4L3EE 1DLHB 3QXAA 1U8KB 5EOCL 4FQXA 5DJAB 3VFUB 3VI3E 4J8RA 1RUQL 4MAYA 5C0EA 1HHKA 2MCG1 2ZCLH 1AI1L 1DBJH 2EXWC 1AXTL 5F3BA 4E5XA 4YHLL 4OIIL 1AXSB 2Q6WB 12E8H 2VUYA 5C09E 4Y16A 1MUJA 4P4KA 5IF0A 5E2JA 5D7SH 1IGFL 1ZWIA 2H32B 4Q9RL 2E27H 2FHCA 1T03L 3O6ML 5DD5H 4PJ9C 5EBGA 4PJBE 3MFGB 2CUHA 1UCTA 4H1LB 4LAJH 1A2YB 2HG5B 4POZC 3OG6B 3MNZB 4W6YB 5IM7B 1MRCH 3PE9A 4IOIA 4XPBH 3MRIB 5CBEB 3IDMB 3SDCA 1VCAA 4PJDA 3SE8L 3VXRA 4LARH 4R0LB 5FYLD 4LMQE 4NZUH 2XPGB 5FGSA 2D9QB 1UWXK 1R3HA 4NO3B 3VGFA 3LQAH 3DX8A 4X0KB 3OZ9H 5DHYB 3S36L 2CH8A 3ORJA 3TBVB 1VKXA 2FR4B 3UZEA 2YPLE 4L8SB 4OUUB 1IFHH 1CE1H 3A67L 1T1ZA 1J05A 4XNYL 1OT2A 3QPXL 2BY1A 5K9KB 2PCPB 5IG7B 1DQDL 2N1KA 3O2DA 2NY2C 4JGMA 3QUXD 1OY3B 4P3CH 5I1EL 1BFVH 4QKXB 2V2TA 1INQA 1CL7I 3O8XB 3I6GB 3FQWB 3VXNA 1HNGA 4QHMB 1MHCB 3WFBL 5DQJA 3V9FA 3IAGC 1FO0B 2AXGB 1S7SB 2R15A 1FGNL 4XPFH 2XKNA 4K2UL 3QZWB 4KUZL 1DVFB 1YPZF 2YMXH 1C1EH 2AJVL 1JYVA 2WBJA 3WS6C 5I74C 4N0UB 2C3VB 4PRID 5L2KD 3RGVC 5DZLA 1ZSDA 5D2NC 1KENL 4ZSOB 3WLWC 1S7TA 1CS6A 2R1XB 4I48B 5E1AA 3T0WA 1TQBB 1P4IL 4ZO9A 3PGDA 1W0VB 2AK4D 1JI1A 2YBRB 3PXJA 5ILTL 5EDXA 4HXAH 1J12A 4MXQD 3KPSA 3OPZH 3ROOB 3KJ6H 1L7TL 2KKQA 3VRJB 1E4JA 3NCJH 3RUGB 2Y25A 3QQ3B 2FIRT 4JZJB 4NQXB 5HGHA 3IDJA 3PHOA 2X7LA 4K23L 1N5YL 4R4BB 4WCYH 4WI3A 1V3KA 3EO0A 1KYOJ 1YEIL 5DTFA 1WFNA 1DQML 4OQ1A 2AJSH 3KPRB 5H8DA 4U2ZA 1LEIA 5EPMB 1P84J 2VLKD 1FNGB 4JQVA 4XH2A 3HZMB 5LGJA 1FORL 1WAAF 3ARVA 3EGSA 3LKSA 1OQXA 3SE9L 4F7MB 1JPSH 3WKML 4NRXA 4JFOA 3ULVF 4WEBH 2V5TA 4GSDH 2ZOKB 3DGGB 3MUGB 1BP3B 3MA7B 4JY5L 4P99A 4FFVC 3K46A 4M6AA 4JRXE 3HI5H 3VXTA 1KJMA 3EYVB 3HR5B 1HXYA 2NW3A 3PWJA 3GSXB 4G8GB 2F5BL 2QADB 3QEGL 5D2LB 1GIGH 5IQ7L 2W9EL 1NQBA 3VFGH 1CD0A 2IFFL 2F58H 1RHFA 2Z8VC 4NWUH 4D0BB 1DLFL 2VITB 3RWFA 5I1IH 2WWKT 5B4MC 1S7WA 1R5IB 5J1AB 2MKWA 4K3JL 2C4FU 4NN7B 4QNPF 4M48L 1IAKB 4OGAD 5L8JB 1YQ2A 4PRPB 3ULUL 3MO1B 1YMHA 3AB0C 4K8RD 5EZOH 1NFKA 3TH2T 4Z7VA 1SBSH 4LLUB 3UJJL 2D0HA 3QIBD 4BYHA 4PB9H 3GJFB 5F3HB 5IW6B 3SBWC 1F02I 1J1PH 3VFOB 4JN2A 4QRTB 3SJVA 2HAZA 4IOFD 3MXVL 3BPNC 3BEWB 1LO4H 4LBEA 1OPGL 5FO8B 1KC5L 3R8QA 4UUJA 3F65A 3STBA 1J0YA 3Q48A 2MMXA 1V05A 3MROA 4YEFA 4ELMB 2A83B 3BDBA 4Y2DC 5FM4A 4V2CB 3CLEH 1IL1B 2JCCF 5AYQA 5SWSE 3T0XA 4PB0L 5HDQH 1HXMA 3LKOA 1AGBA 1CIDA 1HH6B 4ZS6D 1PLGL 3X14A 1WCQA 5TPWL 1BBDH 4MA3B 1TJGH 3F7YA 3MCG1 3VFMB 5BZDB 2DYPD 5DD3H 1PG7H 2RIKA 4I18C 5C0JB 4ZXBA 3VFPA 4M43L 4J3SA 3JTTA 2DMBA 2Z0BA 4V1DE 4XZUA 1FO0L 3O6KL 4QXGL 2ZUWA 2QSQA 1UXSB 2QTEA 3MRRB 5TDOA 3BEVA 3IU3B 2IH1B 1A4KA 4PP1D 1B9ZA 3GNML 3U7YL 3TA3A 3RVWD 1J10A 1UEYA 5F1OB 1DFBH 2QSTA 5EU4B 3VMOA 3DRQB 5F7HA 4HWUA 3PL6A 1K3IA 5DJDB 4KKAC 4OJFH 1UZ8B 3U36B 2Y23A 3RIAK 2V17H 4NP4H 1H3GA 3IDIB 3RPIB 1NCBH 1FBIL 4YXKH 3HRZB 5EN2B 4GRLD 3O0RH 3ULUC 3DWTA 3BT2L 2PYFA 5KS9E 4MB3A 3TVMD 1QNZH 4UIKL 4UOW0 3D2UB 1P4LA 1UH3A 3VXMA 5GS2H 4RGNE 3F12B 1IARB 3HKFA 3P0YH 4YGVA 2PXYA 3LQZB 3CZFB 3QDJA 4RFEB 3H3PL 4HUVA 1JZ4A 4ZTOL 3HG1A 3HS0A 3WXWH 5A2LH 4XGZA 1PGRB 4JHZA 3ESVF 2J2ZA 2VQ1B 2XICA 1X4XA 1AO7A 1FC2D 3JV5A 1GAFL 1KSRA 3EIFA 1X5HA 4L8SC 2FLRT 1FVDB 2CGRH 3I50L 5EIIB 5L2JB 4BQ8A 4UZGA 1M7DA 1PKQE 2F54A 4JLRB 1X5JA 2FLBT 1BECA 1X7QA 4NM8L 4U6TA 3T77B 1RMFH 3MV8B 4K3EH 3DMMA 4AEHH 4JFXB 3FT4A 3OF6D 4PTUB 4ZODA 2APTA 2ICEB 4GH7B 2A0LD 4OZFB 3AREA 4R4FH 1TJHH 4LU5L 3LKQA 1WGOA 4F9PC 4AENB 1KIPB 3DO3A 2IEPA 1V3MA 2P24A 1FZOA 5F8QC 3MOBH 5TFSL 5T1LD 2IPTL 3THMH 2KPNA 3SOBH 2H45A 4HH8A 4GKZB 5EU6D 3VWJB 1DVFC 3HC0B 3BQUA 4H1LG 3D6GA 4PUBH 4D0CA 1OAKH 3MRGA 1JGDA 4WI5A 3QDME 5C1MB 1ZLSH 3NCBB 3X3GL 4PJXB 3L3HB 1BBJA 3A6CL 3K8MA 1JPTL 4KQ3L 3L3JB 3SDDC 4YHYB 3SDYL 1M7XA 3V6ZB 2BNRA 1Q9OA 1WEJH 3STLB 1A22B 2NY7H 4TUOA 4OZIF 4Y5VC 3QCVL 1TQBC 3F5WA 1KB5B 3QPQD 5ETUA 3U83A 1JCKA 1IC4L 2RHEA 2J7LA 1U42A 2P7TB 1XF2A 4OLUL 3K1KC 4TQEL 3UYRH 4IRSB 5E0QA 4H88H 1RZ8B 5IEHB 1UVQA 1JN6B 5FUZH 2AQ2A 2H2SD 2WIIB 2D7TH 4JM4H 5IBLC 3SKOB 1N6QL 2J8UE 3NA9L 1UH2A 2FB4L 4M61B 4FQQB 1JWSB 4PR5B 5ID0B 1BVLA 1Z2KA 4DKAA 1SM3L 4XPHL 5ITBL 4R7DA 3MLZH 1MCKA 3SKJL 1U41A 1A3RH 3RVXD 3UBXB 4P2OD 1HIML 1BQLL 4OTXL 1YNLL 5ADPL 4NUJA 2XG4A 4TPRL 1ZT4A 3TO4D 1BZ9A 1BJMA 2MHAB 5GPRA 1C5DB 4MCYB 1CICD 4OD2B 2LAAA 4ZS7L 4N0RA 1NL0H 4R7NB 2DF3A 5HYJD 5F6HJ 4X7CC 1RJYB 2ORBH 1MJUL 1V8HA 4M7KL 4GQ9H 4ALAL 4NO5B 5DO2D 2ZSVB 3MLVH 3QZWG 5B21A 2LU3A 3Q1SH 3KS0J 3PV6A 4LASL 5FOJA 1OTSD 1TZGH 4ZFOA 1QSEA 3DPBA 4PJ8C 5E5RB 3S8WA 3BMWA 1MCQA 4YR6B 3QXWA 1D5BB 5DD0L 3KAAA 5LBSH 3CFBB 4C57C 2DL2A 2P8MA 3FN9A 4PJGE 2VLRE 1CFVH 3OR7B 5ELIA 5I18L 4Q9BA 1KXQE 4MNHB 2VLLB 4UBDD 1OF2B 4RWYH 