3UFYA

Akr1c3 complex with r-naproxen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
303
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 303
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ufyA00
1LWIA 3DN5A 4YS1A 2DV0A 3C3UA 5LIXX 4NKCA 4DZ5A 5AZ0A 3P2VA 3UWEA 4WEVX 4GABA 2IKHA 2HV5A 4XVEA 1PZ1A 3EAUA 3BURA 3H4GA 1QRQA 1XGDA 2ACQA 4QXIA 5HNUA 4YVPA 3V0TA 4EXAA 4WDUA 1S2AA 2HE8A 3R8GA 2IKJA 4JTCA 1HQTA 3RX4A 3UP8A 2ACSA 4OTKA 3GHSA 3GHTA 1S2CA 2WZTA 4JTDA 4HBKA 4AUBA 4JQ1A 3V0SA 1HW6A 3LD5A 3O3RA 4R9OA 2BGQA 2I16A 3LQLA 2WZMA 3LQGA 3UZYA 1IEIA 3LZ5A 4JTRA 3EB3A 4GCAA 2IQ0A 2A79A 1J96A 1US0A 1FRBA 4JQ3A 1PYFA 2ALRA 1IHIA 4I5XA 2IPJA 1ZQ5A 5LIKX 4FZIA 4DBUA 4L1XA 4XZNX 2PDYA 3BUVA 3NTYA 2NVDA 2ACUA 4XAPA 3WBXA 5LIWX 1VBJA 1JEZA 3WG6A 2J8TA 4IJCA 3GHRA 2ACRA 3WCZA 3H7UA 4JIIX 3G1RA 2PDPA 2PD5A 1SM9A 5LIYX 2BP1A 1T41A 4ICCX 1PWLA 4GIEA 3UG8A 1MI3A 4WGHA 2PEVA 4JQ2A 3U2CA 3LENA 3N2TA 1EF3A 1YNQA 1S1RA 3RX3A 3R43A 2IPFA 5JH2A 3BV7A 3UZZA 1UR3M 2IS7A 2PD9A 2PDBA 4GACA 4WDWA 2PDMA 4QR6A 4PRRA 4WDXA 5DANA 4FAMA 1YE6A 2BGSA 3R8HA 5JH1A 2PF8A 2PDUA 1Q5MA 4EXBA 3G5EA 4YVVA 3V35A 1AZ2A 4GQGA 1X98A 4LB3A 3B3DA 4XZMX 2FZ8A 5AZ1A 2DUXA 2PDNA 2FGBA 2PDWA 4PUWA 3Q67A 1RY0A 4LBSA 3N6QA 2P5NA 3V0UA 2PFHA 1AH4A 3MC5A 1PWMA 2HVOA 3UZXA 3WBYA 4IGSA 4H7CA 1ZSXA 1Z89A 3CMFA 3T42A 1RALA 3R58A 4QX4A 3CAVA 2INEA 2IQDA 1MRQA 2NVCA 3FJNA 1C9WA 1EL3A 1T40A 4WDTA 1PZ0A 4H8NA 3D3FA 2IKGA 4JTQA 1K8CA 4YU1A 3ONBA 4PUUA 5M2FX 2HDJA 1X97A 4DBSA 3LNMA 2HVNA 2QXWA 4FA3A 3EB4A 4IJRA 3COTA 5KETA 2PDQA 1Z9AA 3Q65A 1RY8A 2IPWA 3KRBA 3R94A 3LUTA 3LEPA 3BCJA 1VP5A 3DOPA 1ZGDA 1LQAA 2PDKA 2HEJA 1ZUAX 4XK2A 5HNTA 3UFYA 3M0IA 2PDLA 4JIHA 2FZDA 1M9HA 3ONCA 2I17A 2HE5A 4L1WA 3MB9A 2F38A 1A80A 2PDFA 4XVDA 2F2KA 3R6IA 4PRTA 1XJBA 1ADSA 1AH3A 2AGTA 1Z3NA 2PDIA 4Q3MA 2C91A 2FZ9A 4YVXA 1GVEA 2ISFA 2PDJA 3CV7A 4JQAA 2VDGA 3RX2A 3CASA 4JQ4A 1AZ1A 1XF0A 4XZLX 5HA7A 5C7HA 3S3GA 2PZNA 1OG6A 3UYIA 3GHUA 2PDXA 3V36A 4GQ0A 4ASTA 1EKOA 4XZHA 3CV6A 2IKIA 1QWKA 4XZIA 4ZFCA 2IPGA 3UZWA 3M4HA 4Q7BA 4WRHA 3FX4A 1EXBA 4G5DA 2FVLA 4PMJA 3LN3A 3LBOA 1AFSA 4QBXA 3LZ3A 2PDGA 4HMNA 1Q13A 2INZA 1S1PA 1AH0A 3M64A 3UGRA 4JTAA 1X96A 3H7RA 4JIRA 2DUZA 3QKZA 4GA8A 2FZBA 4LAZA 3ERPA 2PDHA 5LIUX 3WBWA 4RPQA 1YE4A 4LB4A 3VXGA 3O0KA 4LBRA 1Z8AA 1R38A 1MZRA 3F7JA 4XO7A 2R9RA 4F40A 4DBWA 4FALA 4PR4A 4XO6A 2R24A 2PDCA 3GUGA 4MHBA 3R7MA 1YNPA 2CLPA 3CAQA 4LAUA
chains in the Genus database with same CATH superfamily
3OVRA 4HU3A 3BTNA 4UQDA 1HKWA 1AW1A 3WL1A 2PA6A 3NQ8A 1UJQA 1NELA 4Q32A 1VLWA 3PBGA 5CC3A 1TSIA 4ZOAA 4ES4A 4R85A 2FMNA 3BAYA 3L68A 5AZ0A 3UWEA 3UG4A 4GXWA 1SZEA 2WSKA 2HV5A 4LV9A 2XZ7A 2HMCA 2ISDA 1F4HA 2QGHA 1JCMP 4NG3A 3H4XA 1I0BA 1M68A 4U5KA 1FKWA 3B0PA 1TV4A 3CHEA 4DPPA 4QJ5B 4EXAA 5C9WA 4IQLA 1S2AA 1R3RA 4KFNA 3TTQA 1WCGA 3NM1A 3UP8A 1KWKA 1US3A 1R3SA 2Y8KA 2YXGA 1Q6QA 2JBMA 4R5EA 1RJRA 3WDPP 3P82A 2X0YA 2QUMA 3U8GA 3K46A 1IEIA 3EA3A 3AZTA 2W3ZA 4GX9A 1QW9A 3KZSA 2W61A 3RO8A 1TWIA 2QJHA 4WD0A 4CD8A 3S2CA 3OGSA 1KWGA 1FWWA 3SUUA 1GONA 5D02A 3BGJA 1BVNP 2ZZ7A 3OQ8A 3AUJA 1YQ2A 2QJJA 3WNPA 2FGLA 1TA3B 4CEUC 3TJIA 4NJGA 1S5VA 3KVLA 1HJUA 3NNTA 4G7FA 1TKKA 3QSTA 1JPKA 3SUWA 4FSAA 4LVGA 5LNRA 4NU7A 3GVWA 3GU9A 3G3MA 1P4CA 3GHRA 5CG7A 3TN6A 3IUIA 3VUPA 3NVTA 1WUFA 3B4YA 3E1F1 3PS7A 1SM9A 3UU0A 5A6AA 1UG6A 5GJNA 4LVDA 3R1ZA 1XX1A 4DAFA 3O0FA 5CLTA 3UF9A 2D2HA 4JNZA 3WEZA 1L9WA 3GXNA 4HNVA 3RDKA 1M6JA 4QCEA 1A5NC 4JZ5A 4PULA 1G9HA 2O92A 4R88A 4AHOA 3NQBA 3RG6A 1IXPA 1E55A 4I5UA 1S1RA 3C0JA 2WVSA 5CEWA 3PJWA 4Q8NA 1DIOA 4GACA 1QPNA 1XRSA 4JY9A 3URBA 2ZYFA 1UWUA 5FJRA 4JFWA 3TH6A 4JTFA 1GJUA 1VJIA 3EGJA 3EKZA 3WNLA 4G2DA 4NZCA 2Z4GA 5CGTA 4E6MA 3K4DA 4JHOA 3DEQA 2QV5A 2UY5A 5M03A 4MIMA 4YVVA 3VOGA 5KZEA 1AUSL 2ZZ4A 2J66A 3T09A 6TIMA 2GGGA 2HISA 3DGRA 3TTYA 4AD0A 1DORA 4YN5A 3WZ0E 3BMWA 1RY0A 2QMJA 4BFAA 3B9AA 3V1HA 5BXPA 2NVAA 2PURA 2E9LA 2QPUA 1PWMA 3P3BA 3TFXA 4YYCA 2V5KA 3AHZA 3CLWA 1U1UA 4W7UA 3TZFA 2QCNA 3PJTA 4PN2A 1PSCA 1VBGA 2C18A 1JYWA 2Y5JA 4KIEA 2V8ZA 4Q22A 1E3XA 4M1RA 3O05A 2QCFA 3DUGA 3LSBA 2D0FA 4X22A 4UUIA 1GKQA 3IJQA 4HN8A 1LBFA 1JXKA 1NFBA 4DO7A 3IJ8A 4NRSA 2XGBA 3N9SA 3M5XA 4DYKA 1MEWA 2FPVA 2HROA 3N4EA 4R33A 2EBNA 3W38A 3URAA 3KRBA 1A5CA 5FJJA 2BWGA 3GDLA 1NQKA 5I3HA 2B81A 2HEJA 2ZX5A 1JZ6A 4RDWA 2YCKX 1MQQA 2XWDA 1PUDA 5BWAA 3UT0A 1HL8A 1KD0A 2F38A 3W6MA 1DWAM 2PDFA 1H2JA 3WF3A 4RZ6A 1ADSA 2PS2A 4UR9A 3AYRA 3CUHA 1HL2A 3G22A 2J27A 3HZ3A 2I57A 3EWWA 4HMDA 1BQCA 3UJEA 3VKCA 1VEMA 5L6UA 5AHEA 3OZOA 4RNJA 3R0DA 2O9TA 2B7OA 1JXJA 1PXGA 4YNGA 1AQ0A 3D47A 2DZUA 1JRCA 3ARRA 4PBEA 4FNTA 3GK0A 1TV7A 1UWRA 4W86A 3TAOA 4ZFCA 4LVFA 4AEFA 1K8ZA 2RJGA 2BSLA 3AIQA 3H2EA 2E25A 1WB0A 7ODCA 2CITA 4CQDA 1QAPA 1W5NA 3R25A 3GDRA 3H53A 1EBGA 5CZTA 2XIIA 4KBXA 4JTAA 3VGFA 1IZKA 4LQ1A 3KM8A 3TC7A 1RVKA 1H62A 1R3TA 1DJNA 3H7VA 4GYPA 4AYGA 3CWNA 1MVYA 4W4QA 1CI1A 2CW6A 5DO8A 3F7JA 4Q8WA 2RFGA 4FALA 3PZGA 2PLKA 1OJXA 3S2LA 2PPGA 3GUGA 5HK4A 4YTRA 1X7IA 3CZLA 