3UGPA

Crystal structure of rna-polymerase sigma subunit domain 2 complexed with -10 promoter element ssdna oligo (tataat)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
179
structure length
179
Chain Sequence
SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for promoter-10 element recognition by the bacterial RNA polymerase sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 69
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ugpA00
4OIPF 1KU2A 4G7HF 3WODF 2CW0F 2A6HF 1IW7F 4Q5SF 4G7OF 4OIOF 4XLPF 4XLNF 4MQ9F 4OIRF 3UGOA 1SMYF 4OIQF 2BE5F 2A6EF 2A68F 4OINF 3DXJF 4Q4ZF 2A69F 3LESA 3UGPA 4G7ZF 1ZYRF 3EQLF 4KI2A 3LEVA
chains in the Genus database with same CATH superfamily
3EG9A 4DVZA 3I5PA 4NCQA 1KNYA 4KNWA 1OCOC 1L7CA 2J9BA 3HNJA 1JPNA 4DRHB 3DJUB 3S0XA 5KYXA 2XM4A 2G3VA 4PJNA 4PFPA 1JRAA 1ZHZA 3RIPA 5DS4A 1E2XA 4JEBA 5DQTA 3X2QC 1ZHWA 5F28E 3E9VA 1ZVZA 3FDQA 3I5QA 5DQZA 4YL0A 1LE4A 1U6HA 3IQCA 1HW2A 3NYMA 3QW0A 2ASRA 4MTGA 4O6MA 3RKOF 1KTMA 2LFDA 2I8BA 2QE9A 3MFNA 1Z6AA 2ZD9A 4RD9A 2LQGA 2PBEA 3B0UX 3AG4C 1V4AA 1ZHYA 2HJMA 3EH1A 4DVYP 3DAFA 5F5HA 5COMA 4K0DA 1E85A 2G3KA 2ETSA 5KYUB 3ITFA 3EZIA 4P9FA 2L6HA 4EKWA 1T6IA 2QY9A 2PFDA 3JRTA 4CJGA 2R7WA 1OW8A 3PCVA 3AOUA 4N06A 1LM3B 1ZHTA 2KK1A 4AE4A 2HKVA 4JCHA 3TQOA 4G78A 3DMDA 3SP1A 1F1MA 1T6QA 3IQ5A 4G7OF 3CAXA 3KYJA 2YL7A 4XLNF 1QPUA 3EFOB 3R2PA 1JAFA 1J8MF 2XLEA 3CSKA 1AVOB 5COFA 3SXZA 1I5NA 1MMGA 1Q0MA 2QTVA 1G4WR 3DE8A 1EA8A 2R9RB 4U5EE 4OINF 1YLMA 2DYRC 1ZHXA 2YLDA 1Y6DA 2OOCA 1OCZC 1PCXA 2VB6A 1FR0A 3ZQVA 2LCHA 1PD0A 3ZDLA 4XPYA 3GEEA 3FMSA 1RJ9B 1TWGA 2NG1A 4I3MA 3K1IC 3ZIBA 3H2UA 4GYTA 3F47A 4U5GA 3G4ZA 3ZG1A 5BUOA 1M6TA 5KYNA 3HNIA 4PJMA 1Z7Qc 2XS1A 2A6HF 4C7OA 2BC5A 2KGOA 2WZFA 3U3BA 4ZLDA 3QMKA 5K0IA 2HMQA 1R5ID 2WVNA 4U5FE 4U9DA 2LSEA 1Q0KA 1V74B 3RF3A 1YZAA 4YT4A 3DD7A 3RFYA 5TJ5E 1WGWA 2XL6A 1E84A 4XQ1A 1EI7A 1NFNA 1OR3A 5DVWA 4PACA 3GM3A 3RQFA 1VYKA 1ZW3A 1M57C 4GQHA 2ZXOA 2EPNA 4I44A 2L9JA 3TD7A 1MMAA 2DYSC 4YT8A 2XRHA 3AGTA 3ZSUA 1SZIA 4BJ5C 4IJJA 3UGPA 1V54C 4KI2A 4RBNA 1PV3A 1S7ZA 4Q5SF 3RVZA 2IXNA 1JOGA 2PX0A 3NG1A 4DRIB 1G4US 3AGUA 2IOQA 4IAOA 2NPUA 2WVQA 3GM2A 3GWLA 2LK4A 2HV6A 3EGXA 3VYWA 3FXHA 5JS5A 1M56C 1K40A 2L81A 4XLPF 2HSBA 2R7TA 4MVSA 4YWQA 2EIMC 1FMVA 2R7OA 4DXWA 4BEJA 3CEXA 1E83A 4XPWA 5DLJA 2OEVA 2YRFA 1UFBA 3F46A 3S9OA 3NRHA 1FTSA 2M64A 3EHNA 3JSZA 3KH2A 4IB4A 4YT5A 2FFHA 1BZ4A 1G5ZA 2YHSA 3AJMA 3LNRA 2D5RB 4BJ6C 4CSAC 2W4BA 3EPVA 4MVRA 2Z15A 3U8PA 3E70C 1WN0A 1OXKA 3S28A 3S84A 4JJGA 3H65A 2B0JA 2H8AA 5EK0A 2OU6A 1D0YA 2EIKC 1XZQA 2ZXWC 4G0HA 2NSGA 2H7VC 2Y3GA 4E7ZA 3W2WA 3LLKA 2JX0A 1E86A 3K33A 1A7EA 3HNLA 3U5SA 3MYFA 3KKBA 2NUTA 2GDCA 5L0GA 1SMYF 2R05A 2HZ8A 2J9WA 4EIYA 1Y4CA 3TJ6A 3KMIA 3UMKA 3AG1C 3ABMC 1Q0FA 2QLAA 3L8IA 3QZCA 1UG7A 5CI8A 5CIVA 5A6BD 5L0JA 2XXAB 4CDVA 3LAYA 2NUPA 2I15A 4XWJA 1QSPA 3M4BA 3TOMA 5L3QA 5L0FA 1FNTc 2GA0A 3JYYA 3I4UA 1MMDA 1VK5A 2Y3DA 4LDRA 1KU2A 1TWCA 3LLIA 4LDKA 4YN0B 3T9OA 2ZPAA 4QDLA 2PF4E 5BQGA 2L6GA 4MVMA 4O6NA 3RQGA 5CI9A 5HSWA 3V5YA 4FESA 3C7JA 3QW1A 1EKYA 1SR2A 3NKEA 5B1BC 4AX2A 4E18A 4M63A 3DKAA 2QNLA 4CS8C 5KYXB 1HMOA 2YLGA 3T4RA 4P6IC 1YYXA 2E87A 3NMKA 3JSEO 1VLTA 4BEMJ 1ZZPA 2R7QA 3PDMP 4DRJB 4C3BA 5KYYA 2YQYA 2HUJA 1BDJB 2Y3BA 2Q00A 4IRUA 2IXMA 2P0NA 3C62A 4ANJA 4XTKA 5L0CA 3KYIA 4U5CE 1RMVA 2WVOA 3G50A 3Q7LA 2HFIA 2VCAA 3G4XA 3LNMB 2LD6A 3VF0A 1BR1A 2Q4FA 3AQBA 3LEVA 3L8JA 3SXYA 3FAJA 1Z5ZA 4A2NB 3N2ZB 2KC3A 1GGQA 3K7DA 4OIPF 4UDVA 3IHUA 4I1MA 