3UICA

Crystal structure of fabi, an enoyl reductase from f. tularensis, in complex with a novel and potent inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
b'GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and enzymatic analyses reveal the binding mode of a novel series of Francisella tularensis enoyl reductase (FabI) inhibitors.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 86
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uicA00
4E5PA 4Z3KA 2Q3EA 1TI7A 4MVJP 4J0EA 3G3EA 2D4AA 4R68A 4L4XA 4FFOA 4LCJA 1S6YA 2Q1TA 3WIDA 4IBOA 5F5NA 4JP3A 1A7KA 5CEEA 2J6IA 1E3LA 2DVMA 3TZHA 2Y1GA 3IMFA 1MGOA 1R37A 1PSDA 1LRKA 4DLBA 4IZHA 2ZK7A 4YT5A 4WLUA 1CETA 1PZEA 5AXCA 4PLWA 3BTUA 4G2NA 4GKBA 3VTFA 3DMTC 1YBMA 4D0RA 5FFFA 3S2IA 2Z1MA 4L4SA 4AJNA 1PGPA 3QHAA 4GGOA 5DBGA 2OFPA 1ZW1A 4RO0A 1KY4A 5JDIA 3RBXA 1U3WA 3JQ6A 3AOEA 4YYZA 4L8VA 5DBIA 5L45A 5LDGA 4GI2A 4YEDA 2C07A 4CMGA 1PS9A 3B20A 1Q1NA 5C5IA 3MOIA 3NDJA 1KBZA 4J7UA 4B4UA 1D1TA 4OQYA 5TS3A 4INAA 2I5PO 1ENYA 2Q46A 2PH5A 3PJGA 2DT5A 1U3TA 1SZJG 1D8AA 2PGLA 3IP3A 2NU6A 3M1AA 3AOEC 2FSSA 1DJNA 2ZB8A 3H65A 5KOIA 3GRPA 1SO8A 3EK2A 5A9SB 1I33A 1LLDA 4ZA2A 1T2CA 1ZK1A 3BHJA 1YWGO 2WEKA 1LUAA 2Z95A 1QYWA 3HHPA 3MJTA 1PWXA 2OZPA 5EMHA 1YB1A 1HLDA 5BNFA 1PX0A 4AFNA 4XGKA 2VNAA 3ZV6A 4NJMA 2GZ2A 3RC1A 3H5RA 4RVUA 3SC6A 2JD2A 2PH3A 1GU7A 3TOXA 2I65A 2NM0A 4AJIA 2DFDA 1PL6A 2IODA 3JQAD 3Q3CA 5KJEA 4G65A 1NPTO 3DOOA 3G1TA 1ENOA 5KKAA 5C37A 1SC6A 2JD0A 4XJTA 2PK3A 1HE2A 5DCYA 5FF9A 3INGA 4GAEA 4E3ZA 1J4AA 1CQIA 3V1YA 3W1VA 2OORA 5ILGA 3TSCA 3VC7A 1E3IA 1O0SA 4MKXA 4C4OA 1VKOA 4OAQA 2A94A 2D5CA 3V2HA 4Z6KA 3O8QA 4DRYA 1VJTA 3OQBA 5TC4A 1FJHA 4BNKA 2VCYA 3ZU2A 1LDNA 4IPTA 5B4TA 3AM4A 3GPIA 2VUTA 5L3ZA 1IHXA 1FMCA 2JHFA 2BFMA 1E3WA 4MKZA 2ZATA 1UZLA 3HFGA 3OF2A 4P38A 3BA1A 2DUWA 4YRDA 3CMMA 3SC4A 3ZV3A 5JSFA 2Q99A 1DDOA 3DBLB 2VHVA 1O89A 1ISGA 2OHXA 3GGPA 3MWDB 4XDZA 4E0BA 3HDJA 5IF3A 1UXHA 2IXBA 3WG9A 5L4SA 2VYND 1X1EA 1B26A 1LSUA 1LA2A 4RDHA 1DJQA 5DBFA 3E03A 3JQ8B 4G81A 4PLTA 1I3LA 2EXXA 4GGPA 1BDMA 4B3JA 4FFRA 5L95A 2RCYA 3OMLA 3JD1A 1PEDA 3Q11A 3QQPA 1R4NA 1X1TA 1XQ1A 2XXJA 1Y9EA 2C5EA 4AJEA 3PHGA 1WNTA 2VOEA 3NDRA 3MZ0A 4MKRA 2WWRA 2VHYA 4ND2A 4WUVA 3ROKA 2BFAA 3WJAA 1WZIA 2EWMA 2WYVA 1KOLA 1NHGA 3DBRB 3ASUA 1RM3A 3K8ZA 4TWRA 2X23A 4S1VA 4D42A 4KWHA 1TVEA 2C54A 5KNLA 1BGVA 3JQDA 4FW8A 4DQUA 4XA8A 1HDXA 4WCDA 4PLZA 1A9YA 4N5NA 4GWGA 4QT0A 2W4QA 4E2ZA 1P1HA 1QYXA 1W0CA 1ZXBA 4XD2A 1XEAA 4IXWA 3RAJA 2VNSA 2X9VA 5KVCA 4G5HA 4XEHA 1X15A 4CM8B 3PYXA 4BNXA 3P5SA 3W6UA 4H3VA 1DIBA 4NU5A 4EYEA 4PLHA 1HDCA 1PIWA 5CPFA 1E6WA 3WMWA 4BKOA 4EGFA 4MVJI 2IZ1A 2WMDA 1C0LA 1YL7A 2VHXA 3TFQA 3ZNOA 4U5QA 2GNAA 3BTOA 1BVUA 1B15A 3ZWPA 3DFUA 1C1XA 3IS3A 3AY6A 4RZIA 1R6DA 1HWYA 1T24A 4BO1A 3LLVA 4II2A 3I9JA 2ZYAA 1HYHA 3JQAB 1VKNA 4PG5A 1GY8A 1KS9A 3NT5A 1OC2A 5TT1A 1DSSG 3TNLA 4CR8A 3H8VA 2VWQA 2C29D 2NTJA 1DC4A 3F9IA 1T2EA 3I5MA 3LT2A 3V2UA 1NVMB 4EUEA 5ENVA 5TIIA 3AWDA 3JQBA 1AGNA 2O2SA 3KM0A 4BNJA 3QWIA 1PTJA 1T26A 3UN1A 4J1QA 