4RNFA 5I3KA 2F6XA 4MGGA 4W87A 1WBJA 4PTDA 3FKKA 3RRXA 3M0VA 4LALA 3IGSA 3C3UA 1QI2A 3M46A 1TPWA 2F6UA 1ZJHA 2OSYA 2G3JA 4Y9MA 2JALA 4OVXA 2O9PA 1MUMA 1P6BA 4C6KA 4AAJA 4PL2A 2C0HA 2FVMA 3NO3A 4LNYA 4DAIA 3JRKA 4HCHA 3LOTA 3FVDA 1FWIC 4BQ3A 4QM1A 1SJAA 4IHCA 3PC0A 1N8WA 3ATYA 1T5AA 3KLLA 3MHUA 1E6SM 2HBXA 2QUVA 3W27A 5E09A 4L7ZA 1RLCL 5D04C 2ANUA 4DBDA 5G1YA 1PTDA 5LNSA 4H9VA 4MJ2A 3ABRA 3ICJA 1EX5A 4Y8EA 4H2HA 1TWZA 3T0BA 1H63A 1XR2A 3L5LA 4GYFA 2WV8A 2FHCA 3WQOA 3L5MA 3RPMA 4YTSA 2W91A 1KM6A 2YB1A 1I2PA 1B3YA 1WXJA 2GDQA 1CT5A 2CHRA 2VGBA 5A69A 2XH2A 4J3UA 1P5BA 1MZHA 1HKMA 1E5NA 3LZ5A 3A12A 3DAQA 3O63A 3NDZA 1XS2A 3QMRA 3PSVA 3E0IA 1H1YA 1PS9A 4NJJA 5DXXA 2WMKA 4JYFA 3LGGA 2A3AA 1ZLPA 1PYFA 4N4QA 3AO0A 3OVQA 3PTMA 3EA1A 4C1NA 5LIKX 2BVTA 3AXKA 4U4MA 3PVFA 2WPBA 5K9DA 3EX1A 4TX9A 4GUIA 1JZ8A 5FAGA 3KCJA 7TIMA 3H26A 5C54A 1IZJA 2VHLA 5AY7A 1VPYA 4JEQA 2G37A 2OPJA 1BAGA 3BJFA 3FK4A 1NDYA 3XINA 4L4PA 4MKVA 4LANA 1W1IE 2BV9A 1I1XA 3HJZA 4AWEA 1PCKA 4ATDA 4PL1A 2ZUUA 1FVPA 5I77A 1I4NA 1OK4A 3PNZA 1H4PA 1GVIA 5K9CA 2DSZA 2OWWA 2TMDA 4H1ZA 1MXDA 1Y5WA 1BGGA 2INFA 4XAFA 2GQAA 3ZVIA 3KS6A 3N2XA 3FDKA 4TV6A 5DMMA 2PP1A 2ZUMA 4ZE5A 3PJUA 3B40A 4IJBA 4GQBA 4IXHA 5JH1A 3N18A 2ON3A 2DQWA 4C6LA 3HJEA 1YTKA 1QPRA 4A8NA 3W7EA 1D7FA 4GNKB 4PB5A 2CLEA 1B54A 1ELSA 4NAFB 4PUMA 3C2OA 4TX8A 4O13A 2FZ8A 1GVOA 3IJIA 3ARVA 3RMJA 2E1WA 3Q67A 1OF6A 1WDQA 3DFSA 2DQXA 3D6NA 5HOSA 3V0UA 1R86A 1UH4A 3WNKA 4ZENA 2PTWA 1DWJM 3RYSA 2YLLA 4QIUA 3UR8A 4DJDC 3GS6A 5AC8A 3NGFA 5XINA 1K70A 2DSVA 4B2DA 5BMWA 2QZRA 4XD4A 1BQGA 4ZQNA 4PTMA 3VIHA 3DFYA 4L4LA 4GC4A 3GQYA 3URQA 3D46A 3W1NA 1G67A 2DW6A 4AVOA 1P0KA 5FL0A 5I03A 3TAKA 3G1SA 3BAJA 4EACA 3TQVA 4B5TA 1A5UA 2O0TA 3LTYA 3AZSA 3N25A 4XTDA 4IJRA 1KBLA 1W6TA 1I2QA 5C7VA 4OZOA 1UIOA 2WYSA 1G1YA 4QE4A 4W7VA 2DH2A 1Q4WA 3T0CA 4PRWA 1A5MC 1LLZA 3ARPA 3O6DA 3AXXA 1XIEA 1DXFA 3QC0A 2FMOA 2EG8A 4JTHA 4C1NB 1E1CA 3SUVA 1M9HA 4PCNA 2GVJA 2I5GA 1H7PA 3VO0A 1A5LC 3W26A 5E70A 1CIUA 4PRTA 2AGTA 3WKZA 1VJSA 1E9LA 1TMQA 2PDIA 4NRRA 2DFAA 3FEQA 2ABAA 3E0LA 1UR4A 4EANA 1OQFA 1F4AA 1R85A 2V9DA 1QI0A 1JI1A 3OLDA 5T26A 2C19A 2OX4A 5IBXA 1LBMA 3I10A 4WQ6A 4ADTA 5JVLA 5A3HA 3HIJA 3IJ6A 2V63A 1XFCA 4ACYA 1XH0A 3O06A 3SI9A 3L9CA 4B16A 2E68A 1LROA 4PCTA 4U5IA 1MQPA 4H9XA 4Q7BA 2VGGA 4MLRA 1W5PA 3WLLA 3MWAA 2CC0A 2W62A 1I9CB 4GBDA 2CZ5A 3DFOA 2VUYA 4MOZA 2ZRUA 3W24A 6ALDA 4NX0A 2YYUA 2V69A 4E2DA 2PTDA 2VZOA 2PWVA 3QPZA 1WO2A 3SSZA 4Z0JA 1OVDA 2FZBA 4A3HA 4A8LA 4JL2A 1VCGA 2X16A 3W6YA 3GKFA 2WANA 4J27A 5LIUX 5LKYA 3QPEA 2HK0A 1UR9A 4XO7A 3WQFA 3FAWA 1VS1A 4W8LA 1EJVC 3Q37A 4V27A 4JYEA 1QNSA 3THDA 4EIVA 3VDGA 1KNWA 4NUWA 3GG1A 5EBAA 1OEPA 1FKXA 3NG3A 4Q8UA 3IVSA 3NSXA 3T9PA 3CMJA 2XN0A 2QS8A 5DRIA 3E49A 1GUVA 1PX4A 4RJEA 3MVIA 2GPTA 5KEZA 2XIBA 4W5ZA 1FH7A 2A3HA 3LHYA 2QCHA 1SO6A 4AZBA 2V82A 3VIIA 3T7VA 5IXEA 1PJ9A 1RD5A 3GD6A 1CXLA 2FHFA 3LRKA 3S5YA 4R53A 3CZJA 3GIYA 2PAJA 3WQCA 3E5PA 5D9OA 2H8XA 3B06A 3IANA 2E6DA 1LTDA 5AC7A 3WUGA 4HZ8A 3NUKA 3F5JA 3WQ8A 1GNXA 3AYVA 1HW6A 1XI3A 1LCOA 4TVUA 4RZBA 5A6LA 2WM1A 4EP8C 1R3YA 3LQGA 4JAWA 3DI1A 1ISWA 4UTLA 5LXEA 2VD9A 5CXPA 4A2RA 1WA3A 1TELA 3STPA 1RQEA 1XPYA 3VMPA 3ZM8A 1AQHA 4U3AA 4IIHA 5LNVA 3MSYA 3A4XA 5AYXA 3PPGA 4RL3A 4IIGA 2JF6A 1X7FA 3QVQA 1V0KA 2OMAA 3HG4A 2Z25A 3QTGA 5ABEA 2OKTA 2GFTA 1Q85A 2QAPA 4DLMA 4GE8A 4KRTA 1TMHA 2Z28A 4UBPC 2ACUA 4RW5A 4BHYA 3CZGA 1DVJA 1H11A 1IWPA 1SYTA 1IIGA 2REQB 4UTFA 1D3CA 4PGLA 4CN6A 9CGTA 1V7AA 3PPCA 1XIIA 1DXIA 3F4WA 3BICA 4LNCA 2ZE0A 3UG8A 3W87A 3EZ4A 4IIFA 4JTKA 3WDQA 2PP3A 4S2BA 4UCFA 2Y88A 4D71A 4TOQA 4FHAA 1POJA 2Z6IA 2PWUA 1EUAA 1H09A 1LBLA 1OX4A 5I24A 1V79A 5A8MA 1E4NA 5EFFA 1C29A 2CNCA 3A5VA 3L4ZA 3SCNA 2DZPA 3HM7A 3LCGA 1C7TA 3S5OA 1NOUA 4FAMA 2CFFA 3POHA 4AZ5A 1A0CA 3QHMA 4L4MA 1G4TA 4H83A 5DX7A 5FD0A 3C0LA 4ZB5A 5FAJA 3B9EA 1FWBC 4HQVA 4Q8PA 2HS8A 4XIMA 3L66A 2WVVB 3WMLA 3ELFA 1XV8A 4H7VA 1ECEA 4L4OA 1Q8AA 2WC3A 2YW4A 4QNWA 3WNOA 2DUXA 1A50A 1MEHA 2PDWA 5DXYA 5HXMA 3WH8A 2MUCA 1PKYA 1GVYA 1PCWA 3ANUA 1HIZA 4I9AA 5LGZA 3ZFHA 1S5MA 2BOGX 4LSBA 3PZQA 3M0LA 5GNZA 1KTCA 2VFFA 3T4WA 3NQGA 1E71M 4GYPC 4J1OA 4LC8A 4DO4A 3FS2A 2R8WA 3VDCA 4LUSA 4WJ8A 2YBUA 4HSHA 1W1YA 1R46A 2BY0A 4UTIA 3GUWA 1F3WA 2DZXA 1GW1A 1JUEA 3M07A 4JTEA 3W75A 3IGUA 1K4HA 4EAYA 3CC1A 4IGMA 3A13A 5HULA 1J01A 2Y70A 1KFJA 3GVGA 3QXBA 4L1GA 2HVNA 2OQYA 2NWSA 1XIHA 1CLXA 2VFGA 3E02A 2IXVA 4KCWA 3CO8A 4G7EA 2BXYA 3HTWA 3GC5A 2YKKA 1A49A 2IPWA 3B0YA 1O1ZA 4TMCA 3BGGA 3CEPA 2Y8VA 2W27A 2ZDSA 3RF9A 3W70A 3E2VA 3R79A 2E1DA 3K13A 4J7RA 1LJYA 4JIHA 2ZFAA 3VKBA 2CCRA 1A80A 3KRSA 4XTIA 1SR9A 3R0KA 4AHQA 2YPIA 1OABA 3I7QA 3Q4DA 3FJLA 4RX0A 5FJUA 2F9RA 3CIXA 1PV8A 3BW2A 3C2FA 1Q7ZA 4Z2GA 5HPCA 2E8ZA 4AXNA 2ISFA 4C6OA 1GG0A 2BVYA 2I5QA 4LGXA 3CL7A 3P6LA 4OECA 2DIEA 3CZKA 4V33A 5HQLA 3GSMA 4NL1A 3ABQA 1NEYA 5IDIA 3A24A 4ASTA 2Z1WA 1KTNA 1JCTA 1A3HA 1F05A 4LYKA 2OTDA 3I3EA 3MP3A 2OQLA 3OG3A 5D9NA 4HVXA 3C0QA 3N17A 2ZX8A 3O6CA 1HKJA 3FOKA 4ZCWA 3IJLA 3FX4A 3UNTA 