3UGPA

Crystal structure of rna-polymerase sigma subunit domain 2 complexed with -10 promoter element ssdna oligo (tataat)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
179
structure length
179
Chain Sequence
b'SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for promoter-10 element recognition by the bacterial RNA polymerase sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 69
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ugpA00
4XLPF 2A69F 3EQLF 3DXJF 3LESA 1SMYF 4G7OF 4OIQF 3UGOA 4Q4ZF 3LEVA 2BE5F 1KU2A 2A68F 2A6HF 4KI2A 2CW0F 4OIPF 4XLNF 4G7HF 4OIRF 4MQ9F 3UGPA 2A6EF 4G7ZF 3WODF 1ZYRF 4OIOF 4Q5SF 1IW7F 4OINF
chains in the Genus database with same CATH superfamily
1D1AA 3S0XA 1VB5A 3M4BA 1K05A 3K1HA 2CGEA 1VYIA 1YYXA 3JRMO 3NDBB 2A69F 2YWAA 1NFNA 3S29A 4MVMA 1O87A 2A1DD 4Z9IA 3B0UX 1V55C 4AE4A 1T6IA 1MNDA 4A2NB 5CIVA 2CCYA 4CIHA 5KYNA 5KYWB 2CW0F 1TWCA 2DYSC 1C02A 2ETSA 3NMIA 3LEOA 1ZVZA 3DI5A 4NQFA 4XTKA 5AC4A 3M1CB 3EH1A 2HV6A 4CDYA 5DLJA 5L0DA 4ZLDA 2NPUA 3C8GD 5IY5C 1EQ1A 3PHF2 2LIGA 3ABMC 3AJMA 3QZCA 3FAJA 5D92A 1CPQA 2EIJC 1T6QA 5BUOA 1T5OA 3G4XA 4MVQA 4DVYP 3ZSUA 2EPLX 5CI8A 3NYJA 4IRUA 1IW7F 1C03A 5D91A 5F5FA 1LI7A 2Q9BA 2HSBA 4EHPA 1WASA 4JJGA 3AQBA 4XPYA 1K04A 2KSFA 4JTAB 3I4UA 2TMVP 1TR2A 1J8YF 1CGNA 4G0HA 3U9JA 1RKEA 1LVKA 2XL8A 5L0IA 1DOWA 1ST6A 3Q6NA 2XXAA 4YT5A 1Q0GA 3H65A 2Q00A 5COGA 1SF8A 5EGYA 2A6HF 4PFOA 2KW3C 4X0RA 4KBLA 1YA9A 1YA7O 4U5GA 3HNIA 3U0CA 1NU7D 2R03A 1FMWA 2NUPA 4MQ9F 3RF3A 4BJ1A 3B0VC 1I5NA 1C17M 4FAPB 5GPGB 1ORSC 1FFHA 3VAYA 4CS9C 1APCA 3H2VA 1WOLA 3LAYA 3DWWA 2DGJA 4EKWA 5DS4A 1YZAA 4MVZA 3K7DA 3NMKA 2LP4A 3Q7LA 4JIOA 2CDQA 5E3CA 1ZHZA 5A6JA 1Q0FA 3J06A 5HSWA 2W9YA 1I4YA 1FTSA 5JLIA 1UG7A 2YHSA 1BR4A 3KH2A 2KC3A 3L1MA 1KTMA 4KNVA 2J46A 3V5XA 3KL4A 5BQIA 3TJ5A 3LLIA 5EK0A 2BE5F 3EFOA 2XLOA 1OXKA 1QSPA 3EPVA 3HTKC 4JVSA 3EZIA 4N6HA 1T9KA 2KYHA 4AX2A 1H6GA 4NCQA 1SR2A 3ZIBA 4BJ6C 4C7OA 4IB4A 3E9VA 3GM2A 1XZQA 3RH3A 4AE4B 2CNWA 5DVWA 2XS8A 1L7CA 1RCPA 1QKRA 1VLSA 2J9WA 4XQ1A 3PDMP 2HSQA 2Y39A 2ZXRA 4J7TA 2KGOA 3C8GA 2IXMA 2LFDA 2OKUA 4YWQA 3L8JA 1FFTC 2QNLA 1QQ3A 2MHRA 2LSEA 2PFDA 3EZHA 3V5ZA 4ULWA 1YVIA 1YLMA 2R05A 3IEEA 3W4YA 4Z9JA 2AP3A 3GM1A 4IJJA 4RD9A 2H8AA 2WVQA 1OKKA 2EPNA 3CAXA 4CS7A 1Z63A 1CGOA 1YYJA 1JMWA 3ZQVA 3TOLA 4YL3A 2VCCA 4KI2A 5A6AA 1MMDA 3GODA 2Q7RA 5K0IA 3T6GB 1HY5A 3OWTA 3I5PA 2HS5A 1D1CA 2HMZA 1RKEB 1UFBA 2EPMX 2J7PD 4LLEA 1NLXA 1ZU5A 4IGGA 2XXAB 1I4ZA 3EHNA 4E7SA 4AK9A 1BR1A 3L0IA 3JSZA 4GEHA 3POVA 2LK4A 2YL0A 3BEHA 3NKEA 2OQMA 2G3KA 1PV3A 4E17A 2YL1A 3AGTA 2OEXA 4MW3A 4YT2A 1ZW3A 2NUPB 4XPWA 3LS1A 5JRAA 1J8MF 3A11A 1WATA 2XS1A 3NYMA 3SP1A 3DD7A 5KYXA 3LESA 5B3SC 3EGXB 1LS1A 3K6BA 1U0BB 1O5HA 4DRHB 2BL2A 2A0UA 3SNHA 4NTFA 1ZHYA 3ASOC 3X1OA 3UGOA 4JJFA 3GANA 4O6NA 3VRCA 2WZGA 4LACB 2OG2A 4NC3A 2KNHA 3KYIA 3MYFA 3HNJA 4EIYA 1U89A 3IHUA 3MX3A 3NG1A 3EH2A 3KMIA 1YZCA 2XLWA 4JC7A 3V7OA 3MYIA 1FNTc 2B0JA 4CSAC 3O39A 4DXWA 1HW1A 1S7ZA 3EFOB 4O79A 2XM4A 2OJQA 2R9RB 3U9MA 4CDVA 1WGWA 4J32B 4JCHA 1A41A 4I1MA 1U6HA 1TQGA 2Q4FA 4W8KA 5T3TA 1TWHA 4GYTA 4C7OB 3U2MA 3EQLF 4CSAA 2IXOA 3EHMA 1TWAA 3ZQYA 1MMAA 1T01A 2ZXWC 3M15A 3OA1A 4K7BA 3W8HA 1HMDA 1VYKA 3IPMO 3BRJA 3EG9A 2FGYA 1NG1A 3F47A 2WL8A 4FX5A 3K33A 4HFFB 4KNWA 3C8GB 4OD4A 3TULA 2R7OA 3DM9B 2ASRA 2Y69C 4YL1A 2MYSA 5A6BD 2I15A 4ULVA 1O3UA 3TK0A 1OW8A 3U2LA 4YT8A 4IARA 2L6GA 2HUJA 2YZSA 4CDAA 4MVUA 5F28E 1HE9A 1KNYA 4PACA 1LS4A 2XLHA 3ABKC 1JPJA 2PNOA 3C62A 4W8PA 