2IYPA 3C7AA 1MC5A 3DZHA 3GHHA 2O3JA 3MCVA 2Y05A 3PGXA 5MGBA 3UXYA 2VT2A 4JBIA 3WYEA 1QRRA 3ZWYA 5L53A 3AY7A 1R4MA 1XU7A 3HN7A 1ZO8A 4W6ZA 3V1TC 2J5RA 3SJ7A 4ZN6A 5JC8A 1A27A 4XRRA 3JQBC 3UCFA 1DRUA 4FSHA 3AW9A 3IL2A 4UULA 3B70A 5DNAA 3MJCA 2C2XA 4FC6A 4A10A 1ONPA 3GAZA 3ROPA 4TRRA 5JLAA 4L4RA 4TVBA 4YA6A 1BRMA 1E0DA 2HSDA 3ETGA 3Q0EA 4KTVE 3UH1A 5IXSA 4CLHA 1I8TA 3T7CA 4CM9D 1Y8QB 1PL7A 5CDUA 2DUUA 1QV7A 1P0FA 4LW8A 4K26A 1XGKA 3OP4A 4J4TA 3L0DA 4OKIA 4RCVA 3TF5A 3ONFA 5ADHA 3LT4A 4KQXA 3D4NA 5TSDA 4HXYA 1T4DA 4D45A 2GO1A 4WJZA 4TVOA 1E1LA 4R51A 2XF8A 3KOUA 5IDQA 2YV2A 2QYSA 2E82A 1JLLA 3DDNA 4IY1A 4E4YA 3U09A 3M1LA 2FWMX 5IN4A 2E4AA 4JX8A 5GZ1A 3G0OA 3I4FA 4BO4A 3PI7A 3O38A 1GR0A 3GEDA 3AM5A 1X7GA 2QW8A 3A28A 3ZZNA 3U9LA 4I9HA 5CDTA 2PGDA 3K2BA 3GNQA 5JDCA 1ISMA 2VWPA 3WGOA 4OSOA 4B8WA 1YO6A 3GUCA 1UP6A 3LT0A 3GHYA 3DB2A 5U9CA 4BB5A 1KVTA 4WECA 2EIHA 3OIGA 3AOGA 2X22A 1SEVA 2LDBA 1GV0A 1I2CA 4N18A 1LLCA 3B1JA 5BSHA 1D4FA 2GN9A 3TN7A 4BO6A 4I8XA 4CUKA 1OFGA 3I6IA 3EZYA 4KUHA 1Q7CA 3FBTA 1UH5A 2O3TA 3DBLA 3N58A 1B2LA 1EFLA 3F1KA 1K6IA 3GQVA 4F6LA 2IZ0A 3U49A 1CJCA 3ST7A 1OAAA 1WMAA 2X9NA 2P4QA 1V35A 1M76A 3U0BA 2BH9A 5EINA 1PS8A 4WK6A 1DAPA 3W8EA 6LDHA 5L7TA 4WPGA 1PQUA 2NTNA 1SOWA 1O94A 4IS3A 5T64A 2NLOA 2AHRA 4ZRNA 4FR5A 3RC9A 1VPDA 3BTSA 4JCOA 2Y1EA 2HCTA 1LDBA 5FYDA 2BELA 4K9DA 3KUXA 2HK7A 4YWJA 4CLRB 4WKGA 3KSDO 4BGUA 4E12A 1H6DA 1A4UA 1W4ZA 2PTGA 4IQGA 2GD1O 1R0LA 1V6AA 1I01A 3SLKA 3FWZA 4XQ9A 1DIHA 5TRTA 1U5AA 5DOZA 4BV8A 2GASA 4UREA 5DULA 1T1SA 4NZ9A 3RUEA 1BXGB 3X2FA 4BUCA 2DBZA 3CXRA 4FGWA 1NAIA 3L9XA 5F1KA 3FHLA 3I9OA 4J7XA 2C7VA 5JMPA 2G1UA 4GWKA 4WLFA 3E5MA 1EE9A 2DTDA 2P9CA 4PVDA 2RHRA 2I9PA 1A72A 5CEFA 4UEKA 3JYPA 4CMEA 1BHSA 3DZKA 3QP9A 1H6AA 5T8KA 3DOJA 1M2WA 3PQFA 3WNVA 1Q0HA 3DZFA 4L74A 3M2TA 2W98A 2IDZA 4CR7A 5H82A 3KTDA 4IDBA 2X0NA 1PJLA 1VC2A 2DTEA 3OBBA 3F6YA 4J3FA 4YJGA 4DQVA 4DA9A 1R66A 3DBVO 1P1RA 1KEVA 1P44A 1ZK4A 4M49A 2O4UX 2PD3A 2ZB4A 4J2HA 5G0UA 3HG7A 1JKIA 5FI5A 3RASA 3L6OO 3JD0A 3BHMA 3HDYA 3OICA 2QG4A 1V3VA 2G0TA 2VRCA 3AUSA 4DWVA 4J1NA 3TDKA 5IFLA 1DIRA 3E9NA 2EG9A 3AM3A 4KDEA 3C7CB 1FK8A 5G4KA 1YDWA 1EK6A 3K2EA 5TJ9A 4AG3A 4FQ8A 1P31A 4NPCA 4UVDA 4HFRA 4CM4A 3WLFA 1OBFO 2FRDA 1Y8RA 2BGKA 2CVOA 1SB8A 5A04A 3ZNNA 1XG5A 2YDYA 3GA0A 4E5YA 1E7WA 3CUKA 1JWBB 1GZ4A 1F06A 4QQRA 2IRWA 3EHEA 4GSLA 1JWAB 3IIEA 2C2YA 4BNLA 1EUCA 2PWZA 4YAKA 4HBGA 2X0RA 1DLIA 3AUAA 2FY8A 3COSA 2GN4A 4TSKA 4WCFA 3ASVA 5T6BA 5DOVA 4J0FA 3W8FA 2EKLA 3D0OA 4RLHA 4D7AA 2EP7A 2P9EA 3N7UA 3WXBA 1AUPA 4CPDA 1PJ2A 1Q0LA 3FRJA 5AXDA 2I67A 1F0YA 3KV3O 2EV9A 3RU9A 4A27A 3WNQA 1U4OA 1KIFA 3KYDA 3I83A 3VH2A 3ZWVA 1HTBA 4TQGA 4ESOA 5JS6A 3WQQA 2JD1A 1ZKMA 3GNSA 2YW9A 1E1MA 1VSUA 1N8KA 2Y1OA 4Y8VA 1VI2A 1JDJA 4MIOA 5L51A 4NJMB 4E5NA 3ZHZA 2I3GA 4DC1A 2F1KA 1DFGA 4H7PA 1TLTA 4P22A 3ONDA 1ONOA 4P4GA 4CL3A 5DDIP 3GMDA 3JD2A 2HJSA 2GPTA 2GZ3A 1DIGA 3K31A 3PP8A 6ADHA 1PQWA 3VTZA 1WDMA 3T4XA 2BFPA 4RVDA 2BGLA 3WTBA 2NV6A 1I36A 4MIYA 1QSGA 2O7SA 2AG8A 4Y98A 3HDQA 4HKTA 4PLCA 1ZUD1 2ZTMA 5DP1A 2HK8A 5LCXA 4BNVA 4ND1A 2FSVA 5AXAA 1T25A 3ROQA 3O8QB 3ZDFA 2HUNA 3FTNA 4OJNA 5AXBA 4UUNA 1ZIDA 2QZ9A 2PFGA 2I6TA 4QUKA 2PV7A 1E3WB 2W8ZA 1QG6A 3NEPX 5IN5A 1QR6A 1ZK0A 2D2IA 3JYNA 5KJFA 5U4QA 3ZU4A 4NHEA 2P68A 1H93A 2RH4A 5IG2A 1TEHA 4TKLA 1GUFA 1Z7BA 1WMBA 4Y6PA 4ALNA 3KEOA 3PIDA 1IUKA 1E5QA 4BNHA 2R6JA 4HFJA 3GAFA 2Q2WA 4IGEA 4OM8A 4W9NA 2Y93A 1TB4A 4NQZA 2Z1NA 3S55A 1Y9AA 2O48X 3C24A 4TRJA 4WOJA 4OL9A 4WLEA 1R4NB 2QHXA 2EP5A 4KDFA 5U1PA 2GDZA 2PNFA 3RFXA 4WE3A 5JYDA 4EUFA 4CM1A 4BKPA 5A03A 4OHUA 3VH4A 4YJFA 3R3JA 3OM9A 2RHCA 4JK3A 1W8DA 3RVDA 2V6GA 3P2YA 4J90A 3ZV5A 1NWHA 1WW8A 3OH8A 5TX7A 1Y1PA 1L7DA 3LC1O 1HE3A 4ZQFA 2AE2A 2D8AA 2FPGA 4DREA 3D4PA 1Y5RA 3HADA 3Q1LA 4DYVA 4YAJA 1B8VA 3BMCA 3GVXA 4HX5A 4PCVA 3FNFA 1GUZA 1UXJA 5CDGA 1DHRA 4BVAA 5HRUA 4CV0A 5B37A 2R2GA 2PZKA 4H16A 4XB2A 1FF9A 4TRNA 4Z0TA 1WWKA 3TRIA 2JFHA 2GSDA 4FJ1A 3AU9A 2VZ9A 3VPXA 4XKJA 3O03A 1OMOA 1YL5A 4CM9A 4BNYA 3RKUA 1M6WA 3IDSA 3WTCA 3IJPA 4RVSA 4TRMA 2IEBA 4ZD6A 1O8CA 3LT1A 1ID1A 1RM4A 1P0CA 3PHIA 2EHDA 4O63O 4XB1A 4NJOA 3E1KA 1C1XB 3VZQA 5I7SA 1MXHA 3KXDA 3K9QO 1B3RA 3PHHA 4OH1A 2HU2A 1CRWG 2AA3A 2NU7A 2HAEA 3AK4A 4GMFA 3G49A 3BAZA 1OZAA 1QP8A 5ES3A 3PDUA 3RJ5A 1CWUA 4B7CA 3ZU3A 1YJ8A 4DMMA 4EUHA 2H63A 5ITWA 1J49A 3V1UA 3I3OA 1ZEJA 4FFLA 5DF1A 7MDHA 5A4DA 2V65A 4R1NA 4LK3A 3RUHA 1G0OA 3GMSA 1RKXA 8LDHA 3IKTA 1OOEA 4JNKA 3IC5A 4GX5A 5ITVA 1TT7A 1R4MB 1HDRA 1W6UA 2W90A 4F3YA 5LC1A 2AE1A 4B7XA 1HZJA 1NBOA 3D3EA 1PZGA 2Q1UA 4Z9XA 1H2HA 1F14A 1NPDA 4QX6A 4NFSA 1H6BA 3GEMA 4PFJA 5TLSA 3RKRA 3PLRA 4P4NA 5K0ZA 4EJ0A 5IZ4A 1I3KA 3I9KA 3GUYA 3Q9NA 4CR6A 2IZZA 2CSUA 4IDDA 4OOEA 3A4VA 1LC0A 1ZZEA 5A5FA 4ZU3A 4R5MA 1R0SA 4A5OA 5JDIC 2HRBA 3EC7A 2B5VA 4YVFA 4LRSB 3GVIA 4K6FA 3HB5X 4YQZA 3V5NA 1LSOA 3OETA 4L0QA 1HDYA 4D44A 3L4SO 2ZTLA 4IXTA 1NYTA 3K96A 3L77A 4E5MA 2B69A 1JQBA 2PZMA 3ADOA 5TGDA 1LU9A 1ISFA 3ON5A 2AW5A 2FMUA 2NUAA 2NQ8A 4BQPA 1LNQA 4LN1A 3CSDA 1U4SA 3IJRA 2VRCD 1R0KA 3TL2A 3KYBA 3G79A 4GVLA 3Q2KA 1KEPA 4KUGA 3ORFA 1I2BA 4PLPA 5B12A 1BXKA 4RV9A 4CLDA 3MTGA 4CMIA 1HF3A 1PGJA 3QWBA 2R00A 5G4LA 2Y0DA 4IMPA 1KETA 3OECA 3GVHA 4CQMA 1UXKA 3DTTA 5KTKA 1DC6A 2YUTA 4XWYA 2P5UA 5IZCA 5KKCA 3OIDA 4BO9A 4CLXA 4LGVA 5CEJA 2O50A 5L40A 2O4CA 1PGNA 4MVJF 4R1SA 3SBOA 1UR5A 4O6VA 3WWZA 4DTIA 2PD6A 4PLYA 2J3HA 3ETDA 3S2EA 1N9GA 4E32A 4YAGA 4K1LA 3KB6A 3L6DA 3GDOA 5L7WA 3D5TA 2C0CA 4X54A 4D3DA 3PWSA 1K6JA 1HDOA 1O9BA 3D4OA 3IOYA 4XGIA 1MUUA 2QZZA 3K73O 4UVIA 2VTDA 4M86A 1EVJA 1AXEA 4BO2A 1EQ2A 2GGSA 3DZIA 4U8GA 3DL2A 4RQUA 3HQ4O 4XR9A 3OEWA 3PIIA 2W2KA 5BT9A 4GL4A 4RVFA 3EVNA 4URFA 1ZEMA 5IJZA 1SB9A 2IYOA 3H2SA 3ZU5A 1T4BA 3NX4A 4R5HA 3LC7O 3WOHA 1IZ0A 4EJMA 4XYLA 2DBRA 1LEHA 2EKQA 3DHYA 3VVCA 3NJ4A 3FNGA 5FEUA 5F21A 3QLJA 3DEYX 1ADCA 4E30A 1E6UA 1U2GA 4FFNA 3QVTA 4YBZA 2BKAA 4MP3A 4BGIA 2J3JA 1MA0A 2NVUA 3ZHXA 3UKOA 5TT0A 3PWZA 4TROA 1Q0QA 1B8UA 3PWKA 4J4BA 1I0ZA 1LDMA 1GYRA 4KUEA 3STHA 1BXZA 3ZNPA 4CL8A 2Y68A 2AXQA 3KBOA 1VJ0A 4R9SA 4Z3DA 4LMRA 4WNIA 3C1TA 3F4BA 1CDOA 4OGWA 1X14A 3ZWAA 