3UGPA

Crystal structure of rna-polymerase sigma subunit domain 2 complexed with -10 promoter element ssdna oligo (tataat)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
179
structure length
179
Chain Sequence
SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promoter-10 element recognition by the bacterial RNA polymerase sigma subunit.
pubmed doi rcsb
molecule keywords RNA polymerase sigma factor
molecule tags Transcription/dna
source organism Thermus aquaticus
total genus 69
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ugpA00
3DXJF 2A68F 1SMYF 4XLNF 2A69F 1IW7F 2A6EF 3UGPA 4G7OF 4OIOF 3EQLF 2A6HF 4G7HF 4KI2A 4G7ZF 4XLPF 1KU2A 4OIRF 3LESA 3UGOA 4Q5SF 3WODF 2CW0F 4OIQF 4OIPF 2BE5F 4OINF 3LEVA 4Q4ZF 4MQ9F 1ZYRF
chains in the Genus database with same CATH superfamily
2PFDA 1TR2A 3C62A 3DXJF 3SYNA 3VYWA 2AU5A 2I8BA 2P6VA 2GWWA 3ZTMA 2PF4E 3EPVA 3U8VA 4CBEA 4NY3A 4MW3A 4CJOA 2A69F 3HNIA 5A6JA 4R32A 4G78A 3GORA 5BQIA 4Z9JA 2HSBA 2EPMX 4ONSA 1B68A 1YA7O 4JEBA 4YJWA 3SXZA 3U2LA 3ZTZA 4LLEA 5L3QA 2XLWA 4BPMA 1CPRA 2XM0A 1KU2A 1T6IA 2R9RB 3AG3C 1Q0KA 4CS7A 1ZVZA 3W4YA 2Y3BA 1CGNA 3RKOF 4LERA 1BR2A 4WGYA 3K1IA 3S29A 2TMVP 2OCCC 4XPWA 2KW3C 3B0PA 3AGUA 2P61A 1EI7A 1WOLA 3RF3A 4FAPB 2GA0A 1MQVA 4EBJA 1H9TA 3SXMA 3U3FA 2PBEA 2P0NA 3IQCA 2XS1A 2DYSC 3UGPA 1T9KA 1OW6A 3QVZA 4YK5A 3NYMA 1TQGA 1MMGA 2XS8A 3DAGA 5AC5A 5L3VA 3H2UA 1NSGB 3EH1A 3GM2A 1U89A 2KNHA 3KPHA 5E3AA 1YZAA 4A2NB 1HW1A 4CDAA 1BBHA 3H65A 4NC3A 3S0XA 3KH2A 2YRFA 2R25A 1TFOB 2R7RA 1XZQA 4CIHA 3F47A 1JRAA 3ZSUA 2MHRA 2PX0A 3AQBA 1OKKD 4JKVA 5K0IA 1MMNA 3U9MA 4CSAA 2A0UA 2QLAA 1T5OA 1T01A 2HKVA 3NG1A 2G3KA 3RQFA 5JRAA 1LM3B 3AJMA 4FX5A 5L0IA 3M4BA 2PP4A 1RKEA 5EK0A 5B3IA 3DJNB 1VK5A 2JX0A 2HFIA 2VCCA 2XSEA 1KNYA 4CDYA 2QUPA 4IARA 2V26A 4XLNF 1IW7F 1O87A 4H4KC 3RH3A 2C04A 3TJ5A 5KYUB 1OCZC 1NFOA 2ASRA 3EG9A 5E2QA 2R7QA 2BL2A 3G4ZA 3Q6MA 3POVA 1OKKA 2R7VA 1DOVA 5JLIA 4U5GA 3BRJA 2Y69C 3DKAA 2G62A 4FWVA 3U3BA 4C3EA 1WASA 3UMHA 4YT4A 3FXHA 1W2WA 3TK0A 3W2VA 3EZHA 3QTHA 1BDJB 4MVRA 1OQCA 4LACB 4U5FE 4LDKA 2OKUA 1G8XA 3Q7GA 2Y3GA 1C02A 2KSFA 3EHNA 5AGFA 3SXKA 3VAYA 4BJ1A 3FMSA 2R7SA 1AVOB 2YL1A 4XPYA 1QVXA 2IM8A 5B1AC 3JTLO 4C7OA 1OXBA 1RJ9B 3HNJA 1VYIA 2CGEA 2ZXWC 2ZXRA 3UR3C 4MVZA 5JSLA 1EA8A 2QE9A 3MX3A 4I44A 3V5ZA 1YYJA 1M2OA 1A7EA 2Y3HA 2GAQA 4MVQA 2PX3A 2RD9A 2VASA 3LNRA 2YLGA 2NSFA 4AE4B 1I5NA 2E87A 3B0UX 3ASNC 3EFOB 3L1MA 1J8YF 3B71A 2R7WA 3E9VA 3CZ6A 1Z6AA 3LLKA 3C63A 2NPUA 1VOMA 3ABLC 1HE9A 2FFHA 2J46A 3MYFA 4FESA 3CAXA 4RD9A 3W8IA 2OQMA 4IAOA 4BEMJ 3K33A 4JCHA 5L0HA 5KYXB 3EHMA 1Q0MA 2A68F 4EWCA 1H9GA 1OR3A 4MTOA 3RW0A 1S7ZA 3NYLA 4F4BA 4MVOA 3JYYA 2H7BA 4YL1A 4J7TA 4P9FA 3NYJA 1G4US 1ZHTA 4MTGA 1Z7Qc 5EHHA 1OCRC 1OR2A 1WTYA 3O39A 1YZCA 4O79A 3JRMO 2QY9A 4DOZA 1U6HA 1NFNA 4XPXA 2L9JA 2WL8A 4EBBA 1A0BA 2CDQA 4Q7CA 4KC9A 3KKBA 3FHDA 1VLSA 4IAQA 4J30B 2JPUA 4MS2A 2XLOA 5D91A 3H2VA 2LQGA 5BQGA 4OIPF 3BEHA 1D0ZA 4EBKA 4JRZA 2UUIA 1O5HA 2OG2A 3RIPA 4EHPA 1OW7A 1Q0DA 1JR8A 2EPOA 3S27A 4PJMA 2X0CA 3RFYA 5KYUA 5L0JA 5FZTA 4ER9A 2IXPA 4XEKA 2IOQA 2RSEB 4HE8D 2FAPB 5JP7A 1FR0A 3CSKA 4BJ6C 3M4CA 1SYQA 4BJTA 2J9VA 3NKDA 3TD7A 3DWWA 2HV6A 1T6QA 1VTMP 4DJ9A 2FGYA 4I1OB 4HFFB 2MWQA 3OEOA 3GM1A 4IWBA 4JTCB 2HMZA 4MNDA 3TQOA 3VRCA 3R7CA 4D4NA 3SZRA 4DVYP 2Z15A 3ZDLA 3K66A 4CDVA 5E3CA 5DS6A 2QTVA 3I5QA 4JTAB 2NUTB 4I1MA 3ZQVA 4YL3A 1D1CA 2M4EA 5KYYB 4DBQA 3I4UA 2I15A 3RVZA 5A6KA 5JT4A 4DVZA 1A7DA 5TJ5E 3S28A 1TKNA 1HW2A 2R7TA 2CCYA 4Q4ZF 4ZLDA 