3PCVA 4GQHA 3O6XA 1XZPA 2P7VA 3S9OA 5HV9A 3AG2C 1GGQA 2M64A 3ATPA 1QZXA 3SYNA 3RYLA 4C3BA 2C04A 2R7UA 1E85A 3JYYA 2AU5A 2JX0A 1Z6AA 3JCUQ 1OW6A 2EPOA 5B1BC 3DXJF 4JE9A 3T6JA 3U8VA 4D4XA 2XLMA 4YJWA 1RMVA 3HLZA 3RKOF 3U8PA 1NU9C 3DM5A 1OQCA 4C3EA 1RKCA 2XRHA 3QTHA 2AWYA 2AWCA 4G7HF 5KYXB 2Y3DA 3DAGA 2XLDA 3UMHA 2R7VA 2A6EF 4I44A 5CI9A 2EPKX 3Q7GA 2HV7A 1Z7Qc 3TQOA 4U9DA 1HMOA 2VCBA 3HKKA 4JKVA 1JAFA 1V54C 4CS8C 5KYUB 1FMVA 2Y3GA 3K66A 4IAQA 2IXPA 4ZLCA 5BQHA 4L6RA 4CS9A 4J7YA 2Z15A 4DRIB 4JRZA 3US6A 1B68A 1RXQA 3A9CA 4M63A 3RFYA 1PD1A 4UDVA 4PJMA 1ZU4A 2O9XA 1XWJA 2ZPAA 1VOMA 3PMRA 2YEVA 2ZXOA 4JTDB 3RW0A 3TD7A 2W4BA 4PK4A 2NUTA 4JTCB 1BBHA 2C03A 4BJTA 1E86A 4ANJA 5L0CA 3LS0A 2HJ3A 1Y4CA 2NSGA 2CYDA 3EG9B 3FDQA 3ZTMA 1Y6DA 3U3BA 4QDLA 1CPRA 5A6BA 3MFNA 1ZHWA 2W45A 3AGUA 2JD3A 2R25A 4U5FE 5BQGA 3RVZA 2PF4E 1FR0A 4KC9A 4MW8A 4WABA 2XLVA 4YK5A 4N06A 2D5RB 4AL0A 3SXMA 3WG7C 4BJ6A 4A4AA 3M79A 2XLEA 2PBEA 2PX0A 3WAQA 1RJ9A 2KJGA 3ZC4A 4MVOA 3U5SA 4P9TA 3IQTA 4PJJA 1ORJA 1H7IA 2EIKC 2YQYA 1SYQA 1VLTA 3K1IC 1F1MA 3C63A 5JT4A 1TFKB 2GDCA 1V74B 1G8XA 2OOCA 3ECSA 3H2UA 4QI0A 4CIPA 1ZW2A 3AG4C 2RD9A 4HE8D 1GM5A 3JZ0A 4I3MA 4F4BA 1E2XA 2GA0A 1OCZC 2VASA 2IYLD 3AG3C 4FESA 3VM6A 2GWWA 2LFFA 4CBEA 3GORA 4E0HA 1H9TA 1ORYA 4IAOA 2J9BA 3CSKA 4PJLA 1MNEA 3NYLA 5E2QA 4LLCA 5KYUA 3RQEA 4CJOA 2HJMA 3ABLC 3ZDLA 1M2VA 4E0IA 2XL6A 4JCZA 2QY9A 2OU6A 3B0PA 3HJCA 3TJ6A 2VCAA 4JEBA 2A68F 2XSEA 3IQ5A 3RIPA 2P61A 1LE4A 1N1CA 2F22A 3LLKA 3ZG1A 3QW1A 3AOUA 3FOOA 2J0WA 3ITFA 1QLEC 1TWGA 2IM8A 3L8IA 4P6IC 4XEKA 3LJBA 1M57C 1M56C 1SZIA 4WJ0A 5KYYA 1ZYRF 3DE9A 2YLDA 4BJ5C 1T6UA 3FXHA 1WTYA 2VH3A 1BR2A 3DKAA 2NUTB 2DB4A 2LD6A 3MLGA 3T9OA 2R7RA 4XEVA 4DBRA 2Q9CA 3SXKA 5F5HA 2R7SA 2JPUA 4P9FA 3GEIA 1GS9A 3HNKA 3UMKA 4D4NA 1YDIA 1LIHA 4FWVA 1SMYF 1A7VA 1YJGA 1MQVA 2DYRC 2X51A 4K0DA 4U5HA 1LE2A 1HE1A 2OJED 5T3WA 4CJGA 3IQCA 2XL4A 2YLGA 3KPHA 4EBBA 1A7EA 1Z3IX 2D4UA 3LEVA 1EI7A 2EIMC 2YL3A 5JSLA 3DAFA 4O6YA 4PR9A 3RQFA 4OIPF 3B29A 4H54A 4OD5A 4MTOA 2X0CA 5E33A 3JSEO 2LQGA 1TKNA 1D0XA 1RJ9B 2UUHA 5FZTA 2EINC 3X2QC 1DOVA 3U3FA 1LKXA 1AVOB 4BPMA 1OCOC 3N24A 1LM3B 2OEVA 4O7GA 4OIOF 2NSFA 1QVXA 4HEAJ 2J7PA 2VC9A 1A7DA 5L0GA 2YL7A 3EJNA 3LNRA 2E87A 3CQZA 3B71A 4JW1A 5B3IA 4N6CA 2HKVA 1JR8A 3O55A 4BEMJ 4E18A 4DBQA 2AVKA 4MTFA 3QMKA 3GEEA 5E3AA 2IOQA 3GWNA 2QTVA 3DE8A 3C7JA 4MTGA 3RVYA 4G7OF 5COFA 4EWCA 3C18A 5A69A 2P0NA 1A0BA 5FCLA 3S90A 2CNWD 1K40A 1PCXA 1FAPB 4U5BE 4WGZA 4OIRF 2R7XA 2H7BA 1M2VB 2HZ8A 2I8BA 3ZWIA 1OR3A 4ER9A 3FVYA 5L0FA 3WODF 3FHDA 4XPXA 3V5YA 5DQTA 1MMNA 3T6BA 3WHNA 4PJNA 5L3VA 4JEAA 2FAPB 1OKKD 1D1BA 1LPEA 1V4AA 1JPNA 1NBBA 1JOGA 2V26A 3JT1A 4DJ9A 3R2PA 4U5DE 4Q7CA 2B0HA 4H4KC 1MMGA 4J30B 3NMJA 5KYYB 4LDQA 2DI3A 2L9JA 3KKBA 1Z23A 4XEFA 1ZZPA 1Q0KA 4CS8A 3KYJA 4EBJA 2P6VA 3SZRA 3QVYA 3DMDA 5JP7A 2J8WA 3DJNB 4I1OB 1KU2A 2IXNA 2YKZA 4U5CE 1R4TA 2YLIA 2R7WA 4K1OA 1AUEA 4NTBA 1S05A 1BDJB 4EBKA 4G78A 4E7ZA 3B9QA 2EILC 3C8ZA 3LUTB 4MVRA 4NTAA 5DS5A 4R32A 3EGXA 4LDRA 3W8IA 2OCCC 4DOZA 2J9VA 4WGYA 3EGDA 1VMAA 1GQAA 2A0BA 5L3QA 1ZHXA 2PX3A 1G5ZA 2J9UA 3M4CA 4MS2A 5L0HA 3Q6MA 2R7TA 4MVSA 1EKYA 4XLPF 3RQGA 5DS6A 3ZVRA 1JRAA 4JURI 3CZ6A 4HFKB 5TJ5E 1Z5ZA 4C3DA 5JVEA 2J0XA 256BA 3F46A 3LNMB 4NY3A 1D0ZA 2HFIA 1WN0A 2IBFA 2PP4A 3E70C 2BC5A 4U5EE 3S84A 1G4WR 1H9GA 4Q4ZF 3IQ6A 3GM3A 3QW0A 2LCHA 2ZD9A 5AC5A 4YT4A 2MWQA 3L34A 4YL0A 2GFHA 2QLAA 2HMQA 1M2OA 3OEOA 3JRTA 4MNDA 5COMA 3SEOA 2J45A 3FMSA 1EA8A 1NSGB 1QPUA 2FFHA 1BZ4A 2ICWG 3AG1C 