2XINA 1H5VA 3SCRA 3OW1A 3O6YX 4HMNA 3WD1A 4UZSA 3A47A 5D9PA 3DIPA 1EJXC 2VZVA 2V5LA 4QITA 3W1LA 4XSLA 7REQB 3VXGA 3G1VA 1B3ZA 3GTFA 1O1HA 1L6FA 4QP0A 5BRQA 3IVUA 4PMRA 3LY0A 3N04A 1U83A 4Y9OA 4U2ZA 3BZGA 3CTLA 4PMOA 3QV6A 3QH2A 4JKLA 3NGJA 4LYPA 2Y4SA 4TVCA 2YB4A 3BZJA 4LAUA 5ABFB 1NFPA 3TE9A 4GVIA 3VOJA 2PBGA 3H12A 3IEBA 2RDTA 5AHIA 3P81A 4GG9A 3K1DA 2YSWA 3WD2A 1GOWA 1JD9A 3TC3A 3D3AA 3CWHA 4WOZA 2X2GA 3L7RA 2G4FA 5DCEA 4WEVX 3FY1A 4HJWA 1C8QA 1TTIA 2CKRA 1F8IA 4J9JA 3PZIA 4YWIA 2R6OA 4GUJA 1O5XA 2HQAA 2E6YA 4KGJA 2Y6ZA 2GQ3A 4DZAA 1MWOA 3B03A 4PH6A 3W81A 2Z27A 3RCNA 2YW3A 1R30A 4G7EB 4IPJA 3PFMA 5AYZA 3PG9A 4HT3A 2WK2A 4QG6A 1RQBA 4I5RA 1RJPA 2QCMA 2ZX6A 3WJZA 4K3ZA 1QNRA 1KB3A 5CC7A 2YZRA 3RM4A 1TJRA 3RMEA 3INPA 3WD3A 2R1PA 2PTXA 3LXBA 5G4HC 3GR8A 5DMNA 1GOXA 1H7XA 4LRTA 2BXVA 2EEXA 3JR2A 3ZSSA 1IXOA 4BQ5A 4RCXA 4CCZA 4IUGA 4HTYA 1CGTA 3OZYA 3GG7A 2PTZA 1P1MA 3WJSA 4X9YA 3EA2A 2Z7KA 2ALRA 3AYSA 3NPWA 4MPKA 4UQBA 3MCOA 3RU6A 4AISA 1ZALA 1XKYA 1UQZA 3TYZA 1QOPA 4PMXA 1UP2A 4DBUA 4L61A 4OUIA 1OCQA 3BUVA 4JCMA 2QVHA 9RUBA 3NA8A 1UR0A 3STFA 3GU2A 5I3FA 1KLYA 1XD0A 3G1RA 1RR2A 4KCUA 2VQTA 2BTMA 4QCFA 1CEOA 2BHYA 2CETA 1J12A 3CM4A 1T7LA 1AODA 2JE8A 3GVRA 4IH3A 4GY1A 3VAVA 4LOCA 5JBDA 4NNAA 1V0LA 4DJFD 1FWEC 3LENA 3L21A 4NI3A 3LPFA 3ABOA 4CNNA 4FPSA 4PMVA 3OU8A 3VDAA 4IP7A 4YL2A 1SZNA 1TO3A 1WYIA 4TVDA 4G9PA 3E0FA 2IW0A 3RCMA 3MA8A 1UR3M 4O1DA 3PTKA 1V8EA 2PUZA 1K9EA 2V2HA 3TN5A 4OGZA 5IBXC 1R9XA 2YDQA 4WDXA 3WK3A 3L4TA 2G8ZA 5C70A 3NJ3A 1GOOA 4Z2HA 4QJ4B 1HG3A 3NZRA 2E77A 4PMDA 3L0KA 3FKRA 3SGZA 2PF8A 4F0HA 2PDUA 4C7DA 1JNDA 5CZJA 4R34A 4BF9A 1XRVA 3AUOA 3H8AA 3WLQA 4IICA 3T4CA 3N6JA 2QDEA 1XLLA 1D8CA 3NL5A 3N2BA 4HOXA 3FCPA 4BS0A 5DELA 5HQEA 3WLTA 3TW9A 4K8GA 4LBSA 1VFHA 3EPOA 3BV4A 3CK5A 4ZXLA 2C71A 2WHMA 1MRAA 2NX3A 4UR8A 4AD5A 2BVDA 3UZXA 1TPFA 2Y2WA 3KL0A 1OZMA 1JDCA 4Q4QA 1WOAA 4UMBA 3T42A 2PTYA 1H49A 3T40A 2QDGA 4AD1A 4HK5A 2GJPA 1JUKA 4AIEA 4LAMA 3H55A 3KL5A 3HGRA 5E6ZA 4EF9A 3OGRA 1EH9A 3PBMA 4RW3A 4HZ7A 2PWDA 4WDTA 2PMQA 1GW9A 5D2XA 2WQDA 1KW1A 1HKIA 5B80A 1I2OA 1C93A 3AHVA 5AVHA 3TQPA 2HDJA 4EK7A 1XP3A 3UJSA 5E9XA 3GC2A 2PDQA 7PTDA 4GJIA 2WZIA 1K4GA 1G7VA 5HNNA 4DXVA 2TPSA 1EHAA 3GAYA 5HNTA 3M0IA 1JL8A 3EOLA 4GZEA 4CNOA 4GIAA 1Q65A 4E38A 2VC5A 3PULA 1E1FA 5D33A 1L2QA 4HN4A 3F5LA 1U5HA 3N73A 2J8GA 2IXUA 1EJUC 3MI6A 1FHLA 5D2YA 3VGBA 4AZCB 2A3BA 1FWJC 1Z7AA 3B04A 3SCTA 3KHJA 3N13A 3NIYA 5C2CA 2GSJA 2PDJA 3TX9A 3CV7A 2VCAA 4NNCA 1UMLA 2VX6A 3ZJ7A 1V3MA 3HGJA 1R5YA 3VD4A 1SFLA 1XPGA 3WFZA 4J40A 4N9BA 4LS2A 3NPXA 3LV6A 2CHNA 5K2ZA 5HNRA 1XKJA 3ZOAA 1QWKA 5BRBA 3OA5A 1BEUA 4TXEA 2WCGA 2ZBTA 3DFTA 2IPGA 4U10A 2ISVA 1KV8A 1Z69A 3PUGA 4G5DA 2CBVA 5GVJA 1QHPA 1D2KA 4TMBA 3TLLA 4PCFA 3LBOA 2HPIA 2VC9A 3M16A 3QEZA 2X41A 2G41A 2BS9A 4JICA 2YZ5A 3DG3A 3M9YA 3RAOA 3LHVA 1KCZA 5LZLA 3RU8X 2VRKA 4GD0A 5C0QA 4TTUA 3UPMA 3HQ1A 1XQLA 3W82A 4OOUA 2ATMA 4LBRA 1T0OA 4Z1YA 4F40A 3BARA 1I45A 4IQJA 3B0UX 3VK5A 1PKNA 1O60A 1TX2A 4GH1A 5REQB 2NUWA 3JVAA 2X1IA 2VRJA 1B9ZA 2WJDA 2ZA3A 4LF2A 3AC0A 1W3TA 4OKDA 4HNCA 2DV0A 3ORWA 2MNRA 4JTGA 4PB4A 3KOXA 1ZJIA 3UR7A 3DYMA 4ALDA 1TPDA 3AS2A 2BY3A 4XZBA 5D2TA 4S3GA 3FFSA 3A3XA 8XIMA 2A6NA 1SJCA 4KEMA 2OELA 4QQUA 4XVEA 3R5EA 4JR5A 2PGEA 1BTCA 2FPTA 3QGVA 1GJPA 2A7RA 3FA3A 3CIVA 3EEZA 1WQ5A 3HV8A 4Z2KA 3O16A 3VIFA 3LV5A 4B91A 4IQEA 4BA0A 2C16A 3GHTA 3DC0A 1CB7B 3EDKA 3OIXA 3KXQA 4AUBA 3EPNA 2P88A 3GDMA 1KM2A 1K1DA 2VFDA 2GOUA 3W86A 4C6JA 3BMVA 3EB3A 4TO8A 3SR7A 4DNHA 1ZBVA 3QV9A 4RXFA 1TCMA 3AXMA 3SY5A 3PB2A 4RK8A 3U48A 3UG3A 4JXCA 3BQ6A 4CQAA 1S5TA 3DFHA 4O1CA 3LLDA 1BYAA 4HSNA 4RLIA 1EJ7L 3QZEA 1IV8A 1XYBA 4QEEA 2J77A 1E9ZB 5BU9A 1IR2A 4Y9PA 3B9OA 5HMFA 1HJWA 4UNKA 1OFEA 3LS9A 4NXKA 1SO4A 4RE4A 1VBJA 1TUFA 5H6HA 2CPUA 2CBIA 3USZA 2VWSA 1JUBA 1EB3A 1TJ2A 1S38A 1IEVA 2Z26A 3WDIA 1XYZA 1KFBA 2FZNA 3I7SA 4AG0A 4GYJA 3MUAA 2WSRA 3U7VA 1TIWA 4L6HA 3UXDA 1KBJA 1MI3A 4IPPA 2WLZA 2R1MA 2DZVA 2GGEA 2HJPA 1N2VA 1ZP4A 3UZJA 5AFDA 3R43A 5FA5A 3NDYA 4UFJA 1OT2A 4ENLA 2J74A 3HMCA 1JZ4A 3UETA 1GVQA 1DJIA 4E5TA 1VYRA 3LXCA 1RPKA 3DX5A 3Q58A 4O0ZA 4QLJA 4FLOA 1YE6A 4PEKA 1JYVA 4IMAA 3GXMA 1XLCA 1J2WA 3TNOA 4HYRA 2J7FA 4U33A 1FWRA 3IUHA 4EXBA 2QHAA 1QJWA 4XBKA 3FAXA 3V35A 4HU4A 1BGAA 1UQYA 2AOSA 3QW4B 4PUWA 3WJWA 4KPLA 3C2EA 1S3TC 1FWDC 2CKSA 1QW8A 2A3EA 2NUYA 2J9XA 3F03K 2PFHA 2EPLX 2WMIA 3OZPA 1GKRA 4AHPA 2WZHA 1S46A 1XRFA 1ZS2A 2UBPC 1HVXA 3CYJA 4AYSA 3BK0A 4WKHA 1P7TA 2EPHA 3UQNA 3SCQA 3AMCA 1UD3A 3FJNA 1WKDA 1C9WA 3W22A 4BI6A 1EYWA 1OK6A 3UXKA 4FNPA 1UPPA 3D3FA 4JTQA 5ABHA 4YU1A 2ZUVA 2HBVA 3VNIA 2RGMA 3LCLA 1N8FA 3WLKX 1O6IA 3V5CA 1EWDA 4XAGA 4RUBA 5CSRA 4FNRA 4CQCA 2JKPA 4JN6A 4IL0A 1CB2A 3ALFA 3Q65A 1JCJA 4OUEA 2ZWZA 2QIWA 2OSWA 3AWNA 3QZAA 3S6OA 4WLCA 1XLEA 1DJQA 3KRZA 2QNEA 3MVTA 4XK2A 4L6DA 2H8ZA 1DL3A 4O57A 3VD5A 3O15A 3DI0A 5GPRA 2ABBA 3W2KA 4D8LA 1ZTVA 3KHDA 2XVLA 3NL2A 1HJQA 3W2NA 3BL3A 4UQCA 3TDFA 5F4WA 1KM5A 1KFLA 2WNZA 5M5DA 2EKCA 4IGHA 1A53A 3GZAA 5I3DA 4K39A 1T96A 