2OGUA 1C0PA 3FWNA 3KVOA 3HE3A 1MFPA 2XPCA 4R1TA 4UUPA 1GPJA 4Y6SA 1MXFA 5ENDA 4CQLA 1RYDA 1VL8A 5AOVA 4KMSA 3TOZA 3GNTA 1C1DA 1V3TA 2VWHA 2YDXA 4ILKA 2OL4A 4YJGB 3AI1A 4IQ8A 3GF4A 1LDEA 1RJWA 1XKQA 2EERA 3EAGA 4NH4A 1E7SA 4A0SA 1NQTA 1I24A 2IXAA 3GG9A 5AYVA 3U4IA 1PJTA 2HLPA 4R3NA 2HJRA 4YB8A 1NFRA 3OJ0A 2WYWA 4MOWA 5G4KB 2O7QA 2PKQP 4CMBA 4J1TA 4R69A 5A3VA 3W6ZA 3C7DB 4LSMA 1TT5A 3FPCA 4LSWA 3CH6A 1H0KA 4CM4B 1Y8RB 1RPNA 4MVJA 4J6FA 3TQHA 1JW9B 1N7HA 2CDBA 3OFSA 3ZWMA 3QVWA 3BYZA 4ID9A 1N2SA 1YVEI 4NDNE 1MLDA 4BO3A 3ITKA 3RBVA 4O5OA 1P74A 3GN1A 1LTHR 3NTRA 4AICA 1K2WA 4I08A 3F4LA 1J5PA 4FDAA 2JKVA 2ZB7A 3NJ8A 3WBBA 1J6UA 2VTEA 4XIJA 4I9UA 1NTOA 4WCFB 1Q7GA 2ZJ1A 2C7GA 5L7YA 4J16A 2C59A 3WR5A 3A14A 4BHTA 3I1JA 4IIVA 1HLPA 2Q1WA 5BQFA 1U8XX 1XYGA 2Q45A 3LLSA 2DQ4A 1VRWA 4BL5A 3PXXA 5DN9A 1ZJYA 2Y66A 4J49A 3TZCA 1BDBA 1S7CA 1WP4A 1TA4A 5KVVA 1PL8A 4ZQEA 2EJVA 3JQ9A 1GQ2A 3KYDB 1BMDA 4GQAA 1GFSA 2EGGA 3DMYA 4PG8A 4II3A 3D1LA 4ND4A 2EGHA 3EMKA 2ZCVA 4PG4A 1P1KA 2JL1A 5CDYA 4A2CA 1ZK2A 3GN2A 1X7DA 3JYQA 3MOGA 4F45A 5JY1A 3PGJA 3MJSA 3WGYA 5JNLA 2B83A 9LDTA 4J9VA 1ISJA 4ALKA 2XXBA 4YPOA 2O2YA 1MG5A 2GZ1A 1HXHA 3JQ9C 5H81A 2HMWA 4XRGA 1ZBQA 1LX6A 2A35A 1I10A 2QIOA 3LU1A 3CIFA 1M6HA 1V0JA 3GC6A 3RQSA 3JQFA 3DHEA 1I2ZA 3JCZA 1HYEA 2YJZA 3QE3A 2FPIA 4R9RA 3U4CA 4U6SA 3DTYA 2WM3A 3GRKA 4M1QA 2W2LD 5TNXA 2SCUA 4B3HA 1Y7TA 2OBYA 4WGGA 4XYGA 5F1OA 1YOVA 1ZK3A 3WICA 5CG1A 2VRBA 4J2OA 1JAYA 4M87A 1YQDA 1EDZA 3GG2A 1GTMA 4UVHA 3GH3A 3L6EA 4FN4A 3U4HA 1MFZA 1GYPA 3JQFC 1LBEA 3LF1A 1C0KA 2PY6A 5JCJA 3BXXA 1H9BA 2BD0A 3JQGA 2DPGA 4PLFA 1XR3A 5JDCC 1ONNA 3AUUA 1MG0A 1XIVA 2D0IA 1RYEA 4CMJA 4NU6A 2NVWA 1ZSYA 3CPSA 1G1AA 2HKIA 4FOSA 4J1SA 5JAIA 1LLQA 1G0NA 5KVQA 5IDWA 1XHLA 3PHLA 1ADFA 1Z45A 5A3JA 1UXIA 3GDGA 1EFKA 1XSEA 4D41A 3INTA 1EVYA 2YHIB 2WYUA 4FD3A 4YJFB 3TJRA 3H3JA 2IEDA 3BMOB 4R1UA 1YH3A 1DOHA 4DYDA 4ND5A 3TZQA 2QRJA 5DZSA 4NG5A 3VPGA 4RVHA 4DBVO 4CV2A 5ER9A 5EPOA 1XELA 3QRWA 4BNWA 3QV1A 4CODB 4CV1A 3EUWA 3WGQA 2DU8A 3BMCB 4FBGA 3GZNA 3DZGA 1B8PA 4RORA 5T5QA 4GKVA 1GAEO 2F00A 1PJ4A 1GQYA 1YONA 3GEGA 1HE4A 3B6ZA 3SX2A 2E37A 3E5RA 4DIBA 3DWFA 1NNUA 2DFVA 3BHIA 5H83A 4E2YA 2YQ4A 1O5IA 3BTVA 4BNMA 4CQMD 2HRZA 4FC7A 4JBGA 3QSGA 3TFOA 1UXGA 4B4WA 1LQUA 1QKIA 2VZ0A 3GK3A 4FIZA 1IHYA 4ZRMA 3MJ4A 1EQUA 4GSKA 3Q6IA 1V8BA 3B1FA 2VUUA 3AUTA 3EY4A 5JAMA 4BGVA 1WDKA 3KYCA 4OSPA 3D64A 4CM5A 1I3NA 4RF5A 4DVJA 1VSVA 3MTJA 5KWEA 2X86A 1FDWA 3P7MA 1E5LA 5JO0A 3PZBA 1T2DA 3JTMA 4RF3A 4BNNA 1JKFA 4BV9A 4MVJH 3FI9A 4CM7A 1GD1O 2X0IA 5F5LA 5G0WA 4CMEC 4IJKA 4U7WA 1JAXA 4W82A 1B14A 2PLAA 4OOFA 3S1LA 5T8KC 2B37A 3DAPA 5L4LA 3M2PA 4QEDA 3NT4A 1U7HA 4ZJUA 3JYOA 1PZFA 3KEQA 1IYZA 3WB9A 2GUGA 2CUKA 1I32A 1Z82A 1NP3A 1T1RA 3I6QA 1JU9A 1KVRA 2CF6A 2FHSA 2X1HA 4YT8A 2QX7A 3OQ6A 1UDCA 1JN0A 4ZHSA 1DRVA 1NAHA 4KQWA 2Q1SA 4R41A 4YJHA 2EJWA 5EERA 1EK5A 5I7EA 4CMAA 1GQQA 1Y81A 3RUAA 5JC1A 3L4BA 5I8ZA 2X5JO 1BVRA 1D1SA 1LLUA 3SVTA 3SLGA 4XQEA 5JFOA 5EESA 4BB6A 3C3XA 3TWOA 3WGTA 4AJOA 1EZ4A 2YFQA 2DBVO 3GOHA 5KIAA 