3UFYA

Akr1c3 complex with r-naproxen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
303
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ufyA00
1YNPA 2F2KA 2IS7A 3G1RA 3EAUA 3WBXA 4LAZA 1ZSXA 3UGRA 2HE8A 4GCAA 4NKCA 3GHRA 4PUUA 4WGHA 2FGBA 2PDCA 3BURA 3WBYA 3F7JA 5JH2A 4YVPA 1LWIA 3CASA 3UZYA 4JTQA 4WRHA 4XZNX 1XJBA 2HDJA 4L1WA 3UZZA 4HMNA 4XZIA 3CAVA 1QRQA 2IPGA 4FA3A 1IHIA 2INEA 3VXGA 3S3GA 1PYFA 1PWMA 3ERPA 2PD9A 3ONCA 4DBWA 3LZ3A 4FAMA 4XAPA 2ALRA 3P2VA 1Z3NA 1ZQ5A 3DN5A 4JQ4A 5LIKX 3LNMA 1YNQA 2ACRA 2FVLA 5HA7A 1M9HA 2IKHA 2F38A 2PDKA 1RY8A 2PDJA 2PDHA 2PDIA 1A80A 3BCJA 1K8CA 2DUXA 3UP8A 3T42A 1T41A 3LD5A 1XGDA 1RY0A 3EB4A 2ACUA 1ADSA 2IPWA 1SM9A 3EB3A 4WDTA 2FZ8A 4PUWA 3FX4A 1AH3A 3M64A 3MB9A 4JIIX 2I17A 2PDLA 2VDGA 2J8TA 4H8NA 1VBJA 1PWLA 4Q7BA 1OG6A 4GIEA 4QXIA 3FJNA 5JH1A 5LIYX 3V36A 4PR4A 2HVNA 4XK2A 3RX3A 4XVEA 3WCZA 1AFSA 1FRBA 3V35A 2IKIA 1PZ1A 2CLPA 4MHBA 4L1XA 1J96A 2BGQA 5LIWX 3GUGA 2BP1A 1X97A 2P5NA 3LBOA 1X98A 5HNTA 1S2AA 3COTA 2R24A 4RPQA 4XZHA 2INZA 3UZWA 1ZUAX 3R58A 1HQTA 1EL3A 2ACSA 2WZTA 3Q67A 4IJCA 2PF8A 4PRTA 3KRBA 4ICCX 4LB3A 2DUZA 3RX2A 4QX4A 2HV5A 3GHTA 4I5XA 4DBUA 2R9RA 1S1RA 2DV0A 4YVXA 2PDNA 1ZGDA 2PD5A 2NVCA 4JTCA 2HE5A 2IQ0A 5LIXX 2FZDA 1VP5A 4JQ3A 5LIUX 3N2TA 3BUVA 5AZ1A 3LQLA 1T40A 4XVDA 4GA8A 4IJRA 3UFYA 1JEZA 3RX4A 4WDUA 3NTYA 4HBKA 3R7MA 2IKGA 1IEIA 4ZFCA 3C3UA 2IQDA 4XO6A 4JQ1A 2PDYA 4IGSA 1EKOA 1EF3A 2FZ9A 4GQ0A 1HW6A 3CMFA 4JTAA 2C91A 4LB4A 4QR6A 2FZBA 3UWEA 4DZ5A 1Z8AA 4EXBA 3M4HA 3LEPA 4ASTA 4JTDA 4LBSA 1Q13A 3BV7A 3O0KA 2PDQA 3UYIA 1Z89A 4GACA 3GHUA 3R94A 2QXWA 2PDPA 4LBRA 4JQ2A 1LQAA 4JIRA 4JTRA 3LQGA 3R8GA 4PRRA 2PDFA 3O3RA 2PFHA 3R6IA 3V0UA 2PDXA 3V0SA 2PEVA 1EXBA 1MRQA 3CV6A 3GHSA 3UG8A 3N6QA 1MI3A 2PDMA 2PZNA 2HEJA 4R9OA 3QKZA 3CV7A 4LAUA 4WDXA 2AGTA 4GABA 2PDBA 2IPJA 3R8HA 5KETA 1Q5MA 5AZ0A 1C9WA 1MZRA 3R43A 4WDWA 5M2FX 2ISFA 3H7UA 4F40A 4G5DA 3LZ5A 4AUBA 1PZ0A 2A79A 4XZLX 4JIHA 2IKJA 1AZ1A 3D3FA 2HVOA 3MC5A 3B3DA 3Q65A 4EXAA 1S1PA 1S2CA 1YE6A 3UZXA 4Q3MA 4QBXA 1XF0A 2ACQA 4DBSA 3WBWA 2PDGA 4PMJA 4H7CA 3V0TA 1AH4A 1Z9AA 3M0IA 1AZ2A 4WEVX 3G5EA 4XO7A 3H7RA 3WG6A 1GVEA 5C7HA 5DANA 3U2CA 1X96A 4OTKA 4YU1A 4YVVA 3H4GA 1UR3M 2BGSA 1US0A 3ONBA 2PDWA 2NVDA 3LUTA 4GQGA 4XZMX 5HNUA 1AH0A 4JQAA 4YS1A 1RALA 2I16A 1R38A 2WZMA 3LENA 3CAQA 4FZIA 2PDUA 3LN3A 1YE4A 2IPFA 1QWKA 3DOPA 4FALA
chains in the Genus database with same CATH superfamily
1UR0A 3RNDA 4RV3A 4L56A 2XTKA 2VELA 1E4NA 3EWZA 3M9YA 3A5VA 3MWCA 3LPOA 4PUUA 1ZAIA 3TQVA 1E5NA 1JYXA 3APGA 2FGBA 3ARRA 2PDCA 4NQ1A 4YTUA 4JKLA 4QDWA 4YHGA 1GQLA 1U30A 3MQTA 1C29A 3VKJA 1E0WA 1OSEA 3TN6A 2DT2A 4JKKA 1QRQA 1RK6A 5A6JA 2XSXA 1Z41A 4FHAA 4AD2A 2C19A 3G3DA 1V0NA 2ISVA 4I8DA 1JJKA 2XIIA 3CTTA 3VZYA 2CBUA 3GW3A 1DHKA 5C7VA 4ZQOA 5K9DA 1K9FA 1FCBA 5DY2A 4HA0A 1YNQA 3BE7A 2FPTA 3W1TA 2QJJA 4E4UA 3VIPA 3QQ1A 1PAMA 1VAHA 1HGWA 2HNHA 1VR6A 1XICA 1T41A 5F2GA 1DJIA 4C6MA 2Y8VA 1YDOA 3FXGA 6XIAA 2PTXA 2R91A 3EWBX 2ZX7A 1QR7A 2VWTA 3MSDA 7XIMA 2GUBA 1E55A 3MSYA 1L6WA 4NX0A 2FZ8A 3OIHA 1XPGA 1Q45A 2I17A 3OBEA 1J2BA 1KCXA 1ZALA 1TZ9A 5G2IA 2FTWA 3TSBA 4BEUA 4AIOA 3ZLFA 3MI3A 3WD2A 4UQ9A 4LVBA 1C8VA 1OK4A 1SGJA 3DBPA 2GVLA 4RZ6A 3MUY1 1EYEA 1KM1A 1Q6EA 3DIPA 4BI5A 4XD5A 1R87A 1KW1A 1TKKA 1IF2A 3OGVA 2IMRA 3ITOA 3V5CA 1F73A 1HUVA 2VFGA 5IFPA 1ECEA 1JPIA 2E1WA 4RXFA 3CH0A 2ZRYA 5T91A 1C93A 1TPB1 4MYAA 3II1A 3HZ3A 2DZUA 3M44A 3VDBA 2A3AA 3RDKA 3VGDA 1DQXA 3LCGA 2A1YA 4JTUA 1NJJA 2V5LA 2A3EA 2C3ZA 2O9PA 3B4UA 3MYOA 2PE4A 3BAKA 4JAWA 4NI8A 3USZA 3QZEA 2OTDA 3ITTA 4C90A 1GUVA 2XIBA 3H2EA 2X1IA 1IWPA 1FDYA 4HP5A 4HPNA 1XFBA 4CNOA 4NNCA 4M6VA 1TV7A 3GM8A 4NZ1A 4JIEA 3NEHA 4IMEA 3SIZA 2OSXA 4DJED 4O0ZA 3CHFA 3SY5A 2KX9A 3VC5A 4EOUA 4B5TA 1KBLA 4NUWA 1RZMA 3U48A 3RMEA 4AXKA 2E67A 1VHCA 3G22A 3FIGA 5CC3A 4JFUA 1M65A 3PF3A 5G1YA 3EPOA 4UR7A 3S5OA 4C7FA 1IZKA 5F4XA 1UD5A 5A8MA 1F4HA 1YDVA 4LF1A 1REQA 1I2PA 3SFKA 2LLEA 1QW7A 1R0MA 4JN7A 3FGCB 4GVGA 3WUBA 3LNPA 1FP9A 1SO3A 5RUBA 2WQDA 3DI1A 3UPBA 4HPXA 3B97A 3PHAA 4ZO8A 2ZX8A 1V6XA 2VO5A 4H9UA 4GISA 5DT5A 3BPWA 4W9TA 2J77A 4C6DA 4GUFA 3WMBA 1S3TC 2PDQA 3ISIX 4PH6A 3W7LA 4O4WA 3AWOA 1DWGM 3QRHA 2VGIA 5JMUA 4A8NA 2E5CA 5I24A 2D0FA 5EMUA 2VR4A 1OFOA 4LUYA 4LCSA 8TIMA 3W29A 1RP8A 4Q22A 1J0KA 1TZZA 2PFHA 3V0UA 2PU1A 2CXEA 1TPVA 2VD9A 1RV8A 3E02A 1K1DA 1HVQA 2ZX5A 4WKHA 4XIMA 3OLEA 2ZZ4A 1SJBA 4GABA 4UFIA 1SFTA 1EJXC 2RUSA 1Q5MA 1JCJA 3F2BA 2DJLA 2F84A 1PO9A 3GU9A 2CLKA 3G1DA 3E0IA 3NPXA 1Y5VA 3G0XA 1V6VA 1PZ0A 2QHAA 4M1BA 3TR2A 1P43A 3INPA 3EGJA 1UQZA 1NQKA 2AKMA 5E9AA 3M5YA 2YDQA 1PCWA 1Q6RA 2GJXB 2DVUA 1NFGA 3NFUA 2ZTKA 4X22A 4M6QA 1VENA 4HYWA 2D2GA 1U1UA 2VM8A 2G96A 3W23A 3L4UA 1EOKA 1YTEA 1MSSA 4XO7A 4H6EA 4JTTA 3N11A 1GVEA 3IJ9A 3IJDA 3U2CA 4R5EA 4IMAA 3SQSA 3DX5A 1DJQA 3KBJA 3BMVA 4GQGA 4RE2A 3RLUA 4E38A 1GOKA 4P8WA 4JCMA 3AYRA 4LYPA 1V3KA 2CYGA 4IX0A 3UGVA 4XKMA 5AHNA 4GGHA 1QWKA 4L7ZA 3GXNA 4CNPA 3BICA 4JYDA 2G4FA 3EA1A 4UWMA 5LNUA 1GKRA 3DYPA 4R7WA 3LRKA 1W6TA 