4IAQA 4XEKA 1D1AA 2P61A 2Y39A 2UUHA 1O3UA 3JZ0A 3N24A 4IWBA 4EBJA 2BL2A 2CGEA 1OCRC 3ECSA 2NSFA 4AE4B 4EUKB 4ER9A 5A6AA 4CSAA 1YDIA 1D0ZA 1G8XA 2Q7RA 4W8PA 2XLWA 3FOOA 4OIRF 3T6GB 1B68A 2H7BA 3GEIA 2W45A 1HW1A 4JW1A 2A6EF 4YJWA 3US6A 1T01A 3JTLO 3IQTA 3GM1A 1LKXA 1QKRA 3S29A 2J46A 1WATA 2J0WA 3VRCA 4Z9HA 1W2WA 1YZCA 4JIOA 2XLHA 3JYHA 5A6JA 2EPMX 3GODA 4K1OA 1DOVA 4WJ0A 1ZW2A 2CDQA 5B3IA 2KQ9A 3CZ6A 3H2VA 2AU5A 2KNHA 3UMIA 5BQIA 1VYIA 1NLXA 2W4MA 2QUPA 3ASOC 4DBQA 4D4NA 1WWPA 1H9GA 1TWHA 2J0XA 2Q9CA 3W2VA 3DJNB 2XSEA 4L6RA 3C18A 4C3DA 3ZTZA 3RQEA 1CPQA 3EGDA 4MQ9F 4C7OB 2DI3A 4CS9C 1RKEB 1M2VA 1VMAA 2KSFA 3K66A 1OR2A 1HY5A 4MVUA 3V7OA 1RJ9A 3DXJF 4F4BA 3L1MA 3IQ6A 2Y69C 4MTFA 5FCLA 4G7ZF 2W9YA 5T3WA 2L7AA 5JP7A 1I4ZA 4JURI 1V55C 4Z9JA 3ZQYA 1TR2A 3C8GD 4E7SA 2H7OA 2XS8A 1FFHA 4FWVA 2D4UA 2IM8A 3M15A 3C8ZA 4CJOA 3U0CA 2J9VA 3ZC4A 4QI2A 1HE9A 2KJGA 2YWAA 1WASA 3C8GA 2R02A 4PJLA 1K04A 1MNDA 3L34A 1D0XA 1BR2A 3MLGA 4U5HA 2BE5F 4J32B 3V5ZA 4A4AA 4ZLCA 2A68F 1TFOB 2EPKX 4WGZA 2A1DD 2OJED 2YEVA 4JCZA 4X0RA 5L0HA 1U0BB 3B29A 4JE9A 2DB4A 1OXBA 4D4XA 2XLOA 3M1CB 1NBBA 1ZYRF 3EQLF 3QVYA 2A0UA 3X1OA 5KYWB 4KBLA 1OCCC 1QQ3A 1A7VA 4MTOA 5E3AA 3R7CA 1J8YF 3WG7C 3HJCA 3DZAA 3GANA 1VB5A 3W8HA 3JCUQ 2LFFA 1LI7A 2XLDA 3QVZA 5D91A 5F5FA 4LLCA 3U2LA 5DS5A 3U2MA 4CBEA 5JUAA 1O5HA 3LUTB 4KNVA 2YLIA 4P9TA 2OEXA 3K6BA 1ZU5A 2GAQA 4PJJA 3ZTMA 3RVYA 5EHHA 2HS5A 3W4YA 1C02A 4C3EA 2HMZA 4XPXA 2X0CA 1GQAA 3K1IA 3MX3A 4BJ1A 2PP4A 5JLIA 1O87A 2OJQA 4YK5A 4LDQA 2ZXRA 3EJNA 3GEHA 1K05A 4U9EA 2LP4A 1TQGA 3DE9A 1AUEA 4U5DE 1C17M 5FZTA 256BA 4CS7A 5AGFA 2VASA 2X51A 3JT1A 3GWNA 1FFTC 4RDAA 4HFKB 5BQHA 3DM9B 1IZMA 4JTDB 3ATPA 3IPMO 5EGYA 4O7GA 3HKKA 1MNEA 2JD3A 1VLSA 2G62A 5IY5C 2FGYA 5AC5A 3MBGA 3EG9B 5T1DB 3AG2C 1VTMP 2FAPB 2LIGA 2IYLD 2CCYA 4OD4A 4BJ5A 1Z23A 1GS9A 1WTYA 4HFFB 3HTKC 2R25A 2Q9BA 4JZAA 3B71A 1FMWA 1PD1A 2EIJC 4IARA 2GFHA 5D92A 1LIHA 3WHNA 3CQZA 2XXAA 3B0PA 3OWTA 1XWJA 4CX9A 4NC3A 1CGOA 1LPEA 4LERA 2C03A 4DJ9A 4EWCA 3HNKA 1ZU4A 2YL0A 1JMWA 2DGJA 3WAQA 1U89A 4JTAB 3POVA 2R7RA 3FAPB 1OW6A 2EINC 2A0BA 1QZXA 2KW3C 2WZGA 3ABLC 4MVZA 4Q7CA 3DAGA 3HLZA 4OD5A 4YL1A 2WL8A 5A6KA 4BJTA 4CIPA 4CIHA 3J06A 3VAYA 1YJGA 2CNWD 3C63A 2F22A 2Q9AA 3SXMA 2XM0A 4J7YA 3T6BA 3B0VC 3MYIA 4NY3A 4DOZA 3TJ5A 1DOWA 4B6IA 5A6BA 5JRAA 3O10A 2VCCA 4GEHA 2OKUA 1A0BA 2KYHA 4BJ6A 1CPRA 5T3TA 2PX3A 2CNWA 1OQCA 2J7PD 2AWCA 2YZSA 4JKVA 3TULA 2CYDA 2P7VA 2PNOA 4MW3A 1D1CA 2V26A 1NZEA 4NTAA 5KYUA 3W8IA 2WZLA 4WGYA 4Q4ZF 2TMVP 1CGNA 5E2QA 1VOMA 2OCCC 4K7BA 3O55A 4LLEA 4MVQA 3UNGC 3LS1A 2P6VA 1GM5A 1APCA 2J7PA 2XL8A 5L3VA 2VCBA 3Q6NA 5HV9A 2YL3A 3K1HA 3Q6MA 3FVYA 3JRMO 2CW0F 2IBFA 3LS0A 3S90A 3NMIA 3EFOA 3PHF2 1NU9C 4AL1A 4R32A 5E33A 1IW7F 3A11A 3BRJA 4KC9A 1JPJA 3B9QA 3DM5A 1M2OA 4IGGA 5B1AC 4OIOF 3IEEA 4H54A 2J9UA 1R4TA 1WOLA 4E17A 1ORJA 2JPUA 2M4EA 1JR8A 1CGME 1T6UA 3SXKA 1HMDA 1Q0GA 4AL0A 3EGDB 1N1CA 1A7DA 2XL4A 1YA9A 1FAPB 1M2VB 2IXPA 3DWWA 2OG2A 3LESA 3NYJA 4EHPA 1I4YA 2RD9A 3RW0A 3SNHA 4CS8A 5L0DA 4ULWA 3U3FA 1BBHA 3BEHA 5JT4A 5L0IA 2R03A 4JVSA 3M79A 1RXQA 1AEPA 3AQCA 3U8VA 1NSGB 1RCPA 1RKCA 1YAUO 2EILC 3DI5A 2R7VA 4H4KC 3KPHA 3O39A 4MVOA 4BG0A 4N6CA 1NG1A 1SF8A 2XLMA 3EH2A 3SZRA 4EBKA 1HE1A 1LE2A 1RKEA 3V5XA 4BPMA 4O6YA 4N4WA 4J30B 1ORYA 4YL3A 2HSQA 3TOLA 2GWWA 3EGXB 2HJ3A 5GPGB 1QVXA 3C8GB 1C03A 1MQVA 2VH3A 3SEOA 1TKNA 1OKKD 3FOPA 2OQMA 3UR3C 3LJBA 3NMJA 4LACB 4PK4A 4YT2A 1D1BA 3T6JA 3Q7GA 1QLEC 1ST6A 4XEFA 4MNDA 2R7XA 2MYSA 3ABKC 1LVKA 1H7IA 