1PJBA 2I66A 3JD4A 1IZ9A 4UAGA 3PJEA 5F1PA 5A02A 2JFFA 3RC2A 5ICMA 2X6TA 2CMDA 4B4VA 4WCFC 4IUYA 3B1KA 1PU2A 3H9EO 1UP4A 1YBVA 3RU7A 4B7UA 5G0TA 3VKUA 1GEEA 2GN8A 2ZYDA 2NU9A 3AU8A 4P8RA 4YJDA 3LC2O 3ZI0A 5AQ1A 3R0IA 4OXNA 4ZQBA 3ZW9A 1D3AA 3LVFO 1EVIA 4BMNA 2X8LA 1SAYA 3E18A 1P77A 2Q4BA 3VZRA 2AEMA 2DKNA 4YAIA 3ZHYA 1NXQA 2JJYA 4CMIB 4EJ6A 2RIRA 3WGHA 4JBHA 4YACA 1R15A 4MVJD 5JY6A 4CQMB 3VHRA 3E6AA 4JGBA 2ZTUA 2TMDA 5DP2A 3QWFA 1F17A 4B4OA 1ORRA 2O3QA 3RC7A 2C5AA 4XQGA 1A71A 3IUPA 3CINA 4P4LA 1N9GB 1VL6A 4J9UE 4ZGWA 2PD4A 1H94A 4NNJA 3KRTA 5ER6A 2JAHA 3EYWA 1JVSA 2B5WA 3H9UA 2GYYA 4IDCA 1E3EA 1ISIA 1KVQA 4MP8A 5HA5A 3I52A 3LK7A 1NX6A 1E3JA 4RLSA 4CJXA 3QJ5A 1MB4A 3PFWO 4XQCA 1EBFA 1X7HA 4OQZA 3W4IA 2ILTA 2HDHA 2W2KB 3OJOA 3ZGYA 4O1MA 5COQA 3KHUA 4XZ3A 1FDVA 4WLOA 1YL6A 3KZVA 3BMNA 1XQ6A 3VDQA 3HFSA 3ZHBA 2O23A 4PG7A 1O6ZA 5A06A 2YHIA 4IINA 3WLEA 2E48A 4WLVA 3BMOA 2J3IA 1PGOA 2A92A 5KJ6A 3ANLA 1PJQA 3P19A 4NBTA 1KVSA 1EMDA 4W9NC 4QO7A 5JO9A 3U5TA 2Y67A 2JHGA 4EZBA 5K6AA 3V8BA 3UICA 3ZCXA 4FOOA 5TQVA 4QTZA 4D46A 1CERA 1ZH8A 4NBUA 2NVUB 4E31A 3RROA 4WOKA 1HDGO 3IKVA 1KYQA 3PHJA 4FCCA 4HADA 4HNGA 5KJ1A 2C82A 4YDRA 2AQKA 2FZWA 1I5RA 1P33A 3A9WA 1B16A 4B3IA 3TL3A 4YR9A 2WE8A 2UYYA 4Y67A 5FWNA 2YZ7A 4I5FA 2B0JA 2A9FA 1QXSA 3G17A 3VPFA 2BI7A 3UAGA 2B36A 4A03A 4NIMA 4PLGA 1PQPA 1CEQA 1N92A 2GN6A 1ENPA 3E8XA 3FBGA 4GLLA 4CQLB 1CQJA 1WAMA 4EDFA 4XYEA 4NK5A 1AXGA 1C1DB 3PJDA 4Y9DA 5JCJD 4A7PA 3H5AA 1PR9A 3MJVA 3JQ7A 4CM3A 1N1EA 5HWSA 1RM5A 4GLOA 1ISHA 3PVZA 4HP8A 3W4KA 4L76A 4YQYA 1HL3A 1LC3A 2P91A 2AMFA 3H9GA 1BW9A 5G0VA 2UDPA 3OA2A 2V6BA 1E7MA 1EE2A 3FR8A 2WTBA 1QMGA 1EUZA 3ZH2A 1H6CA 1KC1A 2C20A 4Z0PA 4F6CA 2YQ5A 3PQDA 2H1SA 4JJGA 1PR3A 1U1IA 2O3RA 1TT5B 1E6EA 5C7IO 3QA9A 3ICCA 3CMCO 2X0JA 1LJ8A 4IMRA 1YS4A 3DBHA 4R01A 2W2LA 3DMTA 4CLOB 3VH3A 1NVTA 1QLJA 1IPEA 4J7CA 3I23A 1K5HA 2E49A 3HN2A 1ULSA 1DLJA 2NACA 4MDHA 1BWSA 1OC4A 4DXHA 2J5KA 3WYBA 1CIVA 4F46A 5JAQA 4YT4A 2DC1A 1LI4A 3TZ6A 1VM6A 2HMSA 2ZCUA 1Z74A 3GVCA 2DBQA 2NSDA 2CVZA 4AJ2A 3GPDG 3WGIA 4KTTE 3FSRA 4ZQGA 1QLHA 4KP7A 4Z9YA 2V7PA 1Q2XA 4I1IA 4H15A 1LSJA 1U7TA 4BQRA 4IM7A 3WIEA 2Q2VA 3U3XA 3BMQA 3UW3A 3ZV4A 4BO8A 1HZZA 3FR7A 4E2XA 1HDZA 1UJMA 2FP4A 3ICPA 1GCUA 3TZKA 5COBA 2HQ1A 4BIIA 1BTOA 1YGYA 1ZSVA 1YE3A 4BO0A 4RL6A 4WEOA 3TPCA 1LRLA 4XR4A 3JSAA 4HFNA 4UUOA 4LCEA 5BSEA 4DUPA 4TZTA 3C1AA 1WDLA 1IPFA 3VZPA 3WBFA 3HDHA 2EKPA 4OXKA 1UDAA 4XGNA 2CD9A 1DFHA 4DIFA 2VT3A 2XAAA 4ND3A 1YQGA 1GPDG 1IE3A 4IIUA 2EW8A 1GZ3A 4B79A 2YV1A 4IDAA 4RGBA 2G5CA 4JQCA 5EJ2A 4L73A 5BR7A 5B4UA 5CFZA 4NMHA 3VVBA 3E9QA 2DPHA 3GZ4A 1XCBA 3ZWXA 1P1FA 2PKRA 3DC2A 4FGSA 3NKLA 3UFXA 1YOVB 1XDWA 3KETA 3H6KA 1DEHA 1LQTA 1NQAO 3KLMX 5A05A 4BKUA 4AVYA 4GPD1 1Y6JA 1KVUA 5F3RA 1UZNA 4DLAA 1HT0A 2B35A 3WGZA 1W73A 4GBJA 4OIMA 3RI3A 3JQGB 1DO8A 3JQCA 5I7VA 2X5KO 4NBRA 2FR0A 1C14A 2VWGA 2BMAA 3UVEA 1LDYA 1IL0A 4MVJG 3AFMA 2R00C 2UUPA 4CMKA 3FNEA 2JCVA 5BSGA 2OP0A 1E7YA 2CF5A 4N54A 1FXSA 3IQDB 1ZJZA 1U9JA 5J23A 5IZCC 2Y0EA 3T7EA 2NVBA 1X0VA 5I9MA 3R3SA 