3FFCA 2V7HA 2XRAL 5IFJB 4XP5H 3NFNB 3OAUH 2Q86B 3MCKB 4G7VH 4L8BB 5E95B 4NQCB 3KPLA 3G6JB 4X5LA 2XZQL 5EA0L 2OR7A 3V4UL 3ZL4H 1IT9L 3L3OB 5IHUL 4HLJA 2G75B 2JCCA 4JQIH 3VG9B 2X1WL 1QBLL 5I75B 2EDBA 3DX9A 3WS3B 5HGGS 1YEEH 4GAFB 2NPLX 1AQDB 3MRFB 3NOIA 3MV7A 3O3DB 4G3YL 4M1GL 1RFDL 4EI5D 1FFPB 2YK1L 4HXBH 5JTWA 2ID5A 1BLNA 5JW5B 1DL7L 4NKMA 1AHWB 5J13C 1LP9E 4P4RB 4NC0B 6FABH 4JB9L 5IR1A 4K7FB 4X8JB 5HHVL 1BOYA 4JZNA 4KAQH 2FJGA 3L3GB 4PRAA 4Q58C 1Q38A 3HI6H 3DSNA 3D39A 2XWTB 2FX8L 3CD4A 4R6UA 1HHIB 4YIQB 43C9B 2GTWA 3QQ4A 4KFZC 5K9JH 2VXSH 4GG6E 2B20A 4A6YL 4N68A 3SY0B 3DBXA 4C83B 1HINH 3GIZL 4YHOL 3TZVD 1I4FA 1XR9B 3EOBB 1ZLWH 5BQ7B 4FFWD 3RU8H 2IANB 5GSRB 3PJSB 2HT4C 1QRNB 5IMMB 4UILH 1HH9B 4Z5RA 4QXWA 2XA8H 5HGDB 1NEZA 1E4KA 3BI9X 3WEXA 3F62A 1OW0C 4LHUB 1DBBL 2HFTA 3HUJF 2VZTA 4L3CB 2GW5A 5AYUL 5DA0B 5FGBA 4BQCA 1R5VB 4P23B 3BJLA 4DK3A 1UB6B 5ITFA 1MREL 3NCFB 5DYOB 3TNMB 3W0WE 2AJ3B 4RX4D 1BPVA 5C0IB 3QUZB 4TYUA 5JIPA 1A4JA 5KTEL 2FH6A 4TTGA 4G8FB 2O61A 1FV1A 3GDBA 3DYMA 3EYFA 5KOMC 5L7XH 5HHOD 4LCCB 3VXPA 3T0ED 4DGIH 1A6UL 4L9DA 4MZ3A 4P5TB 2L0DA 1LK2A 1QSFB 2BOCB 3W11D 1M7IA 4CVXB 1FVCB 1JPST 4J3XA 3QIUA 4D9QD 1MWAH 1NEUA 2NXYB 3LPGA 1GXEA 4X6BA 3ZE2F 3RKDC 2Z8WC 1Z5LA 2Z8SA 5D9SB 3SE4A 3SGJC 3FQRA 4EVNB 2WWMC 1P9MA 4KI5F 1U3ZA 1UQSA 4JKPH 1TETH 1NMCC 2Z4QB 5F6IC 4NQTA 3CX5J 3WXVL 3PWUB 4QHLA 1GZQA 1CFQA 3L5WB 3GIVB 3MJ7B 4HUXA 3CFJB 3K74B 1GCFA 2XTJC 4FXGB 2GAZA 4H25B 1KLUB 1DR9A 1MVUB 1BMGA 1RZGB 3GSNL 1G84A 5BVJB 5IMKB 3AROA 5IESL 4XCYA 1D6VL 1MF2L 1SMOA 4ODWB 3BYTA 3T0AA 5LWYL 2FX9L 8FABA 5DJ2B 4ZAKB 3UTSB 4ELKB 2PYED 1OGAD 2X4TB 3ABZA 3PWVA 2DBLL 4KRPD 4TN9A 2VISB 5BW7A 1B3JA 3HLAA 2X41A 2Z31C 1NBYB 1T80A 4Y4KB 3ZKMC 1SYVB 3OAZK 3RAJL 3O6LH 1I9RH 1YY8B 4LF3A 2OI9C 4X4ME 2AKRA 1WT5A 3VW3L 4OZIA 2EE2A 1RJLA 4PBXA 2UWEE 5K9OA 5HHMD 3U0WL 5I76B 4L8DA 4UV7L 4WW2F 4FFYL 3CFEA 3DX7A 5C6TL 2AJZA 3LEVH 3MFFA 1IM9A 4U1NB 1WZKA 5T3ZH 4XCFL 2IH3B 3E8UH 1I7RA 3RIFK 5TE6H 1NGZA 2F19H 3B9EA 4OF8A 5IB4A 1NMAH 3ZT6A 3ARGB 1YEFL 3QHFL 1UXWB 5DK2A 1VDGA 5J1SC 1RIHL 4M1DL 3PQYA 1CFTA 5T33H 4K94H 4LNRB 1F58L 1Q1JL 3ILQD 4YHYC 4NQEB 1YDPA 1EJ6A 1J8HA 3DOSA 4R90L 1FFQA 1LEKA 1OP5H 4IIQB 4I5BA 3DVGB 3QNZA 2KUTA 3AS3A 5DRZA 1JGVL 4HH9A 1U95B 4JO2L 3RDTC 2EEAA 4ONGH 2HFFA 3HTLX 3LKPB 5DJCA 3CZJA 3OXRB 1NFDF 5HYSB 2ADIA 3BW9A 4Q2ZA 4M62L 2N7AA 3TYGH 4ZUSA 5IB2A 5FYJD 4F3FB 2NW2A 2OQJB 5D6DA 3GMRA 3B6SA 5J3HC 4HWZA 5BRZA 3EDFA 2J6EH 1H8SA 1HSAA 1X5AA 2D7OA 5CLTA 2VC2H 1UJTA 5L0QC 5IJVA 2ARJA 2DYPA 1QACA 4L5FH 4OZFG 3WNLA 1R24A 2BERA 2C7UA 4JFPA 2FD6L 4Z76B 1PEWA 5HYEA 4LSQL 2DMKA 1NAMB 4Z8FH 2V9TA 4S2SB 2DTSA 2YSSB 4X7DC 2E7MA 2I07B 4DAGL 5CJXA 4XC1L 4U6HB 3P9LB 4PJ7A 4DN4L 2XWJA 4ETQA 4ISVA 4GXUM 4WNQA 4LCIL 5LJYH 4ODXB 4GS7B 5A2IH 4O00A 3TFKC 4EN3B 1FYHB 1G7IA 2MTPA 1KBGL 1UC6A 3MBEC 4EBQL 5CZVL 3RWEB 4JDVB 5JW4M 2BNQB 1JWUB 1FZJB 5DI8A 5CJQL 5T3ZE 5E8DH 3ZE0E 4U1GB 1EAPA 1IBGL 3OGCA 1BEYH 3TVMA 4FQHB 1XIWB 2APWA 4M6OH 4OZHF 5E94B 3NFPA 1V3LA 5T5FH 4X7FC 4M4RA 4BSWB 1J1OL 3U1SH 1EEZA 3OKNB 4OQTA 4P59H 4CMMB 1ZVSB 1A1NA 1KG0B 2XN9E 3TN0A 25C8L 3HI1B 4HWBA 5GS3A 1MSPA 1WITA 4AIOA 4HFUL 2B1HL 5M94B 3IRZA 2WM0A 3F7VB 3WIHA 1UM4L 4HK3J 2QHLA 1YY9D 3FO0H 3LEXA 5MHSD 1BREA 4HIXH 4OFVA 2FJHB 1CZ8H 3P11L 3UBXG 4JFFB 5A16B 1N0LA 4JHBA 4D8PB 3C8KB 4K71B 1AFVL 1WFOA 3DXAE 3MOAL 3MMEB 2I9LA 4NKQB 1HQ4A 3TWCH 1RQ5A 3DUUA 3O41B 1L7IL 3HUJA 5C2UB 3VDBA 4QYOA 1RIVH 2ATPA 1T89C 1G0DA 4PJIF 1CXEA 5FF6B 4YC2B 2Q76A 1DE4A 1I1YB 4OLZL 4OB5H 4JHAH 2NY6D 3RZWA 3MLXL 4OFKA 3AY4C 3T0VA 3ARFA 1CFNB 5T1MA 3WD5H 1CFBA 1JV5A 4XI5C 2GJ6E 3UPCA 4LCWB 4KK9D 4NFCA 3DSFH 1F4XH 1NGYB 4NRYB 2Y7QB 3EFDH 1EUUA 4I77L 3HE7D 3EHBC 2VUOA 3CU1A 3VXUE 5C08E 1XF3B 1IAOB 2HN7B 3PXHA 1LE9A 3CDFA 2ADFH 3PABA 3BP4A 4Y4FA 4P23C 1A47A 2OL3A 3FOLB 1YEJL 1RU9L 2D0GA 3ARBA 4JGJA 5J1TC 5F7EL 3A0OA 4Q7DA 1KV3A 1MPAH 4LRIC 4FQIL 3QUZC 3LN4B 4JFEE 4XBGA 4ZD3H 1INEH 3TBSB 5KVGH 1DN2A 2A77L 2CPCA 4G8EB 4MSWA 1QQDA 2DLEA 4QXTA 1MRFL 4HJGA 4P2RD 2JIXB 4OZGE 1CT8B 1KPUA 1HEZA 1ZA6B 1UYWL 4S1DD 3ZHLA 2YUVA 4Z7WB 3E1F1 3W2DL 4N1EA 3H9HA 4B7LA 3I85A 1JGEA 4RWHA 3HMXH 3B3IB 1G9ML 4NO2A 5J6HA 4WTZA 4AYFA 3N1MC 4I2XB 4HMCA 3BGMB 3MGTA 1ZVYA 2XY1A 4NZDA 2B1AH 4UTBH 3QP3A 4LKCA 3IGAA 3NH7L 3RVUC 1J1XH 4P3WA 5ACMA 2ARWA 1G1YA 1N26A 3J7HA 5CHNA 5HYJA 2X10A 4G43A 4WW2A 3IKCA 4ZUUA 4JFYB 5CEZL 5I6XC 3DVFA 2Y72A 5E9DB 4OM0L 3R1GL 1FG9C 3D9AL 5EOCH 1A6ZA 1FL6B 1DQQA 1RUQH 5IVXF 4HAFA 4JG0L 4S1RL 1AI1H 1ZTXL 1AXTH 5ESVB 4YHLH 4PD4K 4LCYB 4ZAKC 4OIIH 3P9MA 1YUHB 4U3HA 4LHUG 1IGFH 1HZHL 1RZFL 4Y4KC 3KLHC 