3UEZE

Crystal structure of the human colony-stimulating factor 1 (hcsf-1) cytokine in complex with the viral receptor barf1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1
pubmed doi rcsb
molecule keywords Secreted protein BARF1
molecule tags Cytokine receptor/cytokine
source organism Human herpesvirus 4
total genus 43
structure length 142
sequence length 142
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05337 CSF-1 Macrophage colony stimulating factor-1 (CSF-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3uezE00
1RW5A 1FG9A 4MHLA 1RHGA 2B8UA 3VA2A 1RCBA 1Z7CA 3UF5A 4FA8E 2D48A 3G6DA 1BP3A 4O9HA 3QWRB 4Z5RD 3SE3B 3QB1A 4O6KA 3S9DA 2HYMB 1VLKA 1JLIA 2Q7NB 4ZF7A 1SCFA 3BESL 3LB6A 1EERA 1BUYA 1ETEA 1F45B 1HWGA 1I1RB 1WU3I 2B8YA 5E4EA 1ITLA 1F6FA 3HHRA 4NEMA 1QVNA 1PVHB 2ERJD 1GA3A 3OQ3A 1LKIA 1D9GA 5LQBA 1AU1A 3B5KA 1EXZA 1N1FA 4YDYI 5D70A 1HZIA 3QB7A 4RS1A 5D72A 4YQXA 3NCCA 1EMRA 1CN4C 1IARA 5FHXA 5L6YC 5C7XA 3BPLA 1V7MV 1HULA 1IL6A 1BCNA 1IJZA 3QAZA 2CYKA 1HGUA 2E9WC 3NCEA 4NI9A 3HMXB 1D9CA 3BPOA 1HIKA 3MZGA 3N06A 1A7MA 1EVSA 1NBPA 3NPZA 2O26A 1M4BA 1FYHA 1ALUA 1ITMA 2O27A 2D9QA 4GRWA 2B5IA 3PIWA 1IK0A 3G9VB 3N0PA 3PIVA 1YKBA 4NEJA 3UX9A 3QT2C 1GNCA 3UF2A 4YPGC 4X51A 1J7VL 2B90A 1ITIA 3SE4B 3BPNA 2ILKA 1ILKA 1BGEA 1LK3A 3UEZE 3WCYI 1EKUA 4DOHA 3EJJA 1CD9A 1B5LA 1M48A 3DUHC 2Q98A 5KNHI 1A22A 1ITFA 1HUWA 5D22A 1Y6ML 2L3OA 2IL6A 2B8ZA 1KF9A 3Q1SI 1BBNA 2B91A 3D87A 1M4RA 1LQSL 2KZ1A 4CNIC 1PW6A 2LMSA 5D28B 3L5XA 1INRA 1HIJA 1Y6KL 3NCBA 1M49A 1AXIA 4YUEC 2GMFA 5FUCA 4WRLB 1Y6NL 4I77Z 1CSGA 3EW3A 2H24A 4NI7A 2L3YA 2LAGA 3NCFA 1Z92A 1RFBA 3D48P 1CNT1 3DLQI 3LB6B 2INTA 1IRLA 3L5WI 1M47A 4PS4A 4J4LC 1M4CA 3DGCL 1PY2A 2B8XA 1P9MB 1PGRA 1CYLA 1BGCA 4NKQC 5D71A 3D85C 1M4AA 4ZS7A 1HWHA 1BGDA 1AX8A 3INKC 1V7NV
chains in the Genus database with same CATH superfamily