2MHRA 3FHDA 3OEOA 2ZXPA 4O79A 4Z9IA 2J45A 3EZHA 1OKKA 1OW7A 2YVKA 4ULVA 3WODF 2V3CC 3LEOA 1ORSC 3A9CA 1YVIA 1TWAA 4FX5A 4HE8D 4I1OB 2C04A 4JC7A 5AC4A 3RH3A 2UUIA 3RYLA 3S27A 4PFOA 3GORA 5COGA 5DS6A 3UMHA 4NTFA 4OIQF 4QI0A 2RSEB 4DBRA 5KYWA 2ICWG 2WB7A 3O6XA 4NTBA 2AVKA 2J8WA 2NUTB 4JRZA 3VM6A 1YA7O 1A41A 1LS1A 1T5OA 2Y3HA 4NQFA 1XZPA 4AK9A 1Z3IX 3KL4A 4MS2A 1H9TA 4JEAA 1TFKB 1BR4A 3OA1A 3PMRA 2Q3TA 5E3CA 4CS9A 2P1AA 4WABA 2XLVA 4CDAA 4G7HF 4J7TA 2NUPB 1MMNA 3N0TA 2R7UA 2L6FA 2B0HA 2VC9A 4E0IA 2YL1A 3AG3C 3ASNC 4FAPB 4HEAJ 2R7SA 2EPOA 4XEVA 4ONSA 1LI5A 1LS4A 4PR9A 2O9XA 3SYNA 3U9JA 1L3PA 1NU7D 4MW8A 3UGOA 1Q0DA 1SYQA 4E0HA 2HV7A 3EHMA 4W8KA 2EPLX 5A69A 2IXOA 2AWYA 3QTHA 3NKDA 5JSLA 3NDBB 5JVEA 2AP3A 1YYJA 1YARO 2MWQA 4JTCB 3TK0A 3ZWIA 2YKZA 5B3SC 1EQ1A 3NYLA 1S05A 4N6HA 4U5BE 1H6GA 4EBBA 2A69F 5KYYB 3M4CA 4JJFA 3L0IA 1Z63A 4CDYA 3U9MA 1NFOA 1T9KA 3ZVRA
chains in the Genus database with same CATH topology
3EG9A 4DVZA 3I5PA 4KNWA 1OCOC 1JPNA 3DJUB 3S0XA 5KYXA 4PJNA 2G3VA 4PFPA 3RIPA 1ZHZA 5DS4A 5DQTA 3X2QC 1ZHWA 3E9VA 3FDQA 3I5QA 5DQZA 3NYMA 4O6MA 3RKOF 2I8BA 1Z6AA 4RD9A 3B0UX 3AG4C 1ZHYA 3EH1A 4DVYP 3DAFA 5F5HA 4K0DA 2G3KA 5KYUB 3ITFA 3EZIA 2QY9A 2PFDA 3JRTA 2R7WA 4N06A 1ZHTA 4AE4A 4JCHA 3DMDA 3SP1A 4G7OF 4XLNF 3EFOB 1J8MF 3CSKA 1MMGA 2QTVA 4U5EE 4OINF 2DYRC 1ZHXA 1OCZC 1PCXA 2VB6A 1PD0A 4I3MA 1RJ9B 1TWGA 2NG1A 3ZIBA 3K1IC 4GYTA 5BUOA 3F47A 4U5GA 3ZG1A 5KYNA 4PJMA 2A6HF 4C7OA 4ZLDA 2KGOA 2WZFA 3QMKA 2WVNA 4U5FE 2LSEA 4YT4A 3DD7A 3RFYA 1WGWA 5DVWA 1VYKA 1M57C 2ZXOA 4I44A 3TD7A 2L9JA 4YT8A 1MMAA 2DYSC 2XRHA 3UGPA 3ZSUA 1SZIA 4BJ5C 4IJJA 1V54C 4KI2A 4RBNA 1S7ZA 2IXNA 3NG1A 2PX0A 2IOQA 4IAOA 2WVQA 2HV6A 3EGXA 3VYWA 1M56C 4XLPF 2L81A 2R7TA 4YWQA 2EIMC 1FMVA 2R7OA 4BEJA 3F46A 3NRHA 1FTSA 3EHNA 3JSZA 4YT5A 3KH2A 2FFHA 2YHSA 3LNRA 2D5RB 4BJ6C 4CSAC 2W4BA 3EPVA 2Z15A 3E70C 3S28A 4JJGA 3H65A 2B0JA 1D0YA 2EIKC 2ZXWC 4G0HA 2H7VC 2Y3GA 4E7ZA 3W2WA 3LLKA 3K33A 2NUTA 3KKBA 1SMYF 2J9WA 3KMIA 3UMKA 3AG1C 3ABMC 3QZCA 5CI8A 2XXAB 3LAYA 2NUPA 4XWJA 5L3QA 3I4UA 1MMDA 1VK5A 2Y3DA 1KU2A 1TWCA 3LLIA 4YN0B 5DLJA 4G7HF 2ZPAA 4QDLA 2PF4E 4O6NA 5CI9A 5HSWA 4FESA 3NKEA 5B1BC 4AX2A 4Q5SF 4M63A 4CS8C 5KYXB 3T4RA 4P6IC 2E87A 2R7QA 4C3BA 5KYYA 2Y3BA 4IRUA 2IXMA 4ANJA 4XTKA 4U5CE 2WVOA 3Q7LA 1BR1A 3AQBA 3LEVA 3FAJA 1Z5ZA 4A2NB 3N2ZB 3K7DA 4OIPF 4I1MA 1D1AA 3N24A 2Y39A 4IWBA 2CGEA 1OCRC 3ECSA 4AE4B 4CSAA 1G8XA 1D0ZA 4OIRF 2H7BA 2W45A 4JW1A 2A6EF 4YJWA 1LKXA 3S29A 2J46A 2J0WA 1W2WA 3JYHA 3GODA 4WJ0A 2CDQA 2KQ9A 3CZ6A 3UMIA 2KNHA 1VYIA 2W4MA 3ASOC 4DBQA 1TWHA 2J0XA 2Q9CA 3W2VA 3DJNB 2XSEA 4C3DA 3EGDA 4MQ9F 4C7OB 4CS9C 1M2VA 1VMAA 3K66A 3V7OA 1RJ9A 3DXJF 4F4BA 2Y69C 5FCLA 4G7ZF 2W9YA 5T3WA 4JURI 1V55C 1TR2A 4E7SA 2H7OA 1FFHA 4FWVA 2J9VA 3ZC4A 4QI2A 2KJGA 4PJLA 1MNDA 3L34A 1D0XA 1BR2A 3MLGA 4U5HA 2BE5F 4J32B 4ZLCA 2A68F 2A1DD 2YEVA 4X0RA 3M1CB 1ZYRF 3EQLF 3X1OA 5KYWB 4KBLA 1OCCC 5E3AA 3WG7C 1J8YF 3HJCA 3DZAA 3GANA 3W8HA 3JCUQ 5D91A 5F5FA 4LLCA 5DS5A 4CBEA 1O5HA 4KNVA 4PJJA 3K6BA 1ZU5A 5EHHA 4C3EA 3MX3A 4BJ1A 2PP4A 1O87A 2ZXRA 3EJNA 4U5DE 4CS7A 2VASA 2X51A 3JT1A 1FFTC 4RDAA 4HFKB 3DM9B 1IZMA 5EGYA 4O7GA 1MNEA 2JD3A 2G62A 5IY5C 2FGYA 3EG9B 5T1DB 3AG2C 4OD4A 2IYLD 4BJ5A 1Z23A 4HFFB 3HTKC 2Q9BA 4JZAA 1FMWA 1PD1A 2EIJC 5D92A 2GFHA 2XXAA 3CQZA 3B0PA 3OWTA 4LERA 2C03A 4EWCA 1ZU4A 2DGJA 3POVA 2R7RA 2EINC 1QZXA 2KW3C 2WZGA 3ABLC 4Q7CA 3DAGA 3HLZA 4OD5A 2WL8A 4BJTA 4CIHA 3VAYA 2CNWD 3T6BA 2Q9AA 3B0VC 4NY3A 4DOZA 4B6IA 4GEHA 4BJ6A 5T3TA 