3S3GA 2OOGA 2A85A 3PFRA 3HPZA 1SSDA 3TJ4A 2XVGA 2PDXA 2YA0A 5BZAA 1FH9A 3PAJA 2VDIA 2J7GA 4OBTA 3NZPA 1J79A 3W74A 4LPCA 1MW2A 4B5VA 2BASA 5I09A 3KFTA 1QVBA 2J79A 1ZZMA 4B3LA 1LUCA 1I0DA 4JOMA 2C6QA 5KZ6A 1H60A 3BPWA 4X60A 3WFAA 2VX7A 3CUJA 3MV11 4K37A 3VMOA 4IIEA 1AH0A 4I7VA 2WKLA 2GGHA 4JIRA 4O28A 1A5KC 5EL1A 1V51A 4GK8A 1DOSA 1GZJA 1O94A 3WBWA 4LB4A 4BQ4A 3W7KA 4Z17A 3ENLA 3MCMA 1K8XA 2R1LA 1I1WA 2CYGA 3PBUA 4XO6A 2PDCA 3KBNA 4FS9A 5JUVA 1LL4A 1JZ2A 3AWOA 1JQXA 5D8WA 4ZSTA 5FEZA 3DENA 3S83A 1RD6A 1AA1B 1W54A 2CLHA 2O56A 1OM0A 4YS1A 1CGWA 5DQPA 5LIXX 1J0ZA 2WMHA 3SRHA 4AC7C 4AVFA 2QYGA 4PFMA 4MKNA 1R3WA 4O16A 4KEVA 4A21A 2E40A 4JN7A 2DIJA 5H91A 4E3TA 1OYAA 4MM1A 5B7ZA 2IKHA 1PL9A 1EA9C 4DVOA 4LUTA 1OGBA 2FFIA 1CGUA 4GC3A 3V0TA 2RKXA 3GXIA 5FCZA 3EX6A 1YADA 1HQTA 1ME8A 3TLQA 3B8SA 1YKWA 2ACSA 2NSXA 3NQCA 4TX6A 4PMYA 1NP0A 4JTDA 1UR8A 3MJMA 2HXTA 4KESA 4JQ1A 3QYQA 3RN6A 1OF8A 4ADSA 3OGVA 5HATA 2CZVA 4MVAA 1LWHA 4INFA 2ZXQA 3BH4A 5FEWA 4A4AA 4GISA 3GW0A 4IXXA 3QZ6A 1UH3A 3EDJA 3AJ7A 3GTNA 3LDVA 2E8YA 3TN3A 4LWWA 2CLFA 3N1AA 3TFCA 1BWVA 1F3XA 2EHHA 2DIKA 3DFQA 3II1A 3T08A 2WSYA 4EX4A 1PZ3A 1J0IA 3MDWA 4GX8A 3WQ4A 3NAVA 3F1QA 3VOHA 4LCQA 1BYBA 2QR6A 3MQTA 5MKGA 2QUNA 1Q45A 3SN1A 3KOWA 3MUZ1 4FNUA 5FF7A 3KL3A 5I7GA 1UWIA 5EMLA 5LA2A 3P0WA 3TYDA 2QCDA 2ATSA 2E9BA 4UQAA 3H70A 3WLOA 4UTWC 4JIIX 3J7HA 1LUCB 2WHLA 1XYAA 3CMGA 3A23A 2DH3A 4F0MA 2VR2A 2XTKA 1FWSA 3PZOA 4LY4A 1AJZA 3HQOA 1YPIA 2BP1A 3QFEA 2C3ZA 5D05A 1Q2SA 4HTBA 4UFKA 1YTEA 2PC8A 2A0NA 4WXYA 2CBJA 2WLYA 3IIZA 2ZQ0A 4KF1A 4A3QA 2WVTA 3NCOA 1ICPA 1X6LA 2GVYA 3W53A 2E67A 2O4QA 3WMSA 3AU6A 1UC5A 1RBOB 1DP0A 4PMNA 3N12A 4UXDA 4H8HA 1GHRA 1ZAHA 3NFUA 2L5HA 3FXYA 3KVKA 3W72A 1U1HA 3K5XA 1EJTC 3L4VA 1KBBA 3DFPA 1J0JA 4HMCA 2Q01A 3CQHA 1KV5A 4JEJA 4QLKA 5GQBA 3A9IA 4ICNA 3G1DA 5D03A 4DJDD 3TIMA 2DSKA 4M19A 1NM9A 1XLMA 1Q8JA 4QJ1A 2WC7A 3AIEA 3W7RA 4LB3A 8XIAA 1OYCA 2OFJA 1W3HA 3G18A 4GZIA 3HMJG 4OT7A 5F2GA 2NQJA 1V03A 2HNEA 3HA1A 4X2RA 4C6FA 3OBKA 4LUTB 1FHUA 3ZT5A 3PN8A 3ZZ1A 1VC4A 1UA3A 1EGMA 3SUTA 1VZWA 2I9EA 4HNOA 2PLJA 1RQHA 5AC6A 4QX4A 3B97A 2W5FA 3E74A 3VINA 3E12A 4HA0A 4D1IA 3RCYA 2NVCA 5FF3A 3U3HA 3ZJ6A 1YXYA 1DJGA 2V0TA 4ZL1A 4JD4A 3QMTA 3TVAA 4QRNA 4AIBA 2KAUC 4H8UA 4H6QA 1QUMA 1T99A 1CECA 1W5MA 2DZBA 4M81A 4QDMA 4AMAA 4NYUA 3KBJA 4DEFA 5AB3A 2GWGA 1REQB 1ZRQA 1CZ1A 3WQ5A 2OLSA 3VM7A 3R8RA 4AX6A 3QJAA 3WMCA 1L8PA 3KWXA 3LEPA 1ZUAX 1E6PA 3UFYA 4HKPA 5MKGB 3OIHA 3R13A 4Y9NA 1WAUA 3CH9A 4GY7A 3RILA 1TIMA 4P5UA 1H51A 2G3MA 4XVDA 3U0HA 4B92A 3CB8A 3N9KA 3MZNA 2QCDB 4FX7A 4PYSA 3IRSA 4M24A 1QBAA 3VE9A 3ZYZA 1ISXA 2VDGA 4PC8A 1LRQA 1WP6A 1TJ0A 5BCAA 4HPNA 2G95A 1Z6KA 5CSUA 5HR6A 4MY8A 1RPXA 1VCVA 3I65A 3V36A 2Q8LA 2D0HA 2FDMA 3A6OA 1R7OA 3CV6A 4PUKA 3LM7A 2BNJA 3WEMA 4XAYA 3VI2A 3SB0A 4E2VA 5JIPA 1UROA 2V2CA 1ECQA 4PMZA 3PZUA 1AFSA 4FEZA 3WNNA 4HPJA 3APTA 4HSOA 1NWTA 1MW1A 3MKCA 4YWSA 1M1BA 4AEOA 4F0KA 5CH9A 1QXLA 2DUZA 1K03A 4IP4A 3ZXWA 1JZ7A 1J93A 4NAEA 2FTYA 1H1NA 4M29A 3H2OA 3LHWA 4US5D 2D20A 2BZNA 4MUPA 3BVJA 4XV0A 3KBWA 5F2LA 4B4FA 1V3JA 4H6RA 4I6VA 3FVMA 3SCUA 4J2PA 1EOKA 4MNLA 1XH1A 3NXLA 3BMXA 5EMKA 3GKAA 3TXZA 3W3OA 1XLFA 1IYXA 4LV4A 3MKVA 4HHPA 4HHLA 2SFPA 1F74A 4YIWA 2GQ8A 1NP2A 2PSNA 4UTKA 2OZ0A 2YFNA 1V6TA 4NASA 3TOYA 2E09A 3EDDA 2XIJA 4R3UA 2DJLA 1XGZA 3BURA 3D5HA 3TSMA 4WSJA 5ABTA 4S38A 3UWUA 2X09A 2FJKA 4PE8A 1UD8A 4QXIA 4YVPA 4Q4RA 4NI8A 4QG8A 4DYJA 4O17A 2IKJA 3T8LA 1OG0A 1ISVA 2FIQA 5D32A 1ZBWA 3RX4A 3SRFA 3VIMA 3TYEA 5A6KA 2WZTA 1UBSA 2WPGA 4LYQA 3B4UA 1V3KA 3THUA 1P6WA 5CJMA 2J88A 4R9OA 1J0HA 5SWUA 4DWSC 4LVBA 2WW5A 2OO6A 3GTHA 2UWFA 4GCAA 1IQ8A 4O8RA 3SRDA 3IACA 1FH8A 1RA5A 3W1AA 5BYWA 3QQ0A 2E0PA 4ORIA 2OG9A 1K9FA 1O7AA 1KXVA 3EMCA 5AHLA 3VX0A 1PIIA 1UD5A 4FZIA 4O18A 4RZ5A 2PDYA 1S2UA 4O8AA 3RO6A 4MWAC 4F0SA 5D38A 4IJCA 3HURA 1L8NA 4YHGA 2ZA1A 3SCPA 4GRSA 2Z1XA 3PZNA 4WUIA 4FOKA 4DZHA 2J62A 2CEQA 2NLIA 5D37A 4C7GA 2AMXA 1PWLA 3UPBA 4GWEA 1Q63A 1JGIA 2PEVA 1OD8A 8A3HA 2GYIA 1OBAA 4KT2A 2P3ZA 3C5QA 3JS3A 3Q45A 4NAEB 4BI7A 2OT1A 3EKGA 2Q3RA 3T2OA 1WKYA 1TREA 3N3TA 1K7EA 3W88A 1TTJA 3E2SA 1CBGA 1H0IA 3KP1A 1SVDA 3R4IA 1W56A 2PD9A 2PDBA 4RDZA 1YDOA 4TUFA 3TA9A 5D8ZA 1EIXA 4K68A 4PRRA 3WK2A 1IEWA 3R8HA 2WCSA 4UFMA 2ZIDA 4LH8A 5T91A 1V3LA 2NQHA 5F4XA 4OQVA 4JBRA 4B9YA 4NP7A 1EBHA 1W3JA 1MO0A 1UZDA 4L64A 3WQPA 4FXJA 4A35A 1X98A 3NZGA 1FCQA 2XN2A 4DELA 2AAMA 2GUBA 3A4WA 1UUMA 2Q8XA 2OVLA 3B8UA 4N4PA 1JJKA 2AL2A 5F2MA 1WKEA 3M5ZA 3UJFA 2VT0A 1C92A 4U31A 4W89A 1U1JA 3KX6A 4DX3A 5CGMA 2XVPA 2H90A 1Z89A 3WLRA 4LYRA 1PHWA 4IMDA 4S23A 4ZB2A 3CAVA 4M6VA 2IQDA 1NF7A 3FSTA 3O07A 2EF9A 5E5CA 4Z42C 1NTHA 1WDPA 2NQ9A 3OHMB 1RH9A 4KH2A 1TG7A 1EHNA 1V7YA 4GIYA 3C8FA 2OCZA 1EEXA 3GW3A 1W2PA 3ITCA 3UVIA 2YL6A 3KAOA 4W7WA 1KCKA 1NFGA 4EPDC 5A6BD 1OWQA 1KBKA 4J4KA 1YMYA 3W7CA 5U7SA 3FYPA 3U2ZA 2KX9A 2QJMA 3LUTA 3AS0A 1W32A 4UTHA 2GSEA 1KRAC 2V5BA 3MHFA 1FP9A 4IG2B 4BI5A 2XUCA 2PRMA 4AD3A 3KRUA 4GI8A 2WJEA 4Q6XA 2I17A 3FJ6A 3M0ZA 2OYKA 4WJEA 