4MHLA 2B8UA 4TPGA 3QWRB 4Z5RD 4O6KA 3S9DA 4LEPA 1VLKA 1BUYA 1HWGA 5C44D 1ITLA 4BY7D 1F6FA 3HHRA 4NEMA 2ERJD 3OQ3A 1Y14A 5EQHA 4IKVA 3I4ND 4D2DA 4JREA 4YB9D 1BCNA 3H0GD 2R92D 4W6VA 2R7ZD 5TS9A 3N06A 1EVSA 4IU9A 5C3ED 2O26A 4GRWA 2D9QA 1IK0A 3G9VB 3QT2C 4YPGC 4X51A 3EJJA 2Q14A 4A3ID 1ITFA 1Y1VD 5D22A 2L3OA 3HHCA 4GBZA 2B91A 3D87A 1M4RA 3HOWD 2R93D 5D28B 1INRA 5A2NA 4ZYRA 3O7PA 4YUEC 3I4MD 3HOYD 4D2BA 4WRLB 4I77Z 1CSGA 2XUTA 1PW4A 4U4TA 1Z92A 3D48P 4JA3A 1IRLA 3L5WI 2JA6D 4PS4A 1P9MB 4A3GD 2C35A 5EQGA 1CYLA 3DI2A 4UVMA 1V7NV 1RW5A 4IKWA 3VA2A 5C4XD 1RCBA 4ZW9A 2CFPA 4FA8E 4U4VA 4O9HA 3QB1A 1WCMD 4JR9A 4DKEA 4DKFA 4QIQA 5E4EA 4ZWBA 1PV7A 1QVNA 1LKIA 1D9GA 5IP7D 3HOUD 1N1FA 4YDYI 4EXPA 4IKZA 4YQXA 1IARA 4A3FD 4A3MD 1HGUA 2E9WC 4NI9A 1HIKA 4J05A 3PO3D 1M4BA 1FYHA 1ALUA 3PIWA 3PO2D 1YKBA 1J7VL 3BPNA 3WCYI 3UEZE 1EKUA 1B5LA 1M48A 5IYDD 4NN7A 4ZWCA 1BBNA 1LQSL 1PW6A 2LMSA 3L5XA 1Y6KL 2GMFA 2B63D 3EW3A 4EXNA 4NI7A 4A3BD 5IP9D 3NCFA 3TGXB 3LB6B 1M47A 4J4LC 3DGCL 1PGRA 1Y1WD 1BGDA 2CFQA 3HOVD 1RHGA 1Z7CA 3UF5A 2D48A 3G6DA 2JA5D 3SE3B 5FLMD 4LDSA 2HYMB 1JLIA 2Q7NB 5IYBD 1SCFA 3BESL 3LB6A 1ETEA 1I1RB 2B8YA 5D6KA 1GA3A 1PVHB 3OG6A 2O6IA 4TPHA 1EXZA 4BBRD 1HZIA 3QB7A 4RS1A 5D72A 4GBYA 1PV6A 4A3ED 5D58A 3NCCA 1EMRA 1CN4C 5FHXA 5L6YC 5IYCD 3FKID 3BPLA 1V7MV 1HULA 1IL6A 1IJZA 4U4WA 3QAZA 4A3LD 4GC0A 3MZGA 1NBPA 3NPZA 3H3VE 3N0PA 3DI3A 2B90A 3SE4B 5GXBA 3HOXD 2ILKA 4DOHA 2OQPA 4LRLA 1CD9A 3DUHC 2Q98A 4BXXD 2IL6A 3OG4A 2KZ1A 4IKYA 4DKDA 4A3CD 4PYPA 3O7QA 4OAAA 1M49A 4BY1D 2L3YA 4TPJA 1RFBA 4D2CA 4NN5A 2INTA 1M4CA 3HOZD 1BGCA 5D71A 4GS7A 4ZS7A 1AX8A 2JA7D 1FG9A 1BP3A 5EQIA 2VUMD 4ZF7A 5C65A 4APSA 4A3DD 4OH3A 1EERA 1F45B 1WU3I 5LQBA 1AU1A 3B5KA 5D70A 4YBQA 5C7XA 2Y5YA 2CYKA 4A93D 4A3JD 3NCEA 3HMXB 2JA8D 1D9CA 3BPOA 1A7MA 1ITMA 2O27A 2Z3QA 4DKCA 2B5IA 4Q65A 4NN6A 3UX9A 3PIVA 1GNCA 4NEJA 2Z3RA 3UF2A 4IKXA 1ITIA 1ILKA 1BGEA 1LK3A 4XNJA 5KNHI 1A22A 1HUWA 1Y6ML 2B8ZA 5D59A 1KF9A 3Q1SI 4CNIC 5A2OA 3WDOA 1HIJA 3NCBA 1AXIA 5FUCA 1Y6NL 3AYHA 4A3KD 2H24A 2V8NA 4IU8A 2PSMA 2LAGA 2XQBA 4BBSD 1CNT1 3DLQI 4XNIA 1PY2A 2B8XA 3IRHA 4NKQC 3D85C 1M4AA 1HWHA 3INKC