3DJUB 2Q3TA 1PD0A 1AEPA 2L6HA 2Y3BA 3K1IA 5JS5A 3JTLO 3QVZA 4BEJA 3FOPA 1HW2A 1IZMA 3MBGA 3SXZA 4DVZA 3S27A 3UR3C 1TFOB 2P1AA 4U9EA 2WVOA 2QE9A 2Q9AA 5KYWA 2L6FA 5EHHA 1VK5A 4LDKA 1LI5A 3O10A 2GAQA 5B1AC 4RBNA 4N4WA 5A6KA 4Z9HA 1VTMP 2H7OA 4ONSA 3ASNC 4DRJB 1M6TA 3NKDA 3W2VA 1Q0MA 2G3VA 3N2ZB 3JYHA 3HNLA 3NRHA 2WB7A 3W2WA 4XLNF 1OW7A 3N0TA 2L7AA 1NFOA 4AL1A 3G50A 4G7ZF 5T1DB 4RDAA 1ZHTA 1CGME 3R7CA 4JZAA 3TOMA 2W4MA 3UNGC 2KK1A 2KQ9A 4B6IA 3S28A 2H7VC 5AGFA 2RSEB 3SXYA 1W2WA 4PFPA 3CEXA 2QUPA 4XWJA 5JUAA 2WZFA 1Q0DA 2R02A 3VYWA 4IWBA 1YAUO 2WZLA 1WWPA 2VB6A 2WVNA 4YN0B 3DZAA 2L81A 1OXBA 3EGDB 4CX9A 4BJ5A 1YARO 4OIQF 2YVKA 3ZTZA 3AQCA 1E83A 2XM0A 4LERA 3VF0A 3G4ZA 1E84A 2UUIA 1G4US 3T4RA 3FAPB 5L0JA 2R7QA 2YRFA 3GWLA 1R5ID 2M4EA 1OR2A 3I5QA 4BG0A 2G62A 3UGPA 2Y3HA 2NG1A 1NZEA 3GEHA 4QI2A 3UMIA 1D0YA 4O6MA 2V3CC 2ZXPA 1OCRC 4EUKB 1OCCC 4Q5SF 1L3PA 5DQZA 4OINF
chains in the Genus database with same CATH topology
1D1AA 3S0XA 3K1HA 2CGEA 1VYIA 3NDBB 2A69F 3S29A 1O87A 2A1DD 3B0UX 1V55C 4AE4A 4CIHA 1MNDA 4A2NB 5KYNA 5KYWB 2CW0F 1TWCA 2DYSC 5BUOA 5KYUB 4XTKA 4ZLDA 3M1CB 3EH1A 2HV6A 5DLJA 5IY5C 3PHF2 3ABMC 3QZCA 3FAJA 5D92A 2EIJC 4DVYP 3ZSUA 5CI8A 3NYJA 4IRUA 1IW7F 5F5FA 5D91A 2Q9BA 4JJGA 3AQBA 3I4UA 1TR2A 1J8YF 4G0HA 1LVKA 1ST6A 3Q6NA 2XXAA 4YT5A 3H65A 1SF8A 5EGYA 2A6HF 4PFOA 2KW3C 4X0RA 4KBLA 4U5GA 1NU7D 1FMWA 2NUPA 4MQ9F 4BJ1A 3B0VC 3VAYA 1FFHA 4CS9C 3LAYA 5DS4A 2DGJA 3K7DA 3Q7LA 2CDQA 5E3CA 1ZHZA 5HSWA 2W9YA 1FTSA 2YHSA 1BR4A 3KH2A 4KNVA 2J46A 3KL4A 3LLIA 2BE5F 3EFOA 4JVSA 3EPVA 3HTKC 3EZIA 4AX2A 3ZIBA 4BJ6C 4C7OA 3E9VA 3RH3A 4AE4B 2CNWA 5DVWA 2J9WA 2Y39A 2ZXRA 2KGOA 2IXMA 4YWQA 1FFTC 3EZHA 2LSEA 2PFDA 4ULWA 3IEEA 4IJJA 4RD9A 1Z63A 2WVQA 1OKKA 4CS7A 4KI2A 1MMDA 3GODA 3OWTA 3I5PA 1D1CA 2J7PD 4LLEA 1ZU5A 2XXAB 3EHNA 4E7SA 4AK9A 1BR1A 3L0IA 3JSZA 4GEHA 3POVA 3NKEA 2G3KA 4YT2A 2NUPB 3LS1A 1J8MF 3NYMA 3SP1A 3DD7A 5KYXA 3LESA 5B3SC 3EGXB 1LS1A 3K6BA 1O5HA 3SNHA 3UGOA 1ZHYA 3ASOC 3X1OA 4JJFA 3GANA 4O6NA 2WZGA 4LACB 2OG2A 2KNHA 3MX3A 3NG1A 3EH2A 3KMIA 3V7OA 4CSAC 2B0JA 3O39A 1S7ZA 3EFOB 4O79A 1WGWA 4J32B 4JCHA 4I1MA 4W8KA 5T3TA 1TWHA 4GYTA 4C7OB 3EQLF 4CSAA 2IXOA 3EHMA 1TWAA 1MMAA 3OA1A 2ZXWC 4K7BA 3W8HA 1VYKA 3EG9A 2FGYA 1NG1A 3F47A 2WL8A 4FX5A 3K33A 4HFFB 4KNWA 4OD4A 2R7OA 3DM9B 2Y69C 2MYSA 4YT8A 2YZSA 3ABKC 1JPJA 3O6XA 2P7VA 3AG2C 3SYNA 1QZXA 2R7UA 3RYLA 4C3BA 2C04A 1Z6AA 3JCUQ 5B1BC 3DXJF 3T6JA 4YJWA 3HLZA 3RKOF 1NU9C 3DM5A 4C3EA 2XRHA 4G7HF 5KYXB 2Y3DA 3DAGA 3UMHA 2R7VA 2A6EF 4I44A 5CI9A 3Q7GA 2HV7A 4CS8C 1V54C 1FMVA 2Y3GA 3K66A 2IXPA 4ZLCA 4CS9A 2Z15A 4M63A 3RFYA 1PD1A 4PJMA 1ZU4A 2O9XA 2ZPAA 1VOMA 3PMRA 2YEVA 2ZXOA 3TD7A 2W4BA 4PK4A 2NUTA 2C03A 4BJTA 4ANJA 3LS0A 3FDQA 3EG9B 4QDLA 1ZHWA 2W45A 4U5FE 2JD3A 2PF4E 4KC9A 4N06A 2D5RB 4BJ6A 2PX0A 1RJ9A 2KJGA 3ZC4A 4PJJA 2EIKC 3K1IC 1G8XA 3ECSA 4QI0A 3AG4C 4HE8D 4F4BA 4I3MA 1OCZC 2VASA 2IYLD 3AG3C 4FESA 4CBEA 4IAOA 3CSKA 4PJLA 1MNEA 3NYLA 5KYUA 4LLCA 3ABLC 1M2VA 2QY9A 3B0PA 3HJCA 2A68F 2XSEA 3RIPA 1N1CA 5DS5A 3LLKA 3ZG1A 3ITFA 4P6IC 2J0WA 3W2VA 1TWGA 1QLEC 3LJBA 1M57C 1M56C 1SZIA 4WJ0A 5KYYA 1ZYRF 4BJ5C 2VH3A 1BR2A 2NUTB 3MLGA 2R7RA 4DBRA 2Q9CA 5F5HA 2R7SA 3UMKA 4FWVA 4K0DA 1SMYF 2DYRC 5E2QA 2X51A 4U5HA 5T3WA 3WG7C 2XL4A 4EBBA 1Z3IX 3LEVA 2EIMC 3DAFA 4O6YA 4OIPF 4OD5A 5E33A 1TKNA 1D0XA 1RJ9B 3X2QC 2EINC 1LKXA 1OCOC 3N24A 4O7GA 4OIOF 4HEAJ 2J7PA 3EJNA 3LNRA 2E87A 3CQZA 4JW1A 4DBQA 5E3AA 3QMKA 2IOQA 2QTVA 4G7OF 4EWCA 5FCLA 2CNWD 1PCXA 4U5BE 4OIRF 2R7XA 2H7BA 