5D7JD 1T03H 1CG9A 3O6MH 1QG3A 2HJLB 3SGKA 3W9EA 3TJHC 4W81A 3TV3L 3UDWC 2MNUA 3NCYP 4N1CA 1MQ8A 4RBPH 1OAQL 1I8LC 3O4OB 4HMDA 4MD5A 4YZFF 2D7PA 3AAZB 4L4TE 5F89B 2X4OB 2Y5TA 3SE8H 4PJHF 3QEUB 1YEGL 2XZCL 5E6IC 3TBYB 3I6KB 2IPUG 3DRTA 4P0DA 1MNUL 1WWAX 5EC1B 1B6UA 3RBSA 3O11A 3BP6A 2IAMC 2W0LA 3D85D 2O26U 4QOKA 3MRQB 4XNXL 4MS8C 3S36H 4MNGE 3CH1A 5ESQA 1N8ZA 5E24E 1CD1A 4EI5A 1JZ6A 1X5GA 4DN3L 2W0FA 4WDIB 2ZKHL 5DJXB 5F96L 5GS1A 3A67H 3QJHB 3QNYA 4APQD 4OD3H 3SEPA 3MRDB 4CN1A 1MAJA 1FAIL 3BH8A 4XNYH 3QPXH 4D9LL 4MQXD 3H0TB 5EWIL 2V2WB 5D7IF 1J5OH 1T2JA 1DQDH 2QSCH 4M3JA 2A6JA 2G5RA 5IEKB 3TT1L 2C3WA 4EDXB 3KG5A 4L4VB 1MFDL 5D6CA 5I1EH 3RZCD 4LGPB 3CFKB 3GKZA 5JOFA 4XWOD 2BCKA 4GKSB 2PO6D 1F13A 3KYAA 1GC1C 2ZP0T 3WFBH 3TZVA 2DQEH 1XF4A 1R3LA 4S0TD 1BOGB 5FXCH 4P57B 1FGNH 4K2UH 1YMMA 2EYSB 1UCBL 1GOFA 1T1YB 4OZHA 3MSPA 2AJVH 1H3TA 4CMHC 4YH6A 3B8YA 1M05B 3D3VB 3C5SB 3WIHL 1KENH 4YPGB 3H42L 4KK6C 3QIWC 1KN2L 1U3HB 1S7VA 4BSVA 1P4IH 4GBXD 4H26A 4X6DA 5C0CB 2FSEB 4FOMA 3QQ9C 4XHQA 5HHOA 5ILTH 3B9KB 1VGEH 2XWBA 2DM7A 2ESVE 3D5OF 1QFHA 4RQQB 4EUPH 3AMLA 3EUUA 1ZXQA 4PJFE 5TE7L 1L7TH 5KJRL 3WJJC 5F1KC 3MREB 4IRJA 1K6QL 1UENA 4K23H 4DZBA 1N5YH 4UTAH 1ZHLB 4E42A 2X09A 4D94A 4XC3H 3LS4H 1ZHKB 1FJ1B 1YEIH 3K1DA 3V5DA 5B3JE 2V5RA 1DQMH 3D0VA 1A9BA 2C3HA 1FSKC 3RIFF 4HKJA 2EDKA 4X5XA 5D7LE 3PGCB 1IC5L 4UV4H 4PJIA 3LV3A 1KEGL 2F15A 5KSBE 3P4NB 1P7QD 2WLZA 3M17B 3MJ6A 1WJ3A 5HYSG 1FORH 1DP0A 1G7PA 1PG7W 1LDPL 2W60A 3C09C 4YEEA 3SE9H 3WKMH 5DK0A 5FA4B 5C6PB 1MI5E 3QNXA 1J11A 4FQXB 2OXGA 3QEHA 4JY5H 1OM3L 4MJIA 4MAYB 4WU5A 5C0AB 1HHKB 4ETYA 1S9XB 5C0EB 5IGXL 3RWHB 5F3BB 1XH3A 4K71C 3EYOB 4JRXD 1W2KT 5AZEL 1OGAA 1PY4A 3TH4T 4P4KB 1T6WA 2NNAA 2F5BH 3QEGH 3CPLA 3IT8D 5IQ7H 5BJTA 4IOSD 4YC2C 2B39A 2E6PA 2DM4A 5J6GA 4JRYE 5KN5B 1DLFH 1EXUA 1YEHL 5E5MA 3RL1A 4TNVK 4HK0B 4K3JH 2H32H 4DCQA 3HZYB 5ALCL 4AIZB 3SDCB 4M48H 4PJDB 3ULUH 3VXRB 3DGCR 4N9GA 4WI4A 1LO5A 1KPRA 4YX2L 5FYJU 1EO7A 1NC4B 1KCVH 3UJJH 3QXTA 3MRMA 1RPQA 4ZFZA 4OFYD 1KTDA 2JB5L 3OMZA 5CP7A 3BRGC 3FQTB 5CD5D 1F42A 4HKBA 2J12B 4AG4L 5JW4Q 4OCSL 2YRPA 4R2GB 4K55A 3MXVH 3B5HA 3VRLE 4DKDC 3ULSB 1RUML 4WO4B 1EAJA 3ZDYF 4D0DA 4XMLL 2AJYL 1OPGH 4U6YB 1T1ZB 1FN4A 1KC5H 2JLLA 2R1WA 2OLDA 3GKWL 3UYPA 2KBGA 1KEML 3I6LE 1KACB 1A8JH 2VLJA 3TPUB 5KG9B 1TLKA 1G6RA 4OF0A 5IVXA 4DK6A 3O8XD 2ED8A 1I1AD 4PB0H 1YEKL 4J2XA 1L0QA 3TJEH 1LD9B 3VXNB 3FN0L 5C9JA 2W59A 2OR8A 3VFVA 1MCHA 2CQVA 2EDTA 4AM0A 1A6AB 1F3RB 4TUJA 2XKNB 4OF5A 2BSRA 3FB7B 4QWWC 2VKXA 2WBJB 4M43H 3ZHKA 3HZKA 3GSRB 3TM6A 1QBML 1FO0H 3O6KH 4QXGH 4V1DD 3V0VA 1ZSDB 2VRAA 1HOCB 4BZ1L 1S7TB 1QR1B 3UPRA 3U7YH 3GNMH 2UUDH 3M8OH 1QZ1A 1RK1A 3PGDB 1IGIL 4EXKA 2R2BA 5A2FA 1JNJA 1CGXA 3BDXA 3INUL 3KPSB 4ZTPL 3ULUE 1FBIH 3IDXL 4X7TA 3L3DA 5IVNA 5HGHB 5HI3D 1S7UA 2X7LB 3BT2H 5HYIA 5ISZA 3L95A 3GSVA 3PIQA 2YR3A 4UIKH 2DKSA 5I1GL 1ES0A 5DTFB 1P1ZA 1T1WB 3GMOB 2DIJA 3KYOB 3BXNA 3E6FA 1P6FA 3N1PC 1LEIB 3GZKA 4HDIA 5D7IA 3H3PH 4FTVA 4XH2B 3UZVB 4YXLL 3MRCA 4W4OC 4ZTOH 2DQCL 3BPOB 2V5SA 2KQNA 2NY0B 3EGSB 5F88A 4NRXB 4JFOB 3Q6GL 4XBEL 4RZCB 3FT2B 1UFUA 4RDQG 1UWGL 1GAFH 2AAVA 4LDLB 4YJZL 3VXTB 1KJMB 3I50H 3LY6A 3S37L 1HXYB 3CUPA 2QADD 1WC7A 2NW3B 3PWJB 1Z9MA 4NM8H 4XBPA 1YNKL 1VFBB 3S5LB 2GFBA 3NABL 1KIQB 1PSKL 2QSVA 1F90L 4G6ML 3VH8A 3MV11 2VTFA 1MHHA 3NPSB 3RWFB 2HMIC 1S7WB 4LU5H 1OP9A 5LQBL 1TPXB 3PV7A 1UG9A 5D7KE 1YMHB 4MQTB 2DQTH 5TFSH 1VSCA 4HS8L 2IQAB 4WJ5A 5EBMA 3HE7A 5BZWB 3MV9E 4WUUE 1A6WL 1Q8MA 3GMNA 4GRMA 3FONA 4RCAA 3WNKA 3QDMD 3A6CH 4JN2B 5BS0D 4KQ3H 4ZFFA 4YFLI 4BK5A 3SDYH 1WK0A 4Q74A 1PJ9A 4LBEB 1GSMA 5KANG 3GJFH 3P2TA 1U3HC 1MLBA 2IGFH 1C5BL 2VDOL 2ZPKH 5GGTL 4UUJB 1IC4H 1I8KB 4NJAL 1G7LB 1D5ZA 4TQEH 3RUGE 3L1OH 3MROB 5DK3A 4YHIA 1AJ7L 1N6QH 5D1XC 3NA9H 5TF1L 1Q72H 1HXMB 1SM3H 3KPRE 2YA0A 3LKOB 4XPHH 5ITBH 4DJMA 3X14B 1O5DT 3AS0A 3BN9D 1Q9WA 2D7NA 4HGKC 1J8KA 5EO9A 4NQDA 1HIMH 2PKDA 1BQLH 4OTXH 1YNLH 5ADPH 3TCLA 5D1QD 4TPRH 1T0NA 4ZXBB 3VFPB 4WTWA 5KVDL 5DJYA 2W91A 3RWGB 4ZS7H 2WQ8A 3JTTB 1XGUA 2O5XL 4KI1A 5FB8A 4LQ1A 1T83A 2Y1VA 2W9DL 4O2FA 1MJUH 2GJJA 2F9BT 4M7KH 4L3EA 4MAYC 4QRRD 3TA3B 1S78C 1S7QA 5F9WB 4LASH 5IKCA 5D2LE 2VXTL 3PL6B 3WL9A 5C09A 5CIPA 3RX5A 5GS0L 1T66D 2OJEA 4XHJC 4DVRL 1LEGB 4UINL 4BFIA 5DD0H 2PYFB 4PJBA 3FFDA 4ZO8A 4Q6IB 2AXFA 4QRUB 43CAB 3VXMB 4Y8DC 1KJ2A 5I18H 4YGVB 2EE6A 2PXYB 4M9OA 3ZYZA 2AK1L 4TOYH 2XRAH 4HUVB 5ENWA 3VFSB 2I9TA 4BZ2L 3HG1B 3HS0B 4HAGA 4XGZB 3U7AA 1OCWL 3V4UH 5E08L 2XZQH 5EA0H 3CXDL 1IT9H 1MHEB 5IHUH 4U1HA 3GMQA 3O4LB 5CP3A 3SPVA 3IF1A 2BHYA 4KROD 1C12B 3BE1L 1AO7B 3RKPA 4M1GH 4R2GC 1MAML 