chains in the Genus database with same CATH topology
1RW5A 2JA7D 1FG9A 4MHLA 1RHGA 2B8UA 3VA2A 5C4XD 1RCBA 1Z7CA 3UF5A 4FA8E 2D48A 3G6DA 1BP3A 4O9HA 3QWRB 2JA5D 4Z5RD 3SE3B 3QB1A 4O6KA 3S9DA 5FLMD 1WCMD 2HYMB 1VLKA 2VUMD 1JLIA 2Q7NB 4ZF7A 5IYBD 4DKEA 4DKFA 4A3DD 1SCFA 3BESL 3LB6A 1EERA 1BUYA 1ETEA 1F45B 1HWGA 1I1RB 1WU3I 2B8YA 5E4EA 5C44D 1ITLA 4BY7D 1F6FA 3HHRA 4NEMA 1QVNA 1PVHB 2ERJD 3OG6A 1GA3A 3OQ3A 1LKIA 1D9GA 5LQBA 5IP7D 2O6IA 1AU1A 3B5KA 1EXZA 3HOUD 1N1FA 4YDYI 5D70A 4BBRD 1HZIA 3QB7A 1Y14A 4RS1A 5D72A 4EXPA 4A3ED 4YQXA 3NCCA 1EMRA 1CN4C 1IARA 5FHXA 5L6YC 3I4ND 5C7XA 5IYCD 3FKID 3BPLA 4A3FD 1V7MV 1HULA 1IL6A 1BCNA 4A3MD 1IJZA 3H0GD 3QAZA 2CYKA 1HGUA 4A93D 4A3LD 4A3JD 2R92D 2E9WC 3NCEA 4NI9A 3HMXB 2JA8D 1D9CA 3BPOA 2R7ZD 1HIKA 3MZGA 5TS9A 3N06A 1A7MA 1EVSA 1NBPA 3NPZA 3PO3D 5C3ED 2O26A 3H3VE 1M4BA 1FYHA 1ALUA 1ITMA 2O27A 2D9QA 2Z3QA 4GRWA 2B5IA 4DKCA 3PIWA 3PO2D 4NN6A 1IK0A 3G9VB 3N0PA 3PIVA 1YKBA 4NEJA 3UX9A 3QT2C 1GNCA 2Z3RA 3UF2A 4YPGC 4X51A 3DI3A 1J7VL 2B90A 1ITIA 3SE4B 3HOXD 3BPNA 2ILKA 1ILKA 1BGEA 1LK3A 3UEZE 3WCYI 1EKUA 4DOHA 2OQPA 3EJJA 4LRLA 2Q14A 4A3ID 1CD9A 1B5LA 1M48A 3DUHC 2Q98A 5KNHI 1A22A 1ITFA 1HUWA 5IYDD 1Y1VD 4NN7A 5D22A 1Y6ML 2L3OA 3HHCA 4BXXD 2IL6A 2B8ZA 1KF9A 3Q1SI 1BBNA 2B91A 3D87A 1M4RA 1LQSL 2KZ1A 3OG4A 4CNIC 1PW6A 2LMSA 3HOWD 2R93D 4DKDA 5D28B 3L5XA 4A3CD 1INRA 1HIJA 1Y6KL 3NCBA 1M49A 1AXIA 4YUEC 3I4MD 2GMFA 3HOYD 5FUCA 2B63D 4WRLB 1Y6NL 3AYHA 1CSGA 3EW3A 4I77Z 4EXNA 4A3KD 2H24A 4BY1D 2PSMA 4NI7A 2L3YA 4A3BD 5IP9D 2LAGA 3NCFA 2XQBA 1Z92A 1RFBA 4BBSD 3D48P 4NN5A 1CNT1 3DLQI 3LB6B 3TGXB 2INTA 1IRLA 3L5WI 1M47A 2JA6D 4PS4A 4J4LC 1M4CA 3DGCL 3HOZD 1PY2A 2B8XA 1P9MB 1PGRA 2C35A 3IRHA 4A3GD 1BGCA 4NKQC 1Y1WD 1CYLA 5D71A 3D85C 1M4AA 3DI2A 4GS7A 4ZS7A 1HWHA 1BGDA 1AX8A 3INKC 3HOVD 1V7NV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RW5 A;  1FG9 A;  4MHL