4OD5A 2XLHA 1MMDA 1ZYRF 2UUHA 4H54A 3TULA 3U0CA 1RJ9A 1TFKB 2YLIA 5F5FA 3DAFA 3M1CB 1FMVA 4X0RA 3MYIA 5GPGB 1FFTC 2EILC 3U5SA 1QKRA 2LP4A 1YDIA 2EIMC 3M15A 1QZXA 4U5DE 3LLIA 3EGDB 3ZG1A 3LUTB 2G3VA 3JSZA 1OCCC 1YYXA 2KGOA 4KBLA 3IQ5A 4JZAA 4GQHA 5T3WA 2HJMA 4Z9IA 4AE4A 3EFOA 2XLEA 1VLTA 1DOWA 4N6CA 3RYLA 1ZU4A 1GM5A 3G4XA 4OIRF 2OJQA 2HUJA 4NTAA 1NU9C 3X2QC 2P1AA 3L8IA 3O10A 1Z5ZA 4PACA 4OINF 3RVYA 5BUOA 5KYXA 1PD0A 3ECSA 3EZIA 5DVWA 4EIYA 3ZVRA 1JAFA 1RKCA 4U5EE 3C8ZA 3HTKC 2JD3A 2VCAA 4U5CE 1G5ZA 4CIPA 1PV3A 2D5RB 4E7ZA 1SMYF 4EUKB 4GYTA 2A6EF 3DI5A 2LK4A 3AGTA 5HSWA 1I4ZA 2KQ9A 2M64A 3B29A 4C7OB 2AVKA 1FTSA 3DJUB 2J8WA 2OEXA 2W9YA 3AG1C 1LI5A 2W45A 4KNVA 4ANJA 1A41A 2P7VA 4P6IC 4IJJA 1LIHA 3O55A 2HZ8A 1JOGA 3MFNA 4MW8A 3S9OA 4HFKB 4CJGA 2A6HF 3KMIA 2NSGA 3ATPA 1VB5A 4KNWA 2EIJC 3VF0A 3DD7A 1BR1A 5L0GA 2B0HA 3Q7LA 1Q0FA 4Q5SF 1E85A 2WZFA 3GEEA 3N2ZB 3W8HA 2XXAB 2ICWG 2Q9BA 4NQFA 4PJLA 3FDQA 3JRTA 4OD4A 3IQTA 3LS0A 2LCHA 1V54C 2XL8A 2YLDA 2XLMA 3ZWIA 4PR9A 3DMDA 4LLCA 2WVNA 1R4TA 1TWAA 2H8AA 1BZ4A 3MLGA 2J9WA 3T9OA 3UNGC 1FNTc 3T6BA 2HMQA 4W8KA 1SZIA 4AK9A 1T6UA 4AL1A 5DQTA 4W8PA 4E7SA 5JUAA 4BJ6A 3EGXB 4BG0A 2NUTA 1YLMA 2EPKX 4NTBA 4DRIB 2YL7A 2IXOA 5KYYA 1YVIA 5KYWB 4G0HA 4PK4A 2IBFA 3DE8A 3HJCA 1QSPA 4IB4A 1ZHYA 3EH2A 1YJGA 4MVSA 3WODF 5A69A 3MBGA 4LDRA 3WG7C 3ZQYA 2EPLX 2R02A 3G50A 3DE9A 1FFHA 4K0DA 4MVUA 4A4AA 4CS8C 5KYNA 1HMOA 2NUPB 3LAYA 2J0WA 3KYIA 1J8MF 3PMRA 1LKXA 2YWAA 4XEVA 1BR4A 3GODA 4PFOA 2L6HA 3ASOC 4AX2A 1SF8A 2EINC 3PCVA 4O6NA 1K05A 2Q3TA 3IEEA 1PD1A 3EQLF 1OXKA 1NZEA 2GFHA 1EKYA 1Z23A 4DXWA 4YT2A 1WWPA 5AC4A 1K04A 2HS5A 4E18A 3N0TA 1ZHXA 3HLZA 3NMIA 2J9BA 2Q9CA 3T6JA 1L3PA 2Q9AA 1ORJA 1M56C 3FOPA 3LESA 3NMKA 1LE4A 3QVYA 1K40A 1KTMA 4GEHA 4I3MA 3ZIBA 2BE5F 1AUEA 4RBNA 3R2PA 2J0XA 1AEPA 1VYKA 1Y4CA 2A1DD 2W4BA 4HEAJ 3U2MA 4NTFA 2AWYA 4CS9C 5COGA 1PCXA 3V5YA 4JVSA 3L0IA 3OWTA 4BEJA 3ABKC 3NDBB 4P9TA 5CI9A 5F5HA 3JSEO 1EQ1A 4QI2A 2OJED 4NCQA 2LFDA 4BJ5C 3LJBA 4ZLCA 4XEFA 3C7JA 5A6AA 5L0CA 1MMAA 5L0DA 2O9XA 3HNKA 4ULWA 2OEVA 2XXAA 3AOUA 3FAJA 3OA1A 4QDLA 4AL0A 1V74B 1UG7A 3B0VC 3QW0A 3PDMP 1TWGA 3L34A 4JEAA 4PJJA 5DLJA 2DI3A 3JYHA 1XWJA 3T6GB 2J7PD 2CW0F 4OIQF 4B6IA 1QQ3A 2VC9A 1TWCA 3T4RA 1HE1A 2XLDA 1GQAA 1M6TA 2CYDA 1QPUA 1F1MA 2XL4A 3HKKA 3JZ0A 4JURI 1CGME 3JCUQ 4YN0B 2R7UA 1ZU5A 2R7XA 1E83A 3C18A 3EGXA 3RQEA 4XQ1A 3SXYA 1FAPB 4Z9HA 2X51A 3E70C 3US6A 3GANA 4L6RA 1OW8A 3FAPB 1ZHZA 2J7PA 2OU6A 2VB6A 2B0JA 3SP1A 5KYWA 2Y3DA 2ZPAA 4E0IA 1GGQA 4O6MA 4D4XA 1U0BB 2H7OA 4UDVA 3U8PA 3QW1A 4JW1A 4J32B 3UGOA 1ZZPA 1NU7D 3I5PA 1OCOC 1C03A 1CGOA 2CNWD 1R5ID 2GDCA 1D1AA 1L7CA 2NUPA 2WZGA 5CI8A 2KK1A 3U9JA 5COFA 4PJNA 1LS1A 2AP3A 4JJFA 1NLXA 2YQYA 4J7YA 2PNOA 1JMWA 4CS8A 3FOOA 1XZPA 1HMDA 3CQZA 4IRUA 2HV7A 2HSQA 2BC5A 2J45A 4DRHB 1LE2A 1VMAA 5JVEA 3ZC4A 4DRJB 3V5XA 256BA 2ZXPA 2AWCA 2XRHA 1RCPA 1RXQA 4YT8A 1ORSC 4N6HA 2C03A 3PHF2 3ABMC 1FMWA 4U9DA 2CNWA 1GS9A 4YWQA 2WB7A 2IXMA 2Q7RA 1HY5A 2YEVA 1Z3IX 1QLEC 3X1OA 3LEOA 1NG1A 1LI7A 4KI2A 4JIOA 3TOLA 1ORYA 4O6YA 2ETSA 3GWNA 4E17A 3N24A 5IY5C 1V55C 3C8GB 5FCLA 1LVKA 4JC7A 4MQ9F 1JPNA 1H6GA 2L6FA 4U9EA 4N4WA 1TWHA 2IXNA 1Y6DA 2R7OA 5HV9A 2KC3A 4CS9A 1M2VB 3GWLA 5D92A 4MVMA 4LDQA 3L8JA 3LS1A 1O3UA 3AQCA 3Q6NA 1IZMA 2DYRC 2YHSA 1ZHWA 3A11A 4IGGA 4G7OF 2XLVA 4XWJA 2R05A 5EGYA 4ULVA 3SEOA 4OIOF 3AG2C 4BJ5A 5B1BC 1LPEA 3V7OA 5DS4A 3B9QA 4JE9A 3IQ6A 2HJ3A 2Q00A 2YL3A 3K7DA 2Q4FA 4K7BA 4G7HF 3IHUA 2EIKC 1A7VA 5E33A 3WAQA 2VH3A 4QI0A 3UMKA 1JPJA 2KYHA 2DGJA 