1M2VB 2I8BA 3FVYA 3WODF 3FHDA 5DQTA 1MMNA 3T6BA 5L3VA 4PJNA 1OKKD 1D1BA 1JPNA 2V26A 3JT1A 4U5DE 4Q7CA 4H4KC 1MMGA 4J30B 5KYYB 2L9JA 3KKBA 1Z23A 4CS8A 2P6VA 3SZRA 3DMDA 3DJNB 4I1OB 1KU2A 2IXNA 4U5CE 2R7WA 4E7ZA 3B9QA 2EILC 3EGXA 3W8IA 4DOZA 2OCCC 2J9VA 3EGDA 1VMAA 5L3QA 1ZHXA 2PX3A 2J9UA 3Q6MA 2R7TA 4XLPF 5DS6A 3ZVRA 4JURI 3CZ6A 4HFKB 1Z5ZA 4C3DA 2J0XA 3F46A 4U5EE 4NY3A 1D0ZA 3E70C 2PP4A 4Q4ZF 4YT4A 2MWQA 3L34A 2GFHA 3OEOA 1M2OA 3JRTA 4MNDA 3SEOA 2J45A 2FFHA 3DJUB 3AG1C 2Q3TA 1PD0A 2Y3BA 4BEJA 1IZMA 4DVZA 3S27A 3UR3C 2WVOA 2Q9AA 5KYWA 5EHHA 1VK5A 5B1AC 4RBNA 2H7OA 3ASNC 3NKDA 2G3VA 3N2ZB 3JYHA 3NRHA 2WB7A 3W2WA 4XLNF 3N0TA 4G7ZF 5T1DB 4RDAA 1ZHTA 4JZAA 2W4MA 3UNGC 2KQ9A 4B6IA 3S28A 2H7VC 1W2WA 4PFPA 4XWJA 2WZFA 3VYWA 4IWBA 2WZLA 2VB6A 2WVNA 4YN0B 3DZAA 2L81A 3EGDB 4BJ5A 4OIQF 3AQCA 4LERA 3T4RA 2R7QA 2M4EA 3I5QA 4BG0A 2G62A 3UGPA 2Y3HA 2NG1A 1NZEA 4QI2A 3UMIA 1D0YA 4O6MA 2V3CC 2ZXPA 1OCRC 1OCCC 4Q5SF 5DQZA 4OINF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP F;  2A69 F;  3EQL F;  3DXJ F;  3LES A;  1SMY F;  4G7O F;  4OIQ F;  3UGO A;  4Q4Z F;  3LEV A;  2BE5 F;  1KU2 A;  2A68 F;  2A6H F;  4KI2 A;  2CW0 F;  4OIP F;  4XLN F;  4G7H F;  4OIR F;  4MQ9 F;  3UGP A;  2A6E F;  4G7Z F;  3WOD F;  1ZYR F;  4OIO F;  4Q5S F;  1IW7 F;  4OIN F; 
#chains in the Genus database with same CATH topology
 1D1A A;  3S0X A;  1VB5 A;  3M4B A;  1K05 A;  3K1H A;  2CGE A;  1VYI A;  1YYX A;  3JRM O;  3NDB B;  2A69 F;  2YWA A;  1NFN A;  3S29 A;  4MVM A;  1O87 A;  2A1D D;  4Z9I A;  3B0U X;  1V55 C;  4AE4 A;  1T6I A;  1MND A;  4A2N B;  5CIV A;  2CCY A;  4CIH A;  5KYN A;  5KYW B;  2CW0 F;  1TWC A;  2DYS C;  1C02 A;  2ETS A;  3NMI A;  3LEO A;  1ZVZ A;  3DI5 A;  4NQF A;  4XTK A;  5AC4 A;  3M1C B;  3EH1 A;  2HV6 A;  4CDY A;  5DLJ A;  5L0D A;  4ZLD A;  2NPU A;  3C8G D;  5IY5 C;  1EQ1 A;  3PHF 2;  2LIG A;  3ABM C;  3AJM A;  3QZC A;  3FAJ A;  5D92 A;  1CPQ A;  2EIJ C;  1T6Q A;  5BUO A;  1T5O A;  3G4X A;  4MVQ A;  4DVY P;  3ZSU A;  2EPL X;  5CI8 A;  3NYJ A;  4IRU A;  1IW7 F;  1C03 A;  5D91 A;  5F5F A;  1LI7 A;  2Q9B A;  2HSB A;  4EHP A;  1WAS A;  4JJG A;  3AQB A;  4XPY A;  1K04 A;  2KSF A;  4JTA B;  3I4U A;  2TMV P;  1TR2 A;  1J8Y F;  1CGN A;  4G0H A;  3U9J A;  1RKE A;  1LVK A;  2XL8 A;  5L0I A;  1DOW A;  1ST6 A;  3Q6N A;  2XXA A;  4YT5 A;  1Q0G A;  3H65 A;  2Q00 A;  5COG A;  1SF8 A;  5EGY A;  2A6H F;  4PFO A;  2KW3 C;  4X0R A;  4KBL A;  1YA9 A;  1YA7 O;  4U5G A;  3HNI A;  3U0C A;  1NU7 D;  2R03 A;  1FMW A;  2NUP A;  4MQ9 F;  3RF3 A;  4BJ1 A;  3B0V C;  1I5N A;  1C17 M;  4FAP B;  5GPG B;  1ORS C;  1FFH A;  3VAY A;  4CS9 C;  1APC A;  3H2V A;  1WOL A;  3LAY A;  3DWW A;  2DGJ A;  4EKW A;  5DS4 A;  1YZA A;  4MVZ A;  3K7D A;  3NMK A;  2LP4 A;  3Q7L A;  4JIO A;  2CDQ A;  5E3C A;  1ZHZ A;  5A6J A;  1Q0F A;  3J06 A;  5HSW A;  2W9Y A;  1I4Y A;  1FTS A;  5JLI A;  1UG7 A;  2YHS A;  1BR4 A;  3KH2 A;  2KC3 A;  3L1M A;  1KTM A;  4KNV A;  2J46 A;  3V5X A;  3KL4 A;  5BQI A;  3TJ5 A;  3LLI A;  5EK0 A;  2BE5 F;  3EFO A;  2XLO A;  1OXK A;  1QSP A;  3EPV A;  3HTK C;  4JVS A;  3EZI A;  4N6H A;  1T9K A;  2KYH A;  4AX2 A;  1H6G A;  4NCQ A;  1SR2 A;  3ZIB A;  4BJ6 C;  4C7O A;  4IB4 A;  3E9V A;  3GM2 A;  1XZQ A;  3RH3 A;  4AE4 B;  2CNW A;  5DVW A;  2XS8 A;  1L7C A;  1RCP A;  1QKR A;  1VLS A;  2J9W A;  4XQ1 A;  3PDM P;  2HSQ A;  2Y39 A;  2ZXR A;  4J7T A;  2KGO A;  3C8G A;  2IXM A;  2LFD A;  2OKU A;  4YWQ A;  3L8J A;  1FFT C;  2QNL A;  1QQ3 A;  2MHR