A;  1RHG A;  2B8U A;  3VA2 A;  1RCB A;  1Z7C A;  3UF5 A;  4FA8 E;  2D48 A;  3G6D A;  1BP3 A;  4O9H A;  3QWR B;  4Z5R D;  3SE3 B;  3QB1 A;  4O6K A;  3S9D A;  2HYM B;  1VLK A;  1JLI A;  2Q7N B;  4ZF7 A;  1SCF A;  3BES L;  3LB6 A;  1EER A;  1BUY A;  1ETE A;  1F45 B;  1HWG A;  1I1R B;  1WU3 I;  2B8Y A;  5E4E A;  1ITL A;  1F6F A;  3HHR A;  4NEM A;  1QVN A;  1PVH B;  2ERJ D;  1GA3 A;  3OQ3 A;  1LKI A;  1D9G A;  5LQB A;  1AU1 A;  3B5K A;  1EXZ A;  1N1F A;  4YDY I;  5D70 A;  1HZI A;  3QB7 A;  4RS1 A;  5D72 A;  4YQX A;  3NCC A;  1EMR A;  1CN4 C;  1IAR A;  5FHX A;  5L6Y C;  5C7X A;  3BPL A;  1V7M V;  1HUL A;  1IL6 A;  1BCN A;  1IJZ A;  3QAZ A;  2CYK A;  1HGU A;  2E9W C;  3NCE A;  4NI9 A;  3HMX B;  1D9C A;  3BPO A;  1HIK A;  3MZG A;  3N06 A;  1A7M A;  1EVS A;  1NBP A;  3NPZ A;  2O26 A;  1M4B A;  1FYH A;  1ALU A;  1ITM A;  2O27 A;  2D9Q A;  4GRW A;  2B5I A;  3PIW A;  1IK0 A;  3G9V B;  3N0P A;  3PIV A;  1YKB A;  4NEJ A;  3UX9 A;  3QT2 C;  1GNC A;  3UF2 A;  4YPG C;  4X51 A;  1J7V L;  2B90 A;  1ITI A;  3SE4 B;  3BPN A;  2ILK A;  1ILK A;  1BGE A;  1LK3 A;  3UEZ E;  3WCY I;  1EKU A;  4DOH A;  3EJJ A;  1CD9 A;  1B5L A;  1M48 A;  3DUH C;  2Q98 A;  5KNH I;  1A22 A;  1ITF A;  1HUW A;  5D22 A;  1Y6M L;  2L3O A;  2IL6 A;  2B8Z A;  1KF9 A;  3Q1S I;  1BBN A;  2B91 A;  3D87 A;  1M4R A;  1LQS L;  2KZ1 A;  4CNI C;  1PW6 A;  2LMS A;  5D28 B;  3L5X A;  1INR A;  1HIJ A;  1Y6K L;  3NCB A;  1M49 A;  1AXI A;  4YUE C;  2GMF A;  5FUC A;  4WRL B;  1Y6N L;  4I77 Z;  1CSG A;  3EW3 A;  2H24 A;  4NI7 A;  2L3Y A;  2LAG A;  3NCF A;  1Z92 A;  1RFB A;  3D48 P;  1CNT 1;  3DLQ I;  3LB6 B;  2INT A;  1IRL A;  3L5W I;  1M47 A;  4PS4 A;  4J4L C;  1M4C A;  3DGC L;  1PY2 A;  2B8X A;  1P9M B;  1PGR A;  1CYL A;  1BGC A;  4NKQ C;  5D71 A;  3D85 C;  1M4A A;  4ZS7 A;  1HWH A;  1BGD A;  1AX8 A;  3INK C;  1V7N V; 
#chains in the Genus database with same CATH topology