2ZD9A 3NRHA 2MYSA 3DZAA 2VCBA 1Z63A 3K1IC 4U5HA 2L81A 1ST6A 3K6BA 2YZSA 2A0BA 2XM4A 3HNLA 5F28E 1I4YA 3VM6A 3S90A 1YA9A 4JCZA 4U5BE 3WHNA 1N1CA 3K1HA 1LS4A 2ZXOA 4C3DA 1UFBA 1M57C 2W4MA 2D4UA 1G4WR 3DM9B 5T3TA 1E84A 3IPMO 1D0YA 5A6BD 3NMJA 2IYLD 4PFPA 3JT1A 3GEHA 1WN0A 3M79A 3TJ6A 4O7GA 1ZW3A 3KYJA 4MTFA 4CX9A 3NKEA 5DQZA 3UMIA 2KJGA 3EGDA 5DS5A 4YL0A 5L0FA 2L6GA 4M63A 3LNMB 3FVYA 3RQGA 4CSAC 5T1DB 1CPQA 3EJNA 5A6BA 5COMA 4WABA 1YAUO 2H7VC 3GEIA 4RDAA 2YKZA 5JS5A 4JTDB 3TOMA 1D0XA 5B3SC 4JJGA 2Y39A 2J9UA 2LIGA 1WATA 3ITFA 4C3BA 1WGWA 3C8GD 2OOCA 5BQHA 1MNDA 4E0HA 1E2XA 5CIVA 4YT5A 4DBRA 3GM3A 1H7IA 1NBBA 3F46A 4EKWA 1RKEB 1ZW2A 2WZLA 2NG1A 4XTKA 2QNLA 3KL4A 3QMKA 2LD6A 2F22A 1C17M 2WVOA 2XL6A 4WGZA 3S84A 2R03A 3O6XA 1S05A 3EG9B 3QZCA 2LSEA 3W2WA 1D1BA 1Q0GA 2EPNA 4G7ZF 1YARO 4XLPF 2DB4A 3C8GA 3CEXA 3DM5A 3J06A 2WVQA 3A9CA 3AG4C 3SNHA 2YL0A 4N06A 4WJ0A 1E86A 2L7AA 2V3CC 2YVKA 1M2VA 1SR2A 1APCA 2LFFA 1V4AA 3LEVA 1RMVA 4K1OA 1MNEA
chains in the Genus database with same CATH topology
2PFDA 1TR2A 3DXJF 3SYNA 3VYWA 2I8BA 2P6VA 2PF4E 3EPVA 4CBEA 4NY3A 2A69F 4YJWA 4C7OB 5L3QA 4LLEA 1KU2A 3AG3C 4CS7A 2Y3BA 3RKOF 4LERA 1BR2A 3S29A 2OCCC 2KW3C 3B0PA 2DYSC 3UGPA 3NYMA 1MMGA 3DAGA 5L3VA 3EH1A 2KNHA 5E3AA 4A2NB 3H65A 3S0XA 3KH2A 2R7RA 4CIHA 3F47A 3ZSUA 2PX0A 3AQBA 1OKKD 4CSAA 1MMNA 3NG1A 2G3KA 4FX5A 2PP4A 3DJNB 1VK5A 2XSEA 4XLNF 2V26A 1IW7F 1O87A 4H4KC 3RH3A 2C04A 5KYUB 1OCZC 5E2QA 3EG9A 2R7QA 3POVA 3Q6MA 1OKKA 2R7VA 4U5GA 2Y69C 2G62A 4FWVA 4C3EA 3UMHA 4YT4A 1W2WA 3W2VA 3EZHA 4U5FE 4LACB 1G8XA 3Q7GA 2Y3GA 3EHNA 3VAYA 4BJ1A 2R7SA 5B1AC 4C7OA 1RJ9B 1VYIA 2CGEA 2ZXWC 2ZXRA 3UR3C 4I44A 3MX3A 1M2OA 2Y3HA 2PX3A 2VASA 3LNRA 4AE4B 2E87A 3B0UX 3ASNC 3EFOB 1J8YF 2R7WA 3E9VA 3LLKA 3CZ6A 1Z6AA 3ABLC 1VOMA 2FFHA 2J46A 4FESA 4RD9A 3W8IA 4IAOA 3K33A 4JCHA 5KYXB 3EHMA 2A68F 4EWCA 1S7ZA 3NYLA 4F4BA 2H7BA 3NYJA 1ZHTA 5EHHA 1OCRC 3O39A 4O79A 2QY9A 4DOZA 2L9JA 2WL8A 4EBBA 2CDQA 4Q7CA 4KC9A 3KKBA 3FHDA 4J30B 4OIPF 5D91A 1D0ZA 1O5HA 2OG2A 3RIPA 3S27A 4PJMA 3RFYA 5KYUA 2IXPA 2IOQA 4HE8D 3CSKA 4BJ6C 4BJTA 2J9VA 3NKDA 3TD7A 2HV6A 2FGYA 4I1OB 4HFFB 2MWQA 3OEOA 4IWBA 4MNDA 4DVYP 3SZRA 2Z15A 3K66A 5DS6A 5E3CA 2QTVA 3I5QA 2NUTB 4I1MA 1D1CA 2M4EA 5KYYB 4DBQA 3I4UA 4DVZA 3S28A 1TKNA 2R7TA 4Q4ZF 4ZLDA 4OD5A 1MMDA 1ZYRF 1RJ9A 5F5FA 3DAFA 3M1CB 1FMVA 4X0RA 1FFTC 2EILC 2EIMC 1QZXA 4U5DE 3LLIA 3ZG1A 2G3VA 3JSZA 1OCCC 2KGOA 4KBLA 4JZAA 4AE4A 5T3WA 3EFOA 3RYLA 1ZU4A 4OIRF 1NU9C 3X2QC 1Z5ZA 4OINF 5BUOA 5KYXA 1PD0A 3ECSA 3EZIA 5DVWA 3ZVRA 4U5EE 3HTKC 2JD3A 4U5CE 2D5RB 4E7ZA 1SMYF 4GYTA 2A6EF 5HSWA 2KQ9A 1FTSA 3DJUB 4ANJA 4KNVA 2W9YA 3AG1C 2W45A 2P7VA 4P6IC 4IJJA 4HFKB 2A6HF 3KMIA 4KNWA 2EIJC 3DD7A 1BR1A 4Q5SF 3Q7LA 2WZFA 3W8HA 3N2ZB 2XXAB 2Q9BA 4PJLA 3FDQA 3JRTA 4OD4A 3LS0A 1V54C 3DMDA 4LLCA 2WVNA 3MLGA 1TWAA 3UNGC 2J9WA 3T6BA 4W8KA 4AK9A 1SZIA 5DQTA 4E7SA 4BJ6A 3EGXB 4BG0A 2NUTA 5KYYA 2IXOA 5KYWB 4G0HA 4PK4A 3HJCA 1ZHYA 3EH2A 3WODF 3WG7C 4CS8C 5KYNA 1FFHA 4K0DA 2NUPB 3LAYA 2J0WA 1J8MF 3PMRA 1LKXA 1BR4A 3GODA 4PFOA 3ASOC 4AX2A 1SF8A 2EINC 4O6NA 2Q3TA 3IEEA 1PD1A 3EQLF 1NZEA 2GFHA 1Z23A 4YT2A 3N0TA 1ZHXA 3HLZA 3T6JA 2Q9CA 2Q9AA 1M56C 3LESA 4GEHA 4I3MA 3ZIBA 2BE5F 4RBNA 2J0XA 1VYKA 4HEAJ 2A1DD 2W4BA 4CS9C 1PCXA 4JVSA 3L0IA 3OWTA 4BEJA 3ABKC 3NDBB 5CI9A 5F5HA 4QI2A 4BJ5C 3LJBA 1MMAA 2O9XA 4ULWA 2XXAA 3FAJA 3OA1A 4QDLA 3B0VC 1TWGA 3L34A 4PJJA 5DLJA 3JYHA 2J7PD 2CW0F 4OIQF 4B6IA 1TWCA 3T4RA 4JURI 2XL4A 3JCUQ 4YN0B 2R7UA 1ZU5A 2R7XA 3EGXA 2X51A 3E70C 3GANA 