4G3YH 4GOSA 2YK1H 4HUWA 2YPLA 4KKLD 4WO4C 2P8PB 1DL7H 5KS9F 5HVHB 1YPZB 5I30L 1M7DB 3KPOB 1N4XL 1I85A 4JB9H 2F54B 4GG8A 5HHVH 3QH3A 1EHLL 3DV6A 1H8OA 1MIEL 1X7QB 3DMMB 3UJIH 2XV6B 1MLCB 4M02A 3LN5A 4Z0XA 5JUEL 3T2PA 2UZXB 1DBAL 5KSUA 2RFXA 1QHPA 4WFHE 3UTZA 3EFFA 3LKQB 3RZCA 3LD8C 2YWYA 2C1OA 1B0RB 1NMBL 1Y6KR 3BD3A 5INCA 4FRWA 4HPOH 5EZJA 3CLFL 2ZCHH 4A6YH 4Z7VE 4ZO7A 3VMNA 3VWJD 1AKJB 3L9RA 1BFOA 5GISL 1D5MA 4BQ9A 2HKHL 4WWKA 1Q94B 3BQUB 1FZMA 2ICWI 1JNNL 4D0CB 3SJVE 1JGDB 1DBBH 5AYUH 1BBJB 2EE3A 5DRXA 3C5ZA 2PW2A 1CK0L 5GS0C 4UT6L 4X4XA 1MREH 1Q9OB 5CJOL 3KNBA 5CGMA 5LKNA 4KRNA 4X99B 4YLQT 3W0WD 5KTEH 4W68A 5JMOC 3E2HC 3WJLA 3F5WB 3I84A 4F8TA 4GBXA 5CZXC 4IRSD 5I1LA 1A6UH 4OF3A 3KLAA 1FFOA 3K2MC 3BP5A 5FV1L 4TNVF 3MUJA 2X4RA 5EULV 4E41B 3OQ3B 3OKEA 2VB5A 4NIKB 4NN5B 3WDJA 1BVLB 4KH2A 3GK8L 3VI4E 3WFDH 1OP5K 3T8XA 2EH7L 1MCOL 3OB0H 4JQVC 3R8BB 4YFEA 3MLTA 3KPPA 1X5XA 1FFNA 4LSRL 3WXVH 1ZT4B 1P7QA 3W5MA 1JP5A 1BZ9B 3BPOC 2XTJE 1OTTD 4Y5YA 1B2WL 3LRGA 3E3QC 3TNNB 4GUPA 2QLVB 1A3QA 1QR4A 3GSNH 2X5PA 4DUXA 5I17A 3FZUD 1DZBA 5IESH 2J4WL 4LOUC 5B38A 5C9KA 1D6VH 1MF2H 2J8UF 5LWYH 3QG7H 1FDLL 4Y0GA 4JRXA 2FX9H 3GGWB 2A9NL 5IB1A 2ENYA 2QJDA 3PV6B 1CF8L 2DBLH 3FQXA 2VR9A 4ZFOB 4AZ8A 1DANU 2ERJB 3QG6A 4QTIL 4PLJC 1ACZA 2NY3C 3RAJH 9CGTA 1N2RA 3G9AB 2DLGA 1BX2A 3NPSC 3VW3H 2JJSA 2J5LC 2A73A 2OMBA 1TPXC 3QDJE 2HT3C 1NC2D 3RL2A 4UV7H 4FFYH 4TVPE 4WW1A 5C6TH 3STZA 4HFWA 4N5EC 3H3BC 3HZVA 2Q1EA 5JLZA 2EDXA 4XCFH 5FKPA 3BVNA 1I3VA 4GAGL 3S4SA 2D31B 2JCCB 1YEFH 2CK2A 1DANT 3QHFH 3BX7C 1QFWM 4ZYKA 1RIHH 5E6YA 4M1DH 4YBQC 1U8QA 5IFHL 2YPKA 2ED7A 1F58H 1GGCL 4P9ML 3MV7B 5DXWA 2FATL 5LXGL 4NNYA 4R90H 4NKMB 1MFNA 4NQVA 1GRWA 1HYRC 5IR1B 4PJGF 4EIGB 1WIOA 2QV2A 3ISWA 1JGVH 1E4WL 2XA3A 1CLCA 3QWRD 2FJGB 4WVRA 3BHBA 4U0RB 3OL2A 4G6KH 2M26A 2P5WE 2H1PL 3ARDA 2CLVA 2VXUH 4PD4J 4M62H 2ICES 2MSPA 1QFWL 5IVZB 1UJ3B 5SWSA 5CGYD 2GTWB 3QQ4B 3DBXB 1I4FB 2Z93A 4PV9B 2HJKB 3MZGB 3GM0A 4KDWA 1LP9F 4CU6A 1ZK9A 1MY7A 1NEZB 2FD6H 2GTZA 3OTTA 2DI9A 3O45A 3WEXB 4LSQH 4PRIB 5L2KB 3G6AB 2BNRE 5T5NG 5JW4R 4V1DA 3LEYL 1S3KL 4JPVL 1A7BA 3C6LD 4DAGH 2L7UA 1OAUL 4XX1G 4DN4H 5EC2B 3TA3C 4LCIH 4C56E 2O61B 5HI4C 1FV1B 2NY5L 5F9WC 3EYFB 2NXZD 4EOWL 1U2CA 3VXPB 5D4QA 1QSFD 2BSTA 2XACC 4GG6F 1KBGH 1ORQA 1LK2B 4EBQH 1MJJA 4LVOC 4M7JL 5CZVH 5CJQH 4BK4A 1HK6A 2NXYD 1QPPA 1R6VA 3TO2A 2BJML 5KVFL 1FG2A 5KS9A 4Q6IC 1IMHC 4X6BB 1E27A 4KZDL 4YDIL 1T5XB 4GW4A 4OCMC 4OBSA 4LGRB 1J1OH 1WWBX 3UYOD 1T5WB 5ICXA 5H94B 3RY5A 1U8NA 4XB8A 2XN9D 3AXLA 5F1SA 5EO0A 4HFUH 2B1HH 3BZFA 5F7DB 2CK0L 4OT1L 4CU8A 3W39B 4NCC1 4QHLB 1GZQB 1Z3GL 3H9SE 1CFQB 4U1SB 3P77B 5FCUL 2WLYA 1UM4H 3FTGB 4HUXB 1F8TH 2GAZB 1QFOA 1GOGA 1CLZL 4XXCC 5FUCC 4OLYH 3P11H 1KJ3H 4XCYB 5GIRA 3VRIA 3UTSD 2XG5A 3U4AA 5I1AA 4J4PC 1T20A 4NCDA 4M1CD 8FABB 4RGMC 3CFCL 1MIML 1AFVH 3MOAH 2BY3A 1BVKA 3PWVB 1JTPA 2ZJSL 3OX8B 1PKQA 1R0AL 3HLAB 1L7IH 3DMMC 5IJKA 4R4ND 1EHXA 2G60L 1S7RA 2AKRB 4OLZH 2BVTA 3MLXH 3KDMA 4OZIB 4LLQB 3H7LA 5K9OB 3FFCE 1FL3B 3CFEB 3DX7B 4MHHI 2ITDA 2AJZB 3MFFB 1OB1B 2PR4L 1IM9B 3DYOA 5DJ8A 1QRNE 1I7RB 3ARGD 1NGZB 4XP1L 4OM1L 5GXBB 3BQUC 3VXUD 3KYNB 5C08D 1CDHA 5DK2B 3VWKA 3HR6A 3PQYB 2NY5C 4TUKL 3MUY1 5CD3A 2EXYC 4JY4A 1V5JA 3QDMA 2VH5L 2GSGA 2E9BA 1MCEA 3D87B 1L0XA 4I4WA 3V6FB 4RBPK 1IFHL 1YDPB 1RU9H 1YEJH 5L6YL 5F7EH 1J8HB 5E4EC 3RHWK 4KPHL 2BSED 4FQIH 5IV2A 2F74B 4NDMB 3WDIA 2UWEF 5I1JL 3QNZB 5DRZB 4CKVX 3TT3L 2NYYC 2A77H 1OAYL 3ULVC 1MCBA 2HFFB 1MRFH 4Z7QF 4WI8A 4RMUA 2VN4A 4WI6A 1UYWH 3BW9B 4I0PA 3MX0A 2UYLA 5IB2B 4ZUSB 3W2DH 4NN5C 5KVEH 3ARPA 3RWCB 2NW2B 2P5ED 2HKFL 5DEGA 1DQTA 3GMRB 2Z8RA 3B6SB 1G9MH 4HWZB 5BRZB 2VWEE 3HNTL 5CCKL 1LE5A 3HB3C 2AJUL 4NKDB 5IJVB 2ARJB 2DYPB 5KSAA 5D1QA 1EERB 1B6DA 5JHDE 3NH7H 2C7UB 4EDWL 4OV5A 1B4JL 1WWWX 4MNQA 1GC1H 2EC9T 3U46B 1EJOL 3V8CA 4OM0H 2R56L 3R1GH 1BD2E 3MNWA 3D9AH 5D93B 4QRQA 4P49A 3N1FC 4MJ2A 4PJ7B 2G2RA 4JG0H 5F9JA 4S1RH 3RVVD 4K07A 3HE6D 4X8XA 5EH1A 5IHLB 4ISVB 4FN0A 3AS2A 4EN3D 1ZTXH 4HXAL 4HJ0D 1NAMH 4XCNB 4JHWL 1KCRL 2BNQD 3EYQD 4HIHB 2X9XA 5TDPA 5DD6A 2ERJC 4D9RE 1HZHH 2JK5A 5DI8B 4P3DA 3MJ8A 1EAPB 1XIWD 4JREB 2BVPA 4CU7A 1B0WA 1QO3A 3TV3H 3TVMB 5KBNC 3IS0X 5D96C 3NFPB 4R26L 1IAIM 4PJGA 1OAQH 2VLRA 5H2BB 1EEZB 4LDOB 4ZDHA 1A1NB 4MWFA 4L4TD 5L88L 4WFEE 2VDPL 3GB7A 2GCYB 1YEGH 3NIGE 5JNYA 4CN6A 5M95B 1MNUH 5D1ZA 1GGUA 4F33A 4JO4L 1FZKA 1QTYT 1JZ2A 1Q9LA 2UZYB 3LEXB 1D9KA 4XNXH 4KTEL 1H15A 5IQ9A 1NUGA 1NJ9A 4I3GA 4I0KA 3HI5L 3ZE0F 3P4OA 4DN3H 4JFHE 1FYTE 2ZKHH 5F96H 3O6FD 1G9EA 4MQ7A 2LE9A 1IAIL 1LP9A 2I9LB 1HQ4B 1FAIH 5TH2A 3KWWB 1GGIL 4RMSA 