 4MHL A;  2B8U A;  4TPG A;  3QWR B;  4Z5R D;  4O6K A;  3S9D A;  4LEP A;  1VLK A;  1BUY A;  1HWG A;  5C44 D;  1ITL A;  4BY7 D;  1F6F A;  3HHR A;  4NEM A;  2ERJ D;  3OQ3 A;  1Y14 A;  5EQH A;  4IKV A;  3I4N D;  4D2D A;  4JRE A;  4YB9 D;  1BCN A;  3H0G D;  2R92 D;  4W6V A;  2R7Z D;  5TS9 A;  3N06 A;  1EVS A;  4IU9 A;  5C3E D;  2O26 A;  4GRW A;  2D9Q A;  1IK0 A;  3G9V B;  3QT2 C;  4YPG C;  4X51 A;  3EJJ A;  2Q14 A;  4A3I D;  1ITF A;  1Y1V D;  5D22 A;  2L3O A;  3HHC A;  4GBZ A;  2B91 A;  3D87 A;  1M4R A;  3HOW D;  2R93 D;  5D28 B;  1INR A;  5A2N A;  4ZYR A;  3O7P A;  4YUE C;  3I4M D;  3HOY D;  4D2B A;  4WRL B;  4I77 Z;  1CSG A;  2XUT A;  1PW4 A;  4U4T A;  1Z92 A;  3D48 P;  4JA3 A;  1IRL A;  3L5W I;  2JA6 D;  4PS4 A;  1P9M B;  4A3G D;  2C35 A;  5EQG A;  1CYL A;  3DI2 A;  4UVM A;  1V7N V;  1RW5 A;  4IKW A;  3VA2 A;  5C4X D;  1RCB A;  4ZW9 A;  2CFP A;  4FA8 E;  4U4V A;  4O9H A;  3QB1 A;  1WCM D;  4JR9 A;  4DKE A;  4DKF A;  4QIQ A;  5E4E A;  4ZWB A;  1PV7 A;  1QVN A;  1LKI A;  1D9G A;  5IP7 D;  3HOU D;  1N1F A;  4YDY I;  4EXP A;  4IKZ A;  4YQX A;  1IAR A;  4A3F D;  4A3M D;  1HGU A;  2E9W C;  4NI9 A;  1HIK A;  4J05 A;  3PO3 D;  1M4B A;  1FYH A;  1ALU A;  3PIW A;  3PO2 D;  1YKB A;  1J7V L;  3BPN A;  3WCY I;  3UEZ E;  1EKU A;  1B5L A;  1M48 A;  5IYD D;  4NN7 A;  4ZWC A;  1BBN A;  1LQS L;  1PW6 A;  2LMS A;  3L5X A;  1Y6K L;  2GMF A;  2B63 D;  3EW3 A;  4EXN A;  4NI7 A;  4A3B D;  5IP9 D;  3NCF A;  3TGX B;  3LB6 B;  1M47 A;  4J4L C;  3DGC L;  1PGR A;  1Y1W D;  1BGD A;  2CFQ A;  3HOV D;  1RHG A;  1Z7C A;  3UF5 A;  2D48 A;  3G6D A;  2JA5 D;  3SE3 B;  5FLM D;  4LDS A;  2HYM B;  1JLI A;  2Q7N B;  5IYB D;  1SCF A;  3BES L;  3LB6 A;  1ETE A;  1I1R B;  2B8Y A;  5D6K A;  1GA3 A;  1PVH B;  3OG6 A;  2O6I A;  4TPH A;  1EXZ A;  4BBR D;  1HZI A;  3QB7 A;  4RS1 A;  5D72 A;  4GBY A;  1PV6 A;  4A3E D;  5D58 A;  3NCC A;  1EMR A;  1CN4 C;  5FHX A;  5L6Y C;  5IYC D;  3FKI D;  3BPL A;  1V7M V;  1HUL A;  1IL6 A;  1IJZ A;  4U4W A;  3QAZ A;  4A3L