1ZHZA 2J7PA 2VB6A 3SP1A 2B0JA 5KYWA 2Y3DA 2ZPAA 4O6MA 2H7OA 4JW1A 4J32B 3UGOA 1NU7D 3I5PA 1OCOC 2CNWD 2WZGA 3EGDB 5CI8A 4ZLCA 1D1AA 2NUPA 4PJNA 1LS1A 4JJFA 4CS8A 3CQZA 4IRUA 2HV7A 2J45A 1VMAA 3ZC4A 2ZXPA 2XRHA 4YT8A 3PHF2 2C03A 3ABMC 1FMWA 2CNWA 4YWQA 2WB7A 2IXMA 2YEVA 1Z3IX 1QLEC 3X1OA 1NG1A 4KI2A 4O6YA 3N24A 5IY5C 1V55C 5FCLA 1LVKA 4MQ9F 1JPNA 1TWHA 2IXNA 2R7OA 4CS9A 1M2VB 5D92A 3LS1A 3AQCA 3Q6NA 1IZMA 2DYRC 2YHSA 1ZHWA 4G7OF 4XWJA 5EGYA 3SEOA 4OIOF 3AG2C 4BJ5A 5B1BC 3V7OA 5DS4A 3B9QA 3K7DA 4K7BA 4G7HF 2EIKC 5E33A 2VH3A 4QI0A 3UMKA 1JPJA 2DGJA 3NRHA 1Z63A 2MYSA 3DZAA 3K1IC 4U5HA 2L81A 1ST6A 3K6BA 2YZSA 4U5BE 1N1CA 3K1HA 2ZXOA 4C3DA 1M57C 2W4MA 3DM9B 5T3TA 1D0YA 4PFPA 2IYLD 3JT1A 4O7GA 3NKEA 5DQZA 3UMIA 2KJGA 3EGDA 5DS5A 4M63A 3FVYA 4CSAC 5T1DB 3EJNA 2H7VC 4RDAA 1D0XA 5B3SC 4JJGA 2Y39A 2J9UA 3ITFA 4C3BA 1WGWA 1MNDA 4YT5A 4DBRA 3F46A 2WZLA 2NG1A 3KL4A 3QMKA 2WVOA 3O6XA 3QZCA 3EG9B 3W2WA 2LSEA 1D1BA 4G7ZF 4XLPF 3DM5A 2WVQA 3SNHA 3AG4C 4N06A 2V3CC 4WJ0A 1M2VA 3LEVA 4XTKA 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ F;  2A68 F;  1SMY F;  4XLN F;  2A69 F;  1IW7 F;  2A6E F;  3UGP A;  4G7O F;  4OIO F;  3EQL F;  2A6H F;  4G7H F;  4KI2 A;  4G7Z F;  4XLP F;  1KU2 A;  4OIR F;  3LES A;  3UGO A;  4Q5S F;  3WOD F;  2CW0 F;  4OIQ F;  4OIP F;  2BE5 F;  4OIN F;  3LEV A;  4Q4Z F;  4MQ9 F;  1ZYR F; 
#chains in the Genus database with same CATH topology
 2PFD A;  1TR2 A;  3C62 A;  3DXJ F;  3SYN A;  3VYW A;  2AU5 A;  2I8B A;  2P6V A;  2GWW A;  3ZTM A;  2PF4 E;  3EPV A;  3U8V A;  4CBE A;  4NY3 A;  4MW3 A;  4CJO A;  2A69 F;  3HNI A;  5A6J A;  4R32 A;  4G78 A;  3GOR A;  5BQI A;  4Z9J A;  2HSB A;  2EPM X;  4ONS A;  1B68 A;  1YA7 O;  4JEB A;  4YJW A;  3SXZ A;  3U2L A;  3ZTZ A;  4LLE A;  5L3Q A;  2XLW A;  4BPM A;  1CPR A;  2XM0 A;  1KU2 A;  1T6I A;  2R9R B;  3AG3 C;  1Q0K A;  4CS7 A;  1ZVZ A;  3W4Y A;  2Y3B A;  1CGN A;  3RKO F;  4LER A;  1BR2 A;  4WGY A;  3K1I A;  3S29 A;  2TMV P;  2OCC C;  4XPW A;  2KW3 C;  3B0P A;  3AGU A;  2P61 A;  1EI7 A;  1WOL A;  3RF3 A;  4FAP B;  2GA0 A;  1MQV A;  4EBJ A;  1H9T A;  3SXM A;  3U3F A;  2PBE A;  2P0N A;  3IQC A;  2XS1 A;  2DYS C;  3UGP A;  1T9K A;  1OW6 A;  3QVZ A;  4YK5 A;  3NYM A;  1TQG A;  1MMG A;  2XS8 A;  3DAG A;  5AC5 A;  5L3V A;  3H2U A;  1NSG B;  3EH1 A;  3GM2 A;  1U89 A;  2KNH A;  3KPH A;  5E3A A;  1YZA A;  4A2N B;  1HW1 A;  4CDA A;  1BBH A;  3H65 A;  4NC3 A;  3S0X A;  3KH2 A;  2YRF A;  2R25 A;  1TFO B;  2R7R A;  1XZQ A;  4CIH A;  3F47 A;  1JRA A;  3ZSU A;  2MHR A;  2PX0 A;  3AQB A;  1OKK D;  4JKV A;  5K0I A;  1MMN A;  3U9M A;  4CSA A;  2A0U A;  2QLA A;  1T5O A;  1T01 A;  2HKV A;  3NG1 A;  2G3K A;  3RQF A;  5JRA A;  1LM3 B;  3AJM A;  4FX5 A;  5L0I A;  3M4B A;  2PP4 A;  1RKE A;  5EK0 A;  5B3I A;  3DJN B;  1VK5 A;  2JX0 A;  2HFI A;  2VCC A;  2XSE A;  1KNY A;  4CDY A;  2QUP A;  4IAR A;  2V26 A;  4XLN F;  1IW7 F;  1O87 A;  4H4K C;  3RH3 A;  2C04 A;  3TJ5 A;  5KYU B;  1OCZ C;  1NFO A;  2ASR A;  3EG9 A;  5E2Q A;  2R7Q A;  2BL2 A;  3G4Z A;  3Q6M A;  3POV A;  1OKK A;  2R7V A;  1DOV A;  5JLI A;  4U5G A;  3BRJ A;  2Y69 C;  3DKA A;  2G62 A;  4FWV A;  3U3B A;  4C3E A;  1WAS A;  3UMH A;  4YT4 A;  3FXH A;  1W2W A;  3TK0 A;  3W2V A;  3EZH A;  3QTH A;  1BDJ B;  4MVR A;  1OQC A;  4LAC B;  4U5F E;  4LDK A;  2OKU A;  1G8X A;  3Q7G A;  2Y3G A;  1C02 A;  2KSF A;  3EHN A;  5AGF A;  3SXK A;  3VAY A;  4BJ1 A;  3FMS A;  2R7S A;  1AVO B;  2YL1 A;  4XPY A;  1QVX A;  2IM8 A;  5B1A C;  3JTL O;  4C7O