1BSIA 3B8TA 3OG2A 2EXOA 5HUPA 1GYNA 5AHFA 3F7JA 5JH2A 3WSUA 1Q6DA 1H41A 1IE7C 4F8XA 3CT7A 4DUXA 2QMKA 2WC7A 2EF9A 1J0ZA 5FJIA 3TUUA 1IV8A 1SJDA 1F05A 4LYQA 4CQ8A 5I77A 3CL8A 2WC3A 4JFTA 4DJEA 3KP0A 3W0KA 5AYBA 4KF1A 3DFPA 3TCEA 4MJMA 1KCZA 3DHPA 1PWMA 3NXFA 5BNKA 3PN8A 4L4MA 3AUJA 2RFGA 3PWGA 1XIFA 3QM3A 3ZJ7A 3WH7A 1QK2A 2FZMA 4NT0A 3V1HA 4WVXA 3DDMA 3BJFA 1LOSA 1TYGA 1PV8A 1JCLA 2GJLA 3L4TA 3WBAA 3CAKA 1EO7A 4DEFA 3TN3A 3B0YA 3QBUA 4M56A 2V5BA 5CPNA 5FJJA 2JIWA 4O13A 4AZ6A 1UUMA 4ZMGA 3QQWA 1W2PA 5HR6A 5TNVA 1B5TA 1H7XA 2HJPA 1RBOB 1WX0A 3CT2A 4S39A 4AY7A 1KGXA 3BW3A 3SUSA 1H7RA 2CXGA 3H2NA 3M1ZA 1QNRA 2RAGA 3PG8A 4RNJA 3BJSA 1PWLA 4Q7BA 1OG6A 4KERA 5CPQA 4ZL1A 3K8KA 3W70A 4X0NA 1WO2A 1PJ9A 4U2YA 1L6GA 4XVEA 3K4AA 4HA4A 4B5UA 2VQTA 4J3XA 5CSSA 4QRNA 5B80A 1E51A 1V0MA 1WXZA 4ZODA 3S9YA 5A8PA 1PZ1A 1QMLA 4W84A 1FWRA 2BGQA 2O9RA 1VBGA 5FJPA 1BGAA 1JUBA 2PRMA 2PODA 3GIYA 1G9HA 3UR7A 2P5NA 1Q65A 1X98A 1XYCA 3HG5A 5A1AA 1J18A 1PIIA 3EWXA 3AU2A 4DYEA 3BZJA 1TV8A 1CLVA 2QCDA 4P7NA 4L4PA 2FQIA 3WNNA 3BLFA 4YNGA 1JULA 1KRCC 4I9MA 4R3UA 3TYAA 3GNXA 4X2PA 2DH3A 3WLNA 1GHRA 1V3JA 2JIEA 5CZ0A 2HMCA 2VOMA 4BK9A 3CQJA 5D33A 5IRPA 1POJA 1BYAA 3AQUA 2DUZA 3NQDA 3RX2A 3A4WA 3S1WA 1X39A 3B05A 1V5XA 3HPZA 4DBUA 3VMPA 3WDHA 2J27A 5I6SA 2P50A 1S1RA 3TROA 3ANYA 1IR2A 4ACZA 4FOUA 4IT1A 1VP5A 2QCMA 1FHLA 3M0LA 4LS0A 1KM6A 3SCPA 1FCQA 2CHNA 3BLPX 3AIUA 3TW9A 3ZO9A 1ZU8A 4C6KA 1R2RA 5EMYA 2HXTA 4GXMA 3SUVA 2ATSA 1VKFA 1LOQA 3PNZA 1Y8BA 3RCNA 3GVVA 4I5RA 1MW2A 4HU8A 2IQDA 2D0GA 2PTDA 3CB3A 1UPPA 1LCOA 4BI7A 4NXKA 3DBNA 3NDOA 4KCWA 4O28A 3JR2A 3NSXA 2KZHA 4JY9A 4Q7NA 4JTAA 3MPGA 5A2AA 3UBPC 1CGXA 3GAKA 3WDPP 2A3HA 1JF6A 2DORA 1EO5A 3VI2A 6ALDA 4LY8A 4B4HA 1B0IA 4Q6JA 8CGTA 2EGZA 3M07A 3A5FA 2P0OA 2QXWA 1POKA 4V2XA 2J62A 2PDPA 2DZAA 1L6FA 4DQWA 4S3JA 4JIRA 4ILSA 1E0UA 4H00A 4GNJA 5IBXC 1DIOA 1UROA 4ECLA 2E09A 3R6IA 3KRSA 3TW7A 4ACYA 1PHWA 3LHWA 4W7WA 4PMDA 3QXBA 4YJ5A 2HEJA 3WJXA 4D6JA 4L4LA 4ZOEA 4L6OA 4P61A 1FKWA 1V02E 5M03A 5D9PA 4GIAA 1OWQA 3M6DA 2AGTA 4UTLA 3RITA 2QDGA 2VZOA 1QATA 4Q8VA 2YCIX 5A8GA 4PBGA 1BTCA 1GOXA 1R3VA 3VKAA 3QFWA 3NVDA 1G5AA 5XIAA 4PB4A 3WH5A 1GQIA 4DPPA 1CXFA 2O0TA 1UOKA 2CU0A 4L9ZA 1UUOA 4GUIA 4ZXLA 1A50A 2XU2A 2HVOA 1OT1A 3N17A 3WLPA 3FYPA 3O6YX 3RN6A 1R9ZA 1M7XA 4F2TA 3CL7A 2I56A 3UXLA 3W7KA 2ACQA 1UZHA 2AAAA 4CQBA 3URAA 4O1BA 1Z9AA 4GE8A 4DBDA 2OX1A 3K1GA 1ISVA 5GQBA 4HPHA 3G5EA 5CZKA 1RR2A 1WPCA 2NT0A 3VA8A 5KEZA 1KFEA 1VPYA 1UR3M 4UQEA 4GCXA 2X40A 5FJUA 5DMYA 1H7PA 2YLAA 4CD8A 1JDAA 3C6CA 3LXAA 3AMLA 4JQAA 4S3GA 1V7AA 2D3NA 1D3CA 1NU5A 2Y5EA 3VOGA 5CLTA 1XIHA 5FEWA 1WUFA 3IGSA 1PBGA 1D3HA 5TBOA 3MVIA 2ZA1A 1JAKA 1SR0A 3H2CA 4MB5A 1LRNA 1V3LA 1XGZA 2OMAA 4Z1YA 2GSHA 5BU6A 4R27A 3HFTA 4M82A 1AL8A 3U8GA 4MUZA 3MTWA 1OX6A 4RX0A 1VYSX 5ECVA 3AHTA 2E3ZA 3KS5A 3EDEA 2CLOA 3LMYA 2GWGA 5C0QA 3D47A 4JTQA 4AWEA 2HDJA 2VWSA 4UTUA 2WBKA 5AB3A 1HO4A 4KEMA 4N2YA 2P3ZA 3CQKA 5E6YA 1P6CA 2JKAA 3VZZA 1TIMA 3AXXA 5H2ZA 1TX0A 4C91A 4MY9A 3Q37A 5KZDA 3NQEA 4WD0A 4DBWA 4XAPA 2O56A 3WENA 2C18A 4DYJA 2OWXA 4LAOA 3VK5A 2X05A 2ACRA 2HK1A 2EJAA 2PDJA 3O15A 4WKFA 1P4CA 3VMNA 3AXKA 4MUPA 3PUDA 1LLZA 4PFMA 5AKQA 3QZAA 1NQ6A 1VFOA 1UQYA 2ZUSA 1QO2A 3LTSA 4GPNA 4IMCA 2ZRZA 4J3WA 4D6CA 3ZZ1A 4NNBA 3FYYA 1TRIA 4QQUA 2CLLA 1JDFA 7PTDA 4S1FA 4HHPA 2NLYA 3S5NA 1X38A 4S2CA 4LRSA 3GXFA 1DIEA 5CJNA 2Y62A 1QNQA 4OUEA 4XBKA 5LIYX 1OGSA 1JNDA 4TV6A 5C2GA 1RHCA 1T5AA 2OQLA 2VFFA 4LU0A 5DEZA 4RDVA 1Y65A 4PL1A 3BK0A 2EPHA 1XCFA 3UJ2A 1K6WA 1IZCA 3GDRA 1A5KC 3PTKA 3E0WA 3N12A 3TCSA 3AIEA 2H6RA 4FOKA 2VUYA 3R8RA 1ZUAX 3ZOAA 2O92A 3FAXA 4JTKA 3VDCA 1ZTVA 4N4PA 3LCLA 4IJCA 3OGSA 5FKYA 1CXEA 3QTPA 4MYXA 2R1MA 5DO8A 3ZT7A 3V5OA 3D46A 2PBOA 2FZNA 1TR9A 1H4PA 5JBEA 4GVFA 1QPRA 3QH2A 3P84A 4A3RA 3L2IA 3REQB 2VFHA 1KKRA 2WM0A 3TC6A 2HE5A 3ZR6A 3NGJA 1PX8A 2WW5A 4OGZA 3KBNA 3BUVA 2OX4A 4G1NA 3CBWA 4HOZA 1CXKA 3N3TA 4UFLA 1LDCA 1T40A 1DHPA 1SW0A 4AHOA 4LC6A 1CLKA 3MS8A 3LHUA 2WHLA 4K38A 1I1XA 3OVPA 4IMGA 1JDCA 3HBLA 3EOEA 3MY9A 4UNIA 4XZBA 4DELA 1BWVA 1TR1A 3RHGA 3CM4A 4Y9AA 1X7IA 4GY0A 2WHMA 1ODZA 1OZQA 1SMDA 1QW8A 5EKYA 1V3IA 3W02A 1UCWA 4GQ0A 2PURA 4MJ4A 1XDJA 3B9NA 2SFPA 4GKTA 7ENLA 1PKMA 3KTCA 2QVHA 1C9DA 1EJRC 1Q13A 3W1PA 4HMCA 1E40A 5H8MA 1G4TA 4ZSTA 4UFJA 4L80A 5I02A 1HTIA 1WDRA 2OPJA 3PM6A 2NQJA 4QROA 2VOTA 3MKVA 3W27A 3MMWA 5F2LA 4QCEA 1BG9A 2EG6A 2PDFA 4DF2A 1TTQA 5D37A 3SQMA 4H9TA 3SDOA 1LF1A 5D8WA 3UWUA 4F48A 3PPGA 2VCBA 2HS8A 3N6QA 3N04A 2E9MA 4JNZA 2Z0IA 2YA0A 1O6IA 1DJNA 1GG0A 3LHTA 4F0LA 3BCFA 4E3VA 3GDLA 1WDPA 2EPOA 3EOSA 1RJQA 4XX6A 4K37A 1XLJA 4BQ2A 4ADTA 1LWJA 3VNYA 4KCUA 1KD0A 2WANA 2FFCA 4IMDA 4IJBA 1CGVA 2F2HA 2DY3A 2GGJA 4ZVJA 1RBAA 4GX8A 5DQPA 1V02A 4FMVA 4H9ZA 2V30A 2V3FA 4G5DA 3LS9A 2YYUA 5KZEA 1VJZA 5EFDA 3A4JA 3ZVHB 2YCKX 3W87A 2B7QA 3I3DA 4Z2LA 1OEPA 1A5AA 1Q6QA 2A7PA 1KC7A 1SO5A 1KB3A 2ZFAA 3HV8A 3IIXA 1UP3A 4PMJA 1MEWA 3SCNA 4PCPA 2PA6A 4UNKA 3AS3A 3G24A 4IP4A 3MKCA 4G6CA 2JFEX 3NJ3A 2G8ZA 2O7SA 3E6EA 