D;  4GC0 A;  3MZG A;  1NBP A;  3NPZ A;  3H3V E;  3N0P A;  3DI3 A;  2B90 A;  3SE4 B;  5GXB A;  3HOX D;  2ILK A;  4DOH A;  2OQP A;  4LRL A;  1CD9 A;  3DUH C;  2Q98 A;  4BXX D;  2IL6 A;  3OG4 A;  2KZ1 A;  4IKY A;  4DKD A;  4A3C D;  4PYP A;  3O7Q A;  4OAA A;  1M49 A;  4BY1 D;  2L3Y A;  4TPJ A;  1RFB A;  4D2C A;  4NN5 A;  2INT A;  1M4C A;  3HOZ D;  1BGC A;  5D71 A;  4GS7 A;  4ZS7 A;  1AX8 A;  2JA7 D;  1FG9 A;  1BP3 A;  5EQI A;  2VUM D;  4ZF7 A;  5C65 A;  4APS A;  4A3D D;  4OH3 A;  1EER A;  1F45 B;  1WU3 I;  5LQB A;  1AU1 A;  3B5K A;  5D70 A;  4YBQ A;  5C7X A;  2Y5Y A;  2CYK A;  4A93 D;  4A3J D;  3NCE A;  3HMX B;  2JA8 D;  1D9C A;  3BPO A;  1A7M A;  1ITM A;  2O27 A;  2Z3Q A;  4DKC A;  2B5I A;  4Q65 A;  4NN6 A;  3UX9 A;  3PIV A;  1GNC A;  4NEJ A;  2Z3R A;  3UF2 A;  4IKX A;  1ITI A;  1ILK A;  1BGE A;  1LK3 A;  4XNJ A;  5KNH I;  1A22 A;  1HUW A;  1Y6M L;  2B8Z A;  5D59 A;  1KF9 A;  3Q1S I;  4CNI C;  5A2O A;  3WDO A;  1HIJ A;  3NCB A;  1AXI A;  5FUC A;  1Y6N L;  3AYH A;  4A3K D;  2H24 A;  2V8N A;  4IU8 A;  2PSM A;  2LAG A;  2XQB A;  4BBS D;  1CNT 1;  3DLQ I;  4XNI A;  1PY2 A;  2B8X A;  3IRH A;  4NKQ C;  3D85 C;  1M4A A;  1HWH A;  3INK C; 
#chains in the Genus database with same CATH homology
 1RW5 A;  2JA7 D;  1FG9 A;  4MHL A;  1RHG A;  2B8U A;  3VA2 A;  5C4X D;  1RCB A;  1Z7C A;  3UF5 A;  4FA8 E;  2D48 A;  3G6D A;  1BP3 A;  4O9H A;  3QWR B;  2JA5 D;  4Z5R D;  3SE3 B;  3QB1 A;  4O6K A;  3S9D A;  5FLM D;  1WCM D;  2HYM B;  1VLK A;  2VUM D;  1JLI A;  2Q7N B;  4ZF7 A;  5IYB D;  4DKE A;  4DKF A;  4A3D D;  1SCF A;  3BES L;  3LB6 A;  1EER A;  1BUY A;  1ETE A;  1F45 B;  1HWG A;  1I1R B;  1WU3 I;  2B8Y A;  5E4E A;  5C44 D;  1ITL A;  4BY7 D;  1F6F A;  3HHR A;  4NEM A;  1QVN A;  1PVH B;  2ERJ D;  3OG6 A;  1GA3 A;  3OQ3 A;  1LKI A;  1D9G A;  5LQB A;  5IP7 D;  2O6I A;  1AU1 A;  3B5K A;  1EXZ A;  3HOU D;  1N1F A;  4YDY I;  5D70 A;  4BBR D;  1HZI A;  3QB7 A;  1Y14 A;  4RS1 A;  5D72 