A;  1OXB A;  1RJ9 B;  3HNJ A;  1VYI A;  2CGE A;  2ZXW C;  2ZXR A;  3UR3 C;  4MVZ A;  5JSL A;  1EA8 A;  2QE9 A;  3MX3 A;  4I44 A;  3V5Z A;  1YYJ A;  1M2O A;  1A7E A;  2Y3H A;  2GAQ A;  4MVQ A;  2PX3 A;  2RD9 A;  2VAS A;  3LNR A;  2YLG A;  2NSF A;  4AE4 B;  1I5N A;  2E87 A;  3B0U X;  3ASN C;  3EFO B;  3L1M A;  1J8Y F;  3B71 A;  2R7W A;  3E9V A;  3CZ6 A;  1Z6A A;  3LLK A;  3C63 A;  2NPU A;  1VOM A;  3ABL C;  1HE9 A;  2FFH A;  2J46 A;  3MYF A;  4FES A;  3CAX A;  4RD9 A;  3W8I A;  2OQM A;  4IAO A;  4BEM J;  3K33 A;  4JCH A;  5L0H A;  5KYX B;  3EHM A;  1Q0M A;  2A68 F;  4EWC A;  1H9G A;  1OR3 A;  4MTO A;  3RW0 A;  1S7Z A;  3NYL A;  4F4B A;  4MVO A;  3JYY A;  2H7B A;  4YL1 A;  4J7T A;  4P9F A;  3NYJ A;  1G4U S;  1ZHT A;  4MTG A;  1Z7Q c;  5EHH A;  1OCR C;  1OR2 A;  1WTY A;  3O39 A;  1YZC A;  4O79 A;  3JRM O;  2QY9 A;  4DOZ A;  1U6H A;  1NFN A;  4XPX A;  2L9J A;  2WL8 A;  4EBB A;  1A0B A;  2CDQ A;  4Q7C A;  4KC9 A;  3KKB A;  3FHD A;  1VLS A;  4IAQ A;  4J30 B;  2JPU A;  4MS2 A;  2XLO A;  5D91 A;  3H2V A;  2LQG A;  5BQG A;  4OIP F;  3BEH A;  1D0Z A;  4EBK A;  4JRZ A;  2UUI A;  1O5H A;  2OG2 A;  3RIP A;  4EHP A;  1OW7 A;  1Q0D A;  1JR8 A;  2EPO A;  3S27 A;  4PJM A;  2X0C A;  3RFY A;  5KYU A;  5L0J A;  5FZT A;  4ER9 A;  2IXP A;  4XEK A;  2IOQ A;  2RSE B;  4HE8 D;  2FAP B;  5JP7 A;  1FR0 A;  3CSK A;  4BJ6 C;  3M4C A;  1SYQ A;  4BJT A;  2J9V A;  3NKD A;  3TD7 A;  3DWW A;  2HV6 A;  1T6Q A;  1VTM P;  4DJ9 A;  2FGY A;  4I1O B;  4HFF B;  2MWQ A;  3OEO A;  3GM1 A;  4IWB A;  4JTC B;  2HMZ A;  4MND A;  3TQO A;  3VRC A;  3R7C A;  4D4N A;  3SZR A;  4DVY P;  2Z15 A;  3ZDL A;  3K66 A;  4CDV A;  5E3C A;  5DS6 A;  2QTV A;  3I5Q A;  4JTA B;  2NUT B;  4I1M A;  3ZQV A;  4YL3 A;  1D1C A;  2M4E A;  5KYY B;  4DBQ A;  3I4U A;  2I15 A;  3RVZ A;  5A6K A;  5JT4 A;  4DVZ A;  1A7D A;  5TJ5 E;  3S28 A;  1TKN A;  1HW2 A;  2R7T A;  2CCY A;  4Q4Z F;  4ZLD A;  4OD5 A;  2XLH A;  1MMD A;  1ZYR F;  2UUH A;  4H54 A;  3TUL A;  3U0C A;  1RJ9 A;  1TFK B;  2YLI A;  5F5F A;  3DAF A;  3M1C B;  1FMV A;  4X0R A;  3MYI A;  5GPG B;  1FFT C;  2EIL C;  3U5S A;  1QKR A;  2LP4 A;  1YDI A;  2EIM C;  3M15 A;  1QZX A;  4U5D E;  3LLI A;  3EGD B;  3ZG1 A;  3LUT B;  2G3V A;  3JSZ A;  1OCC C;  1YYX A;  2KGO A;  4KBL A;  3IQ5 A;  4JZA A;  4GQH A;  5T3W A;  2HJM A;  4Z9I A;  4AE4 A;  3EFO A;  2XLE A;  1VLT A;  1DOW A;  4N6C A;  3RYL A;  1ZU4 A;  1GM5 A;  3G4X A;  4OIR F;  2OJQ A;  2HUJ A;  4NTA A;  1NU9 C;  3X2Q C;  2P1A A;  3L8I A;  3O10 A;  1Z5Z A;  4PAC A;  4OIN F;  3RVY A;  5BUO A;  5KYX A;  1PD0 A;  3ECS A;  3EZI A;  5DVW A;  4EIY A;  3ZVR A;  1JAF A;  1RKC A;  4U5E E;  3C8Z A;  3HTK C;  2JD3 A;  2VCA A;  4U5C E;  1G5Z A;  4CIP A;  1PV3 A;  2D5R B;  4E7Z A;  1SMY F;  4EUK B;  4GYT A;  2A6E F;  3DI5 A;  2LK4 A;  3AGT A;  5HSW A;  1I4Z A;  2KQ9 A;  2M64 A;  3B29 A;  4C7O B;  2AVK A;  1FTS A;  3DJU B;  2J8W A;  2OEX A;  2W9Y A;  3AG1 C;  1LI5 A;  2W45 A;  4KNV A;  4ANJ A;  1A41 A;  2P7V A;  4P6I C;  4IJJ A;  1LIH A;  3O55 A;  2HZ8 A;  1JOG A;  3MFN A;  4MW8 A;  3S9O A;  4HFK B;  4CJG A;  2A6H F;  3KMI A;  2NSG A;  3ATP A;  1VB5 A;  4KNW A;  2EIJ C;  3VF0 A;  3DD7 A;  1BR1 A;  5L0G A;  2B0H A;  3Q7L A;  1Q0F A;  4Q5S F;  1E85 A;  2WZF A;  3GEE A;  3N2Z B;  3W8H A;  2XXA B;  2ICW G;  2Q9B A;  4NQF A;  4PJL A;  3FDQ A;  3JRT A;  4OD4 A;  3IQT A;  3LS0 A;  2LCH A;  1V54 C;  2XL8 A;  2YLD A;  2XLM A;  3ZWI A;  4PR9 A;  3DMD A;  4LLC A;  2WVN A;  1R4T A;  1TWA A;  2H8A