1HYSD 1OSPL 1VFMA 2AEIT 1VGKA 1UB5A 4XMPL 3MRHA 3HUJB 4LSSH 4D9LH 3NTCL 5EWIH 1JI2A 1FNEB 4U0RC 2ATPB 1A7NL 4LCUA 3UTTE 3OR6A 4KWUA 3QUXC 3TT1H 2DWDA 3ECBA 3JVGC 3ARFB 5DJZB 1MFDH 1L6XA 2V2XA 1UJ3C 4U33A 4M7ZB 5C0DA 4Y4HD 2LV4A 5CEZE 4JKMA 3CC5A 4GG6A 5D8JL 5T1LB 3REVA 1UCBH 3V5KA 1E4KC 3UCRA 4N0YL 4NNPL 1KJVA 3RGVD 3BP4B 4N8CL 1CQYA 5J12B 5FGBC 4K8RL 1NGXB 4KDTA 1KTRL 3H42H 5T1KD 3DV4B 3W0WA 3BZEA 5HHNA 3PP3H 3I3DA 2P45B 4MSWB 2DTML 4MXQC 2ESVD 1Q0YL 5TE7H 4HJGB 1EVTC 4UMGA 5KJRH 3QEQA 1MFBL 1KPUB 1HEZB 3G9VA 3GMPA 5GGUB 4Y1AE 1K6QH 5GGSB 3H9HB 4CRPA 1JGEB 2PN5A 4GW1A 5EU5B 2F5AL 4BFGA 5HDOA 2PTVA 1BFSA 2WBKA 3SE4C 4NO2B 3O2VL 4RFOL 5I1DA 1BGXH 4FMKA 1IGTA 4LKXB 3HRPA 5DD3L 4P2OB 3QCTL 3MGTB 1F4AA 1IC5H 3FB6B 5D7LD 4YDJA 1TJIL 1IZJA 1KEGH 4LKCB 1RZJC 3IGAB 3LZFL 3MLRL 1B0GB 1ZKAA 4K3GA 5CHNB 5HYJB 4WW2B 1LDPH 3IKCB 4ZUUB 1GHFL 1PZ5A 1A3LL 2VNCA 1MI5D 1A6ZB 2W0PA 3BPCA 1OM3H 1DQQB 4OZGF 3X12A 5IGXH 3VE0A 2DIBA 3EDEA 5IW3A 2X70B 5I19L 4QRPA 1SYSA 5AZEH 4X9HA 3BKCH 4WGVB 1YQVL 2FGWL 3P9MB 4R8WL 3UMTA 5BW7C 1NEZG 1U93A 1BIHA 2R1YA 4UU9A 5A3ID 3MRJB 5INDA 3E6HA 1REIA 4KKBD 1QNZL 1EV2E 1P5UA 1ZGLM 4X4MA 3W9EB 1UM6L 1WT5C 4JFZL 4WTXA 5DQ9A 5T1DL 4X6EA 1YEHH 3RX8A 3P0YL 5DJ6B 3C5JA 1IKFL 1NC2A 2R2EA 2XY2A 2X42A 5CWSA 3BUYA 1C16A 1II4E 3T4AA 4OF6A 2UUDK 4PLKD 4XTRC 5FKAA 4R9HA 5ALCH 3S96A 1QLFA 2DL9A 3C6SA 5JXEA 4HZLA 3CSGA 5CFHA 4K8RC 3CAFA 4PJEA 3QHTC 4XCCL 4YX2H 1ZEAL 3DRTB 3RWIA 1P7HL 3QIBC 3O11B 3BP6B 1QLRA 4QOKB 3ARQA 2JB5H 3Q0HA 1CD8A 3T09A 2R0KL 3CH1B 3QDGE 4CVUA 4TULL 2VL4A 4LPCA 5ESQB 5DC9B 4AG4H 4IOFC 4OCSH 1CD1B 4EI5B 2W0FB 3N1QC 1RUMH 4XMLH 4EKXA 2A1WH 2AJYH 3GO1L 1JYNA 3QNYB 3QUYD 2YXFA 4J3UA 1MWAA 3O9WA 1WIUA 4X80H 3OHXA 1KEMH 1KCUL 1VHPA 3WIFA 2FCBA 3X11A 3IDYC 3I6LD 4R4FL 1H0DB 1T7WA 4G9FA 4I13B 1FVEA 4L4VD 2A6JB 1RUPL 2CKBA 1K4DA 2XXMB 3G5VA 3KXFE 2N7BA 1YEKH 4MB4A 2CSPA 4ZS6C 3FN0H 2AV1A 4O2EB 5GRWA 3MQIA 3TZVB 1B4RA 3DO7A 4GJTB 2IADA 1YMMB 5EG6C 1AGEB 1ZLSL 4OZHB 3MXWL 1HQRB 4X4YA 1OVZA 4DTGL 3BSZH 1QBMH 1WEJL 1MCIA 3C6LA 4UNTA 5D93C 4Y19E 4PP1C 4BZ1H 2HTLD 1MY5A 3NMEA 3RVWC 3VD3A 1IGCL 3TIEA 5EZLB 3B9KD 2JJUA 4H26B 4X6DB 3L3KB 5HHOB 4QO1A 1JPGB 1A1MA 4ERSH 4JM4L 4YHML 3INUH 3WFHA 4ZTPH 1XZ0A 5E2UH 3MA9L 4GRLC 4CADA 4HKXB 3HPLB 3TVMC 3FO2A 4H0GA 5DUML 4E42B 3T4YA 1UT9A 5I1GH 1YYMH 3MRNA 3V5DB 3D0VB 1A9BB 4M4PA 4HKJB 4FA8A 3C87A 1FH5L 3QULA 1HI6A 2XN9A 5CBAB 1U36A 4PJIB 4YXLH 3IDGA 5EORL 3LV3B 4JN1L 4LSVL 4JPIB 3DIFA 3SO3B 1XFPA 3OKDA 4F80A 3GFUA 1R3KB 1G7PB 4U7SA 1R3IL 4FQXD 1CXKA 3H8NA 3Q6GH 4GMTL 2NCMA 3QNXB 5DSCB 1FFRA 2ZG2A 1A5FL 5C0BE 1UWGH 4HG4K 4WU5B 1X6NA 2GK0A 3QI9A 4HIJA 4X9BA 5DVLA 5EUOF 5H37G 5MEOB 2D03L 4Y16D 2ED9A 2EDOA 4P4KD 2PYEB 1OGAB 2Y07L 5SV3A 2A2QT 4KRPB 3DXAA 5B3JF 2ADJB 1TVHA 5EFIA 2BY0A 3CPLB 3NABH 3TYFA 5GRXG 2J6EA 2P4AB 5KW9L 1F90H 2A0LC 4G6MH 3RTQC 5J6GB 5KSBF 3S34L 5E5MB 3RL1B 1ZV5A 4L3AA 5LQBH 5J4MA 4M7ZC 1V7NL 3KR3L 3SDCD 1QFWI 3VXRD 5ABDE 3OAUL 2GJ6A 4OD1L 5GRJL 5D7KD 1I9JH 5FGCB 3DYPA 4HS8H 3WN5A 5E8NA 2VSDA 1LO5B 1ZMYA 1KPRB 2DQFA 1EZVY 3VXUA 3MV9D 5C08A 4WUUD 1A6WH 3MRMB 4ZFZB 1KTDB 4WRLA 2PW1B 5J12C 3SDDD 1JUFA 4HKBB 5ANME 2FRGP 2WV3A 4YHZL 4RAUB 3Q6FA 4D0DB 4Z7OE 4Z18A 5J0BA 1I1CA 1WV7T 3QPQC 2VDOH 1C5BH 1FN4B 4JFEA 4J6RL 2R1WB 2DWEA 3BZ4B 4NJAH 5BV7B 4HS6A 5T3XL 3PDOA 2H2SC 5JXAL 1AJ7H 1G6RB 4TNWK 5IVXB 3T2QA 3FHQA 2A6IB 4OZGA 2VXSL 3JV6A 5ESAA 5TF1H 4X98A 3UJTL 4NGHL 5C9JB 4FXLA 3O2DH 5DLML 1MJ7H 1NLBH 3VG0L 3VFVB 4XPGL 3RVXC 4P2OC 4AM0B 1NUDA 2XA8L 3CK0L 4RMVA 2Y6SD 3VRLF 4TUJB 1WZMA 2WBJD 2BSRB 1IKNC 2LVCA 3TO4C 4M7LL 3PDDA 1CICC 5KVDH 1AY1L 1OP3K 2NZ9D 4N9OB 2EYTA 3HZKB 2O5XH 3V0VB 2W9DH 1T7ZA 4MAUH 4BJLA 3UPRB 5DO2C 5FK9B 3S3SA 5IHZA 1ONQA 1RK1B 1XCTB 2LAGB 4JJHA 4XRCA 4H20H 1RZIA 3KPSD 5DT1L 3CXHK 4AQ1B 4M9PA 2VXTH 4FABH 4PJ8D 5DUPL 5GS0H 2Z9TA 4HKZA 4DVRH 1S5HA 4UINH 4S0SD 4L9LA 3L3DB 2JJWA 2R9HC 3HC3L 4YE4L 1S7UB 4F7TA 2OX5A 4E9LA 5ISZB 3L95B 4PRBB 3GSVB 5E99L 3PIQB 5HY9A 2HA1A 4F2MA 3VJ6A 1ES0B 1P1ZB 1U9KA 4LPTA 5AD0A 3BXNB 3E6FB 4LHQB 3FB8A 3GJEA 4NN6B 4IMLA 5GGRA 1F00I 4UBDC 5IMOA 4HC1L 4L4TA 5D7IB 3BGAA 4CW1A 2X1OA 5IIEA 3MRCB 4E0RA 3IJHA 1JWMA 2NY0D 1RZKL 1OCWH 3FOMB 5E08H 1NCDL 3KYKH 3CXDH 2EYRA 5JO5A 5HI5C 2R0WH 5F88B 4ZPVA 1YYLH 4ZUTB 5F8RC 3BE1H 4MNGA 4WTZG 3QSKB 1MAMH 4KGLA 1KCKA 1BF8A 3MRBA 5DFWH 4XP9L 3OB0K 3BMVA 4BELD 1N4XH 1WC7B 3QO1A 4QLRA 1N7ML 5TQ2L 4PJCA 1EHLH 1MIEH 1P7KA 2FHBA 4XBPB 4PRHA 2EECA 3LAFA 1FIGL 4HWNA 1UGNA 4C54A 3VH8B 5JUEH 1N59A 2NY6B 1CU4L 1MHHB 1ZS8A 5EZIL 1CTNA 2Q87A 4CN4A 4Y8AA 4WFHD 5LGHH 4GT7A 4LLWA 5DUBB 1NMBH 3IXTA 