2PX3A 2CNWA 2J7PD 2YZSA 2P7VA 1D1CA 2V26A 1NZEA 5KYUA 3W8IA 4Q4ZF 2WZLA 5E2QA 1VOMA 2OCCC 4K7BA 4LLEA 3UNGC 3LS1A 2P6VA 2J7PA 3Q6NA 3K1HA 3Q6MA 3FVYA 3LS0A 2CW0F 3EFOA 3PHF2 1NU9C 5E33A 1IW7F 4KC9A 1JPJA 3B9QA 3DM5A 1M2OA 5B1AC 4OIOF 3IEEA 2J9UA 2M4EA 3EGDB 1N1CA 2XL4A 2IXPA 1M2VB 2OG2A 3LESA 3NYJA 3SNHA 4CS8A 4ULWA 4JVSA 3AQCA 5L3VA 2EILC 2R7VA 4H4KC 3O39A 4BG0A 1NG1A 1SF8A 3EH2A 3SZRA 4O6YA 4J30B 3EGXB 3SEOA 2VH3A 1TKNA 1OKKD 3UR3C 3LJBA 4LACB 4PK4A 4YT2A 1D1BA 3T6JA 3Q7GA 1ST6A 1QLEC 4MNDA 2R7XA 2MYSA 3ABKC 1LVKA 3FHDA 3OEOA 4O79A 2ZXPA 2J45A 3EZHA 1OKKA 3WODF 2V3CC 4FX5A 4HE8D 1TWAA 4I1OB 2C04A 3RH3A 3RYLA 3S27A 4PFOA 5DS6A 3UMHA 4OIQF 4QI0A 4DBRA 5KYWA 2WB7A 3O6XA 2NUTB 1LS1A 2Y3HA 4AK9A 1Z3IX 3KL4A 1BR4A 3OA1A 3PMRA 2Q3TA 5E3CA 4CS9A 2NUPB 1MMNA 3N0TA 2R7UA 3ASNC 3AG3C 4HEAJ 2R7SA 2O9XA 3SYNA 1NU7D 3UGOA 2HV7A 3EHMA 4W8KA 2IXOA 3NKDA 3NDBB 2MWQA 5B3SC 3NYLA 4U5BE 4EBBA 2A69F 5KYYB 4JJFA 3L0IA 1Z63A 3ZVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIP F;  1KU2 A;  4G7H F;  3WOD F;  2CW0 F;  2A6H F;  1IW7 F;  4Q5S F;  4G7O F;  4OIO F;  4XLP F;  4XLN F;  4MQ9 F;  4OIR F;  3UGO A;  1SMY F;  4OIQ F;  2BE5 F;  2A6E F;  2A68 F;  4OIN F;  3DXJ F;  4Q4Z F;  2A69 F;  3LES A;  3UGP A;  4G7Z F;  1ZYR F;  3EQL F;  4KI2 A;  3LEV A; 
#chains in the Genus database with same CATH topology
 3EG9 A;  4DVZ A;  3I5P A;  4NCQ A;  1KNY A;  4KNW A;  1OCO C;  1L7C A;  2J9B A;  3HNJ A;  1JPN A;  4DRH B;  3DJU B;  3S0X A;  5KYX A;  2XM4 A;  2G3V A;  4PJN A;  4PFP A;  1JRA A;  1ZHZ A;  3RIP A;  5DS4 A;  1E2X A;  4JEB A;  5DQT A;  3X2Q C;  1ZHW A;  5F28 E;  3E9V A;  1ZVZ A;  3FDQ A;  3I5Q A;  5DQZ A;  4YL0 A;  1LE4 A;  1U6H A;  3IQC A;  1HW2 A;  3NYM A;  3QW0 A;  2ASR A;  4MTG A;  4O6M A;  3RKO F;  1KTM A;  2LFD A;  2I8B A;  2QE9 A;  3MFN A;  1Z6A A;  2ZD9 A;  4RD9 A;  2LQG A;  2PBE A;  3B0U X;  3AG4 C;  1V4A A;  1ZHY A;  2HJM A;  3EH1 A;  4DVY P;  3DAF A;  5F5H A;  5COM A;  4K0D A;  1E85 A;  2G3K A;  2ETS A;  5KYU B;  3ITF A;  3EZI A;  4P9F A;  2L6H A;  4EKW A;  1T6I A;  2QY9 A;  2PFD A;  3JRT A;  4CJG A;  2R7W A;  1OW8 A;  3PCV A;  3AOU A;  4N06 A;  1LM3 B;  1ZHT A;  2KK1 A;  4AE4 A;  2HKV A;  4JCH A;  3TQO A;  4G78 A;  3DMD A;  3SP1 A;  1F1M A;  1T6Q A;  3IQ5 A;  4G7O F;  3CAX A;  3KYJ A;  2YL7 A;  4XLN F;  1QPU A;  3EFO B;  3R2P A;  1JAF A;  1J8M F;  2XLE A;  3CSK A;  1AVO B;  5COF A;  3SXZ A;  1I5N A;  1MMG A;  1Q0M A;  2QTV A;  1G4W R;  3DE8 A;  1EA8 A;  2R9R B;  4U5E E;  4OIN F;  1YLM A;  2DYR C;  1ZHX A;  2YLD A;  1Y6D A;  2OOC A;  1OCZ C;  1PCX A;  2VB6 A;  1FR0 A;  3ZQV A;  2LCH A;  1PD0 A;  3ZDL A;  4XPY A;  3GEE A;  3FMS A;  1RJ9 B;  1TWG A;  2NG1 A;  4I3M A;  3K1I C;  3ZIB A;  3H2U A;  4GYT A;  3F47 A;  4U5G A;  3G4Z A;  3ZG1 A;  5BUO A;  1M6T A;  5KYN A;  3HNI A;  4PJM A;  1Z7Q c;  2XS1 A;  2A6H F;  4C7O A;  2BC5 A;  2KGO A;  2WZF A;  3U3B A;  4ZLD A;  3QMK A;  5K0I A;  2HMQ A;  1R5I D;  2WVN A;  4U5F E;  4U9D A;  2LSE A;  1Q0K A;  1V74 B;  3RF3 A;  1YZA A;  4YT4 A;  3DD7 A;  3RFY A;  5TJ5 E;  1WGW A;  2XL6 A;  1E84 A;  4XQ1 A;  1EI7 A;  1NFN A;  1OR3 A;  5DVW A;  4PAC A;  3GM3 A;  3RQF A;  1VYK A;  1ZW3 A;  1M57 C;  4GQH A;  2ZXO A;  2EPN A;  4I44 A;  2L9J A;  3TD7 A;  1MMA A;  2DYS C;  4YT8 A;  2XRH A;  3AGT A;  3ZSU A;  1SZI A;  4BJ5 C;  4IJJ A;  3UGP A;  1V54 C;  4KI2 A;  4RBN A;  1PV3 A;  1S7Z A;  4Q5S F;  3RVZ A;  2IXN A;  1JOG A;  2PX0 A;  3NG1 A;  4DRI B;  1G4U S;  3AGU A;  2IOQ A;  4IAO A;  2NPU A;  2WVQ A;  3GM2 A;  3GWL A;  2LK4 A;  2HV6 A;  3EGX A;  3VYW A;  3FXH A;  5JS5 A;  1M56 C;  1K40 A;  2L81 A;  4XLP F;  2HSB A;  2R7T A;  4MVS A;  4YWQ A;  2EIM C;  1FMV A;  2R7O A;  4DXW A;  4BEJ A;  3CEX A;  1E83 A;  4XPW A;  5DLJ A;  2OEV A;  2YRF A;  1UFB A;  3F46 A;  3S9O A;  3NRH A;  1FTS A;  2M64 A;  3EHN A;  3JSZ A;  3KH2 A;  4IB4 A;  4YT5 A;  2FFH A;  1BZ4 A;  1G5Z A;  2YHS A;  3AJM A;  3LNR A;  2D5R B;  4BJ6 C;  4CSA C;  2W4B A;  3EPV A;  4MVR A;  2Z15 A;  3U8P A;  3E70 C;  1WN0 A;  1OXK A;  3S28 A;  3S84 A;  4JJG A;  3H65 A;  2B0J A;  2H8A A;  5EK0 A;  2OU6 A;  1D0Y A;  2EIK C;  1XZQ A;  2ZXW C;  4G0H A;  2NSG A;  2H7V C;  2Y3G A;  4E7Z A;  3W2W A;  3LLK A;  2JX0 A;  1E86 A;  3K33 A;  1A7E A;  3HNL A;  3U5S A;  3MYF A;  3KKB A;  2NUT A;  2GDC A;  5L0G A;  1SMY F;  2R05 A;  2HZ8 A;  2J9W A;  4EIY A;  1Y4C A;  3TJ6 A;  3KMI A;  3UMK A;  3AG1 C;  3ABM C;  1Q0F A;  2QLA A;  3L8I A;  3QZC A;  1UG7 A;  5CI8 A;  5CIV A;  5A6B D;  5L0J A;  2XXA B;  4CDV A;  3LAY A;  2NUP A;  2I15 A;  4XWJ A;  1QSP A;  3M4B A;  3TOM A;  5L3Q A;  5L0F A;  1FNT c;  2GA0 A;  3JYY A;  3I4U A;  1MMD A;  1VK5 A;  2Y3D A;  4LDR A;  1KU2 A;  1TWC A;  3LLI A;  4LDK A;  4YN0 B;  3T9O A;  2ZPA A;  4QDL A;  2PF4 E;  5BQG A;  2L6G A;  4MVM A;  4O6N A;  3RQG A;  5CI9 A;  5HSW A;  3V5Y A;  4FES A;  3C7J A;  3QW1 A;  1EKY A;  1SR2 A;  3NKE A;  5B1B C;  4AX2 A;  4E18 A;  4M63 A;  3DKA A;  2QNL A;  4CS8 C;  5KYX B;  1HMO A;  2YLG A;  3T4R A;  4P6I C;  1YYX A;  2E87 A;  3NMK A;  3JSE O;  1VLT A;  4BEM J;  1ZZP A;  2R7Q A;  3PDM P;  4DRJ B;  4C3B A;  5KYY A;  2YQY A;  2HUJ A;  1BDJ B;  2Y3B A;  2Q00 A;  4IRU A;  2IXM A;  2P0N A;  3C62 A;  4ANJ A;  4XTK A;  5L0C A;  3KYI A;  4U5C E;  1RMV A;  2WVO A;  3G50 A;  3Q7L A;  2HFI A;  2VCA A;  3G4X A;  3LNM B;  2LD6 A;  3VF0 A;  1BR1 A;  2Q4F A;  3AQB A;  3LEV A;  3L8J A;  3SXY A;  3FAJ A;  1Z5Z A;  4A2N B;  3N2Z B;  2KC3 A;  1GGQ A;  3K7D A;  4OIP F;  4UDV A;  3IHU A;  4I1M A;  4IAQ A;  4XEK A;  1D1A A;  2P61 A;  2Y39 A;  2UUH A;  1O3U A;  3JZ0 A;  3N24 A;  4IWB A;  4EBJ A;  2BL2 A;  2CGE A;  1OCR C;  3ECS A;  2NSF A;  4AE4 B;  4EUK B;  4ER9 A;  5A6A A;  4CSA A;  1YDI A;  1D0Z A;  1G8X A;  2Q7R A;  4W8P A;  2XLW A;  3FOO A;  4OIR F;  3T6G B;  1B68 A;  2H7B A;  3GEI A;  2W45 A;  1HW1 A;  4JW1 A;  2A6E F;  4YJW A;  3US6 A;  1T01 A;  3JTL O;  3IQT A;  3GM1 A;  1LKX A;  1QKR A;  3S29 A;  2J46 A;  1WAT A;  2J0W A;  3VRC A;  4Z9H A;  1W2W A;  1YZC A;  4JIO A;  2XLH A;  3JYH A;  5A6J A;  2EPM X;  3GOD A;  4K1O A;  1DOV A;  4WJ0 A;  1ZW2 A;  2CDQ A;  5B3I A;  2KQ9 A;  3CZ6 A;  3H2V A;  2AU5 A;  2KNH A;  3UMI A;  5BQI A;  1VYI A;  1NLX A;  2W4M A;  2QUP A;  3ASO C;  4DBQ A;  4D4N A;  1WWP A;  1H9G A;  1TWH A;  2J0X A;  2Q9C A;  3W2V A;  3DJN B;  2XSE A;  4L6R A;  3C18 A;  4C3D A;  3ZTZ A;  3RQE A;  1CPQ A;  3EGD A;  4MQ9 F;  4C7O B;  2DI3 A;  4CS9 C;  1RKE B;  1M2V A;  1VMA A;  2KSF A;  3K66 A;  1OR2 A;  1HY5 A;  4MVU A;  3V7O A;  1RJ9 A;  3DXJ F;  4F4B A;  3L1M A;  3IQ6 A;  2Y69 C;  4MTF A;  5FCL A;  4G7Z F;  2W9Y A;  5T3W A;  2L7A A;  5JP7 A;  1I4Z A;  4JUR I;  1V55 C;  4Z9J A;  3ZQY A;  1TR2 A;  3C8G D;  4E7S A;  2H7O A;  2XS8 A;  1FFH A;  4FWV A;  2D4U A;  2IM8 A;  3M15 A;  3C8Z A;  4CJO A;  3U0C A;  2J9V A;  3ZC4 A;  4QI2 A;  1HE9 A;  2KJG A;  2YWA A;  1WAS A;  3C8G A;  2R02 A;  4PJL A;  1K04 A;  1MND A;  3L34 A;  1D0X A;  1BR2 A;  3MLG A;  4U5H A;  2BE5 F;  4J32 