A;  1BZ4 A;  3MLG A;  2J9W A;  3T9O A;  3UNG C;  1FNT c;  3T6B A;  2HMQ A;  4W8K A;  1SZI A;  4AK9 A;  1T6U A;  4AL1 A;  5DQT A;  4W8P A;  4E7S A;  5JUA A;  4BJ6 A;  3EGX B;  4BG0 A;  2NUT A;  1YLM A;  2EPK X;  4NTB A;  4DRI B;  2YL7 A;  2IXO A;  5KYY A;  1YVI A;  5KYW B;  4G0H A;  4PK4 A;  2IBF A;  3DE8 A;  3HJC A;  1QSP A;  4IB4 A;  1ZHY A;  3EH2 A;  1YJG A;  4MVS A;  3WOD F;  5A69 A;  3MBG A;  4LDR A;  3WG7 C;  3ZQY A;  2EPL X;  2R02 A;  3G50 A;  3DE9 A;  1FFH A;  4K0D A;  4MVU A;  4A4A A;  4CS8 C;  5KYN A;  1HMO A;  2NUP B;  3LAY A;  2J0W A;  3KYI A;  1J8M F;  3PMR A;  1LKX A;  2YWA A;  4XEV A;  1BR4 A;  3GOD A;  4PFO A;  2L6H A;  3ASO C;  4AX2 A;  1SF8 A;  2EIN C;  3PCV A;  4O6N A;  1K05 A;  2Q3T A;  3IEE A;  1PD1 A;  3EQL F;  1OXK A;  1NZE A;  2GFH A;  1EKY A;  1Z23 A;  4DXW A;  4YT2 A;  1WWP A;  5AC4 A;  1K04 A;  2HS5 A;  4E18 A;  3N0T A;  1ZHX A;  3HLZ A;  3NMI A;  2J9B A;  2Q9C A;  3T6J A;  1L3P A;  2Q9A A;  1ORJ A;  1M56 C;  3FOP A;  3LES A;  3NMK A;  1LE4 A;  3QVY A;  1K40 A;  1KTM A;  4GEH A;  4I3M A;  3ZIB A;  2BE5 F;  1AUE A;  4RBN A;  3R2P A;  2J0X A;  1AEP A;  1VYK A;  1Y4C A;  2A1D D;  2W4B A;  4HEA J;  3U2M A;  4NTF A;  2AWY A;  4CS9 C;  5COG A;  1PCX A;  3V5Y A;  4JVS A;  3L0I A;  3OWT A;  4BEJ A;  3ABK C;  3NDB B;  4P9T A;  5CI9 A;  5F5H A;  3JSE O;  1EQ1 A;  4QI2 A;  2OJE D;  4NCQ A;  2LFD A;  4BJ5 C;  3LJB A;  4ZLC A;  4XEF A;  3C7J A;  5A6A A;  5L0C A;  1MMA A;  5L0D A;  2O9X A;  3HNK A;  4ULW A;  2OEV A;  2XXA A;  3AOU A;  3FAJ A;  3OA1 A;  4QDL A;  4AL0 A;  1V74 B;  1UG7 A;  3B0V C;  3QW0 A;  3PDM P;  1TWG A;  3L34 A;  4JEA A;  4PJJ A;  5DLJ A;  2DI3 A;  3JYH A;  1XWJ A;  3T6G B;  2J7P D;  2CW0 F;  4OIQ F;  4B6I A;  1QQ3 A;  2VC9 A;  1TWC A;  3T4R A;  1HE1 A;  2XLD A;  1GQA A;  1M6T A;  2CYD A;  1QPU A;  1F1M A;  2XL4 A;  3HKK A;  3JZ0 A;  4JUR I;  1CGM E;  3JCU Q;  4YN0 B;  2R7U A;  1ZU5 A;  2R7X A;  1E83 A;  3C18 A;  3EGX A;  3RQE A;  4XQ1 A;  3SXY A;  1FAP B;  4Z9H A;  2X51 A;  3E70 C;  3US6 A;  3GAN A;  4L6R A;  1OW8 A;  3FAP B;  1ZHZ A;  2J7P A;  2OU6 A;  2VB6 A;  2B0J A;  3SP1 A;  5KYW A;  2Y3D A;  2ZPA A;  4E0I A;  1GGQ A;  4O6M A;  4D4X A;  1U0B B;  2H7O A;  4UDV A;  3U8P A;  3QW1 A;  4JW1 A;  4J32 B;  3UGO A;  1ZZP A;  1NU7 D;  3I5P A;  1OCO C;  1C03 A;  1CGO A;  2CNW D;  1R5I D;  2GDC A;  1D1A A;  1L7C A;  2NUP A;  2WZG A;  5CI8 A;  2KK1 A;  3U9J A;  5COF A;  4PJN A;  1LS1 A;  2AP3 A;  4JJF A;  1NLX A;  2YQY A;  4J7Y A;  2PNO A;  1JMW A;  4CS8 A;  3FOO A;  1XZP A;  1HMD A;  3CQZ A;  4IRU A;  2HV7 A;  2HSQ A;  2BC5 A;  2J45 A;  4DRH B;  1LE2 A;  1VMA A;  5JVE A;  3ZC4 A;  4DRJ B;  3V5X A;  256B A;  2ZXP A;  2AWC A;  2XRH A;  1RCP A;  1RXQ A;  4YT8 A;  1ORS C;  4N6H A;  2C03 A;  3PHF 2;  3ABM C;  1FMW A;  4U9D A;  2CNW A;  1GS9 A;  4YWQ A;  2WB7 A;  2IXM A;  2Q7R A;  1HY5 A;  2YEV A;  1Z3I X;  1QLE C;  3X1O A;  3LEO A;  1NG1 A;  1LI7 A;  4KI2 A;  4JIO A;  3TOL A;  1ORY A;  4O6Y A;  2ETS A;  3GWN A;  4E17 A;  3N24 A;  5IY5 C;  1V55 C;  3C8G B;  5FCL A;  1LVK A;  4JC7 A;  4MQ9 F;  1JPN A;  1H6G A;  2L6F A;  4U9E A;  4N4W A;  1TWH A;  2IXN A;  1Y6D A;  2R7O A;  5HV9 A;  2KC3 A;  4CS9 A;  1M2V B;  3GWL A;  5D92 A;  4MVM A;  4LDQ A;  3L8J A;  3LS1 A;  1O3U A;  3AQC A;  3Q6N A;  1IZM A;  2DYR C;  2YHS A;  1ZHW A;  3A11 A;  4IGG A;  4G7O F;  2XLV A;  4XWJ A;  2R05 A;  5EGY A;  4ULV A;  3SEO A;  4OIO F;  3AG2 C;  4BJ5 A;  5B1B C;  1LPE A;  3V7O A;  5DS4 A;  3B9Q A;  4JE9 