2XM1A 3M7WA 1WXYA 3GXFA 3PBWA 4MADA 4YPJA 3O1NA 2OU4A 2FZ9A 4O50A 4V15A 5FOOA 3Q2DA 3W01A 3HFYA 2ZUSA 2XFRA 1V6UA 3M0KA 4D6GA 1DIEA 2EJ1A 3WN6A 3TN4A 9XIMA 1PBGA 2VC7A 2YA1A 1XF0A 1E15A 1BXBA 3GHUA 2ZX7A 4CKQA 1ZY9A 3DGBA 4Q8TA 1EUNA 1RK6A 4GIRA 5CPNA 2C79A 1QNVA 4IOTA 4WSHA 3G8EA 4EKJA 2B7NA 4Q8OA 3IAPA 4ATWA 4LU0A 3ITVA 2BX7A 4HZ6A 5E0KA 4WRHA 1E51A 5A2CA 5DCBA 4A3RA 1AMKA 1YDVA 4MLJA 3RLHA 1C8XA 1XLAA 4ADUA 4PCPA 5FJIA 1Q7QA 4MNKA 4QBXA 3T55A 1TV5A 2YLAA 1S1PA 1QNQA 3AHTA 5T9CE 3BLFA 3VGHA 4O52A 4Q8QA 1MSSA 1O66A 2GVGA 5IDZA 3RLGA 1TR1A 1A5OC 3CQKA 2WAGA 1BTMA 4N9CA 3U2EA 4ZQOA 4L6OA 4A8IA 1Y5XA 3B0XA 4AZ6A 3GG8A 1I2NA 1XLHA 3O9NA 2BHZA 2ZWYA 3MSDA 4PR4A 1IT7A 2QCGA 1PDZA 1V6XA 4D8ZA 2Z1VA 4RNIA 2AL2B 2CHOA 1KA9F 2Y7DA 2BHUA 3NQ7A 1R2TA 1S5NA 3UR5A 1KRMA 2XWEA 2ZUTA 1LWIA 1GZGA 3IIOA 4PEEA 3C2RA 5G2HA 5I23A 3FDGA 1KXHA 4PTVA 3W7QA 1H5YA 3ES8A 3QY6A 1UWTA 2G3NA 3MI3A 1BWKA 3VIKA 4D6DA 3AXHA 3BAIA 3SQLA 4HCDA 2OQHA 3TP4A 4XKMA 3E2QA 1PTGA 3QMSA 3P93A 1XGDA 4YJ5A 1HP5A 3KVJA 3IAQA 3R8GA 1UUQA 5GJMA 1UP3A 3KBMA 3P67A 1LZOA 3H2NA 1DWIM 4DJFA 1KM4A 1XUUA 4UQ9A 1DIKA 3T2PA 3IJ7A 4GJ1A 1GVSA 1F76A 2WJFA 5A8QA 5CC5A 3NVDA 4LXFA 3BOFA 1TZZA 2C1HA 3MBDA 3QHOA 2OR2A 3OZMA 3STGA 1QTWA 1E9YB 4S39A 4B90A 3LMYA 1NWSA 3W2MA 1OD0A 2QQ6A 1YBQA 3U5UA 1TPC1 1ALDA 1C8YA 1TX0A 1US0A 5ENLA 1YW1A 3WQ6A 4PSPA 1UR1A 1JNEA 5A6SA 1GQLA 4PFHA 4NHVA 3WF0A 1KRBC 2W63A 2X30A 4QAWA 3G0SA 3GR4A 1Q66A 3DKJA 3H2AA 4JCLA 4QEHA 3DHPA 4XZNX 4O15A 3RR4A 4AB4A 4XAPA 4LVAA 1QWGA 4QJ3B 2OEKA 1VFMA 1N7KA 1FCBA 4LF1A 2YX0A 1HZYA 1B9BA 2J8TA 3N15A 2ZC1A 1WZKA 2GJLA 3S9ZA 1QHOA 2Q8ZA 4E4UA 2PDPA 1PIFA 3CPGA 3GH7A 1E6RA 4ERIA 5LIYX 5G2IA 3MUXA 2WKJA 2A1YA 3IGHX 4O1BA 2I56A 5J8LA 5I00A 4U3CA 3N2TA 3G0UA 4KWVA 5LA0A 1RSCA 2NT1A 3GY1A 2WNWA 3L5AA 3RNDA 4AMCA 2YL5A 5CPTA 3PJXA 1U30A 2YCJA 1K8YA 3RUBL 1UWSA 3XIMA 4IFOA 4RPPA 3S2MA 4AZGA 3GYEA 4DUOA 1KCXA 1KLZA 2Z24A 3C56A 3U57A 1XG3A 1QASA 1EQCA 4P7NA 1UIPA 4BZYA 4CVUA 5I78A 1A0DA 2X1SA 3E3HA 4C7FA 4CD6A 3F4CA 1KFKA 4FF5A 2CWXA 3THQA 1W37A 4O0QA 4L9XA 3IVTA 3DHFA 2PWEA 4O4WA 4F2UA 3TK7A 3RR1A 2NZLA 1WNOA 1N8IA 3CU2A 1RP8A 3SBFA 6XIAA 3U7BA 1XIFA 4F9JA 4C5ZA 3R2GA 2I14A 2P5NA 4CNUA 3W9ZA 3MC5A 2NX1A 2XGIA 4DO5A 4CQBA 4IPIA 5AN7A 2YCLA 1O5QA 2X8RA 1OFRA 1G0CA 4N2YA 1EGZA 1RALA 4HPXA 1F8MA 4AWSA 1EPVA 1GORA 1HP4A 3E9AA 1TV2A 3WQDA 3GBDA 2CZEA 3F2DA 1QI5A 2P1FA 4MKSA 3OPSA 4C6IA 5AC4A 4M1BA 3TTEA 3HV9A 3L12A 1DV7A 3IARA 3EMZA 2IKGA 1E0TA 1X6NA 1W9UA 1RP9A 4B4HA 3ZMRA 3LNMA 1DYSA 4ORMA 3QGKC 2RGLA 1L2UA 1E9IA 1Q6CA 3COTA 1YBQB 1D7KA 1JD7A 3V7PA 4UQEA 4NXSA 3BXWA 2XH4A 2QCCA 4C6DA 3AOFA 1V77A 4FMVA 2X0SA 4B5UA 1VFUA 3MBFA 2GGIA 3CHFA 4NAFA 4A05A 2PDLA 3H21A 1QK2A 1B3OA 3UWVA 2VC6A 3EMQA 3QOKA 1FUYA 4S3EA 1NWRA 2X0HA 3TJXA 5JIWA 5CSSA 4DZIA 1BVWA 3WUBA 1AH3A 3W1RA 5CAKA 1SZFA 2OJPA 5K7JA 5FESA 2B4GA 3A3WA 4Q3MA 1RAKA 2PB1A 2R91A 2QPXA 4FOJA 4JQAA 3UBPC 1UKPA 8CGTA 3CQ0A 2DT2A 3A3HA 3EX4A 4B5WA 1B0IA 4Q4OA 4M56A 1OX6A 3UG5A 5A1AA 3W7IA 1UZHA 4IIBA 1M3UA 1UR2A 4MDPA 3UVAA 1FHVA 3FNDA 2GDVA 3LYEA 2J7DA 1XLDA 1ZB5A 2QF7A 1YPFA 5A6TC 3B8DA 3QRHA 3D0CA 1SMDA 4LEFA 3GFYA 4QNEA 1TVPA 4WJXA 4F4RA 4ZVJA 4CU6A 3E0WA 1SO3A 4JX4A 1BKSA 1KR1A 1SW0A 3HBLA 4QHRA 5H8UA 2EGZA 1J9YA 4UNIA 3W7JA 1HUVA 4A3UA 2VR5A 3NO5A 1F7BA 4DXXA 3C4UA 1W9PA 3ZT7A 1X96A 3N14A 3LG3A 1VLIA 2P8CA 1ITQA 1A5BA 5CJNA 3PTDA 3MHGA 4H2CA 2PODA 6ENLA 4LCSA 3G0XA 3CV1A 5CPQA 1YE4A 1ICSA 1CNVA 3SIZA 1ODZA 1RVGA 2V81A 2HWGA 3M41A 4DO6A 1E0UA 1MZRA 3AIWA 2BB0A 5IFPA 2YL9A 3BOLA 1XLGA 2CLIA 4Z1CA 3LGDA 1KXTA 4YTUA 1TVLA 2YCLB 1VYPX 5KZMA 3F2CA 1DHKA 2PZ0A 2CLMA 5L9FA 2Y5EA 1S2TA 3KTXA 4I8DA 4JKMA 3P2VA 1UMYA 3EWXA 4ERGA 2I5IA 4NZ4A 1OFBA 3E2RA 4MAVA 2WM0A 3MYOA 5A2BA 3S42A 5AYIA 4REQB 3H4GA 1US2A 3S1GA 2RDWA 3GDTA 3QR3A 1PKLA 2PGFA 3LRMA 1ZNNA 1TPH1 6TAAA 3GHSA 2WB5A 4XUGA 1V6VA 4J3ZA 2JKEA 4H6EA 3W7PA 1K7FA 4FI4A 6A3HA 4R7OA 2J7HA 3V0SA 4A29A 3KLKA 3RJYA 3FSUA 2YR1A 1YLVA 1M04A 4E8GA 2I16A 3LQLA 5CSYA 2CU0A 1TQXA 1S2WA 4OFCA 3KTCA 1EFZA 2NXHA 4ML4A 1LQ2A 3C2VA 1XRTA 4A8RA 2QGYA 3KDNA 1T8QA 4HNNA 4RV8A 4MYAA 4UIOA 5G4EA 3OVGA 3IIPA 4GJJA 1FRBA 1F6YA 2UY2A 1K77A 4I5XA 4JHMA 1GG1A 1YNYA 2O7QA 3WK1A 4R27A 2CLKA 4L1XA 2NXGA 3VOFA 3S5NA 4DUVA 1JDDA 4FP1A 1JCLA 3TROA 3IV3A 3CUFA 3DHDA 2ACRA 1LORA 1NOWA 3W1UA 3PZ9A 4Z2IA 2YA2A 3MMUA 3EXTA 5DT7A 4JTJA 3N6HA 2J24A 3ZQ9A 2BXZA 5DY3A 5IHRA 5BXTA 3OBAA 3VOCA 1WZLA 3WY1A 4I90A 2FH8A 2P3EA 3U2CA 4ZQRA 1W2VA 4QGCA 5A6JA 1EF3A 3UA3A 3MSRA 4X9SA 2ZKMX 1XYMA 4FNQA 3GNOA 2PP0A 3MMDA 3GXDA 4ZOEA 4OE7A 1XXXA 4KERA 1ZCOA 2UV8G 4WDWA 2PDMA 3EWUA 3W76A 4UTMA 5BOEA 1S2VA 4QR6A 1KCLA 4FX8A 5C2GA 4DWDA 3FN9A 4MZYA 3M0HA 4GQRA 1VQTA 2F8QA 1EF2A 4UOJA 1OC5A 5DRCA 1J0KA 3K4WA 3MUCA 1E6XM 3W1TA 1TZ7A 2WC4A 4CVWA 2VELA 1K3UA 4MB4A 3MCNA 3A5FA 1JDEA 3FXGA 2E5DA 3B3DA 3UCCA 5GNXA 1OIMA 5LXXA 1Q3NA 4D6EA 5M3WA 3BSMA 1DIDA 3RXZA 1B2YA 2REQA 4FXRA 1LG1A 4HZMA 2C1IA 5F1UA 4LAKA 1G7UA 1M65A 4D6IA 3NQFA 4E3VA 1Q6EA 3LSCA 3WK0A 3AYTA 1W3NA 