3LH2L 5FHBL 3LS5H 3TZVC 3C9NA 2DS4A 4FFWC 5I0DA 1K8IA 1PYWA 5GISH 3HE7B 4QY8A 2GYSA 1CI5A 2HKHH 1I8IA 4S1SL 3DI2B 5E03A 3B2VL 2FJFB 2FO4A 3MC0A 3WS6A 1JNNH 3DETD 4K94L 4TSBL 1T04A 4GRMB 3RGVA 3SJVD 3PWPE 3FONB 4U1IB 5ICYA 5D2NA 5KSVB 4ZFFB 2E9IA 3IFNL 4GAYA 2G5BA 2UVFA 1CK0H 3AM8C 3HHRB 4PY7A 5HPMA 4BA8A 4UT6H 5CJOH 3MPCA 4JJ5A 4QTHA 3K8KA 1QBAA 1CLYH 3T0EC 1HE7A 2VLJE 1U8PA 1VEPA 1AD9A 4UIMB 2X4QB 1WTLA 1F6FB 1JNLL 2ESVA 2EO9A 4YHIB 4PPTA 3W11C 4PJFA 4XCEA 4DOHB 1I7ZB 1NBZA 1MCDA 1RZKC 4LVNC 3GK8H 5BV7L 3B83A 1WWCA 3LPWA 2EH7H 1RK0B 2CXKA 3DX6A 1Q9WB 5MEPB 4L5FL 1PX4A 4NQDB 2VOTA 4ZXBD 1F45A 5FYJL 4LSRH 5GGVL 1I1FA 5EOCJ 3PGFL 4FP8L 3QJFA 3SO3C 4AY0A 5DJYB 3BPLB 1E4XL 3Q5TA 2CIIA 1B2WH 2C3XA 4F37K 2Q3AA 1ZHNA 3JTSA 3NIDE 3CFDA 1XR8A 2VZOA 1NH6A 1MI5A 4L3EB 1MEXL 5CEXA 2J4WH 5I1CH 4XVJL 4DGVL 3U2SA 1FDLH 3PL6D 3FCTA 2A9NH 3IXAA 1U8JB 4KRPC 1IAII 4OBRA 5DFVC 5IKCB 5C09B 3GHBL 4QTIH 3U0PA 2HP4A 4FG6C 4BFIB 2IFGA 4HSQA 2P42B 4PJBB 3FFDB 4JRYA 3U48A 2AXFB 4NFDA 2PXYD 5D5ME 1JFQL 4FTVE 3QDJD 2BVQB 1KJ2B 3T04D 4TVPD 3HG1D 5ENWB 2I9TB 3C8DA 5FECA 4GAGH 4TSCL 4DEPB 5CS7A 5IW1A 1KUMA 3SBWA 3ZYIA 5DWUL 4U1HB 4JM2C 3GMQB 2AS5M 3SPVB 3IF1B 3UX9B 3QXVA 4KDVA 2HFEB 4ESKA 5IFHH 3ILQC 4P9MH 4EUPA 2FATH 3ZDXE 3CDYA 5LXGH 2YPLB 2BHZA 3OXSA 3IDNA 2MQ0A 3QUYA 2IWGA 4MCZA 2DOCA 1EGJL 3DV6B 3L5HA 3RDTD 5BV7C 3TBWB 3ARED 4G80A 5DZOA 4IMKA 4Y2DA 4H5SA 1G7HA 2H1PH 5L9DH 2P5WD 4JFDA 4CDGC 2RFXB 3UTZB 3RWDA 1NDMA 3RZCB 4O02L 1QFWH 3GSQB 1YN7A 3Q5OA 3RJDA 5EZJB 3EFDL 2PETA 4NYLA 5IOPA 2WUBL 3GI8L 2YUXA 3L9RB 3IFLL 3EBAA 2EZ0D 1AP2A 1PEZA 3VXQA 4I18A 4WWKB 3MR9A 4PRNA 1FZMB 4GKNA 1M71A 3TP4A 3MUZ1 3I3BA 2BNRD 3LEYH 1DLHA 1S3KH 4JPVH 2PW2B 5DJAA 3VFUA 1OAUH 2LU7A 4X4XB 1EUTA 5EOQL 1MFEL 2DJ4A 4GBXB 1IEAB 3FT3B 2NY5H 4C56D 4EOWH 5C0GA 1YECL 5I1LB 3BN3B 3MBED 5IHBA 3KLAB 2H32A 4Z7VF 4M7JH 2XTLA 1N0XL 2EDEA 2RCSH 3BP5B 1PQZB 2XFXB 1F6AA 5E8EA 5SX5H 1TDQA 3HMXL 1R5WB 2BJMH 5KVFH 5IM7A 2O93L 4LLDA 4KZDH 4YDIH 3HFML 3ULVH 3MGAA 3T8XB 2H2PD 1U8HA 4NN6C 1ZLVH 5CBEA 4AMKL 3FN3A 5TDNA 1G6VK 4IEFB 4ONHB 3KPPB 1FFNB 2CK0H 4OT1H 1P7QB 2QKIB 3H9SD 4Y5YB 5FCUH 4WIQA 5IBTL 1YY9C 3MRLB 2BRRL 4ENED 1FP5A 5FUCE 4GUPB 5AUMA 5DRWA 1CLZH 5I17B 4GXVL 2YKLL 3EJZD 4L8SA 3FO9A 5B38B 3FQNB 4AJ0A 1YPZE 4DUWA 3FAWA 5DHVH 4JRXB 3CFCH 1MIMH 1QSED 4HX1B 2ZJSH 3VI4F 3FQXB 2BMKA 2BSSA 1R0AH 4TNWF 3MYJA 4P2CG 5GZOD 5K9KA 5IG7A 1XGPA 1ACYL 3QG6B 2QHRL 3FRPA 1T1XA 2DIAA 2G60H 1EA9C 2E6QA 5DQDL 1N2RB 4S1QL 4HLZG 2X9WA 2NY6C 1NSNL 2ZWLT 1R3JB 3RWJA 2A73B 3DTXB 4N8VA 3REWA 5GGSY 5JIIA 4WW1B 4XI5D 4QHMA 4HFWB 3FFCD 1FO0A 2PR4H 4HT1L 2AXGA 3ZKND 3HZVB 1S7SA 1TIUA 5FKPB 5JLZB 4HCRL 4J1UB 3HE7C 1DVFA 4XP1H 4OM1H 4F9LC 3MV9A 4WUUA 1UZ6E 4YQXL 4N0UA 2E8YA 3MJGX 2OTWA 3NACL 2HRLA 4RMWA 3MV7D 4Z9KB 4TUKH 3G08A 2A6DA 3SDDA 2YPKB 2VH5H 4KK8C 4ZSOA 1H3PL 2M1KA 4OD3L 5I66A 4NNYB 5L6YH 4Y5VA 4KPHH 4NQVB 3ZT5A 2IPKB 3EW3B 3RY6A 5I1JH 4OGYL 1J5OL 3TT3H 5DMYA 2QSCL 4KMLB 3I02A 1OAYH 3BHBB 3ROOA 4AL8L 3D39D 3RUGA 1NGWA 4NQXA 1DBML 4S1DC 5L8KB 2CLVB 4R4BA 1JZ8A 4OFDA 1I1AB 4JVWA 4U2YA 2CRIA 2DQEL 2HKFH 3KPRA 2D4DA 4L8CA 3HNTH 5CCKH 5F9OL 4FFZL 3HZMA 2AJUH 5C07E 3VH8G 1MHPL 2CR6A 3RVUD 2YZ1A 1CDYA 2CRZA 5JHDD 1A9EB 2GTZB 4EDWH 3BPLC 1B4JH 4RSVA 5EO1B 1JMZA 2I60L 3CVHL 4LVEA 4QNPE 4V1DB 1T83C 1K5NA 1D7FA 1EJOH 2B0SL 2R56H 3MUGA 3DGGA 2DLIA 1XGTA 1MRDL 3N0PB 2OTUA 2YN3A 4YBLC 1ND0A 1Q9KB 1VGEL 4C55A 4TVSa 1MH5B 4QCIB 4JHWH 1KCRH 3RI5K 2BSTB 5JOPE 5D2LA 4PJ8A 1ORQB 1MJJB 3KLHD 3JWDL 1IC7L 3QIUD 1S8DA 5D7JC 4PYHA 4FNLL 4UTAL 4D9RD 3QWOB 4XC3L 3LS4L 2VITA 3TO2B 1IGYA 1FG2B 5J1AA 5C0RL 5KS9B 1E27B 1TCMA 4IDJL 4R26H 4PG2A 4RGNB 4UV4L 3Q5YA 5ICXB 4ZOCA 1IAKA 2VR4A 3PP3K 1U8NB 3AXLB 5L88H 4KK5D 5EO0B 5D71L 5I9QB 3BZFB 3PHQA 5HHQB 1MCWM 5J89A 1FGVL 2VDPH 1Y0LA 1W0WA 2XZAL 4HGMA 1T7VA 3V52L 3HAEH 35C8L 4I3SL 4JO4H 5F3HA 5IW6A 5C3TA 1CN4A 3VFOA 1IEBB 4KTEH 4HWEL 1QOKA 1QYGL 3WIIL 1GPOL 3BEWA 3LRHA 4M5YL 4QT5B 3VRIB 3PWLA 1BQSA 3SDAC 1T3FA 2PUQT 1WVZA 2K7PA 4JFHD 1E0OB 1T20B 4MJ4A 1T6VN 1IAIH 4UAOB 5EUKA 3ZKXB 4APQC 1U8MA 1BVKB 3JUZA 4RMRA 3BJ91 1GGIH 1PKQB 1OSPH 2HH0L 4XMPH 1U3JA 4MQXC 1XGYL 3NTCH 1NGQL 4KV5E 1S7RB 2BZDA 4WI9A 1A7NH 4OCYL 4NT6B 3UTTD 2HVKA 1I3RA 3U0TA 3RZCC 1JRHL 5C92A 4XWOC 1IM9D 2R0ZL 4OFIA 2ITDB 2PO6C 4BH8B 4CNIA 2CO6B 5CAYB 1JNHB 4BM7A 5CEZD 4MA3A 5D8JH 5DJ8B 1RZ7L 5DMIL 1KCVL 1XAUA 5JPMA 5C0NC 4F37F 2XQYK 3PQYD 2EIDA 2RGSA 1OW0A 2AEWA 4N0YH 3I9GL 4NNPH 3VWKB 5EU7C 1S7XA 1JTTA 4HJJL 4N8CH 5CD3B 2EEBA 2R23A 3QDMB 2GSGB 1F11A 4MMXC 1J8HD 4I4WB 5BS0B 4K8RH 1YEDA 1H3XA 3I75B 3JWDC 4KK6D 2C4FT 