3RPDA 4CLMA 3O07A 1XRVA 4B9ZA 3VGFA 1R3QA 1EWEA 1PEZA 4HQVA 1F6KA 2X16A 1DTUA 4LAMA 4FB7A 3WLOA 2ZADA 1EJTC 1GHSA 3E12A 3UPWA 4IP7A 2I16A 3C0SA 1R38A 1B30A 1B3XA 4U2ZA 3CAQA 3UEQA 5AYIA 3MT1A 1KXQA 1SPQA 1YE4A 3OW1A 1ISWA 1UIOA 3CH9A 4FALA 1AVAA 4HZ7A 3IVSA 2XH0A 1G01A 3OHMB 3W86A 2BGNE 4IXXA 1RVGA 4ERGA 1DOSA 4GQQA 1KBIA 4LX4A 1ZSXA 1VHNA 4HU3A 1KM5A 3YPIA 1EC8A 2ZUWA 3C2FA 1VEOA 2PTYA 4B4FA 4I6VA 2ZXQA 3GU1A 3HMCA 2JF7A 1MO0A 3L2MA 3BURA 2WMIB 4GHRA 2YR1A 3W76A 2NWSA 3DKJA 3UG5A 1LG1A 2MANA 3WK3A 3B04A 3E0FA 2QDDA 4NJJA 4C6PA 3CAVA 1EDGA 2OQHA 3BMXA 1TV5A 3IUHA 4JTSA 4Z2KA 1XRFA 3RJXA 4O57A 1P6BA 2JEQA 4IIDA 4P7LA 1TIWA 3O06A 4GC3A 2G3FA 4KRUA 4JTFA 2CBVA 2V9DA 1UHVA 2NX9A 4NASA 3TAOA 4ZO9A 1TJPA 3WIJA 1RP9A 2Z1SA 1M9HA 1RH9A 2MUCA 1RD6A 3OIXA 3GH4A 4IGMA 3LTYA 3H21A 3T0CA 1ME7A 3NOYA 3LD5A 4U10A 1PIGA 1TCDA 2ZKMX 1XM3A 2FPYA 3GFXA 4IIEA 4BQ5A 2XN1A 4YMZA 2CPUA 4GUHA 5A6AA 3VAVA 3SJ3A 3WJZA 4EF9A 1DL3A 1NDWA 3S83A 1J4EA 4AF0B 3TC3A 1AA1B 1KTNA 1BSLA 1A3XA 1PKNA 4NY2A 4L65A 2VVNA 3SURA 1WP6A 2PTZA 4JEJA 5D9NA 2HTMA 5HQMA 4AISA 1VBJA 3T2OA 1W3HA 2QCLA 4J2PA 2A6LA 5K3VA 2GJXA 1FA2A 3FN9A 2DGAA 1VLIA 3P82A 1DTNA 3C5QA 5FF3A 2BY1A 2YGYA 2GQAA 1KFCA 3GVRA 4I9JA 3VUPA 2OEMA 2QCHA 2TODA 4J4KA 5DRCA 4AVFA 3TWBA 3KTXA 1X97A 3HPXA 1HJQA 2QCCA 4DO4A 3A4XA 1JCTA 3COTA 1GKPA 2DSWA 3TLQA 3N2BA 5F2IA 1QCWA 3UZWA 2G0WA 1GQKA 3CQIA 3N13A 4KGLA 4ZO7A 4WOQA 2XSBA 4JNMA 3C2OA 2C71A 4DUOA 2J25A 3TLLA 3P62A 1R30A 3N9SA 4H9YA 5I5RA 4ICCX 1PX3A 2WK2A 1DEDA 1W3IA 4HK5A 5D8ZA 1KV5A 1CW2A 2ZUTA 3DECA 2W79A 3TYDA 4Z42C 3K8LA 3T55A 3NVTA 4AZBA 4V28A 5AFDA 3N6HA 1HVXA 4YVXA 5A2CA 5F4SA 4JICA 1EDQA 2WSKA 4GOAA 4CD7A 3ZS4A 5LIXX 1FXPA 2QIWA 1EBGA 3P7YA 4J5NA 2ON3A 1C7SA 3MV11 4GA8A 2ISDA 3WNMA 4PTMA 3RX4A 2YCLB 2FVKA 1DXFA 1YPXA 3LLFA 1B3YA 3N9KA 3LLDA 5FD0A 1UD6A 1CNVA 1E15A 4XV0A 2CNCA 4RJEA 2ZWZA 4IX2A 3FOKA 3MWAA 3MCOA 4DX3A 2F9RA 4JR5A 3N4EA 5JIPA 3W1LA 3VE7A 2GQ3A 3CMFA 4QCFA 1XLMA 3UWEA 4K8GA 3IV8A 1UG6A 4IGNA 1E4LA 2P76A 3T6CA 4QE1A 3VOIA 2OEJA 3GKAA 4G7EA 3VABA 2ANUA 1GVSA 4DXVA 4AC7C 4NZJA 3CLWA 2VKZG 3ZXWA 2VZUA 4AMAA 3AXIA 1W56A 3WH8A 2PTWA 4LBRA 4LANA 4QS6A 5AHIA 2VX5A 2OQYA 3DESA 3TK7A 2I9UA 4WJ8A 3WF0A 3FEQA 4NSBA 1P0BA 1UC4A 1IYXA 2QAPA 2QLYA 3EPMA 2ZE3A 3WZ0E 4LY4A 2OO0A 5A6TC 4WDXA 1BHGA 3KVLA 4UTKA 4ORMA 4CCCA 1OD0A 3VKKA 1ZZMA 2OLHA 4DO6A 2DZVA 1GQJA 4P8XA 5A6KA 3LGEA 1MZRA 2OCZA 5AHLA 1C90A 1TA3B 1X6UA 1IXNA 3TSDA 3CNYA 4GH3A 5BOFA 3PBYA 5BWFA 4DJFC 3R79A 4XWUA 4U4MA 4I7UA 3PY2A 3G1SA 2PC8A 4FXJA 3F2DA 3QC0A 3UQNA 2XIMA 3IS4A 3JZUA 4UMCA 1OGGA 2ZDSA 3O16A 3M0XA 4D71A 4FLRA 3MUAA 3QYSA 3K1DA 5KZMA 4Q4PA 3BLKA 1Z32X 1BFNA 2P53A 3UNTA 5LSMA 2J7FA 5D05A 1F4AA 1XYFA 1ZBWA 3PWIA 1TPDA 3S2JA 1FWIC 4FK9A 4Q8OA 3EB2A 3BOXA 4YU1A 3T78A 1GJPA 4YVVA 4C6JA 1DJYA 1N7KA 3N25A 3QHNA 4DM1A 1UMYA 1WZAA 4XZMX 5ABTA 3BGJA 3S2MA 1GTEA 1S2VA 4XIAA 2WLZA 3GD6A 4YCOA 2OWCA 3LENA 1O60A 1ZBKA 1UBPC 1KXVA 4C1NA 2ZTJA 3EEZA 1FWTA 3DC0A 1V51A 2GWNA 5BXSA 3I7SA 3AYVA 4PCTA 2C1HA 3VNIA 2R14A 2PMQA 4H4IA 2G3JA 1B4KA 1C7TA 3LXBA 3RM9A 1D9EA 3CXOA 4YXGA 4KQNA 4GY7A 3W7CA 3KBSA 1XRTA 4QQ3A 3HJEA 2NX3A 3UZYA 4A3UA 1XJBA 1NFPA 4HMNA 1E4MM 4QG6A 4XUGA 1R47A 1UC5A 5BCAA 2WYSA 1J6OA 5JUVA 3UVAA 1W3KA 5F7UA 3KE0A 3HFYA 4KETA 3CAWA 5DLCA 2REQB 1IHIA 1EJWC 2FB3A 3GRIA 4E8DA 2FYMA 2OR2A 1FFRA 1RAKA 3AZTA 3WUGA 4WQ6A 1FWWA 2A5HA 2HQAA 1YW1A 2J7CA 4EWJA 2BXZA 5EMKA 3NL6A 4W93A 3T0AA 1B57A 2F38A 1OINA 2QR6A 5DFAA 2XN0A 3M5XA 3ES7A 2J7EA 2BB0A 3GR4A 2C15A 3DUGA 5FACA 4B5XA 4DF0A 4ZOCA 1DXEA 3QV8A 4R7JA 2IPWA 1MW3A 1ALDA 3H4XA 2DEPA 4Z2JA 1MEIA 3ITVA 5AVNA 4OT7A 2CBJA 1Q7QA 3KCJA 2OFJA 5I06A 4RDWA 3BOFA 1V93A 1VD6A 4S3KA 5A2BA 2NLIA 1ODUA 6TIMA 3LDVA 4WXYA 2RJHA 4MB3A 4B3KA 4RNFA 5JH1A 2GQ8A 4AD4A 2YFNA 1H0IA 2HVNA 3SIMA 2PB1A 2P1FA 2VXNA 4BA0A 3TSMA 5LNRA 2BOEX 4E2BA 2NXIA 4RPPA 4RUBA 3KL0A 4J28A 5IHRA 2JQXA 2XJ7A 2ZZ2A 3FJ4A 3W73A 2WMGA 1LT7A 5K2ZA 4ZQNA 3U4FA 3ZJ8A 4GBDA 3PJUA 4XTDA 1NOWA 2DFAA 1TVPA 3OU8A 4IIFA 5CGMA 3T1GA 1BRLA 1R6WA 4HD5A 2R24A 4HNCA 1C92A 4UFMA 4JN6A 2EO7A 3FVDA 1ME8A 1KBJA 1XKJA 3VNLA 4UOQA 1J0YA 2WXDM 3VX0A 1NOFA 1L0PA 1TZ7A 5LNVA 3TJXA 1W37A 3H7VA 4FEZA 4I90A 4H83A 5BRBA 5EY5A 4IG2A 4DWSD 4FOJA 3WFZA 4AIBA 3BSGA 2Y63A 2I14A 3UNDA 1BD0A 2CLHA 4UTIA 1RK5A 1A49A 2Q8ZA 4B90A 4IQLA 3WEOA 2W5FA 4I5XA 3IGUA 1S3HA 2QVNA 1YKWA 4QISA 1KGWA 4Q32A 1I60A 3NUKA 4WIWA 1FKXA 2W63A 1H7NA 1JCMP 1M7PA 4QG9A 2FZDA 2E5DA 2B31A 4QLKA 3WJYA 1QPNA 1UKSA 1LRTA 1MFVA 5AZ1A 1UH3A 1XC6A 3NQBA 3KLKA 4M81A 4B5WA 1BXCA 5DCDA 1SSDA 1E3ZA 4WDUA 3HGRA 4HBKA 1LLOA 2WKLA 1L8NA 3HV9A 3OJGA 1IEIA 1MUWA 1TV3A 4Y96A 4ZFCA 5BXTA 3SCTA 3S5YA 3VNDA 2V81A 3WEMA 2VGBA 2TSYA 3QTGA 2A3LA 4L5ZA 5FEXA 1RLDA 3KRZA 5BW6A 1R2SA 1K4GA 3UY7A 1PTDA 5ABFB 1LG2A 3B9AA 3MKKA 4JTDA 4QJ3B 3MUZ1 2CZDA 3MBDA 5K4ZA 3PBUA 3UYIA 1Z89A 2E1DA 1O12A 4CEXC 4GACA 2WMJA 2VC6A 1OK6A 4YTQA 1ZB5A 3HQ1A 3P6LA 4XSLA 1FXQA 4H6KA 2XIJA 4RKAA 4JS3A 3ZYZA 5B7ZA 5LHFA 3ITLA 1TG7A 1VJSA 