3OQ1A 1GEGA 2D5AA 5JCXA 4R4JA 3KLPX 4I5GA 4PN3A 1IB6A 3QWHA 1DAOA 4FS3A 5K9ZA 1QV6A 2RH8A 3RCBA 4OKNA 2WD8A 4GX2A 5HTOA 1E3SA 1XWFA 2AG5A 1P1IA 3LSYA 5DCWA 1NPYA 3RUCA 1Z73A 3FN4A 3R6DA 5DT9A 1K89A 3KSUA 3CKYA 5GMOA 4K6CA 4XDYA 1ADBA 1PZHA 3GZNB 3K6JA 4ONEA 4RPLA 4UEOA 1HKUA 5FI3A 2G76A 2GR9A 3RFTA 1SNYA 3GT0A 1FDTA 1VLLA 3BZUA 3SJUA 1SCUA 1QORA 3F47A 4XYBA 5B4VA 4E6PA 5KVSA 5CPBA 4OXYA 3WGGA 1P3DA 4NBWA 2I99A 1E7RA 3VH1A 2PZJA 3FTPA 3E82A 5TF4A 2PKQO 2FPPA 3EVTA 3SXPA 4ALIA 3ZWNA 2J5QA 3QWAA 1KEUA 3SEFA 2VOJA 1U28A 2UVDA 1A5ZA 2A4KA 4IDFA 1HETA 3KYCB 4QXMA 4ALMA 4QFCA 4BNGA 4W4TA 1YBAA 3IAHA 2D59A 5JMWA 1GV1A 4CLEA 4RDIA 2J8ZA 2JFGA 2B4TO 3IUSA 3DR3A 3UHAA 4EI2A 4BNFA 1ZVMA 3QIVA 5JE8A 4A26A 1U2DA 1BG6A 4Q9NA 4BOYA 1H2BA 2RAFA 5G0SA 3PYMA 4DIOA 4HNHA 4KOAA 3WJ7A 4MIEA 4QO8A 3AFNA 1UUFA 1AHHA 3E48A 3OIFA 5IXYA 1QYCA 2YFHA 3F46A 3H7AA 3PLNA 4Q3NA 2POQX 3DO5A 4CMCA 2BRUA 2WD7B 5AVOA 5I9LA 4Q39A 3K30A 1SEPA 3X2EA 2O3SA 2HMTA 3S8MA 4CM6A 1DIAA 3FD8A 1K3TA 1QYVA 3EDMA 1U3VA 4YRBA 4QSMA 2RBEA 1VJ1A 3RBZA 4YJHB 3RIHA 4W7IA 2B4QA 2G82A 3FPLA 4CLOA 2UV8A 1N1GA 4U6QA 4J91A 4Q3BA 4J43A 1XLTA 3T4EA 5CG2A 4GH5A 3JQEA 1E7QA 3H9JA 3K92A 3CZRA 4TMFA 2VHWA 5EN4A 2XOXA 4MVJM 3WSWA 4JIGA 1T2AA 3L07A 4RF4A 4M89A 3ETEA 2B4RO 3GY0A 4BNTA 4YRAA 3PEFA 2E6UX 3ULKA 4RPHA 5DCUA 1YB5A 2PGJA 4IJWA 4Y6RA 2ZKLA 5KCZA 3WMXA 3HWRA 4I5EA 4NFYA 1YJQA 1D7OA 1I3MA 3VPSA 4C7KA 4N7RA 3UF0A 4NFHA 3ZWWA 5G2OA 2PZLA 5CAEA 3GGGA 3JYLA 5C7LO 1DXYA 3D3WB 2FR8A 3OJLA 4BNZA 4B8ZA 3F5SA 4EITA 4YT2A 1U5CA 3LQFA 3RWBA 5A5EA 2VYVD 3GFGA 3U62A 2CVQA 2HMVA 2Q50A 1C0IA 3QVSA 3RJ9A 1DBVO 1K0UA 3ADPA 5I8WA 1M75A 2FN7A 1GL3A 2Z5LA 2HO5A 8ADHA 3PDJA 1E1KA 4LMPA 1ZFNA 3KSZO 4A73A 2HMUA 2OMEA 5CHEA 3HB4X 2X5OA 5GZ6A 1G6KA 3PTZA 4AJ1A 1DB3A 1Y5MA 2JCXA 3D7LA 1ZNQO 3ENKA 3PZRA 4QECA 5T57A 1Z75A 9LDBA 3D5QA 3RUFA 5A9SA 1WZEA 3UGKA 1PGQA 4BNUA 4S3MA 4JJFA 2X4GA 1KERA 3ZWCA 2EW2A 4FJ2A 1HSOA 4R54A 1NFFA 2H5LA 5A9TA 1SOVA 4EEXA 3PRJA 3RSHA 2FZEA 3WDSA 2DAPA 3VZSA 1EDOA 4NI5A 3ZWBA 2Y1DA 4E33A 3EGOA 1ULUA 5THQA 2YYYA 3VAZA 3MJEA 4WLNA 1GDHA 2CFCA 3BIOA 1F12A 2VN8A 4JLWA 3WSVA 2GRAA 1HYGA 1HEUA 3ZW8A 4MVJE 4FPXA 1H5QA 1P9LA 1GZ6A 2D3TA 4DLLA 2QYTA 4PZDA 2ZYGA 1DRWA 2BGMA 3DQPA 3HNPA 4FFMA 1NQ5A 2P2SA 1WVGA 2LDXA 4DBZA 3FCOA 3LYLA 4LVUA 1O95A 2NNLD 1LSSA 1MP0A 3AY3A 4NR0A 1X0XA 3INRA 3BMNB 1HSZA 5C7OO 4D43A 4AJ4A 1C3VA 1V9LA 3WQRA 4MO2A 5ILOA 3RUIA 5COAA 3WWYA 4O59O 2Y0CA 2AQHA 2ZB3A 3DAGA 5BNIA 4NK4A 2EEZA 3V2GA 1R12A 4AJHA 1HRDA 4BKQA 4BS9A 3A06A 4MP6A 2YV3A 1A4IA 1DC3A 1IULA 3UOGA 4D79A 4IQ0A 1A9ZA 3FF4A 3QY9A 3Q2IA 3L9WA 4W7HA 1PJSA 1GCOA 2ZQYA 1DC5A 2BFOA 2BLLA 4WEQA 3ZWOA 4BNIA 3DZJA 4PIVA 4PGFA 3JQ8A 4U0JA 4GVXA 4FB5A 5EQFA 1GUYA 5JPIA 4WNCA 2NWQA 3C8MA 2FR1A 5GZ3A 3I9NA 4EBFA 1I30A 3NV9A 1AHIA 3ZN2A 4AJLA 1U8FO 3H5NA 3WFIA 3DAFA 1HE5A 3I9LA 3NGLA 4JJIA 4RPKA 4AJPA 1Q7BA 4R16A 1NASA 4XCVA 3HZZA 1F8GA 4JROA 2BI8A 4XX0A 1L7EA 1L1FA 3GR6A 1E1NA 2CDAA 3VKVA 4IGFA 3GDFA 4IDGA 1EEHA 1GYQA 3JQ7B 5B1YA 2CY0A 2GERA 2Y1CA 3DBRA 