A;  2LSE A;  2PFD A;  3EZH A;  3V5Z A;  4ULW A;  1YVI A;  1YLM A;  2R05 A;  3IEE A;  3W4Y A;  4Z9J A;  2AP3 A;  3GM1 A;  4IJJ A;  4RD9 A;  2H8A A;  2WVQ A;  1OKK A;  2EPN A;  3CAX A;  4CS7 A;  1Z63 A;  1CGO A;  1YYJ A;  1JMW A;  3ZQV A;  3TOL A;  4YL3 A;  2VCC A;  4KI2 A;  5A6A A;  1MMD A;  3GOD A;  2Q7R A;  5K0I A;  3T6G B;  1HY5 A;  3OWT A;  3I5P A;  2HS5 A;  1D1C A;  2HMZ A;  1RKE B;  1UFB A;  2EPM X;  2J7P D;  4LLE A;  1NLX A;  1ZU5 A;  4IGG A;  2XXA B;  1I4Z A;  3EHN A;  4E7S A;  4AK9 A;  1BR1 A;  3L0I A;  3JSZ A;  4GEH A;  3POV A;  2LK4 A;  2YL0 A;  3BEH A;  3NKE A;  2OQM A;  2G3K A;  1PV3 A;  4E17 A;  2YL1 A;  3AGT A;  2OEX A;  4MW3 A;  4YT2 A;  1ZW3 A;  2NUP B;  4XPW A;  3LS1 A;  5JRA A;  1J8M F;  3A11 A;  1WAT A;  2XS1 A;  3NYM A;  3SP1 A;  3DD7 A;  5KYX A;  3LES A;  5B3S C;  3EGX B;  1LS1 A;  3K6B A;  1U0B B;  1O5H A;  4DRH B;  2BL2 A;  2A0U A;  3SNH A;  4NTF A;  1ZHY A;  3ASO C;  3X1O A;  3UGO A;  4JJF A;  3GAN A;  4O6N A;  3VRC A;  2WZG A;  4LAC B;  2OG2 A;  4NC3 A;  2KNH A;  3KYI A;  3MYF A;  3HNJ A;  4EIY A;  1U89 A;  3IHU A;  3MX3 A;  3NG1 A;  3EH2 A;  3KMI A;  1YZC A;  2XLW A;  4JC7 A;  3V7O A;  3MYI A;  1FNT c;  2B0J A;  4CSA C;  3O39 A;  4DXW A;  1HW1 A;  1S7Z A;  3EFO B;  4O79 A;  2XM4 A;  2OJQ A;  2R9R B;  3U9M A;  4CDV A;  1WGW A;  4J32 B;  4JCH A;  1A41 A;  4I1M A;  1U6H A;  1TQG A;  2Q4F A;  4W8K A;  5T3T A;  1TWH A;  4GYT A;  4C7O B;  3U2M A;  3EQL F;  4CSA A;  2IXO A;  3EHM A;  1TWA A;  3ZQY A;  1MMA A;  1T01 A;  2ZXW C;  3M15 A;  3OA1 A;  4K7B A;  3W8H A;  1HMD A;  1VYK A;  3IPM O;  3BRJ A;  3EG9 A;  2FGY A;  1NG1 A;  3F47 A;  2WL8 A;  4FX5 A;  3K33 A;  4HFF B;  4KNW A;  3C8G B;  4OD4 A;  3TUL A;  2R7O A;  3DM9 B;  2ASR A;  2Y69 C;  4YL1 A;  2MYS A;  5A6B D;  2I15 A;  4ULV A;  1O3U A;  3TK0 A;  1OW8 A;  3U2L A;  4YT8 A;  4IAR A;  2L6G A;  2HUJ A;  2YZS A;  4CDA A;  4MVU A;  5F28 E;  1HE9 A;  1KNY A;  4PAC A;  1LS4 A;  2XLH A;  3ABK C;  1JPJ A;  2PNO A;  3C62 A;  4W8P A;  3PCV A;  4GQH A;  3O6X A;  1XZP A;  2P7V A;  3S9O A;  5HV9 A;  3AG2 C;  1GGQ A;  2M64 A;  3ATP A;  1QZX A;  3SYN A;  3RYL A;  4C3B A;  2C04 A;  2R7U A;  1E85 A;  3JYY A;  2AU5 A;  2JX0 A;  1Z6A A;  3JCU Q;  1OW6 A;  2EPO A;  5B1B C;  3DXJ F;  4JE9 A;  3T6J A;  3U8V A;  4D4X A;  2XLM A;  4YJW A;  1RMV A;  3HLZ A;  3RKO F;  3U8P A;  1NU9 C;  3DM5 A;  1OQC A;  4C3E A;  1RKC A;  2XRH A;  3QTH A;  2AWY A;  2AWC A;  4G7H F;  5KYX B;  2Y3D A;  3DAG A;  2XLD A;  3UMH A;  2R7V A;  2A6E F;  4I44 A;  5CI9 A;  2EPK X;  3Q7G A;  2HV7 A;  1Z7Q c;  3TQO A;  4U9D A;  1HMO A;  2VCB A;  3HKK A;  4JKV A;  1JAF A;  1V54 C;  4CS8 C;  5KYU B;  1FMV A;  2Y3G A;  3K66 A;  4IAQ A;  2IXP A;  4ZLC A;  5BQH A;  4L6R A;  4CS9 A;  4J7Y A;  2Z15 A;  4DRI B;  4JRZ A;  3US6 A;  1B68 A;  1RXQ A;  3A9C A;  4M63 A;  3RFY A;  1PD1 A;  4UDV A;  4PJM A;  1ZU4 A;  2O9X A;  1XWJ A;  2ZPA A;  1VOM A;  3PMR A;  2YEV A;  2ZXO A;  4JTD B;  3RW0 A;  3TD7 A;  2W4B A;  4PK4 A;  2NUT A;  4JTC B;  1BBH A;  2C03 A;  4BJT A;  1E86 A;  4ANJ A;  5L0C A;  3LS0 A;  2HJ3 A;  1Y4C A;  2NSG A;  2CYD A;  3EG9 B;  3FDQ A;  3ZTM A;  1Y6D A;  3U3B A;  4QDL A;  1CPR A;  5A6B A;  3MFN A;  1ZHW A;  2W45 A;  3AGU A;  2JD3 A;  2R25 A;  4U5F E;  5BQG A;  3RVZ A;  2PF4 E;  1FR0 A;  4KC9 A;  4MW8 A;  4WAB A;  2XLV A;  4YK5 A;  4N06 A;  2D5R B;  4AL0 A;  3SXM A;  3WG7 C;  4BJ6 A;  4A4A A;  3M79 A;  2XLE A;  2PBE A;  2PX0 A;  3WAQ A;  1RJ9 A;  2KJG A;  3ZC4 A;  4MVO