3JU2A 3LCXA 4EP8C 3QHOA 1FP8A 3ABXA 3GB6A 2YIHA 2GGEA 4JYFA 5A6BD 4A8LA 1MI3A 3UA3A 3P93A 5BWAA 1PE1A 4BZYA 4HA3A 1W1IE 3CC1A 2FHCA 5IHSA 4FLOA 3DFSA 3FA4A 2ZBTA 4DYKA 4MMWA 2ZVRA 4XZ9A 2XWDA 3V5FA 1H7WA 3CO4A 2R94A 3QMRA 3TTYA 3ZMRA 1UKOA 3BSHA 2ZZ5A 1ONEA 4POCA 4LEQA 2G37A 2VFDA 2YJQA 2WVTA 2PWUA 2CKRA 2GZXA 1ZP3A 3RCMA 5ENLA 4AQLA 5HUOA 3STFA 1NVMA 3MP5A 3GTXA 3NQ6A 2DZSA 3DERA 1YPFA 3T09A 5TQLA 1N8FA 3OLDA 6ENLA 5E5CA 5HBFA 2Y85A 1W5OA 4NAEB 5C6MA 2DSVA 1H62A 3EEGA 5DN1A 5EA9A 1E1EA 4AXNA 3RRXA 1JXKA 5A6MA 1DXIA 4REQA 1K4HA 2Q3OA 3B4YA 4ZQCA 3MMDA 4DB7A 3F4NA 1O5XA 3BAJA 4LV4A 1R3WA 3CZGA 2JEPA 4ZOAA 3BZGA 1OT2A 2E8YA 3H4GA 3KW3A 2BGSA 1US0A 1XLLA 2ZDRA 5KSWA 3RLHA 3EYPA 3MJYA 7REQB 4FI4A 4OHQA 2DSZA 3IVUA 1FH7A 3VUSA 4Q6XA 3JZEA 1OC6A 3LN3A 2Y7EA 1BF2A 3IRDA 4H01A 1XCWA 3CYJA 1XIBA 1HO1A 3O05A 4LUSB 4HSOA 2WVVA 4Z08A 3DHDA 3T8QA 1GOIA 1XLEA 4O1DA 1L6YA 4NKCA 3AUOA 2PWEA 1OFBA 2Y89A 4PFHA 2A2IA 2NT1A 3LMZA 2GDUA 4DWSA 3H4WA 3L9CA 4KIEA 3N34A 4KW2A 2HPIA 4MWAD 2X7VA 4D8LA 2VHLA 2BY0A 4JCLA 4HK7A 4HNLA 4UMBA 3DG3A 5ECUA 3UWQA 5I7GA 1PKYA 1SJCA 1A5CA 4AYGA 1MXDA 1J93A 3AHXA 5G5IA 3R0UA 1EIBA 3GC4A 2WKJA 3TXZA 4ADUA 3B8VA 3WF2A 1W5MA 1XYAA 1SZRA 4RCXA 3SY8A 1IIGA 3TJIA 4LYKA 4Y6GA 6XIMA 2VRQA 4M24A 1B9ZA 3LNMA 3AS1A 1HN1A 1OX4B 4YLWA 1VEPA 3EKZA 1MQQA 3UXDA 3C8FA 1MYRA 4PODA 1UASA 4NYUA 3MZ2A 3G1YA 3WH9A 2WSRA 1AL7A 5HAOA 3EDDA 4E2OA 3UR2A 1W54A 2ZXAA 1Q7MA 2Z4GA 3NZRA 2I57A 4GGBA 4IF2A 2WZHA 1EDTA 3R2GA 3RPTA 4HJWA 1QDSA 1DP0A 1ONXA 3W7RA 4EXQA 4O1AA 4F9DA 3PZIA 4PUEA 3PJXA 2J9XA 6A3HA 3QN3A 2PDLA 3VKCA 4ATLA 3QY7A 2D73A 3BLDA 3Q2DA 1K7XA 2QCNA 1F76A 3S9ZA 2R1NA 2VFIA 4GIEA 1JPHA 3V36A 2WOQA 3THDA 3JS3A 3RX3A 1X7FA 1GYLA 1FVPA 4F3HA 4MKVA 4TQTA 1XDMA 3ID7A 4H8VA 4KWOA 3DCPA 1JAEA 5FSEC 1CECA 4N0RA 3RLGA 3SCUA 2E4TA 4L1XA 4HVXA 4IOTA 1QNOA 5A6BA 3OHIA 1WDQA 3IJLA 3J7HA 3CPGA 1E9YB 4FXFA 3AICA 3L21A 4X0VA 1P7TB 1A4MA 2OVLA 2GUYA 3L2LA 2VTFA 3T0TA 1QBAA 4DPQA 2PRLA 4AD5A 4Z1AA 1XBVA 4S3BA 1M41A 3TH6A 5E09A 3LHZA 1LUCA 4GJJA 4M80A 2PF8A 1VS1A 2P0IA 5HMSA 2E68A 1SSGA 3SUUA 3WQDA 1XG3A 2Z2UA 3W72A 1L2UA 1QWGA 4X2RA 2ISWA 1FUYA 4PC8A 4D1IA 4Y2WA 3FXYA 1OHLA 2PUZA 3UXAA 4LVGA 1OYCA 2WMIA 3AIQA 4ERAA 4KKXA 3PJWA 3OOQA 3GNPA 4DAIA 1KA9F 3LQLA 3V3WA 3QGKC 3FSUA 2AQWA 5T26A 4IJRA 1OBAA 1XL9A 4KIRA 4UCFA 4HT3A 3W7PA 1TFVA 1KBBA 3GKFA 4GYJA 2HROA 1HF6A 2QKFA 4JL1A 2YZRA 3UG3A 1VC4A 3AROA 2VCAA 1VCGA 2CZEA 3PZGA 4C7GA 4RL3A 4CN6A 3HO8A 1EF3A 5U4NA 9CGTA 1K7EA 3VYLA 3SUWA 3VIFA 1E6RA 1F2JA 3O1NA 4JXCA 3N9RA 2GGHA 4XQ6A 3SI9A 3BV7A 3HQPA 4ZA0A 5IOBA 1P0DA 4MZ1A 1FOBA 3QV9A 1EPXA 4D6EA 4IXHA 1I2NA 4MWAA 1QPOA 2W92A 1FWDC 2POZA 3O3RA 4M19A 1WUEA 2VUNA 1YBQA 1KTBA 5I2UA 2JF6A 1KXHA 1XI3A 4J40A 1J12A 3CV6A 3EDFA 1XRSA 4DJFD 1OFEA 2PDMA 3DU0A 5MKGA 1JDDA 4UTMA 2JK2A 3EA2A 2GL5A 2DT0A 1ZLPA 4ONVA 3TZFA 1F3WA 3WK1A 8RUCA 3K30A 4XAYA 1AK5A 2PDBA 4GG9A 4W85A 2GJRA 1EBHA 4XTIA 4UTTC 4QTGA 1WB0A 1AW1A 3MA8A 3E49A 3W7QA 2NQ9A 4UR8A 4DUVA 1QHPA 3CQ0A 3GG1A 4AUBA 4D6IA 2HZGA 4E6MA 4JIHA 1QOQA 3CUIA 1UWSA 2PBGA 2WCAA 3C56A 4OQVA 4GYFA 1CENA 4AHPA 2X2YA 2EQDA 3DFNA 1OIMA 4MAVA 2HVMA 3HN3A 2BHUA 4JZ5A 3LCIA 1TCMA 6PTDA 2WHKA 3B0XA 5D02A 3MDUA 1AZ2A 3BAIA 2QQ6A 5BROA 3HG2A 3TDFA 3WD4A 1VIZA 3TN4A 3LBMA 2X2GA 3WG6A 3NZGA 2R1LA 2GGGA 2Z6JA 4AWTA 5DANA 4UQAA 3UXIA 1JRCA 3NPUA 5GJMA 4CVWA 4ZB0A 4GC4A 2BX7A 4BF7A 4HJFA 3ALFA 2ZZ7A 1VF8A 3W1UA 2CITA 1UH4A 3E2QA 2X1RA 4UMAA 1NEYA 3MHFA 1N8WA 4O50A 3Q58A 1JZ3A 1XYLA 3RU8X 2FGLA 2FTYA 2W3ZA 2WJZA 2OEKA 2BBFA 4CCZA 3WQOA 3W7GA 3EAUA 4MY1A 2Z29A 1A0EA 5IDIA 4Y7EA 3BANA 1V4YA 2XHYA 3MV01 2W4XA 1IXQA 4S3AA 1DJHA 3QZ6A 2OZTA 4EPDC 4R34A 1W31A 3WL1A 3W37A 2J79A 3NPWA 4OUIA 1VJIA 2CERA 2ADAA 1AD1A 4D8AA 5D2WA 4N9EA 2QF7A 2F6XA 4PTDA 3AJ7A 5CGTA 1TPFA 3M0VA 5GJPA 3N14A 2IPGA 4AG0A 3OP2A 1TWWA 1IIHA 1XXXA 3M5ZA 3SCRA 2OOFA 1W3JA 3URBA 3I6RA 3P81A 2GK1B 4AW7A 2A21A 5GVJA 2PLJA 4XKYB 3LY0A 1Z3NA 4NVTA 3NM1A 4JQ4A 1OVDA 3N18A 4YL2A 4R53A 3GIPA 4HGXA 3KM8A 2HS6A 1KM4A 2V3DA 1OZMA 1H3GA 4PTXA 3T42A 3OEXA 2QUVA 3HA1A 5FJRA 3W1MA 3CEPA 4HPGA 1LL4A 5XIMA 3WQ5A 1QNSA 1H5YA 2D23A 3KOZA 3VIJA 4CD5A 3KCLA 1NF0A 2Z2BA 4AZCB 1SW3A 2E77A 2VD8A 2WMFA 4LH8A 3M64A 4JTLA 4PMYA 3KL3A 1E6PA 1L8PA 3UZ5A 5BYWA 2NSXA 2W67A 3ARPA 3SR7A 1UD3A 2DQXA 2NQHA 1H7OA 4CU7A 2GSJA 3KVJA 3I4KA 5AYXA 4RLIA 3VNKA 2VL4A 4AX6A 4O15A 1RSCA 5H8PA 3GTHA 1QI5A 1TTJA 4Q33A 2ESCA 3UCQA 3EWWA 1KLZA 3UWWA 3AIBA 5AECA 3RF9A 3CO8A 1XQLA 3G1HA 4DJFA 1TVNA 7TIMA 3RLVA 4W8BA 3M0KA 2Y8UA 2D24A 2XPKA 3PFMA 3E5BA 2PGEA 3FW6A 2GVGA 1THFD 2J75A 2VDIA 1NH6A 1SU5A 4OE7A 4XAGA 4H9VA 1KTCA 3N4FA 3KVMA 1Z48A 2QJNA 1IR1A 2RKXA 4ATWA 2BTMA 5D4YA 4BQ3A 1XYMA 1UR2A 3WY1A 4PRTA 3S5ZA 1E6XM 2IXUA 4OBTA 1WZLA 4LB3A 2NX1A 1PTAA 1TWZA 4I9TA 3RAOA 1JNEA 2XN2A 4LUTB 4CVUA 3CZJA 2HV5A 4K3ZA 5BRPA 5K7JA 1Z69A 2EPKX 2FJUB 3ARQA 2VYOA 1UWUA 2PD5A 3OZMA 1LORA 4OZOA 1UD4A 3ARZA 4UFKA 5A6LA 1EP2A 4KCVA 1R85A 1CDGA 1A5NC 2YKKA 4MZ8A 2DJXA 3MU7A 2DW6A 4ZTXA 4QITA 