B;  3V5Z A;  4A4A A;  4ZLC A;  2A68 F;  1TFO B;  2EPK X;  4WGZ A;  2A1D D;  2OJE D;  2YEV A;  4JCZ A;  4X0R A;  5L0H A;  1U0B B;  3B29 A;  4JE9 A;  2DB4 A;  1OXB A;  4D4X A;  2XLO A;  3M1C B;  1NBB A;  1ZYR F;  3EQL F;  3QVY A;  2A0U A;  3X1O A;  5KYW B;  4KBL A;  1OCC C;  1QQ3 A;  1A7V A;  4MTO A;  5E3A A;  3R7C A;  1J8Y F;  3WG7 C;  3HJC A;  3DZA A;  3GAN A;  1VB5 A;  3W8H A;  3JCU Q;  2LFF A;  1LI7 A;  2XLD A;  3QVZ A;  5D91 A;  5F5F A;  4LLC A;  3U2L A;  5DS5 A;  3U2M A;  4CBE A;  5JUA A;  1O5H A;  3LUT B;  4KNV A;  2YLI A;  4P9T A;  2OEX A;  3K6B A;  1ZU5 A;  2GAQ A;  4PJJ A;  3ZTM A;  3RVY A;  5EHH A;  2HS5 A;  3W4Y A;  1C02 A;  4C3E A;  2HMZ A;  4XPX A;  2X0C A;  1GQA A;  3K1I A;  3MX3 A;  4BJ1 A;  2PP4 A;  5JLI A;  1O87 A;  2OJQ A;  4YK5 A;  4LDQ A;  2ZXR A;  3EJN A;  3GEH A;  1K05 A;  4U9E A;  2LP4 A;  1TQG A;  3DE9 A;  1AUE A;  4U5D E;  1C17 M;  5FZT A;  256B A;  4CS7 A;  5AGF A;  2VAS A;  2X51 A;  3JT1 A;  3GWN A;  1FFT C;  4RDA A;  4HFK B;  5BQH A;  3DM9 B;  1IZM A;  4JTD B;  3ATP A;  3IPM O;  5EGY A;  4O7G A;  3HKK A;  1MNE A;  2JD3 A;  1VLS A;  2G62 A;  5IY5 C;  2FGY A;  5AC5 A;  3MBG A;  3EG9 B;  5T1D B;  3AG2 C;  1VTM P;  2FAP B;  2LIG A;  2IYL D;  2CCY A;  4OD4 A;  4BJ5 A;  1Z23 A;  1GS9 A;  1WTY A;  4HFF B;  3HTK C;  2R25 A;  2Q9B A;  4JZA A;  3B71 A;  1FMW A;  1PD1 A;  2EIJ C;  4IAR A;  2GFH A;  5D92 A;  1LIH A;  3WHN A;  3CQZ A;  2XXA A;  3B0P A;  3OWT A;  1XWJ A;  4CX9 A;  4NC3 A;  1CGO A;  1LPE A;  4LER A;  2C03 A;  4DJ9 A;  4EWC A;  3HNK A;  1ZU4 A;  2YL0 A;  1JMW A;  2DGJ A;  3WAQ A;  1U89 A;  4JTA B;  3POV A;  2R7R A;  3FAP B;  1OW6 A;  2EIN C;  2A0B A;  1QZX A;  2KW3 C;  2WZG A;  3ABL C;  4MVZ A;  4Q7C A;  3DAG A;  3HLZ A;  4OD5 A;  4YL1 A;  2WL8 A;  5A6K A;  4BJT A;  4CIP A;  4CIH A;  3J06 A;  3VAY A;  1YJG A;  2CNW D;  3C63 A;  2F22 A;  2Q9A A;  3SXM A;  2XM0 A;  4J7Y A;  3T6B A;  3B0V C;  3MYI A;  4NY3 A;  4DOZ A;  3TJ5 A;  1DOW A;  4B6I A;  5A6B A;  5JRA A;  3O10 A;  2VCC A;  4GEH A;  2OKU A;  1A0B A;  2KYH A;  4BJ6 A;  1CPR A;  5T3T A;  2PX3 A;  2CNW A;  1OQC A;  2J7P D;  2AWC A;  2YZS A;  4JKV A;  3TUL A;  2CYD A;  2P7V A;  2PNO A;  4MW3 A;  1D1C A;  2V26 A;  1NZE A;  4NTA A;  5KYU A;  3W8I A;  2WZL A;  4WGY A;  4Q4Z F;  2TMV P;  1CGN A;  5E2Q A;  1VOM A;  2OCC C;  4K7B A;  3O55 A;  4LLE A;  4MVQ A;  3UNG C;  3LS1 A;  2P6V A;  1GM5 A;  1APC A;  2J7P A;  2XL8 A;  5L3V A;  2VCB A;  3Q6N A;  5HV9 A;  2YL3 A;  3K1H A;  3Q6M A;  3FVY A;  3JRM O;  2CW0 F;  2IBF A;  3LS0 A;  3S90 A;  3NMI A;  3EFO A;  3PHF 2;  1NU9 C;  4AL1 A;  4R32 A;  5E33 A;  1IW7 F;  3A11 A;  3BRJ A;  4KC9 A;  1JPJ A;  3B9Q A;  3DM5 A;  1M2O A;  4IGG A;  5B1A C;  4OIO F;  3IEE A;  4H54 A;  2J9U A;  1R4T A;  1WOL A;  4E17 A;  1ORJ A;  2JPU A;  2M4E A;  1JR8 A;  1CGM E;  1T6U A;  3SXK A;  1HMD A;  1Q0G A;  4AL0 A;  3EGD B;  1N1C A;  1A7D A;  2XL4 A;  1YA9 A;  1FAP B;  1M2V B;  2IXP A;  3DWW A;  2OG2 A;  3LES A;  3NYJ A;  4EHP A;  1I4Y A;  2RD9 A;  3RW0 A;  3SNH A;  4CS8 A;  5L0D A;  4ULW A;  3U3F A;  1BBH A;  3BEH A;  5JT4 A;  5L0I A;  2R03 A;  4JVS A;  3M79 A;  1RXQ A;  1AEP A;  3AQC A;  3U8V A;  1NSG B;  1RCP A;  1RKC A;  1YAU O;  2EIL C;  3DI5 A;  2R7V A;  4H4K C;  3KPH A;  3O39 A;  4MVO A;  4BG0 A;  4N6C A;  1NG1 A;  1SF8 A;  2XLM A;  3EH2 A;  3SZR A;  4EBK A;  1HE1 A;  1LE2 A;  1RKE A;  3V5X A;  4BPM A;  4O6Y A;  4N4W A;  4J30 B;  1ORY A;  4YL3 A;  2HSQ A;  3TOL A;  2GWW A;  3EGX B;  2HJ3 