3N11A 3VNYA 3VIPA 4G6CA 1FWGC 1XSJA 2D23A 5EB8A 2PWHA 2VR4A 3GZ3A 2VEMA 1DWGM 1OCNA 4O12A 5B7YA 4Q4SA 1FWNA 1MYRA 4WY0F 3ITYA 1M01A 3KW3A 3VKDA 3BG5A 4NF7A 4AFYA 1AJ2A 2HVMA 5ABGA 4B9ZA 1T40A 3WNMA 3N19B 1OFQA 1ZENA 1PO9A 3R10A 2VCBA 5EMJA 3QOMA 3HPSA 2ZXDA 1M7PA 4W88A 1JCNA 1R2SA 3TV8A 2RH9A 3K8LA 4Z0SA 1QO2A 1Z9AA 3MZ2A 3DZ1A 3SW6A 2ASHA 4AIUA 1DHPA 1QATA 3ARTA 2Z7GA 2P8BA 4X2PA 2WVVA 1L6YA 4RE2A 2FTPA 1BPLB 2YYTA 4M8UA 1WOBA 1VCFA 1EGVA 5DBTA 3T81A 4BF5A 4I6KA 2OGYA 1ZAJA 4U2YA 1R47A 4G8TA 1LLOA 3WIJA 2XDFA 1DWFM 1OB0A 1QPOA 3N3MA 1CXKA 1XYLA 4JFUA 3TONA 2WNQA 3KBVA 4ZO9A 2XM2A 2OZ3A 4YVXA 4HPGA 3VNDA 4GGBA 1L0PA 1GJWA 3LA4A 3G24A 4OJYA 4F79A 1UP0A 2PI6A 1SFJA 4I7UA 1LP6A 4JQ4A 3ALGA 4JX6A 1CDGA 2VEPA 3CQJA 3PUDA 3RPTA 4AZIA 4XWUA 3UY8A 3V5OA 2ZADA 3SCWA 5LA1A 1RLDA 5H1WA 3NZQA 5AKQA 1JAKA 1EEPA 3CL6A 3QY7A 5TAOA 3ANVA 4F8XA 2IKIA 2OSXA 4LY8A 1B3XA 4X61A 3CUGA 1V02E 3EDEA 4PMQA 3UZWA 4H00A 2Y7EA 1XW8A 5HUOA 3MDUA 5HR7A 4AXKA 3RM8A 1BF6A 3TMLA 1DBTA 1JPMA 1OCBA 2GLKA 1TCDA 3NQ2A 1XIJA 3LZ3A 4WHBA 3M1ZA 4W8BA 3B8VA 2GDUA 3PZVA 2BLEA 3CHVA 2W67A 1AVAA 1DTNA 4RXGA 2ZRVA 3EWCA 1UWQA 4GA8A 2JFEX 3WD4A 1FDZA 1JQVA 1H7OA 4JY8A 4RPQA 3FA4A 1ZFJA 5CC6A 5AC5A 1TJPA 3VUSA 3O0KA 4LW7A 4C6NA 2WOQA 1VHCA 2XJ7A 3VTRA 1VYSX 3LTSA 1G4EA 1G5AA 4HU8A 3MUY1 5BMXA 1XDLA 1RHCA 3CAQA 4GFIA 4HD5A 1OHLA 2NV1A 3L65A 4ROPA 3VABA 4S3FA 4MY1A 3QSRA 5IOBA 3U5YA 1JCXA 1MNSA 5I0DA 1W8SA 3NQAA 3MMWA 4GFSA 3ZSTA 1AW2A 1PDYA 4K36A 3G6LA 2E6FA 3S47A 1HGYA 2VZSA 4HCLA 1BRLB 1ML1A 2J4GA 1PE1A 1YPXA 2QDHA 4LAOA 2E6AA 2R1NA 1OY0A 2ZTJA 1EO7A 1E4LA 3PP7A 4P7OA 4FOUA 4MY9A 1JDFA 3AZRA 4ZGYA 1B31A 3LTPA 2JEPA 2HE8A 5BW6A 2PU0A 2VEIA 4B15A 1FWCC 1M7XA 4L80A 5K4ZA 2JEQA 4I7WA 1JAEA 5LSMA 4LEQA 2G0WA 2YDAA 2OEJA 2XFYA 2WQPA 4H9YA 3NSNA 1IXNA 1E4IA 3TTSA 3S1UA 3O3RA 3KWSA 7REQA 1NDZA 3ZLHA 4JPGA 3UEQA 2Y85A 3W7GA 2WSQA 5IM51 3AU2A 1OYBA 4HK7A 4JTRA 1ZBCA 5FI8A 3UESA 2OZ8A 3W37A 5A2AA 2FYMA 2A79A 1IIHA 1QOXA 3BJTA 4H7ZA 1U5JA 2PWGA 3W4RA 5BOOA 1J18A 5ABFA 5G5IA 1HGWA 1LT7A 2ALDA 2DT1A 1OCJA 2ONEA 4P2VA 4DJDA 1QDSA 3SADA 1ZQ5A 3S4TA 1HFBA 4XD6A 1CLVA 3M0XA 4E8DA 1E4MM 4GOAA 2VURA 1P0EA 4KRZA 2NVDA 2BOEX 3WBXA 2VRQA 4JIQA 4Y9AA 4BJHA 2ZZ2A 1YDNA 2CZDA 1OINA 5E0FA 5HWJA 3APGA 2R82A 1O5KA 2PLMA 2XSXA 4O4VA 3B05A 3WQGA 2HXUA 3MYPA 4RDYA 1V6WA 3QGAC 2QAFA 1LWJA 5A8OA 4XX6A 2GOKA 5D9MA 4W5UA 3MTWA 3LNPA 4LS1A 4O54A 3W2UA 1FX6A 2R1KA 4B5SA 3ZVHA 3C2YA 3A9BA 1N55A 5DY2A 1S3HA 4KS0A 2IPFA 2OYMA 3ARSA 3W7NA 1XCXA 2G97A 2PU1A 4YHEA 4ATLA 3F2BA 4R7JA 2J78A 1LM1A 4TU1A 5DANA 1V4YA 3APYA 3PWGA 3MPGA 2HK1A 2BMBA 3VFCA 1G69A 3VCNA 3XISA 4F2BA 2QMKA 2Z0IA 3HB9A 3PNUA 2DSUA 1MFVA 2VCCA 4Q8VA 4GQGA 3EOOA 4XISA 1UW9A 4P8WA 3KBSA 4NT0A 3EXSA 1MW0A 1BYCA 3G77A 2YIHA 1H7WA 5F4SA 4QG9A 4DJED 4HA1A 3RFAA 3N4FA 3F4DA 1JPHA 4IGSA 1ZSXA 1C91A 3I6TA 3N2CA 4N6EA 3W23A 2OWXA 2OWCA 3L0GA 1TE1A 3MANA 3S1VA 2DZAA 4HGXA 1B4EA 3KE0A 2AL1A 4D2JA 2EO7A 4ZR8A 3MO4A 4M6UA 1W0MA 3DU0A 3M0YA 2ZTKA 1W3LA 4JGDA 3UCQA 3FEMA 3FIGA 4HHHA 1Q6GA 2W66A 1LYXA 3A22A 1NARA 3GFZA 1EZWA 2VENA 1EC8A 1TWSA 4O14A 4FR1A 4L65A 4XD3A 3PG8A 2Z1KA 3AXIA 4PB3A 4GLEA 4F3HA 2PDKA 3RJXA 2AAAA 2J7BA 2NSOA 3C86A 3L4UA 2FDSA 3GDKA 1IEXA 4Q6JA 3MI2A 1R0MA 5J5DA 3A21A 4M3PA 5C71A 4US5A 4XIAA 1QHZA 3NWRA 2WMGA 4D8AA 2CESA 2NX9A 5G1MA 3PK7A 2VTFA 2QV4A 3BOXA 2H6RA 3EX2A 2FTWA 1Z3NA 4QTGA 1O4UA 1SJDA 3EOSA 2C91A 1XDMA 1GVEA 1PKMA 4UOZA 1IGSA 3TQKA 1DQXA 4WSKA 3CLMA 4FLSA 4XZWA 2QCLA 3GX9A 5DMLA 3M0JA 1X6UA 4DY1A 3TWAA 2B7PA 4ZE4A 3EB2A 1LOLA 1M7OA 2EAWA 3BC9A 3V3WA 1HKKA 1LRTA 7A3HA 2J7EA 4X0VA 4P8XA 2XSBA 3NSMA 1VBUA 1QPKA 3ZVHB 3VMNA 4NSBA 2G3FA 3PM6A 4HP5A 3IIVA 3ARQA 1ZU8A 3OLEA 2RDUA 3BE7A 2J7CA 4AW7A 4C90A 4H9MA 1DJYA 5JXQA 2YBVA 3POCA 4XBSA 3W7OA 1BSIA 1CXEA 3WFLA 3LHTA 2INZA 4Y96A 3T1GA 2XFWA 3QC3A 4GINA 5F7UA 4ZOBA 1KFCA 4HMEA 4UFLA 3K2GA 4W9TA 5K9XA 3TKFA 1YXCA 4WXZA 4MB5A 4YTTA 1NIUA 2D22A 2YGYA 3BGAA 2GZXA 3NL6A 2RJHA 1YX1A 4GI6A 3UY7A 2X7WA 1HL9A 4J3VA 2YFOA 3ANYA 4POCA 1K02A 3FYYA 3PBYA 2YXOA 5D09A 3S2JA 1M41A 2ESCA 3VNZA 3DG7A 5CLWA 5EMYA 3IPWA 5TF0A 2ZZ5A 4IMCA 2GWNA 4AZCA 2X1RA 4V28A 2CLPA 5FSEC 1SO5A 3BCFA 2FZMA 1MDRA 2WWDA 3REQA 4Y8FA 4S3JA 1KFWA 3WL0A 3WQWA 1RUSA 5AVNA 4NKCA 4LUIA 1TPEA 3NQ6A 1V3IA 1KKOA 1F07A 3H2CA 1C9DA 4GABA 1ZHAA 1BXCA 2NXIA 1Q6DA 3SCSA 3TC6A 6XIMA 1FWFC 4CD4A 3T0AA 4ZTYA 2I1OA 3EAUA 4DWSD 4GGHA 1YDYA 4W8AA 1ME7A 4IMGA 3GVVA 4MNMA 5AYYA 1VIZA 2C8NA 2QDDA 3SAZA 3BLOA 4S3CA 1E5JA 4A2SA 3QW3A 1Y7VA 3TTOA 2RAGA 1XBXA 2UZ9A 1MW3A 3TJLA 3SIMA 1HXJA 1G6CA 4HBKA 4GXMA 3TA6A 4IZGA 4J35A 3ARZA 1NJJA 2ZUNA 3AS1A 3JW7A 4OHQA 3VFLA 3W85A 4S3AA 1VEOA 1V3HA 1XINA 3SECA 1QW7A 3GVQA 4MWAD 4CU7A 1XGEA 5REQA 3VOIA 3GC4A 2PLCA 4E2BA 5FJOA 1FDJA 3UJ2A 5CJ5A 5BXSA 1O68A 4C6PA 1QT1A 3C61A 3MJYA 4KEZA 2X40A 2OX1A 2DJXA 2TAAA 3FLUA 3W83A 3GNXA 2WSPA 2ADAA 3LCWA 5FF4A 2PF0A 2XIQA 3WQEA 3VKJA 1HKVA 4NX5A 4W84A 4ZO7A 2XH0A 3ZO9A 3R11A 3SEPA 3OYXA 1F9CA 3UZ5A 1JZ3A 1GOIA 3UNDA 3QV7A 2AQVA 2PBOA 