3THAA 3U7BA 2NVAA 2PWFA 1IT8A 3ICJA 3WJWA 2UY3A 4ZE4A 3BSMA 1CBGA 1QNPA 2GOKA 2FFIA 3I65A 4E0CA 3E0LA 3C3UA 3BG3A 2EPNA 3TC7A 2QPSA 2QV4A 1VCFA 1I1WA 4E5TA 2FZ9A 3EXSA 3NDYA 3UJSA 3L0GA 3K4WA 3M4HA 2V8ZA 3H70A 3FV9A 4ASTA 3JRKA 4LOCA 3SUTA 3N2XA 3H54A 2YBTA 5CBIA 4ICMA 3W71A 4UUIA 1GZ1A 4WCJA 4K8EA 5HMFA 2NUXA 2XGBA 5CPLA 4TTGA 4MFDA 3CZLA 3WN6A 4JTRA 3LTPA 2VRKA 1YDNA 1UH2A 4PRRA 2PRHA 3CZEA 4NAFB 1I75A 2CESA 1XC4A 2ZRWA 2BSLA 3GAYA 3R13A 2FB2A 4X9SA 3URQA 1I2RA 1JR1A 3F03K 1UJPA 3ARYA 3SGGA 1M5WA 4QG8A 3G6LA 5E0CA 3VIGA 3XIMA 4KMQA 5DMNA 3QR1A 1ZCOA 5I78A 3W3OA 4WZHA 3WNKA 3ITGA 1W1TA 3JVAA 4QDPA 5SWUA 1UD8A 2JGQA 4GI6A 2YL6A 3RYSA 3PTDA 1OQFA 4S23A 2GSEA 1IGSA 2A79A 2BY2A 5FESA 4GZIA 3BLOA 4LYRA 3VGBA 2WAGA 1JFXA 4GRSA 2EAWA 1QTWA 4ZZ9A 2QUUA 3IK4A 2X1TA 3W7DA 4N4QA 1SZFA 3QJAA 3ATYA 1G4EA 1FWNA 2ZZ1A 3T40A 1W1ZA 1VFUA 1AH4A 4LUJA 4XSMA 3BO9A 3EZ4A 4D6FA 4WEVX 4QAWA 3H7RA 1NSJA 1K9EA 4W8LA 4EWND 1M7OA 1TWIA 4MPKA 3TYCA 1NOUA 4KEZA 1E0VA 1DQWA 1XBZA 3QPYA 3QPZA 1DYSA 2OZ8A 4IHCA 5C71A 5EMLA 2ZOXA 2G50A 3FA5A 3OG3A 2NV2A 4I7WA 3WQCA 1WOAA 3E2SA 1XFCA 4V1XA 5A5WA 6REQA 1G7UA 2CC0A 4C6FA 4FNSA 1RA5A 2GUUA 2VENA 4A29A 3RM8A 1C8YA 4MLJA 2HE8A 3TIMA 4TX8A 4PL2A 4BR1A 3PZMA 1CZ1A 3WBEA 3VD7A 4NHVA 4C6LA 4LV9A 1DORA 3M0JA 1BVNP 5F2MA 4NZ3A 2H3DA 4WRHA 4B92A 2OYMA 4ICNA 1A5MC 4C6QA 2V2HA 1XD0A 3D6NA 4S2BA 3T81A 1G4SA 4O1EA 5FAGA 3GDTA 3DENA 1GNXA 3GNOA 3W83A 1AMYA 3W07A 1PYFA 4RZBA 1TV2A 5LHEA 4GJIA 2VGFA 1ISZA 5DY3A 4QFUA 4IPIA 2QUMA 2HISA 1J9YA 3ARSA 3C2RA 4NF7A 3IJ7A 1K9TA 3WEZA 3FDKA 3CUGA 3DFHA 3TV8A 1OCNA 2HXUA 4JDYA 3GLCA 3FLUA 4ZSUA 3F2CA 2QJMA 1YXYA 2GVEA 4MIMA 3EB4A 4QHRA 3S5SA 4HIBA 4MZYA 3IVTA 5G2HA 3NA8A 4FXRA 1O7AA 7A3HA 2YL5A 1W1B1 2VC5A 3ITCA 3TVAA 3UJRA 4ZR8A 2DIKA 3A3XA 1AH3A 2OELA 1KFLA 2OOGA 2ATMA 2PP3A 4QM1A 5I00A 3G1XA 1E6NA 1ITQA 1OF6A 5M1TA 2J8TA 4OBSA 4L6DA 2J47A 2AL1A 1YDYA 3UPMA 4H8UA 1HGYA 1E6QM 1F6PA 1NDYA 2QUNA 1W0MA 2QJGA 1BLIA 3WCZA 1JFHA 4QJ4B 3CUXA 2VI0A 5IXEA 1NWSA 2TYSA 1E71M 4GVHA 3W01A 4KWWA 1CCWB 2GGIA 4B5VA 1K7FA 2Z7GA 3CV1A 1D2KA 2GDVA 1V6TA 4GI4A 4EE9A 3CUFA 4L4OA 2PWDA 1XPYA 3QY8A 2HBXA 1W5PA 3TTEA 2JE8A 3S1VA 5A95A 1XX1A 1HFBA 1J79A 3VGGA 4GI8A 2ACSA 4QP0A 2W91A 1UPMB 3LSCA 3WDIA 4ML9A 4O10A 3VMOA 4C6EA 1REQB 2WMKA 1QJWA 3GYCA 3PBMA 3BH4A 1M7JA 1WBJA 2QGHA 2XH7A 4DLFA 1VBHA 4AFYA 1N82A 1PSCA 1VFMA 2Z1KA 4JX6A 2F6UA 5H8UA 3VCCA 3T07A 2EHHA 1OM0A 3S6TA 3SRDA 1GTHA 3KVKA 2R9RA 1TMHA 3N2OA 4HZMA 1UR4A 4GUGA 4B3LA 5AOUA 1V0LA 3IEBA 4JQ3A 3GVGA 3VE9A 2NSOA 3S46A 2O55A 4ZQRA 2BWGA 4XVDA 2G3MA 2ODOA 3SRFA 1XG4A 4NJGA 4LBUA 3T9PA 3GNRA 1FWSA 3WF4A 4YCPA 3ARVA 4IGHA 1F5ZA 2EG7A 4R7OA 2D2OA 2QUTA 4AEFA 2D0HA 4WY0A 3L5LA 4JFVA 1LBLA 2IUZA 1CEOA 1VEMA 1OG0A 3U2EA 1WBHA 1UR8A 2E8ZA 2GQ9A 4JOMA 4LBSA 5FOOA 1EQCA 4NRRA 3W2NA 4N9CA 5PTDA 1O1ZA 1O95A 1VH7A 3ARUA 4B5NA 3LLXA 2CETA 1RPKA 1NM9A 4JQ2A 1MNSA 4GLEA 3QPEA 3A9IA 1O5RA 1ISYA 5TIMA 3WLSA 2FLIA 4Y9OA 1M68A 3HU7A 2A6NA 5LNSA 1SR9A 2PDXA 4KWSA 4BY3A 1SO6A 3AZRA 3AIRA 1I8JA 3NOEA 3WL0A 2AL2A 3LM7A 1P1XA 4PGLA 1MWOA 3GHSA 3NIYA 4F2UA 3RU6A 3M47A 4GXWA 1JCYA 5IDZA 2XH2A 2VGGA 3VFLA 3Q4DA 4PULA 1VCVA 1XYZA 5LNWA 4LAUA 5FF4A 4KFNA 1TE1A 3QKEA 2Z2AA 4J27A 2XZ7A 1HJWA 1NTHA 3NWRA 2GYIA 3IACA 1I4NA 5LXXA 3ABOA 2YXGA 6TAAA 4WSKA 3WKZA 3O9NA 3BAYA 1G1YA 2G97A 1PYMA 3PPHA 1QAPA 4DNMA 1G0CA 3L65A 2QDEA 3ZT6A 3C8NA 3AMKA 3WQGA 1WNOA 1OFDA 2W62A 1P5BA 4IPJA 3A21A 3B0VC 5HMDA 3DYOA 4Y8EA 1HT6A 3W1XA 1UKTA 4BF9A 4DJEC 4H7CA 3NNTA 1UWIA 3S9IA 5DXYA 1LQ2A 3H53A 1X1NA 3MCMA 2E7FA 4XD3A 4DI9A 3M0MA 2BLEA 1WAWA 2QAFA 3BLIA 3S8HA 3CQHA 1J0IA 3NQVA 1W3NA 2NVDA 3G1VA 3ITXA 1VIWA 1PCKA 2I9EA 1YYAA 3HPSA 5EBAA 5C9ZA 3HIJA 3IAPA 1F7BA 1TJ2A 4C6CA 2ZCGA 4Q8UA 2BHZA 4X60A 1YHTA 3B8UA 2ZA2A 4LAZA 1TREA 3UGRA 1P0KA 5BZAA 1BAGA 4LALA 3W1RA 4ERIA 5K9CA 1WDWA 3D5HA 4C65A 1MUMA 4BHYA 3WBYA 4YVPA 1XLGA 4GYPC 2WPBA 1GGOA 3KDOA 2WNNA 1ZENA 4HU4A 1OB0A 2PZ0A 5AN7A 5E0FA 5EYWA 3HM7A 1W1A1 5FF7A 1OGBA 3S3GA 1UA7A 1CI1A 5H1WA 3L66A 3FKKA 4P7RA 3O6AA 2X8RA 2GLKA 3G8RA 4FLQA 3THCA 1Y5WA 4L9XA 1YRRA 2EKGA 2DPEA 3EWUA 4EKJA 2VEGA 5BRQA 5CJMA 3QQ0A 3W6LA 2NZLA 2DUXA 4O52A 4MFEA 2ZUMA 1BWLA 1FY6A 3EXTA 1RY0A 1B9BA 3VOCA 3N4AA 2WPGA 3ZR5A 2V38A 1WKEA 2XFWA 3VOHA 3NEVA 4JIQA 3BL3A 3N2MA 1T8QA 1Q3NA 5D9MA 3NZQA 4OECA 1VPQA 4S38A 1CXHA 1Q85A 3FX4A 1JZ8A 3MB9A 4JIIX 5I03A 4OKDA 4M51A 4AWSA 5ABGA 2QCDB 4DZAA 4OV9A 1VBRA 2O4MA 1JZ5A 4J7RA 4CGTA 1HKMA 4YTTA 5ABHA 4K1GA 4A22A 3ZWTA 2D2JA 3TWAA 1SZNA 5AHMA 3CIWA 3AHZA 3U7VA 4UTTA 5CAKA 4QLJA 1X8CA 1TPUA 2E40A 2F61A 3WQ6A 1OCJA 4AH7A 1EX5A 4LVFA 4YHEA 3UERA 1XLIA 4PZVA 4Z17A 4GNKB 4ACZB 5JU6A 3UVIA 4MM1A 3IIPA 4WK9A 3W75A 2INZA 4PB3A 3HPFA 3AAMA 3KHJA 1TUFA 4MAZA 4PA8A 3C61A 3BTNA 3LK6A 2WV8A 2CLEA 5FF2A 4N7QA 4BCEA 3MO4A 1JPMA 4MNKA 3VDHA 2DIEA 3LI0A 4RNHA 3IUIA 3UETA 3KOYA 4I6KA 4QJ5B 1J8VA 2Y5SA 1NF7A 3EX2A 2I5IA 1E1CA 1JF5A 3CWNA 1EZ2A 1RUSA 4F0SA 3H2OA 1CGWA 4O8RA 5HULA 2YL9A 3GK0A 3C86A 1GZJA 2FIQA 2QT3A 4J9JA 