A;  3U5S A;  4P9T A;  3IQT A;  4PJJ A;  1ORJ A;  1H7I A;  2EIK C;  2YQY A;  1SYQ A;  1VLT A;  3K1I C;  1F1M A;  3C63 A;  5JT4 A;  1TFK B;  2GDC A;  1V74 B;  1G8X A;  2OOC A;  3ECS A;  3H2U A;  4QI0 A;  4CIP A;  1ZW2 A;  3AG4 C;  2RD9 A;  4HE8 D;  1GM5 A;  3JZ0 A;  4I3M A;  4F4B A;  1E2X A;  2GA0 A;  1OCZ C;  2VAS A;  2IYL D;  3AG3 C;  4FES A;  3VM6 A;  2GWW A;  2LFF A;  4CBE A;  3GOR A;  4E0H A;  1H9T A;  1ORY A;  4IAO A;  2J9B A;  3CSK A;  4PJL A;  1MNE A;  3NYL A;  5E2Q A;  4LLC A;  5KYU A;  3RQE A;  4CJO A;  2HJM A;  3ABL C;  3ZDL A;  1M2V A;  4E0I A;  2XL6 A;  4JCZ A;  2QY9 A;  2OU6 A;  3B0P A;  3HJC A;  3TJ6 A;  2VCA A;  4JEB A;  2A68 F;  2XSE A;  3IQ5 A;  3RIP A;  2P61 A;  1LE4 A;  1N1C A;  2F22 A;  3LLK A;  3ZG1 A;  3QW1 A;  3AOU A;  3FOO A;  2J0W A;  3ITF A;  1QLE C;  1TWG A;  2IM8 A;  3L8I A;  4P6I C;  4XEK A;  3LJB A;  1M57 C;  1M56 C;  1SZI A;  4WJ0 A;  5KYY A;  1ZYR F;  3DE9 A;  2YLD A;  4BJ5 C;  1T6U A;  3FXH A;  1WTY A;  2VH3 A;  1BR2 A;  3DKA A;  2NUT B;  2DB4 A;  2LD6 A;  3MLG A;  3T9O A;  2R7R A;  4XEV A;  4DBR A;  2Q9C A;  3SXK A;  5F5H A;  2R7S A;  2JPU A;  4P9F A;  3GEI A;  1GS9 A;  3HNK A;  3UMK A;  4D4N A;  1YDI A;  1LIH A;  4FWV A;  1SMY F;  1A7V A;  1YJG A;  1MQV A;  2DYR C;  2X51 A;  4K0D A;  4U5H A;  1LE2 A;  1HE1 A;  2OJE D;  5T3W A;  4CJG A;  3IQC A;  2XL4 A;  2YLG A;  3KPH A;  4EBB A;  1A7E A;  1Z3I X;  2D4U A;  3LEV A;  1EI7 A;  2EIM C;  2YL3 A;  5JSL A;  3DAF A;  4O6Y A;  4PR9 A;  3RQF A;  4OIP F;  3B29 A;  4H54 A;  4OD5 A;  4MTO A;  2X0C A;  5E33 A;  3JSE O;  2LQG A;  1TKN A;  1D0X A;  1RJ9 B;  2UUH A;  5FZT A;  2EIN C;  3X2Q C;  1DOV A;  3U3F A;  1LKX A;  1AVO B;  4BPM A;  1OCO C;  3N24 A;  1LM3 B;  2OEV A;  4O7G A;  4OIO F;  2NSF A;  1QVX A;  4HEA J;  2J7P A;  2VC9 A;  1A7D A;  5L0G A;  2YL7 A;  3EJN A;  3LNR A;  2E87 A;  3CQZ A;  3B71 A;  4JW1 A;  5B3I A;  4N6C A;  2HKV A;  1JR8 A;  3O55 A;  4BEM J;  4E18 A;  4DBQ A;  2AVK A;  4MTF A;  3QMK A;  3GEE A;  5E3A A;  2IOQ A;  3GWN A;  2QTV A;  3DE8 A;  3C7J A;  4MTG A;  3RVY A;  4G7O F;  5COF A;  4EWC A;  3C18 A;  5A69 A;  2P0N A;  1A0B A;  5FCL A;  3S90 A;  2CNW D;  1K40 A;  1PCX A;  1FAP B;  4U5B E;  4WGZ A;  4OIR F;  2R7X A;  2H7B A;  1M2V B;  2HZ8 A;  2I8B A;  3ZWI A;  1OR3 A;  4ER9 A;  3FVY A;  5L0F A;  3WOD F;  3FHD A;  4XPX A;  3V5Y A;  5DQT A;  1MMN A;  3T6B A;  3WHN A;  4PJN A;  5L3V A;  4JEA A;  2FAP B;  1OKK D;  1D1B A;  1LPE A;  1V4A A;  1JPN A;  1NBB A;  1JOG A;  2V26 A;  3JT1 A;  4DJ9 A;  3R2P A;  4U5D E;  4Q7C A;  2B0H A;  4H4K C;  1MMG A;  4J30 B;  3NMJ A;  5KYY B;  4LDQ A;  2DI3 A;  2L9J A;  3KKB A;  1Z23 A;  4XEF A;  1ZZP A;  1Q0K A;  4CS8 A;  3KYJ A;  4EBJ A;  2P6V A;  3SZR A;  3QVY A;  3DMD A;  5JP7 A;  2J8W A;  3DJN B;  4I1O B;  1KU2 A;  2IXN A;  2YKZ A;  4U5C E;  1R4T A;  2YLI A;  2R7W A;  4K1O A;  1AUE A;  4NTB A;  1S05 A;  1BDJ B;  4EBK A;  4G78 A;  4E7Z A;  3B9Q A;  2EIL C;  3C8Z A;  3LUT B;  4MVR A;  4NTA A;  5DS5 A;  4R32 A;  3EGX A;  4LDR A;  3W8I A;  2OCC C;  4DOZ A;  2J9V A;  4WGY A;  3EGD A;  1VMA A;  1GQA A;  2A0B A;  5L3Q A;  1ZHX A;  2PX3 A;  1G5Z A;  2J9U A;  3M4C A;  4MS2 A;  5L0H A;  3Q6M A;  2R7T A;  4MVS A;  1EKY A;  4XLP F;  3RQG A;  5DS6 A;  3ZVR A;  1JRA A;  4JUR I;  3CZ6 A;  4HFK B;  5TJ5 E;  1Z5Z A;  4C3D A;  5JVE A;  2J0X A;  256B A;  3F46 A;  3LNM B;  4NY3 A;  1D0Z A;  2HFI A;  1WN0 A;  2IBF A;  2PP4 A;  3E70 C;  2BC5 A;  4U5E E;  3S84 A;  1G4W R;  1H9G A;  4Q4Z