1NR7A 1PJCA 4BKRA 2V6FA 4YCAA 2Q2QA 5I9NA 2Y1FA 3NUGA 1ZCJA 4BO5A 4IJVA 1FDUA 1F8FA 5C3MA 3PPIA 1BW9B 4UVEA 2Q49A 1UAGA 4UEJA 2OOSA 5IDYA 1MC4A 3CEAA 2QRKA 4ITUA 1X13A 2EF1A 4HV4A 5IDXA 2ZIZA 4PG6A 4CM8A 7ADHA 1MX3A 2OBNA 4NBVA 3WYCA 1RM0A 1Z6ZA 3GVPA 1EVZA 4N5LA 3O9ZA 3R1IA 3DBHB 5MDHA 3P2OA 3OEYA 2WD7A 1N7GA 2G17A 4YTEA 3ROMA 1XA0A 4BO7A 4AJKA 1R16A 2BHLA 3DZBA 4ROSA 1B7GO 4LVCA 2VHZA 2QQ5A 3DHNA 3CZMA 3JD3A 4Z0HO 5BSFA 3GLQA 1PJ3A 3H3FA 1BSVA 4CMHA 3QW2A 3JQAA 4GMGA 4D3FA 1JTVA 3OHSX 1CYDA 4GX1A 3WQSB 5JAZA 1DPGA 4AL4A 3I4CA 1YB4A 3O4RA 5L4NA 3ANNA 1B3BA 1K6XA 2ZTVA 4L9RA 5EQDA 4I9NA 3LZ6A 4PRLA 2WSBA 4MJLA 1AN9A 2DTXA 4HUJA 3QVOA 2JAPA 1U3UA 4IJUA 1VE9A 1YRLA 4DPMA 1UP7A 3JV7A 3DONA 3BMQB 2P9GA 4OO3A 4DPKA 5HBRA 2AQ8A 1PS0A 3K5PA 4TKMA 1CF2O 4CV3A 2CDCA 5LDHA 4BMVA 3G1UA 3L4BC 1KC3A 4E2WA 3D3WA 4IS2A 4PZCA 2OUIA 3LF2A 1N5DA 1T2FA 2NADA 3WS7A 3PYLA 3W4JA 2OO5A 5A1TA 3NT2A 1TXGA 4RZHA 2WDZA 5JBIA 2GF2A 3AI2A 1FDSA 1ENZA 5EL0A 2Y99A 1J0XO 1UAYA 1NR1A 2H9IA 4TZKA 4LISA 2VYNA 4M55A 3A1NA 1WPQA 4DPLA 2HK9A 4Q3CA 1KEWA 5TJHA 1Y8QA 1ZMTA 2ET6A 4ZICA 4IZIA 4ZVVA 4DC0A 4CUZA 3F1LA 4WASA 1MV8A 3DXFA 2GLXA 2NU8A 4ZQHA 1JA9A 2D1YA 4FJ0A 3WX0A 1SPXA 3AJRA 3RUDA 3FNHA 4HWKA 3NAQA 1NM5A 3H4VA 5THKA 4M54A 4HFMA 2Q4EA 3NRCA 3VDRA 1UDBA 2UAGA 3M6IA 2BF7A 3PFFA 2UUOA 1UZMA 1ZXLA 3ENNA 4K28A 2WJPA 1LDGA 4E13A 2GCGA 1NHWA 1JVBA 2H6EA 1E92A 5JYEA 1NQOA 4M8SA 3QVXA 3NYWA 3O26A 4MPDA 4Q3EA 4DMLA 3PK0A 4YXFA 3AI3A 3OJFA 2VUSA 3CE6A 1H9AA 2ZJ0A 4QFDA 5L9AA 2NQTA 4IDEA 4FFPA 1LRJA 3NTQA 4KWIA 1IY8A 4BMSA 1E77A 5ICSA 1XU9A 1AE1A 1EUDA 2NTVA 1PWZA 1DHTA 1NVGA 3UUWA 1KY5A 2ZQZA 1RWBA 3NTOA 4XYMA 2O3UA 1P45A 4GX0A 3N74A 4UVGA 1WXDA 2YY7A 1A7AA 3EW7A 5CDSA 1IOLA 4Z9FA 4ALLA 1SMKA 3HUDA 2AEFA 5HM8A 2FOIA 4RQTA 3MWEB 3F5QA 3ZNQA 2DLDA 4PZEA 1B0AA 3UCEA 4ALJA 3DFZA 4XIYA 5JW6A 1EBUA 3U4DA 1GADO 4JXKA 3OJEA 5A9RA 3RD5A 3GFBA 1WLYA 4Q3DA 4XJSA 1ZMOA 4D3SA 3ONEA 4RPGA 3S2FA 5CP8A 1NFQA 2VQ3A 5T67A 1M66A 1NWCA 4RPJA 4DGSA 1M67A 3ITDA 4BGEA 3HJAA 1SBYA 5BNTA 3DOCA 1YXMA 4KZPA 5I7FA 2I76A 4HY3A 4D0SA 3GGOA 3NGXA 4J4HA 4E21A 2TMGA 2J3KA 2JCYA 1V3UA 4UUMA 3NDIA 4AJJA 3HSKA 1YKFA 3EZLA 3LDHA 3OSUA 4OMUA 3W8DA 3PJFA 4L75A 2X9GA 5K6AC 3VPHA 3ABIA 4C7JA 4CUJA 4JN6B 2CNBA 3PQEA 4PVCA 3WFJA 2PA3A 3S2GA 5JXWA 4I5DA 5HS6A 2PR2A 3I9MA 3OA0A 3ANMA 4E5KA 4CLRA 2AEJA 2I3AA 2VZ8A 3E9MA 4DL9A 2YHUA 3H2ZA 1VL0A 5GY7A 4JP2A 4O0LA 2X7HA 3F3SA 4DQXA 2CZCA 2P5YA 1QYDA 2VYVA 4PRKA 1ADGA 2WE7A 3CTMA 3C85A 5KJCA 4U0KA 1ARZA 4Q3AA 1P1JA 2QRLA 1BXGA 2X58A 1ZSNA 2OP1A 4PLVA 4RF2A 1YDEA 4W99A 1ML3A 2AQIA 2OXIA 3KO8A 4R3WA 3VOSA 4MINA 4EW6A 2IE0A 5HS4A 1DFIA 5IAAA 4RVGA 4LRTB 3IP1A 3Q9UA 5EIOA 2DM6A 4RJTA 3RFVA 3H9QA 3MEQA 4EEZA 4OYRA 1LXCA 4YAEA 1YQXA 1JKJA 1OI7A 1Z7EA 3UCXA 2P4HX 3C1OA 4N5MA 2V6MA
chains in the Genus database with same CATH superfamily