5LIUX 2PSNA 3GVQA 3PTQA 2EG8A 3G8EA 3H2AA 3PBGA 4C7DA 4FNTA 4KT2A 3GY1A 1QU4A 3CHCA 5FL1A 3LRLA 2KAUC 4GI9A 3R7MA 5LZLA 1PDYA 2ZZ3A 3R0KA 1S5WA 1TQJA 4JQ1A 3NL5A 3VM5A 3QV6A 4U33A 4FF5A 2X1SA 3M41A 5FIPA 1CTNA 3W1NA 1A0DA 2BASA 2PI6A 5CCZA 4EXBA 1WCGA 5EU9A 5BXRA 1EHNA 2P10A 4D2JA 4AHQA 3QYQA 5C8BB 3BQ6A 4UZSA 1CWYA 1RCXB 3GHUA 3SECA 4AD0A 3XISA 4EIVA 3FNDA 4RDZA 2PLCA 3P0XA 2A7RA 4AZCA 4MF4A 1DQUA 3N73A 1OIFA 3TAKA 1GEHA 3WH6A 3GXIA 1XH1A 4L6HA 5C5YA 1CXIA 3LPFA 4LUIA 4NRSA 4V15A 4AX7A 1EC7A 4CNSA 2WSYA 1NIUA 4AZ5A 5C2CA 1K8XA 2DSUA 5HJXA 4Y9PA 4K8HA 4OJYA 1MVYA 2J7BA 3KWXA 1BYCA 4HMDA 3VNJA 3SCVA 1K6AA 2NUYA 1ME9A 4DZHA 3M16A 1JCNA 3CHEA 3CUHA 2DU2A 2WJFA 3NR0A 3S47A 1B3ZA 2YDAA 1ICQA 2ZC8A 1VRXA 4ZB2A 3WD3A 4XZLX 1BGGA 3VDAA 1AZ1A 4H1ZA 1W3LA 1Y0EA 1H0GA 4HZ8A 4EXAA 4BQ4A 3L4XA 5EGRA 1YPIA 5CQ1A 1OX5A 2JKPA 4WUIA 1W9PA 1FHDA 2I7GA 3IIOA 3OODA 3KHDA 4I5UA 1BVZA 2DIJA 3AMDA 3CPUA 1DVJA 3WBWA 5DBTA 4GK8A 3KTSA 3DFYA 2H9AA 1GZGA 1VLWA 1QUMA 4AZGA 5HPOA 4LUTA 3MMTA 3UA4A 1V7YA 3OQEA 3DKLA 2CCRA 1O4UA 4OTKA 3WLTA 2RDUA 1WDDA 3SBFA 5AC7A 3EDJA 3S6OA 2WNZA 3ZFHA 4Y9MA 2HK0A 1LBMA 1VQTA 4DF1A 4IFKA 3NDZA 3QFEA 4YS1A 3SCOA 3E0VA 2WMHA 3DHFA 2WZMA 4W88A 1F6YA 4P7OA 1M6JA 4QEEA 1F07A 7ODCA 2G4JA 3W7OA 4QS5A 3BOLA 5D2YA 4LCQA 3VD4A 1MXGA 1XLCA 4Q4SA 2ZX6A 3NGFA 3PZTA 1XW8A 2DVTA 1V6UA 1H50A 1CB2A 1QI4A 3CPRA 5BXPA 5G2WA 3WQEA 1UYQA 3NQ8A 1EUNA 2QGYA 4DBEA 1GVOA 4DVOA 5LGXA 4XBJA 4XD6A 3P14A 4XZNX 1OFAA 1TWSA 4LSBA 4GBUA 5KMYA 2POTA 5DX7A 4US5D 5CZTA 2ABAA 3LU2A 2VDHA 3NYDA 3GIQA 1W17A 3NURA 2GVJA 4FA3A 3V4BA 2PP0A 2J7HA 3P8IA 1ITXA 2AOSA 5CAHA 4OVXA 1KM2A 3PUOA 3GTIA 3ERPA 4GXPA 3FAWA 3ZVIA 1RPXA 1F8IA 4HCLA 1LT8A 1EEPA 1RJRA 5D2XA 3APTA 2X0SA 3E2RA 5FCZA 3RGTA 1H51A 2IKHA 4KGJA 1CGTA 1XSKA 4YYCA 4M29A 2PDIA 1K8CA 3LBCA 2CW6A 2W66A 5DF0A 3WLRA 2A3CA 4JHMA 3S42A 3SN4A 5BMWA 4AZHA 4QNWA 3VVGA 4HKPA 2OSYA 5KINA 5I3KA 1NWRA 1YXDA 3W85A 4JEQA 2J8GA 4LPCA 2QIIA 5IFTA 3TYZA 3T8LA 5DT7A 4UTWC 1F3TA 3PSVA 5CPMA 4IIHA 1MDLA 2H3BA 1AW5A 3W6MA 1JRBA 2V63A 2E6DA 2P8BA 4E2VA 4V1YA 2Z24A 4XB3A 3DFQA 3C52A 2TAAA 3PS7A 3A6OA 1B3OA 4QXIA 3GDKA 3P80A 2OKTA 1XP3A 4RW3A 1XS2A 4XK2A 4WGXA 5B7YA 1V77A 4QAIA 3LPGA 3OYZA 2UV8G 4O12A 2UY2A 3IGXA 3V35A 2V67A 3L68A 3AHVA 1VFFA 1L6SA 2YPIA 1UKPA 4I8YA 1ZJIA 4MSSA 4LVAA 2WBGA 5CXPA 1S5MA 1VFSA 3OA3A 1GG1A 2Z00A 5EPDA 3KBMA 2VRJA 5AC4A 1G7VA 3BQ5A 1JI1A 5HNNA 2OG9A 4EPEC 2Z1BA 4GKLA 2RGMA 3RK8A 4N9BA 1HP4A 5A3HA 3GHTA 4Q8WA 3TKFA 2WSQA 4GIRA 4GVIA 1KWGA 3C2VA 1SQ7A 2IQ0A 3VGHA 4NYYA 3V1PA 5HWJA 5I3GA 4PMUA 1LROA 4NU7A 2EEXA 1FCUA 2V69A 2AAMA 4TO8A 3GYEA 4NI3A 1I0DA 3W28A 1XD1A 1SO4A 4F0RA 1WXJA 2BZNA 1R9XA 3NTYA 3F4DA 1J6PA 4BEQA 4MJ2A 3ALGA 3U3HA 5C70A 2QDHA 3FS2A 3GBEA 1GOOA 3K2GA 1GYMA 4UTJA 2XWEA 2PDYA 1KRBC 1QHOA 2G41A 4B9YA 5D04C 2EKCA 3FHAA 1LZOA 4DZ5A 2VX6A 3LEPA 4H3DA 2L5HA 1Q4WA 1W1YA 4UIOA 5AYZA 3BARA 1R3SA 5I3HA 2O7QA 2B81A 1QNVA 2VVSA 4CD4A 3POHA 4L1GA 1IXPA 1LQAA 1VZWA 5BU9A 1W8SA 3FGCA 3DYMA 5AVHA 3MJMA 3PPCA 1NDZA 1W2VA 1MMFA 4P8VA 4AZ7A 2VP8A 4US5A 4UXDA 3V0SA 3CMJA 8A3HA 1KRMA 1MRQA 3A64A 4UCGA 3UG8A 3MCNA 2UY4A 3S2NA 3C2EA 2BG5A 4UFHA 1SZEA 4MB1A 2J4GA 4FPSA 3AXMA 1AUSL 3CV7A 3W7IA 3QMSA 3ARWA 4CNTA 3NQAA 4Q8PA 4XAZA 3RG6A 4AVOA 1NP2A 3R8HA 4JDBA 3AISA 1E43A 1J2WA 4Z1CA 4H9MA 1TELA 2J9YA 3VD5A 3TNBA 1WQ5A 5KTLA 4V33A 3HOJA 5C9UA 1GW9A 2XVKA 5F1VA 2J74A 4E2DA 5DCEA 2IKJA 4U3AA 3W2UA 1QPKA 3P67A 1EA0A 3B3DA 3PBVA 1S2CA 2J9ZA 2VURA 4MNJA 1JQVA 1B3VA 3QSRA 4YIWA 4ALDA 1VBUA 1E0TA 3EA3A 4GZEA 3W84A 4Q8QA 4A35A 1KNWA 3H6OA 4DJDC 4QE4A 1BTMA 1S39A 4IMFA 3QY6A 5D09A 2PDGA 2XM1A 4PUMA 1PPIA 1IT7A 4IH3A 3I4EA 3PB0A 3AXHA 4Z0JA 2WC4A 3PTMA 1F9CA 4HNOA 4JNYA 1DJGA 4PSPA 3WLJA 3CUZA 4JN8A 3DZ1A 3RIKA 4Q8TA 3QHMA 3TJLA 3W9ZA 3SSZA 1EFZA 3ONBA 3OPSA 4JTHA 4A05A 1EA9C 1X6NA 2WQPA 5HWMA 5T9CE 3P61A 4Z2HA 1XIGA 3A4AA 3VILA 3GO2A 3PC0A 1EEXA 1S5VA 3ZR4A 1F74A 1DIDA 2F2KA 3UU0A 1MW0A 3RUBL 5AC8A 3OA5A 4Q8NA 3WF1A 5CH9A 4Q4OA 4X3ZA 3WMLA 1OFQA 1V6YA 4CEUC 2Z6IA 1U2YA 1FDJA 4HNNA 3KOWA 4IQJA 4I7VA 1HJUA 1F3XA 2XGIA 1N8IA 3ZLGA 1YMYA 2VC9A 3P74A 3W7HA 2Z27A 2Q6ZA 5REQB 3SN0A 4GX9A 2G5WA 1HKVA 3I7QA 2V0TA 2XIQA 1A3WA 6CGTA 1R3TA 4TUFA 4W5ZA 3WO8A 1VPXA 4R85A 3CYVA 5A8QA 4WJEA 1DWHM 3GTFA 1G94A 1ZQ5A 5XINA 3B8DA 5LIKX 1U83A 5AHEA 1O1HA 2B4GA 5FSDC 5JBFA 3BGGA 1I2OA 3KP1A 3IIVA 1KKOA 3AHYA 3WDRA 2DH2A 3MO7A 2CEQA 3UP8A 5AC6A 3OZPA 3EWDA 3KXQA 1OC7A 1NAL1 1V0KA 2GVYA 1QFEA 2YOCA 2VEMA 2CBIA 4G56A 2BHYA 4S3EA 1R7AA 4R88A 3WQ8A 4FLSA 3TTOA 3U2OA 1JZ4A 3IJQA 5HQEA 2ZC1A 3ECQA 1J5TA 3LV5A 5JQ9A 1QXLA 4PMOA 2RDTA 2YDRA 3LI1A 1OF8A 2PWGA 1OJXA 7CGTA 4FP1A 4QNEA 1SW7A 2GFTA 4AEEA 1EP3A 5H91A 2OSWA 4F0KA 1CT5A 3AFBA 1KGUA 1FHUA 2CLMA 2ZRUA 3U4AA 1O66A 1ZJBA 4UTFA 2CLIA 1GOQA 1B54A 1TJ1A 3KZPA 4C1LA 4ES4A 4D6HA 3CHDA 2XVLA 3UJFA 4D8ZA 2CWXA 4PMZA 4PTNA 3L0KA 2QW5A 4RE0A 4ZGYA 4G8TA 3GDMA 3TXVA 4LTSA 4B91A 3OYXA 4AAJA 2C6QA 2Y8KA 4BWLC 3NQCA 4JKMA 3P5ZA 3RO6A 3VFCA 2B7OA 3SN1A 4MVAA 1EF2A 