F;  3IQ6 A;  3GM3 A;  3QW0 A;  2LCH A;  2ZD9 A;  5AC5 A;  4YT4 A;  2MWQ A;  3L34 A;  4YL0 A;  2GFH A;  2QLA A;  2HMQ A;  1M2O A;  3OEO A;  3JRT A;  4MND A;  5COM A;  3SEO A;  2J45 A;  3FMS A;  1EA8 A;  1NSG B;  1QPU A;  2FFH A;  1BZ4 A;  2ICW G;  3AG1 C;  3DJU B;  2Q3T A;  1PD0 A;  1AEP A;  2L6H A;  2Y3B A;  3K1I A;  5JS5 A;  3JTL O;  3QVZ A;  4BEJ A;  3FOP A;  1HW2 A;  1IZM A;  3MBG A;  3SXZ A;  4DVZ A;  3S27 A;  3UR3 C;  1TFO B;  2P1A A;  4U9E A;  2WVO A;  2QE9 A;  2Q9A A;  5KYW A;  2L6F A;  5EHH A;  1VK5 A;  4LDK A;  1LI5 A;  3O10 A;  2GAQ A;  5B1A C;  4RBN A;  4N4W A;  5A6K A;  4Z9H A;  1VTM P;  2H7O A;  4ONS A;  3ASN C;  4DRJ B;  1M6T A;  3NKD A;  3W2V A;  1Q0M A;  2G3V A;  3N2Z B;  3JYH A;  3HNL A;  3NRH A;  2WB7 A;  3W2W A;  4XLN F;  1OW7 A;  3N0T A;  2L7A A;  1NFO A;  4AL1 A;  3G50 A;  4G7Z F;  5T1D B;  4RDA A;  1ZHT A;  1CGM E;  3R7C A;  4JZA A;  3TOM A;  2W4M A;  3UNG C;  2KK1 A;  2KQ9 A;  4B6I A;  3S28 A;  2H7V C;  5AGF A;  2RSE B;  3SXY A;  1W2W A;  4PFP A;  3CEX A;  2QUP A;  4XWJ A;  5JUA A;  2WZF A;  1Q0D A;  2R02 A;  3VYW A;  4IWB A;  1YAU O;  2WZL A;  1WWP A;  2VB6 A;  2WVN A;  4YN0 B;  3DZA A;  2L81 A;  1OXB A;  3EGD B;  4CX9 A;  4BJ5 A;  1YAR O;  4OIQ F;  2YVK A;  3ZTZ A;  3AQC A;  1E83 A;  2XM0 A;  4LER A;  3VF0 A;  3G4Z A;  1E84 A;  2UUI A;  1G4U S;  3T4R A;  3FAP B;  5L0J A;  2R7Q A;  2YRF A;  3GWL A;  1R5I D;  2M4E A;  1OR2 A;  3I5Q A;  4BG0 A;  2G62 A;  3UGP A;  2Y3H A;  2NG1 A;  1NZE A;  3GEH A;  4QI2 A;  3UMI A;  1D0Y A;  4O6M A;  2V3C C;  2ZXP A;  1OCR C;  4EUK B;  1OCC C;  4Q5S F;  1L3P A;  5DQZ A;  4OIN F; 
#chains in the Genus database with same CATH homology
 1D1A A;  3S0X A;  3K1H A;  2CGE A;  1VYI A;  3NDB B;  2A69 F;  3S29 A;  1O87 A;  2A1D D;  3B0U X;  1V55 C;  4AE4 A;  4CIH A;  1MND A;  4A2N B;  5KYN A;  5KYW B;  2CW0 F;  1TWC A;  2DYS C;  5BUO A;  5KYU B;  4XTK A;  4ZLD A;  3M1C B;  3EH1 A;  2HV6 A;  5DLJ A;  5IY5 C;  3PHF 2;  3ABM C;  3QZC A;  3FAJ A;  5D92 A;  2EIJ C;  4DVY P;  3ZSU A;  5CI8 A;  3NYJ A;  4IRU A;  1IW7 F;  5F5F A;  5D91 A;  2Q9B A;  4JJG A;  3AQB A;  3I4U A;  1TR2 A;  1J8Y F;  4G0H A;  1LVK A;  1ST6 A;  3Q6N A;  2XXA A;  4YT5 A;  3H65 A;  1SF8 A;  5EGY A;  2A6H F;  4PFO A;  2KW3 C;  4X0R A;  4KBL A;  4U5G A;  1NU7 D;  1FMW A;  2NUP A;  4MQ9 F;  4BJ1 A;  3B0V C;  3VAY A;  1FFH A;  4CS9 C;  3LAY A;  5DS4 A;  2DGJ A;  3K7D A;  3Q7L A;  2CDQ A;  5E3C A;  1ZHZ A;  5HSW A;  2W9Y A;  1FTS A;  2YHS A;  1BR4 A;  3KH2 A;  4KNV A;  2J46 A;  3KL4 A;  3LLI A;  2BE5 F;  3EFO A;  4JVS A;  3EPV A;  3HTK C;  3EZI A;  4AX2 A;  3ZIB A;  4BJ6 C;  4C7O A;  3E9V A;  3RH3 A;  4AE4 B;  2CNW A;  5DVW A;  2J9W A;  2Y39 A;  2ZXR A;  2KGO A;  2IXM A;  4YWQ A;  1FFT C;  3EZH A;  2LSE A;  2PFD A;  4ULW A;  3IEE A;  4IJJ A;  4RD9 A;  1Z63 A;  2WVQ A;  1OKK A;  4CS7 A;  4KI2 A;  1MMD A;  3GOD A;  3OWT A;  3I5P A;  1D1C A;  2J7P D;  4LLE A;  1ZU5 A;  2XXA B;  3EHN A;  4E7S A;  4AK9 A;  1BR1 A;  3L0I A;  3JSZ A;  4GEH A;  3POV A;  3NKE A;  2G3K A;  4YT2 A;  2NUP B;  3LS1 A;  1J8M F;  3NYM A;  3SP1 A;  3DD7 A;  5KYX A;  3LES A;  5B3S C;  3EGX B;  1LS1 A;  3K6B A;  1O5H A;  3SNH A;  3UGO A;  1ZHY A;  3ASO C;  3X1O A;  4JJF A;  3GAN A;  4O6N A;  2WZG A;  4LAC B;  2OG2 A;  2KNH A;  3MX3 A;  3NG1 A;  3EH2 A;  3KMI A;  3V7O A;  4CSA C;  2B0J A;  3O39 A;  1S7Z A;  3EFO B;  4O79 A;  1WGW A;  4J32 B;  4JCH A;  4I1M A;  4W8K A;  5T3T A;  1TWH A;  4GYT A;  4C7O B;  3EQL F;  4CSA