A;  5GPG B;  1QVX A;  3C8G B;  1C03 A;  1MQV A;  2VH3 A;  3SEO A;  1TKN A;  1OKK D;  3FOP A;  2OQM A;  3UR3 C;  3LJB A;  3NMJ A;  4LAC B;  4PK4 A;  4YT2 A;  1D1B A;  3T6J A;  3Q7G A;  1QLE C;  1ST6 A;  4XEF A;  4MND A;  2R7X A;  2MYS A;  3ABK C;  1LVK A;  1H7I A;  2MHR A;  3FHD A;  3OEO A;  2ZXP A;  4O79 A;  4Z9I A;  2J45 A;  3EZH A;  1OKK A;  1OW7 A;  2YVK A;  4ULV A;  3WOD F;  2V3C C;  3LEO A;  1ORS C;  3A9C A;  1YVI A;  1TWA A;  4FX5 A;  4HE8 D;  4I1O B;  2C04 A;  4JC7 A;  5AC4 A;  3RH3 A;  2UUI A;  3RYL A;  3S27 A;  4PFO A;  3GOR A;  5COG A;  5DS6 A;  3UMH A;  4NTF A;  4OIQ F;  4QI0 A;  2RSE B;  4DBR A;  5KYW A;  2ICW G;  2WB7 A;  3O6X A;  4NTB A;  2AVK A;  2J8W A;  2NUT B;  4JRZ A;  3VM6 A;  1YA7 O;  1A41 A;  1LS1 A;  1T5O A;  2Y3H A;  4NQF A;  1XZP A;  4AK9 A;  1Z3I X;  3KL4 A;  4MS2 A;  1H9T A;  4JEA A;  1TFK B;  1BR4 A;  3OA1 A;  3PMR A;  2Q3T A;  5E3C A;  4CS9 A;  2P1A A;  4WAB A;  2XLV A;  4CDA A;  4G7H F;  4J7T A;  2NUP B;  1MMN A;  3N0T A;  2R7U A;  2L6F A;  2B0H A;  2VC9 A;  4E0I A;  2YL1 A;  3AG3 C;  3ASN C;  4FAP B;  4HEA J;  2R7S A;  2EPO A;  4XEV A;  4ONS A;  1LI5 A;  1LS4 A;  4PR9 A;  2O9X A;  3SYN A;  3U9J A;  1L3P A;  1NU7 D;  4MW8 A;  3UGO A;  1Q0D A;  1SYQ A;  4E0H A;  2HV7 A;  3EHM A;  4W8K A;  2EPL X;  5A69 A;  2IXO A;  2AWY A;  3QTH A;  3NKD A;  5JSL A;  3NDB B;  5JVE A;  2AP3 A;  1YYJ A;  1YAR O;  2MWQ A;  4JTC B;  3TK0 A;  3ZWI A;  2YKZ A;  5B3S C;  1EQ1 A;  3NYL A;  1S05 A;  4N6H A;  4U5B E;  1H6G A;  4EBB A;  2A69 F;  5KYY B;  3M4C A;  4JJF A;  3L0I A;  1Z63 A;  4CDY A;  3U9M A;  1NFO A;  1T9K A;  3ZVR A; 
#chains in the Genus database with same CATH homology
 3EG9 A;  4DVZ A;  3I5P A;  4KNW A;  1OCO C;  1JPN A;  3DJU B;  3S0X A;  5KYX A;  4PJN A;  2G3V A;  4PFP A;  3RIP A;  1ZHZ A;  5DS4 A;  5DQT A;  3X2Q C;  1ZHW A;  3E9V A;  3FDQ A;  3I5Q A;  5DQZ A;  3NYM A;  4O6M A;  3RKO F;  2I8B A;  1Z6A A;  4RD9 A;  3B0U X;  3AG4 C;  1ZHY A;  3EH1 A;  4DVY P;  3DAF A;  5F5H A;  4K0D A;  2G3K A;  5KYU B;  3ITF A;  3EZI A;  2QY9 A;  2PFD A;  3JRT A;  2R7W A;  4N06 A;  1ZHT A;  4AE4 A;  4JCH A;  3DMD A;  3SP1 A;  4G7O F;  4XLN F;  3EFO B;  1J8M F;  3CSK A;  1MMG A;  2QTV A;  4U5E E;  4OIN F;  2DYR C;  1ZHX A;  1OCZ C;  1PCX A;  2VB6 A;  1PD0 A;  4I3M A;  1RJ9 B;  1TWG A;  2NG1 A;  3ZIB A;  3K1I C;  4GYT A;  5BUO A;  3F47 A;  4U5G A;  3ZG1 A;  5KYN A;  4PJM A;  2A6H F;  4C7O A;  4ZLD A;  2KGO A;  2WZF A;  3QMK A;  2WVN A;  4U5F E;  2LSE A;  4YT4 A;  3DD7 A;  3RFY A;  1WGW A;  5DVW A;  1VYK A;  1M57 C;  2ZXO A;  4I44 A;  3TD7 A;  2L9J A;  4YT8 A;  1MMA A;  2DYS C;  2XRH A;  3UGP A;  3ZSU A;  1SZI A;  4BJ5 C;  4IJJ A;  1V54 C;  4KI2 A;  4RBN A;  1S7Z A;  2IXN A;  3NG1 A;  2PX0 A;  2IOQ A;  4IAO A;  2WVQ A;  2HV6 A;  3EGX A;  3VYW A;  1M56 C;  4XLP F;  2L81 A;  2R7T A;  4YWQ A;  2EIM C;  1FMV A;  2R7O A;  4BEJ A;  3F46 A;  3NRH A;  1FTS A;  3EHN A;  3JSZ A;  4YT5 A;  3KH2 A;  2FFH A;  2YHS A;  3LNR A;  2D5R B;  4BJ6 C;  4CSA C;  2W4B A;  3EPV A;  2Z15 A;  3E70 C;  3S28 A;  4JJG A;  3H65 A;  2B0J A;  1D0Y A;  2EIK C;  2ZXW C;  4G0H A;  2H7V C;  2Y3G A;  4E7Z A;  3W2W A;  3LLK A;  3K33 A;  2NUT A;  3KKB A;  1SMY F;  2J9W A;  3KMI A;  3UMK A;  3AG1 C;  3ABM C;  3QZC A;  5CI8 A;  2XXA B;  3LAY A;  2NUP A;  4XWJ A;  5L3Q A;  3I4U A;  1MMD A;  1VK5 A;  2Y3D A;  1KU2 A;  1TWC A;  3LLI A;  4YN0 B;  5DLJ A;  4G7H F;  2ZPA A;  4QDL A;  2PF4 E;  4O6N A;  5CI9 A;  5HSW A;  4FES A;  3NKE