1EX1A 2HBVA 4L9YA 4QX4A 3EX4A 4X9YA 1H63A 1JZ6A 3NSNA 4IM4A 1K9DA 1GVIA 2P88A 2DV0A 1B31A 1NFBA 4GUJA 4PEEA 4KWVA 3ZJ6A 4CQDA 4O0KA 2PGFA 1QT1A 4XZWA 3S2LA 1PUDA 1VYPX 5MF5A 4G7EB 1YADA 4IWWA 4N02A 2PU0A 4PCNA 3E2VA 3POCA 2NXHA 3KUMA 5G1MA 1EJ7L 1EUAA 1Q7ZA 3WLHA 3H12A 3QF0A 1R5YA 2EJ1A 3LB0A 2PC4A 4ZFMA 3N19B 4RE4A 3VIMA 5CKSA 1MQPA 5HPCA 1AMKA 3IAQA 1V08A 1K77A 1CGYA 1XUUA 3L23A 4RZ4A 3M0ZA 1JPDX 3K4DA 4H2CA 2DZXA 2C91A 4GYPA 1RVKA 4LB4A 3PZOA 1JI2A 2FZBA 2VR2A 2WNWA 3EPNA 4LF2A 2XDFA 3A47A 1CGUA 3IJ8A 4Z2GA 1WKDA 3WF3A 4Z1BA 3PP7A 2W6RA 5CBJA 1QHZA 1XIJA 2OODA 3VU2A 1GORA 4KRZA 4ZOBA 3LSBA 5U7SA 1WKYA 2XGZA 4W5UA 3LQGA 4GJ1A 4DO7A 3UR5A 3VNZA 3R4IA 3VCRA 3W25A 3G18A 2CFFA 2D22A 4MGGA 4O18A 4OOUA 2D1ZA 3AZSA 3PANA 5J5RA 1RBLA 1TMQA 1A5SA 2QV5A 2FHBA 1PIFA 2XVPA 5KETA 1W91A 3OO2A 4HHHA 5AZ0A 1JZ2A 1EGVA 2E6FA 3QMTA 2V5DA 2V82A 2PF0A 2WJDA 1JGMA 3NPVA 4K2SA 3G77A 1VFHA 1HIZA 4GIYA 3BG9A 4F40A 1OYBA 3AO0A 5HATA 4TR9A 3AOFA 3S1GA 1FH9A 1AD4A 2ICSA 5LKYA 1AG1O 3MC5A 3Q65A 2H8XA 1S1PA 1YTDA 3TMQA 1EHAA 1ZS2A 1E3XA 3PFRA 1WV2A 5LYRA 5F1UA 1XF0A 2ZXDA 4C1NB 1H5VA 3IRSA 4ROPA 3OZYA 3M0IA 4W7UA 2VFEA 3EWCA 3STCA 3GH5A 3NSMA 2Y7GA 4ORIA 2VEPA 1G67A 1TO3A 4Y90A 5IBXA 4QIUA 4HNUA 1X96A 3CMGA 3N1AA 2RDWA 4H7ZA 1K70A 1XLHA 2OT1A 3S1UA 2V2CA 5FA5A 3BAXA 5HNUA 3SB0A 5L9FA 1ZP4A 4RZ5A 3MI2A 3A3WA 1RALA 4XBSA 3EX6A 1GVQA 4NX5A 4FZIA 1CXLA 1W8GA 4DHGA 5CG7A 2IPFA 4ZTYA 1BKHA 2JALA 3ABQA 3DOPA 2VEIA 4M6UA 1YNPA 4GZ7A 2ABBA 1XIMA 1O94A 1H60A 3W7JA 3SM0A 1R9YA 1JPKA 4DLMA 4GCAA 1DIKA 3LYEA 3G0SA 3L5MA 2A85A 1TJ0A 3TFCA 1D7KA 3A12A 1KFWA 3DFOA 4O19A 1JDEA 1LWIA 1A3HA 4Q4QA 3UZZA 1SJAA 9RUBA 4EVZA 3WJSA 4W4QA 3RJYA 4QJ1A 1KFKA 2AMXA 3W7MA 4A2RA 4AVNA 1U5JA 3U0HA 2CIPA 4O1FA 3I3BA 3EDKA 1GK8A 2Y2WA 1LBFA 4NILA 3GXMA 5LA0A 4IQDA 3OB8A 3UXKA 4JFWA 4HYRA 4ROQA 1A4LA 4AWUA 2FMNA 1EP1A 1RY8A 3H55A 2WJEA 2PDHA 3PJTA 2UWFA 3I6TA 3KFTA 1AW2A 4GFSA 1C3FA 2O4QA 1XQKA 4F4RA 4MLRA 2OLAA 2V3EA 4JPGA 4HNVA 3S2CA 4A3YA 2J6XA 2I5GA 4BJHA 2DT3A 1EGZA 3NYZA 4I9AA 1SM9A 1W9VA 1RXOB 3WUEA 4NNAA 2VMFA 1C8XA 3HGSA 2Y4SA 1NWTA 3L67A 5JVLA 1BRLB 3W2JA 2WO5A 3NO3A 4CD6A 1EIXA 1FWBC 1E5JA 3WNOA 3ZT5A 4O11A 3T2PA 1V8EA 1OY0A 4XUYA 4A3QA 5I3FA 4PMRA 1H1NA 2QJIA 2WWCA 4IG2B 4OV4A 3W6YA 3ZSTA 5D38A 5I0DA 3VINA 4C5YA 1E56A 3P3BA 1RCOB 4E4FA 1VB9A 2JKEA 4QEHA 4LCRA 3WDJA 3T2QA 2Z25A 3M0YA 3GUGA 3W53A 2WZIA 1AQHA 2ONEA 4A2SA 5M5DA 1V3MA 3HURA 1S2AA 5D30A 3RXZA 4OOZA 1IEWA 4B5SA 4H7VA 4F2BA 4XZHA 5BOOA 2YB1A 1O68A 3ARTA 4O8AA 3UWYA 1GOMA 4FSAA 1EOMA 1FX6A 3LGGA 1MEHA 2WWDA 1X1OA 3DFTA 1ZL1A 3WLMA 1QW9A 4JIPA 2VX4A 2OKOA 3AYSA 4ENLA 1J01A 3W7EA 4EAMA 3K8MA 3FJLA 2WKGA 4M0XA 1BKSA 1H1YA 2ISSA 3AYTA 1L9WA 2Z1VA 2A4AA 4HHMA 5TD4A 3GBDA 2PDNA 1ZGDA 4DUWA 1AQ0A 3TQKA 3FJ6A 3S0CA 3TJ4A 4MPQA 4HA1A 3VIKA 1LYXA 2HNEA 4K1WA 3M6YA 4Z0SA 5HJLA 4EX4A 5D2VA 4YTSA 2ALDA 1EWDA 4TVCA 3U5YA 3W26A 3PVFA 3PULA 2IKGA 3VOJA 2HWGA 2ZQ0A 2FKPA 4XO6A 4L64A 4JD4A 3URNA 2XINA 1WDSA 1LOLA 5DMLA 3U6WA 1LWHA 3PWAA 2FJKA 3LV6A 4D6GA 1FCVA 2V3GA 2PWVA 4MADA 3REQA 3TX9A 1DE6A 1D3GA 3UYCA 1LJYA 4A3HA 5A8NA 1M53A 4Q4RA 1K02A 3MUIA 3ZJKA 2QULA 3R94A 2H8ZA 3DGRA 1YNYA 3H22A 3ZWSA 2UZ9A 2XG9A 3N29A 1T8XA 4ZB5A 1BEUA 3CU2A 2BOGX 4QGCA 4OU1A 3QW3A 4LFYA 4NIRA 2ZA3A 3G1AA 1HZYA 3TA9A 3F4WA 3WQWA 1PS9A 1WZKA 3T08A 4GQBA 3WFAA 3VCNA 3B0PA 3EOUA 2CHOA 4HN8A 4J3UA 4HPJA 2BV9A 3GE7A 3O63A 2FTPA 5E0KA 4REQB 2VR5A 1W32A 3KAOA 1T96A 1C9WA 2G3NA 4DJDD 3WLLA 4YWIA 3GVWA 4CNUA 4UTWA 3PUEA 4WDWA 2F6KA 1GVFA 1FWHC 2E6YA 3EBVA 2ISFA 3H7UA 2F7FA 1ELSA 1GJWA 4G7FA 2WSPA 4DI8A 2BODX 8XIAA 3CWHA 4DWSC 3GXDA 3QLDA 1ZY9A 1KM0A 1MW1A 3LCFA 3VKBA 4Q3MA 3VDGA 5CPSA 3V7PA 4UR9A 1UP0A 1XCXA 4O17A 2C8NA 2R6OA 1FH8A 2CWNA 4UBPC 2Q02A 2O9TA 3VC6A 1XYBA 1BPLB 3BDKA 3H2FA 3M43A 1XSIA 2ZZ6A 1A5OC 3B40A 5GNYA 3OVRA 2WVVB 2Z28A 3I3EA 2HPMA 4KFPA 4S3CA 2Y6ZA 4NJHA 4BI6A 2XFFA 3G2GA 2GDQA 3C2YA 2DVXA 1E70M 5A94A 4DWSB 1CPUA 1OYAA 3IIZA 4DN1A 1A53A 3I10A 5I79A 3ZVHA 4ZQMA 2YL8A 3WLKX 4XISA 3WELA 4LRTA 1ZFJA 1FWGC 1UWRA 1S2WA 2DW7A 2XZ9A 1FWAC 1B90A 1AJZA 3OGRA 2C0AA 1QK0A 2DQWA 3QR0A 3OLIA 3GC5A 2WVSA 4PTVA 4BFAA 1UIPA 1UZDA 2QPUA 3PK7A 5DXXA 4I3GA 1WXYA 3ME3A 2ZVIA 5K4XA 3GC2A 3GHRA 4LW7A 2PGRA 1KWKA 3UD6A 4WSHA 3RR4A 4TVDA 1PDZA 1I9CB 2BVDA 3AIWA 1DV7A 3UY8A 1AJ2A 1JD9A 4L1WA 3TZNA 3GUWA 1N55A 3Q94A 1HL9A 3FEMA 2WB5A 4XZIA 4TTUA 5DELA 1D8WA 4DO5A 1KQZA 4WF7A 3TYBA 3OVQA 3W00A 2UY5A 4C1KA 2Y0FA 4DM2A 1EGMA 2PD9A 1LLWA 3GSMA 2PLKA 2HSAA 4NZCA 2ZX9A 4PBFA 2ZICA 1VFLA 2YB4A 1VRDA 4YN5A 3RR1A 3D0CA 4GO8A 3S1XA 5HA7A 3TN5A 2VZSA 4C6BA 4O0QA 1MFUA 1S2UA 4ZBCA 1OC5A 3BCJA 3CL6A 4GFIA 1MXSA 4AMCA 1U33A 3TTQA 2AGKA 3STEA 1XLFA 3PZVA 3FHQA 1IZJA 3LOTA 4Q4MA 2BXVA 1UWQA 1W5NA 4H6RA 2VZTA 1HL8A 3GZ3A 1GONA 5G4HC 3SJNA 1M3UA 4E3TA 5E9XA 3CGTA 4DZIA 1FWJC 3VOFA 4ZENA 1A0CA 2BDQA 3L7RA 1TQXA 2XFYA 4QSHA 3HGJA 1V6WA 3QW4B 1LQ0A 3G3MA 1DBTA 4JTEA 1Z42A 3ZLHA 3WMCA 3IUDA 4B3ZA 1KBKA 3K46A 3ABSA 1MDRA 1A5BA 1GT8A 4JL2A 3DEQA 4IISA 