2PTUA 4LAQL 2AK4E 3CFIC 3DRQA 3QQ9D 1M1SA 3F7RA 5CMAA 3EOTL 3SCMD 1FAKT 1UZ8A 2DTMH 3S37X 4YFLF 3RPIA 3IDIA 1Q0YH 3VDCA 4HG4J 3LKRA 1ADQL 3NN8A 3QR2A 5IT2L 1MFBH 2MPAL 2J8UB 4I0PB 3TJEL 3D2UA 2EIZA 5BRZD 5DEGB 1AQKL 1SY6L 1D5IH 2F5AH 3F12A 3SGJA 5HDBE 3PUCA 2Q7YA 2VLKE 2IBZX 3O2VH 3LQZA 4QF1B 1CGTA 2XQBL 4RFOH 3IJYA 1AGFA 3WNOA 3QCTH 1ZT7A 2BVYA 4F7PB 1TJIH 1DUZB 5D1QB 3LZFH 3MLRH 1A6VL 4B50A 2HWZL 4YNYA 3U9UA 1Z9SA 4YHPB 1GHFH 2OXHA 3MNWB 1A3LH 2A74A 2OBGA 5FDWB 4QRQB 3M8OL 1F4WL 3WE6A 1CQKA 4QRRB 4XVUD 5EIIA 3DROB 5L2JA 4UOJA 5I19H 4Y89A 5A2JH 2VDRH 1YQVH 2FGWH 4R8WH 2F53E 2Z31A 5TDPB 3OWEA 5DD6B 2JK5B 4UQ2B 5LAXB 4A6YA 3P73A 4WHYG 3FJTA 2BVPB 2ZUSA 1UM6H 5SWQB 4JFZH 4LP4A 5T1DH 5E7FA 1KIPA 1FHGA 1IKFH 3TN0D 4PJGB 4RNRA 5DJ0A 2VLRB 5GGVY 1ROWA 3FQUA 4ZDHB 4R0LC 1RD6A 5IVOA 5C0FB 1DBKL 3PG2A 3CSPA 3GB7B 4GKZA 4OCWL 5JNYB 3HC0A 4NKIL 4XCCH 1ZEAH 4F33B 1KGCD 4AIXA 1FZKB 4JCMA 4OQTH 3O3EB 5GRVL 5GZND 3AC0A 1Q9LB 4KROB 1H15B 1RJCA 2R0KH 5CD5C 5DS8B 1NJ9B 4TULH 1QFPA 3QDGD 3STLA 3P4OB 5JMRA 4K9EL 5HXMA 5HD8D 3GO1H 3NAAL 1XF5A 1LP9B 1OGTA 4PLNC 5TH2B 1VGKB 5J9PA 3MRHB 1X5KA 2YZ8A 3TLRA 5IB5A 3EYSL 3RDTA 1KCUH 2X4UA 1MCFA 4XP4L 2DM2A 1JN6A 1AIFB 3ARFD 4MYWB 3SKOA 4LCUB 1NAKL 2P5WA 5K9QG 1RUPH 2DWDB 3ECBB 4M61A 3NIGF 3O8XC 3TIDA 5B38G 4NPYA 1I1AC 2V2XB 5ID0A 1VFAB 4EEEA 3LCYA 3CXHJ 5C0DB 3KXFD 4RFNB 2DQTL 3ARUA 3T65B 3CC5B 4GG6B 2E9JA 2JE8A 1U91A 3GSNA 3REVB 5CJ5A 4F7CA 2WP3O 2MHAA 2GEEA 1C5DA 4MDIA 3V5KB 4Y4FD 3MXWH 1IJ9A 1KJVB 5CLWA 5E00A 4KI5D 1S9YA 4LPVA 4DTGH 1E4XI 3C60D 3ARBD 1KB9J 3WHXB 1IM3A 1SJXA 5ERWA 5A1AA 3T3ME 2IQ9L 1K8DA 4GW5A 3MLPA 1IQDA 2IGFL 2ZPKL 3W0WB 3RGHA 3BZEB 1IGCH 4ZNCD 3ET9F 3S4SG 4C56A 3L1OL 2BRQA 3MBEA 4N90D 3MRKA 4YHMH 4JZJC 1SEBB 4YR6A 2VAJA 1F3DH 3MA9H 1Q72L 5HI3C 3ZZ1A 3CFBA 2VZ1A 5DUMH 4N0CD 4MD4B 2H8PB 1ED3A 4U1JA 4GW1B 4B0MM 5I1DB 1FH5H 1IGTB 1OF2A 3RBGA 2FGZA 4L8BA 1IILE 2B8OT 3D48R 2YD7A 4JN1H 5EORH 3L5IA 4MNQE 1BAFL 4LSVH 2QQQA 2CMRL 2CDGA 4K9EC 3C8HA 1W72B 2CUIA 3DI3B 3H9SA 5B3NA 5E4IA 3U4EA 4RAVB 1R3IH 5SWZE 4GMTH 1PZ5B 3MRFA 1A5FH 3D0LB 1VA9A 3BPCB 4FQCL 3OAYK 3X12B 5C0BD 3VE0B 2VJXA 2D03H 1SYSB 3ZKXC 2DI8A 4X8JA 2QADC 4WGWB 2Y07H 2IALA 4G8IA 2R1YB 4POUB 4UU9B 1P4BL 5INDB 4Q9CA 1T89A 3E6HB 1BZ7A 4DZ8A 5KW9H 4K7PL 3VA6A 2XWTA 4R3SA 7CGTA 5DQ9B 4X6EB 1MCPL 1KIUA 4KJQD 3RA7H 3S34H 5JW3L 5ALBL 1NC2B 2R2EB 2UWEB 4NN7C 4TOYL 3VXOA 1V7NH 3KR3H 5CWSB 4WV1B 1C16B 3B43A 4NNXA 4PJ7F 5FKAB 3SY0A 3S96B 1QLFB 1XR9A 1A6TA 4OD1H 3C6SB 5GRJH 5EU6E 1QRNA 3PDGA 4X6CE 4QOKD 4CL7A 1YC7A 2W65A 4L3CA 3T3PF 1R5VA 5JHLL 1UB6A 3CMOL 4M6ML 5ICZB 3TESA 3TNMA 5DYOA 1U3YA 2EKSA 4YHZH 2FL5A 3QUZA 3RI5F 4U3XA 4G8FA 1HNFA 4PJAE 3UJIL 1MWAB 3V4VL 4N0FA 3ALPA 4J6RH 3NFSL 4O58L 1DQJB 4JKWA 3OHXB 2VZUA 1HHJA 2CLZA 3WIFB 3X11B 5T3XH 1FVEB 2X4PB 5JXAH 4J3VA 2VDKL 2CKBB 1RJZA 1WICA 1K4DB 3V7AE 2ZUUA 4HPOL 3G5VB 2ZCHL 5DVOA 3X17A 3UJTH 3G5YA 4NGHH 2AV1B 5BCAA 4YHNA 5DLMH 1UH4A 2HLFD 3BN9C 5MERB 3CSBA 1EO5A 3VG0H 4XPGH 1YMMD 2GI7A 3DO7B 3CK0H 3V6OC 5J56B 5HHXL 5D1QC 2DQJL 3LIZL 5JHDA 4M7LH 4OLVL 5JPNA 3VA2C 4B41A 3MJ7A 1AY1H 3CFJA 1BWWA 2XIDA 1BHGA 1KN4L 5F97E 1CGUA 3UO1L 1KLUA 1MVUA 2WQRA 1ZGLP 4NRZA 2W92A 4HEME 3C6LB 3WKNA 2NR6D 1MFCL 3K0WA 5TGBA 1BD2A 3KPNB 2XOTA 4ODWA 2AEQL 3TIEB 2WW8A 5DJ2A 1JZ5A 4ZAKA 3IAQA 2NXZB 4KKCD 4O4YL 4U1KB 2VISA 5ADOL 1VACB 3Q3GA 5DT1H 3QEQE 1A1MB 1CDJA 5B39A 5C71A 4XHJD 1MOEA 3SHSA 1T66C 5DUPH 5MENE 4Y4KA 1SYVA 1KB5L 2YD2A 4IRJD 3WXWL 4YE4H 3HC3H 3UDWA 3F6IA 4CADB 4PJ5E 3H9YA 4PGJA 2V9QA 3WFDL 3FO2B 1UWEL 1IRAY 5E99H 3U4BH 2P1YA 1S9VB 5I76A 3MRNB 1I8LA 1C7SA 4I9WD 1J88A 2C3GA 4WHTA 1CVRA 4M00A 4P2QE 2NY1B 3QULB 3ILPA 5IFAH 4HC1H 2XN9B 2WBWB 5GRYA 1NFDE 3IDGB 4U7KA 5E6IA 3SDXE 2FWOB 3OKOB 5DURD 1RZKH 3KLSA 1NCDH 3DIFB 1MCCA 5CSGA 2IAMA 1VENA 3FRUA 4WFFE 4KJPD 1OSZA 3ZTJH 4G6JL 3BGFB 1VERA 3BIKA 2NY4D 4MJID 4KROC 4KZEL 4X7SL 4KTDL 4LEXL 1QPXA 4QRPE 3QG7L 5T3XE 1LNUA 3WBDA 5C2BL 4HGWA 2GK0B 4HIJB 4LSPL 1W72L 1I9EA 4KKLC 4OZ4B 4LQFL 1FYTA 2JF1A 5I1HL 4XP9H 2X40A 3DXAB 1N7MH 5TQ2H 4Y5XB 5J8OA 1U95A 1C08B 1SVCP 2LU4A 2VE6A 3TYFB 1FIGH 3B5GA 5BXFA 3LKPA 3OXRA 2VIRB 3JBG7 1CU4H 2YD9A 5EZIH 3UTTA 4J3OC 2ICWA 1RUKH 4PLOB 5I16B 4PJEE 4XPTL 3LH2H 3P4LA 5FHBH 5ACZA 2QQNL 2LTQB 1JTOA 3T2OA 1TTUA 3VWJC 2W07A 5E8NB 4DUVA 1TITA 2VLMD 2DQFB 3QCUL 4S11A 4S1SH 5F44A 3B2VH 3VXUB 5C08B 4TSBH 1YA5A 5DEFB 1MQKL 4S2SA 1JUFB 2YSSA 1G0YR 4WWID 3IFNH 1X4YA 4NZJA 4Z77A 2FBJL 3QIWA 3Q6FB 3RIAF 3MBXL 4YO0A 4ODXA 3T0EE 1A64A 1A7PL 4JFEB 4G9FE 4IRSC 15C8L 3U82B 2DWEB 4G6KL 1CDBA 3SCMA 1O0VA 2VLJD 4URTB 4Z7UE 1QSZA 5JQ6L 