A;  4EXP A;  4A3E D;  4YQX A;  3NCC A;  1EMR A;  1CN4 C;  1IAR A;  5FHX A;  5L6Y C;  3I4N D;  5C7X A;  5IYC D;  3FKI D;  3BPL A;  4A3F D;  1V7M V;  1HUL A;  1IL6 A;  1BCN A;  4A3M D;  1IJZ A;  3H0G D;  3QAZ A;  2CYK A;  1HGU A;  4A93 D;  4A3L D;  4A3J D;  2R92 D;  2E9W C;  3NCE A;  4NI9 A;  3HMX B;  2JA8 D;  1D9C A;  3BPO A;  2R7Z D;  1HIK A;  3MZG A;  5TS9 A;  3N06 A;  1A7M A;  1EVS A;  1NBP A;  3NPZ A;  3PO3 D;  5C3E D;  2O26 A;  3H3V E;  1M4B A;  1FYH A;  1ALU A;  1ITM A;  2O27 A;  2D9Q A;  2Z3Q A;  4GRW A;  2B5I A;  4DKC A;  3PIW A;  3PO2 D;  4NN6 A;  1IK0 A;  3G9V B;  3N0P A;  3PIV A;  1YKB A;  4NEJ A;  3UX9 A;  3QT2 C;  1GNC A;  2Z3R A;  3UF2 A;  4YPG C;  4X51 A;  3DI3 A;  1J7V L;  2B90 A;  1ITI A;  3SE4 B;  3HOX D;  3BPN A;  2ILK A;  1ILK A;  1BGE A;  1LK3 A;  3UEZ E;  3WCY I;  1EKU A;  4DOH A;  2OQP A;  3EJJ A;  4LRL A;  2Q14 A;  4A3I D;  1CD9 A;  1B5L A;  1M48 A;  3DUH C;  2Q98 A;  5KNH I;  1A22 A;  1ITF A;  1HUW A;  5IYD D;  1Y1V D;  4NN7 A;  5D22 A;  1Y6M L;  2L3O A;  3HHC A;  4BXX D;  2IL6 A;  2B8Z A;  1KF9 A;  3Q1S I;  1BBN A;  2B91 A;  3D87 A;  1M4R A;  1LQS L;  2KZ1 A;  3OG4 A;  4CNI C;  1PW6 A;  2LMS A;  3HOW D;  2R93 D;  4DKD A;  5D28 B;  3L5X A;  4A3C D;  1INR A;  1HIJ A;  1Y6K L;  3NCB A;  1M49 A;  1AXI A;  4YUE C;  3I4M D;  2GMF A;  3HOY D;  5FUC A;  2B63 D;  4WRL B;  1Y6N L;  3AYH A;  1CSG A;  3EW3 A;  4I77 Z;  4EXN A;  4A3K D;  2H24 A;  4BY1 D;  2PSM A;  4NI7 A;  2L3Y A;  4A3B D;  5IP9 D;  2LAG A;  3NCF A;  2XQB A;  1Z92 A;  1RFB A;  4BBS D;  3D48 P;  4NN5 A;  1CNT 1;  3DLQ I;  3LB6 B;  3TGX B;  2INT A;  1IRL A;  3L5W I;  1M47 A;  2JA6 D;  4PS4 A;  4J4L C;  1M4C A;  3DGC L;  3HOZ D;  1PY2 A;  2B8X A;  1P9M B;  1PGR A;  2C35 A;  3IRH A;  4A3G D;  1BGC A;  4NKQ C;  1Y1W D;  1CYL A;  5D71 A;  3D85 C;  1M4A A;  3DI2 A;  4GS7 A;  4ZS7 A;  1HWH A;  1BGD A;  1AX8 A;  3INK C;  3HOV D;  1V7N V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...