5GJNA 1UBSA 1UR1A 1LUCB 3TU9A 1MUCA 4EACA 1TVLA 4PMVA 3KBVA 4B15A 2Y61A 3SCQA 5CC5A 3C3NA 1J11A 5EBUA 2Q71A 4FX6M 3WQPA 4PB5A 4M8UA 3C4UA 4HB7A 1ADDA 2OLSA 1H49A 3EX1A 2B7PA 2CLPA 3THUA 1X6LA 2DZWA 2J66A 4EK7A 1J96A 1WOBA 1JG9A 1WA3A 1WZMA 4NZFA 4AF0A 4DXXA 3A9BA 2V5KA 1MNZA 1Z7AA 3DGBA 3C0QA 1HKIA 3TTSA 3SRHA 1RLCL 4WKAA 1IQ8A 4MY8A 1UZ4A 1SVDA 2PWHA 4Z2IA 4DJDA 2WZEA 3TMLA 1XINA 1KLYA 3NAVA 3W1AA 1Q6OA 3ZIZA 4RDYA 1TPWA 3HPAA 5CJ5A 1RQHA 1U1HA 3KWSA 3AMGA 3FFSA 2OO6A 3SW6A 4OFCA 3GR8A 1A5UA 1JGIA 4F66A 3HF3A 3QOMA 3SADA 3HMJG 3VX1A 1IWBA 1JCXA 3SAZA 2BNJA 4A4AA 4MWAC 4M7TA 3H23A 3AS2A 1M04A 3PZQA 4PUNA 3VIOA 4JTCA 4DXKA 1ZJAA 3JUGA 1BYBA 1QBBA 1GVYA 2YW4A 4Z1DA 2VZVA 5HDRA 4LJ3A 3IJ6A 3MSRA 1HJVA 3ORWA 4IZGA 5REQA 5FF0A 2Q01A 1BXBA 2Y1HA 3UFYA 1TPC1 4HN4A 3TQ0A 3H2MA 2J7DA 1S5NA 5EMMA 1UMLA 4ZQPA 3R1ZA 1G69A 4IFOA 4MWAB 3IARA 2ZXBA 4JY8A 4JHOA 3L4YA 3EWYA 1YBQB 4UZUA 2VC7A 3OBAA 4IGSA 4MTVA 3W1QA 1JYWA 3LM3A 5CPOA 1T6MA 4V27A 4F9JA 3E1F1 4M1RA 4H41A 5MKGB 4UQDA 3SGZA 3VM7A 3BLEA 2E9LA 2FPVA 2DT1A 2DUAA 1DJZA 2P8CA 2G95A 3S6DA 4HMEA 2FH8A 1T99A 4IP5A 2D69A 5E93A 1CLXA 4HTYA 4YPJA 3BWWA 1M1BA 4PCFA 2YCLA 3CS2A 3B03A 2X1UA 4MKSA 3LCWA 2H90A 4OIFA 1DWFM 2ZIDA 3NO1A 8XIMA 2PEVA 2E25A 3O0FA 3W82A 2OXNA 4JTJA 2RHGA 2WHJA 1E6ZA 3VNMA 3WDQA 5EMJA 4CCEA 5C9XA 4E8GA 3G6MA 3GZAA 3BGAA 2E6AA 2IPJA 4X63A 3NQMA 3FA3A 1EJSC 3MMUA 4UQBA 3QVQA 1HKWA 2W0UA 3UZJA 1IWAA 1E0XA 1AQFA 3V16A 4MNMA 4S3DA 5FI8A 1E9ZB 3LZ5A 4ZCWA 3GTNA 2FDSA 2CKSA 3BMWA 2AMGA 3ATZA 3M46A 1BWKA 1P0NA 2YX0A 4FX7A 3GX9A 2OZ0A 1YE6A 3PZUA 1JUKA 4AD1A 4FNQA 5AYYA 1KM3A 1Q6FA 1DKWA 3ANUA 4IUOA 3SEPA 2FGZA 4GZJA 4NZ4A 4DBSA 1MQRA 4H2HA 2F8QA 3NL3A 4IFRA 4D72A 2FDMA 2DZBA 4ZXOA 3CLMA 2X0HA 1ADOA 2WM1A 3R11A 2W9MA 1HNYA 4LXFA 3ABRA 3N6JA 3GNNA 4HK6A 3UWZA 1TA3A 3L4WA 1V3HA 5C7HA 2E9BA 2BFGA 1KFJA 2Q3RA 4MG4A 1UUQA 5CGQA 3VO0A 1JVNA 4WHBA 5J5DA 1U1JA 3MYPA 4NZ5A 2YCJA 1XWYA 2PP1A 1U5VA 1X1ZA 3BXWA 4HHLA 2NWRA 1Q4NX 4KEVA 4BKNA 4BWLA 3IJIA 1EPVA 4AYSA 3PB2A 4F0MA 4CKQA 4TV5A 3PBWA 3NO5A 3W4RA 3CV2A 2IS7A 2NXGA 4UQCA 3PAJA 3FKRA 3EOLA 1XIIA 1GKQA 1FTXA 1PKLA 3ES8A 4AY1A 1J0HA 1JD7A 4JGDA 4WGHA 3UR8A 5ABEA 1EJVC 1VGAA 2AKZA 1HP5A 3W2MA 4RR4A 2NQ5A 1XBYA 1O5QA 3SCSA 2J6VA 2PS2A 4KEUA 3TEVA 3LG3A 4MB4A 3AS0A 1IT0A 5K9XA 5D9OA 4WR3A 1Q6GA 2ZUUA 3DI0A 5AY7A 4U5IA 1H09A 3B9OA 2YSWA 3DC8A 2D20A 4HSHA 4N9DA 1XLAA 2XISA 1VFTA 4GO9A 1IGWA 4QDMA 5CSYA 1DJWA 4EPKA 3ONCA 5FJOA 1K8YA 3U2ZA 3WUFA 1BXNA 2AQOA 3BJTA 2BMBA 3DN5A 4UB9A 3I7RA 2ZRVA 2VJXA 2FVLA 1CB7B 2OZ3A 1EC9A 4GQRA 4CU6A 3LX9A 3U9IA 3UCCA 3FCPA 4AU0A 2BS9A 3ELFA 3LCHA 1LM1A 3M7WA 3H26A 4LGXA 1EH9A 3KOXA 1XGDA 2DZPA 4FXSA 1TWDA 3B06A 5CC6A 4UNLA 4U3CA 2PCQA 2YXOA 4J3TA 5I09A 1PTGA 2A0NA 2REQA 2J78A 1G6CA 1B2YA 2ZUVA 1XKYA 3M7SA 3OBKA 3QGAC 4PUWA 3RO8A 4RXGA 3PG9A 3BAWA 4G9PA 4PMNA 1DE5A 4JX4A 3F4VA 1OADA 3TQPA 4HOWA 2VDGA 4KBXA 3CIVA 2V5JA 2HCVA 5MHBA 4JBRA 1R46A 3MHUA 4N42A 1TTPA 3U57A 1FBAA 4J3VA 4IIBA 4ADSA 2CHRA 4FX8A 1ZHAA 3NXLA 3MVTA 3BG5A 4PEKA 3QR3A 4GY1A 4GYKA 3UT0A 1TUXA 2GJNA 3NZ1A 2Z1XA 5M17A 4MHBA 3FYOA 4LS2A 1JXJA 4S3FA 2R82A 3LBOA 3ZQ9A 4KCTA 1IXOA 3N3MA 3H24A 2NW0A 1BQGA 4IL0A 5I23A 2V6AA 3ENLA 3FSTA 3PNUA 4LEFA 2AQVA 1KXTA 2WLYA 1KCLA 1I45A 2C16A 3WK0A 1EQPA 5D32A 7TAAA 3QC3A 1EL3A 5LA2A 1RA0A 3EMZA 2WZTA 4O14A 3CTLA 3NQFA 3UJEA 3WLQA 1J10A 4PMQA 1IEXA 3EMCA 3A3HA 4W7VA 2X30A 2BXYA 5TAOA 2YZ5A 5T9BG 3TE9A 4IQEA 2PAJA 2A7NA 4NXSA 2EPLX 1YXCA 4WOZA 2MNRA 2I1OA 1I6NA 5HNRA 2NVCA 4FIQA 1GWJA 1GOWA 1Q6LA 1FQ0A 3D3AA 1NARA 4YWSA 5T8GA 4K7YA 2QJHA 2C0HA 1I2QA 1HG3A 3EOOA 4N6EA 1CYGA 2JBMA 3CZKA 3SZ8A 3RRAA 1KV8A 4TOQA 4D1JA 1ZPTA 2NV1A 4LWWA 2YXXA 4O16A 4EF8A 1R86A 2OJPA 5KZ6A 1QASA 2Y88A 2PPGA 3R12A 3QSTA 1FWFC 2BVTA 3KZSA 2QCGA 1EKOA 3KLLA 2Q8XA 3WD1A 3STGA 2WCGA 1HW6A 1EYWA 2RDXA 3CUJA 2Y7FA 5E6ZA 3MBFA 3W2KA 4K36A 3RILA 5C55A 1FFQA 4U28A 4CQ9A 4AB4A 2CZ5A 3K5XA 3ARXA 5DMMA 3VD3A 3T0BA 1ONRA 4CQCA 2X7WA 2XIOA 3VTRA 1TTIA 3T4WA 4PBEA 3BW2A 4GNVA 1JZ7A 2YW3A 1IEVA 3HJZA 4HZ6A 1P0EA 1SFLA 3T7VA 5I3JA 1M01A 3NQ2A 1U5HA 1PXGA 4Q7IA 2VQUA 3IANA 4FO4A 4NP7A 1TV4A 3E9AA 1LL6A 1Z6KA 2BY3A 3LA4A 4R9OA 3QKZA 2XUCA 1E72M 9XIMA 5ABFA 1Q2SA 2WNQA 5AC5A 2GJPA 3L4VA 3AU6A 3F5JA 5DCBA 3AJXA 4AC1X 4MDOA 1P1MA 4MOZA 2Q8LA 3C0LA 5C54A 2QS8A 3GG8A 3AALA 4R9XA 1XUZA 2W61A 4FIRA 1W9DM 5HMEA 3LXCA 3L4ZA 1O5KA 2VCCA 3RMJA 3UZXA 3MANA 4JFSA 1Q6CA 4QBXA 2PGWA 3DG7A 4L61A 1DPMA 3M5VA 6REQB 2RJGA 5LXEA 3VIHA 3MUXA 4UOZA 2PCEA 3TW6A 3GWQA 3NQGA 1UZ1A 1XBXA 2BOFX 1TPH1 2VT0A 3R25A 5JBDA 1NELA 2OGJA 1XGEA 4MWAE 1ECQA 2PDWA 3AC0A 3LUTA 2OT0A 5HINA 5KITA 1W3TA 1MRAA 1AH0A 3T0DA 3WX7A 5DBUA 4DRSA 1ISXA 3PZNA 5FJTA 4NAEA 5G4EA 2PDUA 3NG3A 2BVWA 4HCDA 3UCDA 5HOSA 1ZNNA 2C1GA 1BYDA 1OFPA 4URIA 2Y24A 4Y9NA 9XIAA 1HX0A 1Q63A 5HR7A 1YEYA 3TR9A 3NM3A 4U5KA 3WBXA 2QYGA 3FVMA 1JUEA 3TOYA 5HANA 1XHGA 5CZJA 1LP6A 4X61A 2IQTA 4ML4A 4O4VA 1F3EA 3QOKA 3OZOA 3I6EA 1OCBA 1RCQA 1K8ZA 3MI6A 4HU0A 3WFLA 2ZRXA 1EXPA 3CASA 1M03A