1JNLH 4HS6B 4QGYA 3CSYB 3F58L 2VXUL 3WJJA 4DFHA 4D9QE 4OZGB 4XAKD 4H0IA 4HEPG 4FQHA 5E94A 4Y1AA 4G6AC 4LDEB 1D6EA 2P5EB 5CINH 4X98B 1YN6A 2ICWJ 4RISH 1TTGA 3AU1A 4QHNB 4U4BA 5BV7H 3PP4L 3OKNA 1OLZA 1E6OL 3MCLL 1KTLA 2AXJA 3IFOB 3D1MC 1U58B 3HI1A 3F7QA 3LRSB 3F7VA 2YD3A 5FYJH 1FPTL 5GGVH 3U6RA 3PGFH 4FP8H 1OTTC 1E4XH 2CRYA 2EDHA 5DMKB 3V7AG 2FJHA 3QHZL 3QUKB 3FZUC 1XGQB 1MEXH 4XVJH 3HE6B 1LO2L 2EH8L 3C8KA 4DGVH 2PYEE 4JY6B 5IHZB 1AC6A 1ONQB 4OCNC 4PREA 2OYPA 2GKIA 4XRCB 1EEYB 1RZIB 2OR9L 3VXSE 4CGTA 2BC4A 4RGOL 3G04A 2CDFA 3JSSA 1BQHA 3GHBH 2NY3D 3BWUC 1S5HB 2HLAA 4HKZB 5FF6A 5H35A 5ISZD 3FO1B 4L9LB 4UDUB 5HHME 1I8MB 3RVTD 3VJ6B 4DKEL 2HT3D 2QR0B 1JFQH 1CGYA 3JWNC 3GJEB 2R39A 4N5ED 4WV1C 4IMLB 1I7TA 4FTVD 1JGUL 1JRHI 5GGRB 5IMOB 3ARZA 2P8LB 4KJYA 4L4TB 3MRPB 4BQBA 5IIEB 2ITCA 4X6DF 3IJHB 1JWMB 4FZ8L 2P49B 2YXMA 3VG9C 1XF3A 5I75C 4TSCH 2HN7A 1F8TL 4P5KA 4R97B 2E7BA 2EYRB 5JO5B 5HHPA 2V5MA 1BM3L 2HT2D 5DWUH 5SX5K 3EKCA 4OLYL 1KJ3L 2E6JA 4ZPVB 2DQUL 4MNGB 4MVBC 5D72H 3QDGA 1AHWC 2X9YA 1WBXB 1CD9B 1ZAGA 1ZLVK 3O6FB 4XT1C 4PV8A 3QO1B 1U0QA 1WZ1H 2WAHA 1EGJH 1P7KB 1TFHA 5DMJB 3MJ9L 5BVPH 1MCLA 2JIXA 1N59B 1ZS8B 3UTQA 1U2HA 2G9HA 5C86A 4O02H 4LLWB 2P47B 5CGYC 4BQ6A 3KXFA 3IXTB 4MZ2A 4Y4HB 3TGXA 2VERN 4J3WA 4ZNEE 2WUBH 3C9NB 3GI8H 1KPVA 5FYKL 2JJTC 1K8IB 3IFLH 4JAMB 1PYWB 1I8IB 3U9PL 2FO4B 1T22B 3ME0A 3OAZH 5F7UA 4GRWH 4YZFE 1T04B 3RGVB 1KCLA 2P48B 4JFYA 4H0HB 3C60A 2WINA 1EIBA 4ZUWA 2P46B 1ITCA 4GAYB 2G5BB 4PJHE 4PY7B 5HPMB 1U6AL 7FABL 5T1KB 5EOQH 4Y19A 1MFEH 4JJ5B 4B53A 4LCCC 4LEOB 1QVOB 4QTHB 4LCYA 1A7QL 4P5TC 2NXZC 2PNDA 1YECH 3O3AA 2JB6B 1AD9B 3KLDA 3QXDA 4JE4B 2ESVB 4LSTL 2PTTA 1N0XH 1NPUA 5KVEL 2NXYC 4XCEB 2Q8BH 2AV7A 4PGCA 5EUOB 3SO5A 3VFNA 2IMNA 1E6JL 3HFMH 4JKLA 5IMLA 1U8IA 5E6ZA 1M6OA 3AAZA 4XWGL 2ZUTA 4NQDD 5F89A 4AMKH 3KYMA 4W4OA 5D7LB 1ZE3C 3I6KA 1NKOA 4J7RA 4B7IA 5KSBB 1GC1L 3GRWL 3QJFB 3V5HB 3BP7B 2B4CL 2CIIB 5CSZB 5IBTH 2BRRH 3BGFC 4L3ED 1ZHNB 3JTSB 4RMQA 1XR8B 4GXVH 2YKLH 1MI5B 4WDIA 1KLGA 1NAML 5C0BA 3I3EA 3U2SB 1MVFA 4M1CC 3MRDA 4Y2OA 5C09D 1EEUA 3IXAB 2R8SL 3DURA 3JV0A 4Y5XC 2OJZL 2O5ZL 2V2WA 4R4NC 1ACYH 2QHRH 5HGAA 3U0PB 1YJDL 3UC0L 2P44B 5DQDH 5IEKA 4S1QH 1LWRA 4EDXA 1NSNH 4I0CC 2UY7A 3NVQA 4KC3B 4FHBD 4GRWE 1VPOH 4KY1L 5IUSA 1IGJA 3NIDF 3W9DA 4HT1H 4WEMB 1TZHA 4YUEH 1MCNA 3AB0B 4MX7A 3ARGC 4HCRH 3P4MA 4F57L 2EYSA 2ZSWB 4H8WC 1PG7X 2GUOB 1T1YA 1PDKA 2NX5E 3ZSSA 4NSKA 3MNVA 2QBWA 5JDSB 1NFIA 4YQXH 5IW1B 3VGDA 3B2UC 4PGBA 3NACH 4MDJA 4PRDA 5F71A 3CU7A 5JA9A 2YPLD 1QD0A 4AEIL 2DKMA 4EUPB 4IIQC 4Y88A 1UKSA 1H3PH 4Z95L 4EZMA 1YZZA 5ANMA 3OJDA 4PJCE 1U3HA 4WY7L 1EPFA 4PRHE 3QUYB 5C0CA 4QHKI 4LSSL 4K7PY 4MCZB 5D5MF 2NYYD 4OGYH 5IB3B 3CDCA 5I9QC 1ZOXA 5JIKA 4RQQA 5I2IB 3DUSB 3N50A 4P2RE 4P5MA 4AL8H 2IBBA 4M7LT 2BK8A 3HCVA 3JXAA 2H3NA 4G80B 4Y2DB 4H5SB 1G7HB 5JA8B 5D1XA 1DBMH 5I8CA 3JZ7A 2DQDL 3RWDB 1NDMB 2WIMA 3BKML 3CNKA 2B4CC 2R29L 4NYLB 4NQSA 5IOPB 4Q9QL 1RUAL 4O51A 1JIBA 3S6CA 5F9OH 4FFZH 4WWKD 2IMMA 3ZDXF 3B9DA 3IFPB 3VXQB 4I18B 2YRZA 1MHPH 3M17A 3MR9B 2BVEA 4PRNB 5D2NE 1GOHA 4PY8I 3H7BB 2R2HA 1M71B 4PBWD 4L29A 4NBZB 3C5ZD 1ZHBA 1UA6L 4XMKL 2I60H 3CVHH 2B0SH 3VCLB 4HZAA 1MRDH 2X6MA 4QHUA 5C0AA 1S9XA 4JPKL 1WBZB 1YJDC 4GS7C 3RVVC 3HE6C 3RWHA 4Z7NE 3EYOA 4UDTA 4EN3C 4HJ0C 4QXUL 5C0GB 2BX5A 3EYQC 5FOBA 5GSVA 2VXVL 1OARL 4U1GC 4WHYH 5JOPD 1URLA 1VESA 2WUCL 3JWDH 1IC7H 2CIKB 4C4KT 4FNLH 4L9LC 5EOTB 1XIWC 3ZDYE 1F6AB 5E8EB 3EO9L 5KN5A 4HPYL 4B5EA 3F8UB 4LLDB 2I27N 5C0RH 3QUMB 2GJZB 4EIZC 1BGXL 4HK0A 4IDJH 1U8HB 5GJSL 3HZYA 4A2LA 1KIRB 4O5LL 3ZMRA 4AIZA 2YD1A 3QYCA 5TDNB 5K59E 1QEWA 2IJ0C 1KNOA 3G6DL 2EIEA 4LGSB 5D71H 1FGVH 1NC4A 4Y7MA 3MLSL 2XZAH 4R97C 4ORGA 3V52H 35C8H 4FZEL 4I3SH 2X89D 2E7LC 2ZOLB 3QXAB 1AR1D 5GGTA 5E1HB 5J06A 3FQTA 4J8RB 5AUMB 5DRWB 4HWEH 1QYGH 2D4FA 2EDDA 3WIIH 4IBLT 2HJFA 1GPOH 3FO9B 2FEDD 4E5XB 3ULSA 4M5YH 4WO4A 2YWZA 3BKCL 3O6FC 4Y16B 4U6YA 1CDUA 1MUJB 5IF0B 3H2WA 1HYSC 1ZWIB 2BMKB 1GZPA 2BSSB 2HH0H 5HVGB 3MYJB 1XGPB 1XGYH 3BDYL 1T1XB 1JVKA 3ALWA 1NGQH 3TPUA 1LDSA 4D2NA 5KG9A 4IOIB 4OCYH 4DW2L 1MCRA 1I3GL 3RWJB 4N8VB 2APFA 3OB8A 3REWB 1JRHH 1LD9A 2R0ZH 4Y4HC 4H1LH 5SV4A 1A7RL 3VI3F 2HTKD 2ILLA 3B4NA 1RZ7H 1A6AA 5DMIH 2JELL 1R3HB 1N3NA 2IF7A 3EDJA 3DX8B 3FB7A 3L3IA 2KDGA 3NIFE 1O7SA 3MV9B 4UNVA 4WUUB 5EU7E 2RAMA 2OTWB 32C2A 1GGYA 3CDGA 3I9GH 3GSRA 1VKXB 5KZCD 3G08B 2A6DB 4HJJH 3PWPA 1HWGB 3SDDB 3S9DB 1MFAL 3FMGL 4JZOA 4PJBF 4MXWL 4F15B 1HOCA 2A1WL 2EDJA 4KVNL 5I15L 1QKZL 1SVZA 2MWCA 5I8OL 5I66B 1QR1A 1J05B 4Y5VB 2Q7NA 4LAQH 3GSUA 2OZ4H 4X80L 2GSIA 3L5XH 3S3PA 5ID1A 3EOTH 3I02B 1Y6MR