A;  5B1B C;  4AX2 A;  4Q5S F;  4M63 A;  4CS8 C;  5KYX B;  3T4R A;  4P6I C;  2E87 A;  2R7Q A;  4C3B A;  5KYY A;  2Y3B A;  4IRU A;  2IXM A;  4ANJ A;  4XTK A;  4U5C E;  2WVO A;  3Q7L A;  1BR1 A;  3AQB A;  3LEV A;  3FAJ A;  1Z5Z A;  4A2N B;  3N2Z B;  3K7D A;  4OIP F;  4I1M A;  1D1A A;  3N24 A;  2Y39 A;  4IWB A;  2CGE A;  1OCR C;  3ECS A;  4AE4 B;  4CSA A;  1G8X A;  1D0Z A;  4OIR F;  2H7B A;  2W45 A;  4JW1 A;  2A6E F;  4YJW A;  1LKX A;  3S29 A;  2J46 A;  2J0W A;  1W2W A;  3JYH A;  3GOD A;  4WJ0 A;  2CDQ A;  2KQ9 A;  3CZ6 A;  3UMI A;  2KNH A;  1VYI A;  2W4M A;  3ASO C;  4DBQ A;  1TWH A;  2J0X A;  2Q9C A;  3W2V A;  3DJN B;  2XSE A;  4C3D A;  3EGD A;  4MQ9 F;  4C7O B;  4CS9 C;  1M2V A;  1VMA A;  3K66 A;  3V7O A;  1RJ9 A;  3DXJ F;  4F4B A;  2Y69 C;  5FCL A;  4G7Z F;  2W9Y A;  5T3W A;  4JUR I;  1V55 C;  1TR2 A;  4E7S A;  2H7O A;  1FFH A;  4FWV A;  2J9V A;  3ZC4 A;  4QI2 A;  2KJG A;  4PJL A;  1MND A;  3L34 A;  1D0X A;  1BR2 A;  3MLG A;  4U5H A;  2BE5 F;  4J32 B;  4ZLC A;  2A68 F;  2A1D D;  2YEV A;  4X0R A;  3M1C B;  1ZYR F;  3EQL F;  3X1O A;  5KYW B;  4KBL A;  1OCC C;  5E3A A;  3WG7 C;  1J8Y F;  3HJC A;  3DZA A;  3GAN A;  3W8H A;  3JCU Q;  5D91 A;  5F5F A;  4LLC A;  5DS5 A;  4CBE A;  1O5H A;  4KNV A;  4PJJ A;  3K6B A;  1ZU5 A;  5EHH A;  4C3E A;  3MX3 A;  4BJ1 A;  2PP4 A;  1O87 A;  2ZXR A;  3EJN A;  4U5D E;  4CS7 A;  2VAS A;  2X51 A;  3JT1 A;  1FFT C;  4RDA A;  4HFK B;  3DM9 B;  1IZM A;  5EGY A;  4O7G A;  1MNE A;  2JD3 A;  2G62 A;  5IY5 C;  2FGY A;  3EG9 B;  5T1D B;  3AG2 C;  4OD4 A;  2IYL D;  4BJ5 A;  1Z23 A;  4HFF B;  3HTK C;  2Q9B A;  4JZA A;  1FMW A;  1PD1 A;  2EIJ C;  5D92 A;  2GFH A;  2XXA A;  3CQZ A;  3B0P A;  3OWT A;  4LER A;  2C03 A;  4EWC A;  1ZU4 A;  2DGJ A;  3POV A;  2R7R A;  2EIN C;  1QZX A;  2KW3 C;  2WZG A;  3ABL C;  4Q7C A;  3DAG A;  3HLZ A;  4OD5 A;  2WL8 A;  4BJT A;  4CIH A;  3VAY A;  2CNW D;  3T6B A;  2Q9A A;  3B0V C;  4NY3 A;  4DOZ A;  4B6I A;  4GEH A;  4BJ6 A;  5T3T A;  2PX3 A;  2CNW A;  2J7P D;  2YZS A;  2P7V A;  1D1C A;  2V26 A;  1NZE A;  5KYU A;  3W8I A;  4Q4Z F;  2WZL A;  5E2Q A;  1VOM A;  2OCC C;  4K7B A;  4LLE A;  3UNG C;  3LS1 A;  2P6V A;  2J7P A;  3Q6N A;  3K1H A;  3Q6M A;  3FVY A;  3LS0 A;  2CW0 F;  3EFO A;  3PHF 2;  1NU9 C;  5E33 A;  1IW7 F;  4KC9 A;  1JPJ A;  3B9Q A;  3DM5 A;  1M2O A;  5B1A C;  4OIO F;  3IEE A;  2J9U A;  2M4E A;  3EGD B;  1N1C A;  2XL4 A;  2IXP A;  1M2V B;  2OG2 A;  3LES A;  3NYJ A;  3SNH A;  4CS8 A;  4ULW A;  4JVS A;  3AQC A;  5L3V A;  2EIL C;  2R7V A;  4H4K C;  3O39 A;  4BG0 A;  1NG1 A;  1SF8 A;  3EH2 A;  3SZR A;  4O6Y A;  4J30 B;  3EGX B;  3SEO A;  2VH3 A;  1TKN A;  1OKK D;  3UR3 C;  3LJB A;  4LAC B;  4PK4 A;  4YT2 A;  1D1B A;  3T6J A;  3Q7G A;  1ST6 A;  1QLE C;  4MND A;  2R7X A;  2MYS A;  3ABK C;  1LVK A;  3FHD A;  3OEO A;  4O79 A;  2ZXP A;  2J45 A;  3EZH A;  1OKK A;  3WOD F;  2V3C C;  4FX5 A;  4HE8 D;  1TWA A;  4I1O B;  2C04 A;  3RH3 A;  3RYL A;  3S27 A;  4PFO A;  5DS6 A;  3UMH A;  4OIQ F;  4QI0 A;  4DBR A;  5KYW A;  2WB7 A;  3O6X A;  2NUT B;  1LS1 A;  2Y3H A;  4AK9 A;  1Z3I X;  3KL4 A;  1BR4 A;  3OA1 A;  3PMR A;  2Q3T A;  5E3C A;  4CS9 A;  2NUP B;  1MMN A;  3N0T A;  2R7U A;  3ASN C;  3AG3 C;  4HEA J;  2R7S A;  2O9X A;  3SYN A;  1NU7 D;  3UGO A;  2HV7 A;  3EHM A;  4W8K A;  2IXO A;  3NKD A;  3NDB B;  2MWQ A;  5B3S C;  3NYL A;  4U5B E;  4EBB A;  2A69 F;  5KYY B;  4JJF A;  3L0I A;  1Z63 A;  3ZVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...