A;  2IXO A;  3EHM A;  1TWA A;  1MMA A;  3OA1 A;  2ZXW C;  4K7B A;  3W8H A;  1VYK A;  3EG9 A;  2FGY A;  1NG1 A;  3F47 A;  2WL8 A;  4FX5 A;  3K33 A;  4HFF B;  4KNW A;  4OD4 A;  2R7O A;  3DM9 B;  2Y69 C;  2MYS A;  4YT8 A;  2YZS A;  3ABK C;  1JPJ A;  3O6X A;  2P7V A;  3AG2 C;  3SYN A;  1QZX A;  2R7U A;  3RYL A;  4C3B A;  2C04 A;  1Z6A A;  3JCU Q;  5B1B C;  3DXJ F;  3T6J A;  4YJW A;  3HLZ A;  3RKO F;  1NU9 C;  3DM5 A;  4C3E A;  2XRH A;  4G7H F;  5KYX B;  2Y3D A;  3DAG A;  3UMH A;  2R7V A;  2A6E F;  4I44 A;  5CI9 A;  3Q7G A;  2HV7 A;  4CS8 C;  1V54 C;  1FMV A;  2Y3G A;  3K66 A;  2IXP A;  4ZLC A;  4CS9 A;  2Z15 A;  4M63 A;  3RFY A;  1PD1 A;  4PJM A;  1ZU4 A;  2O9X A;  2ZPA A;  1VOM A;  3PMR A;  2YEV A;  2ZXO A;  3TD7 A;  2W4B A;  4PK4 A;  2NUT A;  2C03 A;  4BJT A;  4ANJ A;  3LS0 A;  3FDQ A;  3EG9 B;  4QDL A;  1ZHW A;  2W45 A;  4U5F E;  2JD3 A;  2PF4 E;  4KC9 A;  4N06 A;  2D5R B;  4BJ6 A;  2PX0 A;  1RJ9 A;  2KJG A;  3ZC4 A;  4PJJ A;  2EIK C;  3K1I C;  1G8X A;  3ECS A;  4QI0 A;  3AG4 C;  4HE8 D;  4F4B A;  4I3M A;  1OCZ C;  2VAS A;  2IYL D;  3AG3 C;  4FES A;  4CBE A;  4IAO A;  3CSK A;  4PJL A;  1MNE A;  3NYL A;  5KYU A;  4LLC A;  3ABL C;  1M2V A;  2QY9 A;  3B0P A;  3HJC A;  2A68 F;  2XSE A;  3RIP A;  1N1C A;  5DS5 A;  3LLK A;  3ZG1 A;  3ITF A;  4P6I C;  2J0W A;  3W2V A;  1TWG A;  1QLE C;  3LJB A;  1M57 C;  1M56 C;  1SZI A;  4WJ0 A;  5KYY A;  1ZYR F;  4BJ5 C;  2VH3 A;  1BR2 A;  2NUT B;  3MLG A;  2R7R A;  4DBR A;  2Q9C A;  5F5H A;  2R7S A;  3UMK A;  4FWV A;  4K0D A;  1SMY F;  2DYR C;  5E2Q A;  2X51 A;  4U5H A;  5T3W A;  3WG7 C;  2XL4 A;  4EBB A;  1Z3I X;  3LEV A;  2EIM C;  3DAF A;  4O6Y A;  4OIP F;  4OD5 A;  5E33 A;  1TKN A;  1D0X A;  1RJ9 B;  3X2Q C;  2EIN C;  1LKX A;  1OCO C;  3N24 A;  4O7G A;  4OIO F;  4HEA J;  2J7P A;  3EJN A;  3LNR A;  2E87 A;  3CQZ A;  4JW1 A;  4DBQ A;  5E3A A;  3QMK A;  2IOQ A;  2QTV A;  4G7O F;  4EWC A;  5FCL A;  2CNW D;  1PCX A;  4U5B E;  4OIR F;  2R7X A;  2H7B A;  1M2V B;  2I8B A;  3FVY A;  3WOD F;  3FHD A;  5DQT A;  1MMN A;  3T6B A;  5L3V A;  4PJN A;  1OKK D;  1D1B A;  1JPN A;  2V26 A;  3JT1 A;  4U5D E;  4Q7C A;  4H4K C;  1MMG A;  4J30 B;  5KYY B;  2L9J A;  3KKB A;  1Z23 A;  4CS8 A;  2P6V A;  3SZR A;  3DMD A;  3DJN B;  4I1O B;  1KU2 A;  2IXN A;  4U5C E;  2R7W A;  4E7Z A;  3B9Q A;  2EIL C;  3EGX A;  3W8I A;  4DOZ A;  2OCC C;  2J9V A;  3EGD A;  1VMA A;  5L3Q A;  1ZHX A;  2PX3 A;  2J9U A;  3Q6M A;  2R7T A;  4XLP F;  5DS6 A;  3ZVR A;  4JUR I;  3CZ6 A;  4HFK B;  1Z5Z A;  4C3D A;  2J0X A;  3F46 A;  4U5E E;  4NY3 A;  1D0Z A;  3E70 C;  2PP4 A;  4Q4Z F;  4YT4 A;  2MWQ A;  3L34 A;  2GFH A;  3OEO A;  1M2O A;  3JRT A;  4MND A;  3SEO A;  2J45 A;  2FFH A;  3DJU B;  3AG1 C;  2Q3T A;  1PD0 A;  2Y3B A;  4BEJ A;  1IZM A;  4DVZ A;  3S27 A;  3UR3 C;  2WVO A;  2Q9A A;  5KYW A;  5EHH A;  1VK5 A;  5B1A C;  4RBN A;  2H7O A;  3ASN C;  3NKD A;  2G3V A;  3N2Z B;  3JYH A;  3NRH A;  2WB7 A;  3W2W A;  4XLN F;  3N0T A;  4G7Z F;  5T1D B;  4RDA A;  1ZHT A;  4JZA A;  2W4M A;  3UNG C;  2KQ9 A;  4B6I A;  3S28 A;  2H7V C;  1W2W A;  4PFP A;  4XWJ A;  2WZF A;  3VYW A;  4IWB A;  2WZL A;  2VB6 A;  2WVN A;  4YN0 B;  3DZA A;  2L81 A;  3EGD B;  4BJ5 A;  4OIQ F;  3AQC A;  4LER A;  3T4R A;  2R7Q A;  2M4E A;  3I5Q A;  4BG0 A;  2G62 A;  3UGP A;  2Y3H A;  2NG1 A;  1NZE A;  4QI2 A;  3UMI A;  1D0Y A;  4O6M A;  2V3C C;  2ZXP A;  1OCR C;  1OCC C;  4Q5S F;  5DQZ A;  4OIN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...