3G6MA 5FKYA 5D30A 2ZVIA 3I68A 3UJRA 4UFHA 3EXRA 1XSIA 4Y90A 4PSRA 3VIGA 3MO7A 4MNJA 2VXNA 5TQLA 5CBBA 4ICCX 3IUDA 1W91A 3E6EA 3IS4A 2G50A 3LCIA 4BKNA 1RCXB 1X38A 2VGFA 2GVEA 2JGYA 2Z2BA 5CQ1A 1UD2A 4HPHA 3L2IA 5T9BG 3C8NA 1EJRC 3P14A 4KWOA 5A6BA 1E43A 3TEVA 3DDMA 4F9DA 3S5ZA 3EWBX 4RZ4A 2J25A 3S9IA 4ZA0A 1VFLA 3CWOX 5I3GA 1XYFA 1SZGA 2ZCGA 3GXPA 1XUZA 3ARWA 5H8MA 3CAWA 3T78A 4E4PA 2E5BA 1XISA 3REQB 1H7RA 1UKQA 2V5DA 2BVWA 4K38A 4IM4A 5DLCA 4FIQA 1TYGA 4CLMA 4Q4PA 3RK8A 1V5XA 4BWLA 5MF5A 2DZWA 1UZ1A 3P8JA 2TRSA 1GWJA 3LERA 2WKGA 4J28A 4AEEA 4G56A 4CNTA 4QDPA 1JI2A 2EXOA 1ITXA 1J10A 2P0IA 4KGLA 3B0VC 3WBYA 4A22A 5PTDA 1AW5A 2Y89A 2ZOXA 1JGMA 3BCDA 4QSHA 1VAHA 2V30A 2PCEA 4KKXA 2F2HA 2OODA 3UD6A 4H41A 4CCCA 1MRQA 4KWSA 2DT0A 4AIOA 1TWWA 1IWAA 3GIPA 3SQMA 1JF5A 3UW6A 1DJWA 1P1XA 1Y0EA 4FA3A 1EWEA 4MZ8A 4WKAA 3EB4A 2CXGA 1Z32X 1UUOA 1I8JA 3OHIA 4CD5A 3LB0A 1EX1A 4AF0A 4OV9A 3WLSA 1J11A 2B7QA 1CXIA 1UOKA 1QU4A 1NWUA 3DOPA 4C6EA 3CO4A 3IK4A 3NEVA 2QJNA 3GFXA 4DPQA 1M7JA 4JFTA 2GQ9A 3ONCA 1SPQA 3EDFA 3H24A 2FJUB 4ZO8A 3ZJ8A 3UCDA 1Q6FA 1HO4A 4C6CA 4D1JA 4FIRA 4O1EA 2R14A 1P0BA 1QNPA 4K8EA 2Z6JA 4WR3A 1Z42A 3B9DA 4ZODA 2V3FA 2DPEA 2G5WA 1XC4A 4EOUA 3CASA 2KZHA 5LHEA 5C9ZA 3DG6A 5FL1A 5IFTA 1EIBA 1U2YA 1B57A 2XH7A 3VNMA 2DSWA 1A5SA 3STEA 1IXQA 1ZCCA 1U22A 1SR0A 2CXEA 2Z00A 1DPMA 3P7YA 4ONVA 1IR1A 2DW7A 1L6SA 4UR7A 1MFUA 3ECQA 3R89A 3S2NA 4ZMGA 4FX6M 2E28A 3LN3A 1LG2A 5E6YA 3TMQA 1J6OA 3VU2A 4KQNA 3ITTA 1KO0A 1EP2A 1Y5VA 4CNSA 1ONEA 2NV9A 1XFBA 5RUBA 1E56A 4GMEA 1V6YA 4OU1A 5CPOA 3UYCA 3L2MA 4LAZA 1RXOB 3T07A 3QR0A 5GJPA 1B5TA 2A3CA 1XC6A 1BYDA 4OBRA 4LCRA 2QULA 4MFDA 4MB1A 2R9RA 4EPKA 2IMRA 3G1HA 1GOMA 2AQOA 3O8AA 5BWFA 1UPMB 2VEFA 4KWWA 3GAKA 1EC7A 4MHBA 3TWBA 1SFTA 4IWWA 3NQVA 3QHNA 3BDKA 3VCCA 2ZXAA 4UB9A 1H7NA 1VFSA 3V16A 1M53A 3VDBA 1B30A 1MUCA 1ZJBA 3OODA 1GOQA 1V08A 3TSDA 4MZ1A 4DZ5A 5EY5A 4US6A 4IFRA 3PUEA 1OC6A 3R12A 1XIGA 1AK5A 2YJQA 1QI3A 3TZNA 3P74A 2PRHA 2OXNA 4YYFA 2HPMA 3P80A 3VZZA 2TODA 3HU7A 3BW4A 4IPLA 4P8UA 4WCJA 3S5SA 1R9YA 2ACQA 3NPUA 2ISWA 3CB3A 4Z1BA 1W1A1 1WE5A 4NILA 1G01A 3G1FA 2Y0FA 4TTGA 4AF0B 3IJ9A 4EE9A 3EX3A 1F5ZA 5KSWA 5EU9A 1NDWA 3VGGA 3KEHA 1X1ZA 3T2QA 1QBBA 5KMYA 1OGSA 4AC1X 1UD4A 2A3LA 1RZMA 1E0WA 3LU2A 1V02A 2W6RA 3CNYA 1GVFA 5BRPA 1BF2A 4IL2A 3NOEA 3RHGA 3LHUA 4DIAA 2PGWA 3H22A 4FF7A 1UC4A 4GCXA 3EWYA 3VC5A 3MMTA 3BLIA 1FFQA 3S46A 1BFNA 3VD9A 2C0AA 1EYEA 3G8RA 1XIDA 4QFUA 3LLXA 3QYSA 3JU2A 4S3BA 4JQ3A 2ZRWA 1E40A 3NXFA 3W2LA 4N9EA 1VFOA 4N6FA 1W5QA 2OT0A 1TPVA 3KCLA 3T0TA 4O53A 1AQFA 2WZEA 2ZICA 5IRPA 3IK2A 2WJZA 2EPKX 1AL7A 1DJHA 1RBAA 4KEUA 3FGCA 3QLLA 2VZUA 3P8IA 2OYLA 2W79A 1ZL1A 3CHDA 1B1YA 4LFYA 3S6DA 4DF1A 1A3XA 2VDHA 1ITCA 1OT1A 3U4AA 3BLLA 4E8CA 1V0MA 3GLCA 1UWAA 4LBUA 4C91A 5EA9A 1PIGA 2GGJA 5FF2A 2C1GA 3CPUA 2B31A 3UZZA 4YCPA 2IS7A 3F4VA 3WDHA 3VZXA 4EF8A 1IT8A 1FBAA 1KTBA 3TXVA 4FXSA 1FTXA 2H9AA 2GK1A 2XYLA 5FSDC 4J3TA 5I5RA 3MSGA 1VRXA 5HMSA 4NY2A 3A4JA 1THFD 1TTQA 1XBVA 3MW7A 4KWUA 2AKMA 4BY3A 4M0XA 2FB3A 3U2OA 1OSEA 1E1CB 5T8GA 2IQTA 1P6CA 1GKPA 1UD6A 3OJGA 3AISA 4EXQA 2TYSA 2Y61A 3DECA 4JFVA 1P0DA 3L0NA 1P48A 2JKAA 2W9MA 5A95A 3GYCA 3P60A 2D73A 1Q4NX 3KOYA 2YOCA 3OA3A 4CNPA 1D9EA 3PTQA 4IQDA 3N2OA 2OEMA 2BBFA 1RK5A 4JTUA 2GSHA 4R9XA 4EPEC 1VD6A 1XYCA 3QM3A 5KINA 2VEKA 2XPKA 3GIQA 1UH2A 2Y7GA 4AD2A 2EPOA 3CYVA 1EL3A 4L5ZA 4FNSA 3N9RA 2J6VA 2QPSA 4F0RA 1VB9A 1HNYA 5XIMA 3V1PA 4MWAE 4GZ7A 3NPVA 2V5JA 2V5CA 2HRWA 5FEXA 2QXWA 2VL4A 2D0GA 4FR6A 4AU0A 5KETA 2E4TA 5C8BB 5XIAA 1C7SA 1AG1O 1VPQA 1ZGDA 1KBIA 3KCOA 4WIWA 1SU5A 2CIPA 1P43A 3W6LA 1JPIA 2Q02A 1J6PA 4P7QA 5DMYA 4G1NA 1BXNA 3A64A 5CZ0A 4J2MA 4I8YA 4GNVA 3DYPA 3NQMA 1GHSA 2FKPA 4S1FA 4DUWA 4GUFA 1FQ0A 1NQ6A 2V2DA 3USBA 3DXIA 4EWND 1WDSA 3E38A 2C15A 2FGZA 3UWZA 6CGTA 1W9BM 2YCIX 5DN1A 1OX5A 4X3ZA 2A4AA 2DUAA 4NYYA 1H61A 2V6AA 2OOFA 5J5RA 3RX2A 1CPUA 1SZRA 1W17A 5LNWA 2JGQA 3FGCB 3CS2A 8TIMA 4BF7A 1MEIA 1LOSA 1C8VA 4XZLX 3HQPA 2CLLA 5FEPA 2NW0A 1T6MA 4PBGA 3UYIA 1H3GA 2X1TA 4IPNB 1EKOA 1DEDA 4DHGA 3GM8A 4G1KA 4AX7A 1HF6A 2VO5A 4XZIA 4NVTA 2HS6A 4K6AA 3NM3A 3M4HA 2I9UA 3B8IA 4V1YA 4NZ3A 5ECVA 3P0XA 4PMJA 3TR2A 1E72M 3AMGA 5HJYA 2WMJA 1REQA 3MWCA 3HOJA 4BCEA 3ZLGA 3ID7A 1HJVA 2H9AB 2GK1B 2FH6A 3M64A 1HT6A 2ZRZA 1FXQA 4DUXA 1E3ZA 1TJ1A 3WQVA 2VFHA 4H3DA 3L2LA 1VKFA 3LK6A 3QN3A 5A94A 3VIOA 2DY3A 5D2VA 4GQQA 1R38A 4NZFA 4DBWA 4GVGA 4CUCA 1QPQA 1W3KA 4WK9A 1FWHC 2R24A 3MKKA 5KZDA 3GU1A 5DCDA 2NQ5A 3I3DA 4TR9A 4MDOA 1LL7A 3HPAA 1F2JA 4PODA 1ONXA 1MUWA 3HG5A 1RCQA 1C3FA 1D8WA 3ZWSA 3SM0A 3CH0A 2DGAA 2VX5A 3VD3A 3K8MA 3W28A 7TAAA 4L56A 1W9DM 3LXAA 4MG4A 3QTPA 4RE0A 1PAMA 4OBSA 4P8VA 3RPDA 3GG0A 2FHBA 1QRQA 3BW3A 4GVFA 2QUUA 3T6CA 4XG1A 3HGOA 3M47A 1SMAA 4FLRA 5HJLA 2HNHA 4GVHA 5C9UA 1OZQA 1S2CA 4BWLC 3C3NA 1VH7A 5EKYA 3I4KA 3IGXA 4PUDA 2O9OA 4M80A 1OX4B 1HTIA 1WDWA 4AY8A 4ZZ9A 2DZTA 5AECA 2WZMA 3UWYA 4OWGA 4MMWA 3T44A 1KGUA 2IQ0A 4QQ3A 1DTUA 1W5OA 1MMFA 4X0NA 3THAA 1HJSA 3WLMA 3CBWA 3OBEA 2OLHA 1TE6A 1GOKA 