A;  3IQ6 A;  2HJ3 A;  2Q00 A;  2YL3 A;  3K7D A;  2Q4F A;  4K7B A;  4G7H F;  3IHU A;  2EIK C;  1A7V A;  5E33 A;  3WAQ A;  2VH3 A;  4QI0 A;  3UMK A;  1JPJ A;  2KYH A;  2DGJ A;  2ZD9 A;  3NRH A;  2MYS A;  3DZA A;  2VCB A;  1Z63 A;  3K1I C;  4U5H A;  2L81 A;  1ST6 A;  3K6B A;  2YZS A;  2A0B A;  2XM4 A;  3HNL A;  5F28 E;  1I4Y A;  3VM6 A;  3S90 A;  1YA9 A;  4JCZ A;  4U5B E;  3WHN A;  1N1C A;  3K1H A;  1LS4 A;  2ZXO A;  4C3D A;  1UFB A;  1M57 C;  2W4M A;  2D4U A;  1G4W R;  3DM9 B;  5T3T A;  1E84 A;  3IPM O;  1D0Y A;  5A6B D;  3NMJ A;  2IYL D;  4PFP A;  3JT1 A;  3GEH A;  1WN0 A;  3M79 A;  3TJ6 A;  4O7G A;  1ZW3 A;  3KYJ A;  4MTF A;  4CX9 A;  3NKE A;  5DQZ A;  3UMI A;  2KJG A;  3EGD A;  5DS5 A;  4YL0 A;  5L0F A;  2L6G A;  4M63 A;  3LNM B;  3FVY A;  3RQG A;  4CSA C;  5T1D B;  1CPQ A;  3EJN A;  5A6B A;  5COM A;  4WAB A;  1YAU O;  2H7V C;  3GEI A;  4RDA A;  2YKZ A;  5JS5 A;  4JTD B;  3TOM A;  1D0X A;  5B3S C;  4JJG A;  2Y39 A;  2J9U A;  2LIG A;  1WAT A;  3ITF A;  4C3B A;  1WGW A;  3C8G D;  2OOC A;  5BQH A;  1MND A;  4E0H A;  1E2X A;  5CIV A;  4YT5 A;  4DBR A;  3GM3 A;  1H7I A;  1NBB A;  3F46 A;  4EKW A;  1RKE B;  1ZW2 A;  2WZL A;  2NG1 A;  4XTK A;  2QNL A;  3KL4 A;  3QMK A;  2LD6 A;  2F22 A;  1C17 M;  2WVO A;  2XL6 A;  4WGZ A;  3S84 A;  2R03 A;  3O6X A;  1S05 A;  3EG9 B;  3QZC A;  2LSE A;  3W2W A;  1D1B A;  1Q0G A;  2EPN A;  4G7Z F;  1YAR O;  4XLP F;  2DB4 A;  3C8G A;  3CEX A;  3DM5 A;  3J06 A;  2WVQ A;  3A9C A;  3AG4 C;  3SNH A;  2YL0 A;  4N06 A;  4WJ0 A;  1E86 A;  2L7A A;  2V3C C;  2YVK A;  1M2V A;  1SR2 A;  1APC A;  2LFF A;  1V4A A;  3LEV A;  1RMV A;  4K1O A;  1MNE A; 
#chains in the Genus database with same CATH homology
 2PFD A;  1TR2 A;  3DXJ F;  3SYN A;  3VYW A;  2I8B A;  2P6V A;  2PF4 E;  3EPV A;  4CBE A;  4NY3 A;  2A69 F;  4YJW A;  4C7O B;  5L3Q A;  4LLE A;  1KU2 A;  3AG3 C;  4CS7 A;  2Y3B A;  3RKO F;  4LER A;  1BR2 A;  3S29 A;  2OCC C;  2KW3 C;  3B0P A;  2DYS C;  3UGP A;  3NYM A;  1MMG A;  3DAG A;  5L3V A;  3EH1 A;  2KNH A;  5E3A A;  4A2N B;  3H65 A;  3S0X A;  3KH2 A;  2R7R A;  4CIH A;  3F47 A;  3ZSU A;  2PX0 A;  3AQB A;  1OKK D;  4CSA A;  1MMN A;  3NG1 A;  2G3K A;  4FX5 A;  2PP4 A;  3DJN B;  1VK5 A;  2XSE A;  4XLN F;  2V26 A;  1IW7 F;  1O87 A;  4H4K C;  3RH3 A;  2C04 A;  5KYU B;  1OCZ C;  5E2Q A;  3EG9 A;  2R7Q A;  3POV A;  3Q6M A;  1OKK A;  2R7V A;  4U5G A;  2Y69 C;  2G62 A;  4FWV A;  4C3E A;  3UMH A;  4YT4 A;  1W2W A;  3W2V A;  3EZH A;  4U5F E;  4LAC B;  1G8X A;  3Q7G A;  2Y3G A;  3EHN A;  3VAY A;  4BJ1 A;  2R7S A;  5B1A C;  4C7O A;  1RJ9 B;  1VYI A;  2CGE A;  2ZXW C;  2ZXR A;  3UR3 C;  4I44 A;  3MX3 A;  1M2O A;  2Y3H A;  2PX3 A;  2VAS A;  3LNR A;  4AE4 B;  2E87 A;  3B0U X;  3ASN C;  3EFO B;  1J8Y F;  2R7W A;  3E9V A;  3LLK A;  3CZ6 A;  1Z6A A;  3ABL C;  1VOM A;  2FFH A;  2J46 A;  4FES A;  4RD9 A;  3W8I A;  4IAO A;  3K33 A;  4JCH A;  5KYX B;  3EHM A;  2A68 F;  4EWC A;  1S7Z A;  3NYL A;  4F4B A;  2H7B A;  3NYJ A;  1ZHT A;  5EHH A;  1OCR C;  3O39 A;  4O79 A;  2QY9 A;  4DOZ A;  2L9J A;  2WL8 A;  4EBB A;  2CDQ A;  4Q7C A;  4KC9 A;  3KKB A;  3FHD A;  4J30 B;  4OIP F;  5D91 A;  1D0Z A;  1O5H A;  2OG2 A;  3RIP A;  3S27 A;  4PJM A;  3RFY A;  5KYU A;  2IXP A;  2IOQ A;  4HE8 D;  3CSK A;  4BJ6 C;  4BJT A;  2J9V A;  3NKD A;  3TD7 A;  2HV6 A;  2FGY A;  4I1O B;  4HFF B;  2MWQ A;  3OEO A;  4IWB A;  4MND A;  4DVY P;  3SZR A;  2Z15 A;  3K66 A;  5DS6 A;  5E3C A;  2QTV A;  3I5Q A;  2NUT B;  4I1M A;  1D1C A;  2M4E A;  5KYY B;  4DBQ A;  3I4U A;  4DVZ A;  3S28 A;  1TKN A;  2R7T A;  4Q4Z F;  4ZLD A;  4OD5 A;  1MMD A;  1ZYR F;  1RJ9 A;  5F5F A;  3DAF A;  3M1C B;  1FMV A;  4X0R A;  1FFT C;  2EIL C;  2EIM C;  1QZX A;  4U5D E;  3LLI A;  3ZG1 A;  2G3V A;  3JSZ A;  1OCC C;  2KGO A;  4KBL A;  4JZA A;  4AE4 A;  5T3W A;  3EFO A;  3RYL A;  1ZU4 A;  4OIR F;  1NU9 C;  3X2Q C;  1Z5Z A;  4OIN F;  5BUO A;  5KYX A;  1PD0 A;  3ECS A;  3EZI A;  5DVW A;  3ZVR A;  4U5E E;  3HTK C;  2JD3 A;  4U5C E;  2D5R B;  4E7Z A;  1SMY F;  4GYT A;  2A6E F;  5HSW A;  2KQ9 A;  1FTS A;  3DJU B;  4ANJ A;  4KNV A;  2W9Y A;  3AG1 C;  2W45 A;  2P7V A;  4P6I C;  4IJJ A;  4HFK B;  2A6H F;  3KMI A;  4KNW A;  2EIJ C;  3DD7 A;  1BR1 A;  4Q5S F;  3Q7L A;  2WZF A;  3W8H A;  3N2Z B;  2XXA B;  2Q9B A;  4PJL A;  3FDQ A;  3JRT A;  4OD4 A;  3LS0 A;  1V54 C;  3DMD A;  4LLC A;  2WVN A;  3MLG A;  1TWA A;  3UNG C;  2J9W A;  3T6B A;  4W8K A;  4AK9 A;  1SZI A;  5DQT A;  4E7S A;  4BJ6 A;  3EGX B;  4BG0 A;  2NUT A;  5KYY A;  2IXO A;  5KYW B;  4G0H A;  4PK4 A;  3HJC A;  1ZHY A;  3EH2 A;  3WOD F;  3WG7 C;  4CS8 C;  5KYN A;  1FFH A;  4K0D A;  2NUP B;  3LAY A;  2J0W A;  1J8M F;  3PMR A;  1LKX A;  1BR4 A;  3GOD A;  4PFO A;  3ASO C;  4AX2 A;  1SF8 A;  2EIN C;  4O6N A;  2Q3T A;  3IEE A;  1PD1 A;  3EQL F;  1NZE A;  2GFH A;  1Z23 A;  4YT2 A;  3N0T A;  1ZHX A;  3HLZ A;  3T6J A;  2Q9C A;  2Q9A A;  1M56 C;  3LES A;  4GEH A;  4I3M A;  3ZIB A;  2BE5 F;  4RBN A;  2J0X A;  1VYK A;  4HEA J;  2A1D D;  2W4B A;  4CS9 C;  1PCX A;  4JVS A;  3L0I A;  3OWT A;  4BEJ A;  3ABK C;  3NDB B;  5CI9 A;  5F5H A;  4QI2 A;  4BJ5 C;  3LJB A;  1MMA A;  2O9X A;  4ULW A;  2XXA A;  3FAJ A;  3OA1 A;  4QDL A;  3B0V C;  1TWG A;  3L34 A;  4PJJ A;  5DLJ A;  3JYH A;  2J7P D;  2CW0 F;  4OIQ F;  4B6I A;  1TWC A;  3T4R A;  4JUR I;  2XL4 A;  3JCU Q;  4YN0 B;  2R7U A;  1ZU5 A;  2R7X A;  3EGX A;  2X51 A;  3E70 C;  3GAN A;  1ZHZ A;  2J7P A;  2VB6 A;  3SP1 A;  2B0J A;  5KYW A;  2Y3D A;  2ZPA A;  4O6M A;  2H7O A;  4JW1 A;  4J32 B;  3UGO A;  1NU7 D;  3I5P A;  1OCO C;  2CNW D;  2WZG A;  3EGD B;  5CI8 A;  4ZLC A;  1D1A A;  2NUP A;  4PJN A;  1LS1 A;  4JJF A;  4CS8 A;  3CQZ A;  4IRU A;  2HV7 A;  2J45 A;  1VMA A;  3ZC4 A;  2ZXP A;  2XRH A;  4YT8 A;  3PHF 2;  2C03 A;  3ABM C;  1FMW A;  2CNW A;  4YWQ A;  2WB7 A;  2IXM A;  2YEV A;  1Z3I X;  1QLE C;  3X1O A;  1NG1 A;  4KI2 A;  4O6Y A;  3N24 A;  5IY5 C;  1V55 C;  5FCL A;  1LVK A;  4MQ9 F;  1JPN A;  1TWH A;  2IXN A;  2R7O A;  4CS9 A;  1M2V B;  5D92 A;  3LS1 A;  3AQC A;  3Q6N A;  1IZM A;  2DYR C;  2YHS A;  1ZHW A;  4G7O F;  4XWJ A;  5EGY A;  3SEO A;  4OIO F;  3AG2 C;  4BJ5 A;  5B1B C;  3V7O A;  5DS4 A;  3B9Q A;  3K7D A;  4K7B A;  4G7H F;  2EIK C;  5E33 A;  2VH3 A;  4QI0 A;  3UMK A;  1JPJ A;  2DGJ A;  3NRH A;  1Z63 A;  2MYS A;  3DZA A;  3K1I C;  4U5H A;  2L81 A;  1ST6 A;  3K6B A;  2YZS A;  4U5B E;  1N1C A;  3K1H A;  2ZXO A;  4C3D A;  1M57 C;  2W4M A;  3DM9 B;  5T3T A;  1D0Y A;  4PFP A;  2IYL D;  3JT1 A;  4O7G A;  3NKE A;  5DQZ A;  3UMI A;  2KJG A;  3EGD A;  5DS5 A;  4M63 A;  3FVY A;  4CSA C;  5T1D B;  3EJN A;  2H7V C;  4RDA A;  1D0X A;  5B3S C;  4JJG A;  2Y39 A;  2J9U A;  3ITF A;  4C3B A;  1WGW A;  1MND A;  4YT5 A;  4DBR A;  3F46 A;  2WZL A;  2NG1 A;  3KL4 A;  3QMK A;  2WVO A;  3O6X A;  3QZC A;  3EG9 B;  3W2W A;  2LSE A;  1D1B A;  4G7Z F;  4XLP F;  3DM5 A;  2WVQ A;  3SNH A;  3AG4 C;  4N06 A;  2V3C C;  4WJ0 A;  1M2V A;  3LEV A;  4XTK A;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...