4QSFA 2V3DA 4S3DA 2D2OA 3CTTA 4ZQPA 3ZLFA 3PBVA 3EWZA 1YTDA 3N29A 5A6MA 1UKOA 5LIWX 4M51A 4RDVA 4C60A 3AFBA 4AWTA 1JEZA 1Q6OA 3AAMA 3CT7A 3O2LA 3W1QA 3WG6A 3H6OA 2O9RA 3RM9A 2XVKA 3H7UA 1WXZA 4V1XA 2P0OA 2WMFA 4Y2WA 3P5ZA 1ODUA 2X7VA 1KXQA 1ZPTA 3VM5A 3OLIA 3QY8A 1T41A 2E9MA 1WBHA 4GIEA 1KFEA 4WGHA 4JQ2A 4LUSB 2XVNA 3W25A 3SN0A 1YNQA 1CXFA 1V0NA 3RX3A 1QOQA 1SW7A 1A5AA 3RRAA 1DKWA 1FA2A 2NLYA 3UR2A 5JH2A 3ABSA 3LPOA 1YEYA 3TCEA 3F4NA 1JF6A 3LMZA 3GDBA 1XCWA 2ODOA 3H23A 5U4NA 3WH6A 4PTNA 3M6DA 4PUEA 3DH7A 1J5SA 1Z44A 4JIPA 5CPLA 1UYQA 2GVLA 1E0XA 5LYRA 1AZ2A 4GO9A 2WCAA 5BXRA 3S8HA 4L9ZA 3W1PA 3VNKA 3AMLA 1QFEA 4RNHA 1Z41A 3KS5A 4LUYA 1R6WA 1XBYA 3WDJA 2HVOA 3H2MA 1GPWA 1YRRA 5HJXA 5TD4A 4QAIA 1CGYA 2YBTA 3CMFA 5AHNA 4CU8A 1PPIA 1I2RA 2D1ZA 3CV2A 3NR0A 4ZOCA 5I3IA 5CKSA 4HYWA 1FOBA 1E6QM 1OFAA 4HHMA 2B0MA 2H3BA 4H9ZA 1EJSC 2VM8A 4NZ5A 1XIMA 2V67A 4X63A 3DESA 5I6SA 2G96A 1PZ0A 2VZTA 3L4YA 5E0CA 1HO1A 3BANA 1J4EA 3SDOA 5HPOA 5DEZA 3L4XA 4YLWA 2OO0A 5M2FX 3MP4A 3PZTA 2VQUA 3AMKA 3I6RA 3PHAA 3CPRA 3TCSA 3V5FA 3EPMA 6REQA 3ARYA 2GJNA 4FK9A 2VYOA 4IF2A 2V68A 3BAKA 4QE1A 2TSYA 1LQAA 1TV3A 5F2IA 4DNMA 4KFPA 2YDSA 3LLFA 2UY3A 4JX5A 3LI0A 1D3HA 2HTMA 1VBHA 2RDXA 1X8FA 2E5CA 4MFEA 3VPLA 3HGSA 2OGJA 2F2KA 1XJBA 2VKZG 3N2MA 2HZGA 1WAWA 3W7MA 2XFFA 3PR2A 1F73A 4UTJA 3PF3A 3GTXA 1W1B1 4NIRA 3CT2A 2YDRA 4ECLA 1B4KA 3LRLA 5JBFA 1VFTA 2A7PA 1BD0A 1BLIA 5HA7A 4HNUA 5C7HA 4BEUA 1E6NA 2VI0A 4GY0A 3UPWA 4WGXA 4XZHA 2C7FA 1UCWA 3PZMA 2WNNA 3UERA 4FXFA 4UMCA 5I79A 5G1TA 4UWMA 1EO5A 3NL3A 4JL1A 1E70M 1EXBA 3GH5A 5JU6A 1JVNA 1FHDA 1EQPA 1EP3A 3LCXA 4ZEPA 3SFWA 2PDGA 4K2SA 4D6JA 1Q13A 3RITA 3SJ3A 2D3LA 2GUUA 5F1VA 2G4JA 3G2GA 3U6WA 1TUXA 1Z48A 2DDXA 4RE3A 4UTTA 1TRIA 1WDRA 3EKLA 3ERPA 3FYOA 4D72A 4IG2A 4O1FA 1Y65A 4DYEA 2EG7A 2I7GA 3HQNA 1GT8A 2Z2UA 3I7RA 3JZEA 2JK2A 4I3GA 1EPXA 3AI0A 3DCPA 3LBMA 3WDRA 5HBFA 1KM3A 1D3GA 1ISYA 4UTWA 1H41A 1OFOA 1VFFA 3AICA 3F5KA 4EWJA 4HK6A 5H8PA 2Y63A 2POZA 1CCWB 1J8VA 1QR7A 4J5NA 3PB0A 3BLDA 4MJ4A 1CWYA 3URNA 3KOZA 3P62A 3IIXA 5C6MA 2F7FA 3S9YA 3H2FA 3AIRA 2VMFA 3T0DA 2OKOA 1OGGA 1FXPA 4MTVA 1R3QA 2O55A 2BDQA 3B8WA 5JQ9A 2ZA2A 5M17A 3WF2A 2XHYA 3V4BA 5I3JA 5ECUA 2VNCA 3I6EA 1POKA 3MT1A 3QKEA 2AKZA 4OV4A 1HX0A 1TWDA 3M0MA 1IE7C 4MPQA 4WDUA 2ZE3A 1W1TA 3FW6A 3SGGA 5HUPA 6REQB 2ISSA 1CLKA 4A6GA 3HG3A 1Q7MA 1QK0A 4IT1A 4IX2A 1OFDA 1NAL1 3M6YA 4PUNA 3GTIA 4TIMA 1G4PA 2GJRA 2BGQA 4MUZA 4O11A 5HDRA 2D2GA 3GE7A 4DF0A 8RUCA 3KZPA 3UZYA 4UMAA 4N42A 3H4WA 1J2BA 4M6PA 4S3KA 4K7YA 4Q4MA 5I02A 3AHYA 3B9NA 3DKLA 1FP8A 4LTSA 3FHQA 3W1MA 1TB3A 2DORA 3MY9A 1NVMA 6PTDA 1XHGA 1FDYA 1K9DA 2IPJA 3CUIA 4QISA 4XD5A 4O19A 4XSMA 1GQKA 5EMMA 1TR9A 1XICA 1GK8A 3TNBA 3W07A 3QV8A 4LJ3A 4P7LA 2QT3A 1LF1A 4S2CA 4DJEA 3HO8A 5A8PA 5CPMA 4K1GA 1S5WA 1RV8A 3C52A 3SUSA 1KKRA 2ZVRA 4C1LA 3NDOA 3WX7A 2NQZA 3Q94A 3E96A 3HFTA 3W71A 1ADDA 4H9UA 1E0VA 4HU0A 4ILSA 5C55A 1UASA 1MQRA 5M1TA 3WEOA 5I2UA 1JZ5A 3MS8A 3OEXA 3TYBA 1EXPA 3LX9A 4AZHA 2NWRA 3YPIA 3LM3A 1X1NA 3T05A 5AOUA 4F2TA 1CYGA 3VX1A 3WLPA 2QUTA 4JHZA 3PY2A 1AL8A 7ENLA 3WLHA 2WBKA 3K4AA 3WENA 4Z2JA 2VD8A 3SJNA 1VGAA 1ADOA 1AD4A 2FFCA 3C6CA 3E0VA 1C90A 3LPGA 4CD7A 1F6PA 1GQNA 3ARXA 2DEPA 1S39A 4Q8MA 1IWBA 3WUFA 4C6BA 2V3GA 2D3NA 2Y1HA 3VGDA 4EVZA 4XQ6A 1JDAA 2PDNA 3WLJA 4CCEA 1JYXA 4ZBCA 5FJPA 1KGXA 3CGTA 4J3XA 1EOMA 3NQDA 1AH4A 1TZ9A 2VFIA 4WX2A 3WJXA 4KMQA 5AHFA 2BGNE 3SCVA 3HPFA 1UOZA 1LRNA 3VZYA 1JPDX 1ONRA 1Q6LA 3M43A 3PPFA 4NNBA 2AMGA 1R3VA 4H01A 5CGQA 5TIMA 4XKYA 3W0KA 1KC7A 2MANA 4GBUA 1CGXA 4MJZA 2RHGA 3ITLA 4I9MA 3UXLA 5CBJA 3WF1A 3CZEA 1EP1A 3PWIA 3VGEA 4I9JA 4HIBA 2C14A 2YCEA 3JUGA 3PUOA 2YL8A 2GJXA 2OB3A 4E2OA 2XGZA 3DBNA 4IUOA 3ONBA 5JMUA 4QE5A 1R9ZA 5HMDA 1X97A 3BAWA 3UA4A 4AQLA 1M5WA 4Z1AA 4EPBC 4LUJA 1OC7A 4EAMA 4ZXOA 2CWNA 3QQ1A 1UZ4A 1NDVA 1R7AA 5E9AA 3R94A 3G1YA 1DE5A 1AD1A 3CXOA 2P10A 3GNNA 2DP3A 5LHFA 4KIRA 4QDWA 3PSWA 4Q33A 1KQZA 2FZDA 1TRDA 3AIVA 3UXAA 5C5YA 3AMDA 4KCVA 2HE5A 4L1WA 3WMBA 3MV01 3NQEA 1U33A 1DE6A 4WZHA 4DQWA 1EDTA 5MHBA 4GKLA 4PZVA 1E6ZA 3TOPA 4GI4A 4HOWA 1RJQA 1EA0A 4MF4A 3DYOA 5DFAA 1LLWA 4QROA 2P53A 1B90A 5GNYA 3JZUA 1GYLA 3N4AA 4N0RA 4E4FA 3PWAA 3OB8A 4UCGA 3GWQA 3ZS4A 3SY8A 5E1QA 3TU9A 2XSAA 2FLIA 4AY7A 1OADA 2DVUA 5A5WA 1IEQA 5HANA 1GQIA 4DXKA 1JCYA 1BG4A 1WKFA 4B2DD 4JKKA 2V3EA 3BQ5A 4GQ0A 5C2XA 3IRDA 3VKKA 3G1XA 4LC6A 2R94A 1LL6A 4K1WA 2Y62A 4AD4A 4DWSA 4HOZA 2X05A 4J3SA 1A4LA 1JFXA 3UGVA 5EFDA 1E73M 2ZZ6A 1PHQA 4PMUA 2ZRYA 1L6GA 4N9DA 3QF0A 4Z1DA 2VP8A 4CQ8A 4NJKA 2IUZA 3O7UA 3AIUA 3RLUA 5CZKA 1ESWA 2Y5SA 3V75A 3QKZA 4IMEA 3WLIA 3EEGA 1CENA 4DF2A 3NYZA 5I06A 1AJ0A 4FO4A 3G3DA 4M6QA 3ATZA 4AH7A 3VIJA 3OG2A 1Z8AA 2C13A 2XU2A 1KM0A 2QJIA 2VGIA 1GCYA 2A21A 4MWAA 1PVNA 4BEQA 4H4IA 2POTA 1QMLA 4ZQCA 3WH9A 2VWTA 4F0LA 1XD1A 1YNPA 2A7NA 4JNMA 4ZQMA 4H6KA 3AIBA 3ZJKA 4FB7A 3M5VA 3W00A 3SGUA 3DN5A 2VJXA 5J04A 1XCFA 4GUHA 2X1UA 4M5PA 3DERA 1ONWA 4WKFA 3DFNA 4XKYB 4DI8A 2OLAA 4Z08A 1O95A 3E5BA 3GBEA 1LDCA 3CEUA 1JRBA 3AJXA 3RGTA