1NOIA 3E9ZA 5BUCA 2IQIA 3SR0A 1X77A 3QPUA 4AZTA 4IDQA 2WSYB 3DV2A 1OE0A 4RA9A 2D4AA 4OCZA 2OGSA 4FFOA 4LCJA 2D7CA 3WIDA 3TSZA 4IBOA 4JT2A 4M9RA 5F5NA 1J39A 4YV7A 5BNWA 5CEEA 1DINA 2QAGB 3TZHA 4TVSA 1XC7A 3STWA 1MGOA 3WL8A 1LRKA 4B83A 4IZHA 2ZK7A 4QU0A 4LQDA 5BOVA 3FM9A 4DJJA 3EPPA 2OHFA 2RGRA 3GFFA 1KMIY 1RI5A 3WYAA 4NP6A 5EZSA 1JDBB 5CAEB 2GZDA 3JR3A 4L4SA 5DYGA 4DZZA 3IULA 1AGRA 3ROZA 3PICA 1C9DB 2YC4C 1ZW1A 3KOZA 2O2EA 2V55B 1UK7A 5JDIA 3TLZA 4Q05A 4UAVA 1AX9A 5E8JA 5CVDA 5ADVA 4XTRA 4Q4AA 1RJ9B 5L45A 1KZ7B 3A3PA 1A1SA 5DLDA 4YEDA 3HVRA 2LZ0A 3SJAA 2C4WA 4BJ3A 2GJSA 5I7WA 3B20A 3CNOA 4U63A 1Q1NA 3QXJA 2JI7A 2IXGA 5SZKB 1F0NA 1KBZA 1DT3A 3T12A 4D4JA 1I3CA 4B4UA 2EJTA 1D1TA 3DDCA 1BZYA 2P7IA 1X8JA 4OGGA 2F3QA 4NCIA 2I5PO 4PGAA 2IITA 1JLMA 1SVKA 4JQOA 2Q6TA 2DT5A 1UQUA 2UZ1B 4Z51A 1SZJG 2FWNA 5HKKA 3K9WA 3STUA 1ZMXA 2I78A 3ORRA 3AOEC 4P7KA 1JH9A 4EQ6B 4JEHA 1FDIA 5JPCA 1DJNA 1K4YA 1SO8A 3T1QA 3EK2A 2VXOA 3ZZTA 1LLDA 2RB5A 3HYSA 3E3AA 3JARA 3BHJA 1HKHA 1EX1A 1NBIA 1YWGO 3QKRB 3ZJYA 4B17A 3I62A 4OB6A 2XMRA 3RGWS 4HAYA 1I14A 5JIBA 2JGRA 3EIWA 4E14A 1UBSB 3RC1A 4G0WA 4P3PA 3GFRA 4MB0A 2WM9B 3TOXA 2GYWA 2I65A 2QTCA 4E07A 2OK8A 2IODA 3PHCA 3Q3CA 2WPDD 2HGZA 4ZARA 2XTNA 5DWQA 3DOOA 3INYA 1SA0B 1QS0A 3I2GA 5ECYA 1PR0A 3BGWA 3G0BA 2C94A 2XCIA 3ABOB 3LUDA 3QU5A 5C37A 1BMQA 2XTAA 4K9KA 4MYSA 2EQAA 1IXZA 4B2YA 3JRXA 1HE2A 4LRQA 1J2JA 5IJ9B 2KBEA 3INGA 3E58A 1TADA 2QGNA 2XSZD 5E9WA 3V8PA 5A5DA 3GGSA 1MPXA 3E53A 3SIXA 1C9KA 4HEA1 1V11A 4X95A 1I7NA 2A94A 2ZZKA 2D5CA 1AY0A 3FLEA 4X0EA 1OH6A 4RFSA 1TJ3A 1EX6A 1G7SA 3GMTA 3JWPA 3O8QA 3Q72A 3EDYA 4RD0A 5TC4A 1JU4A 4MEBA 4BNKA 5KSYA 4K9RA 1ZBDA 1RW4A 1LDNA 1SM4A 4IPTA 4UDNA 2VQFB 1VYTA 5B4TA 4F4CA 1B93A 1ZXXA 3AM4A 1DAEA 1WZUA 1UKEA 3B3QA 2B94A 2RJ3A 3SC4A 3ZV3A 3BA1A 1A5SB 5JSFA 1S2LA 3CMMA 4GC5A 2Q99A 4KE9A 4N82A 4QM7A 4HTFA 2VHVA 3KYJB 1E96A 2KM1A 3HBNA 3MWDB 2H00A 1AUVA 2VT7A 4FHZA 1AQUA 1J90A 2XT0A 3WG9A 4ZJZA 4EB6A 2RK6A 1GG5A 4RDHA 1W59A 4YCNA 4G81A 5B55A 3TEMA 2M1ZA 4PLTA 2FEPA 1I3LA 5JCPA 1G1MA 2R6AA 1M34B 4LZPA 4GGPA 3F7MA 4B3JA 3UWMA 2DJ5A 2RCYA 3OMLA 4R9UC 1T6XA 1XMPA 1AJEA 1NR5A 2WR8A 2XXJA 5GIOE 1Y9EA 3O3OB 5TGZA 4BWGA 5JQGA 2C5EA 4HPJB 2BTQB 3BD7A 4DA6A 4ZHQF 3DTVB 3B2QA 5F2KA 3GFPA 4ARUA 1FUEA 2AB0A 1TMOA 2AN9A 2PAAA 3FSJX 3L7NA 3LX6A 3HEBA 4KLAA 3WWOA 4C06A 2QLFA 4QYXA 1RPTA 1I9GA 4AZ0A 1Q83A 2XGOA 4P4SA 1XTSA 5NULA 5MN4A 1MC8A 1KKLA 4FYWA 4OYHA 4BKMA 1IBSA 2W0MA 3C7TA 5ERGB 4BWYA 1RM3A 5BT8A 5CNIA 4RJKA 2X23A 1I2AA 1L5WA 3DPSA 3PU6A 1TX4B 5D01A 4IIJF 4QPDA 4TQAA 2C54A 2B7LA 2HN9A 4U7GA 3JQDA 3N86A 4FW8A 1HDXA 3I3SR 6YASA 2Q8PA 5J2TA 2HHAA 1SOMA 1VMIA 2H5IA 5KTOA 1P1HA 1ZD9A 1YE8A 2QQ0A 1JBQA 2IXFA 1ZXBA 1JX6A 1VMKA 1YQTA 2XYGA 2VNSA 2VBCA 3FPBA 3HP1A 5KVCA 3B78A 4G5HA 3BORA 3M89A 2IYTA 4MYUA 1I4EB 3S2YA 4KYUA 1L5HA 4D9IA 5JS2A 3T5PA 1QGUA 1AKUA 4PLHA 1QIDA 2ZIFA 1D6MA 3ZTWA 4CT0A 4Y7CA 4JELA 3WMWA 4MVJI 2VCEA 4Q1VA 3ZNOA 1XD8A 5FWYB 5JVDF 3GLGA 3L0IB 3RTAA 3TXXA 4YUWA 1T5BA 3VR1A 5HBGA 1RQGA 2ZWVA 4I99A 5IVKA 3D02A 4DZRA 4F12A 5K7SA 2CL7X 5FTKA 1GM5A 1W5TA 2P6UA 3M34A 2CJYA 5GGXA 2WWVD 1RBYA 2ZWIA 1WUIS 5CDFA 1OTYA 1HWYA 3FCYA 5CMLA 1ZCBA 4FOPA 4NCHA 4Q7QA 5I6DA 1R6UA 1RZUA 3JW8A 3UUGA 1D2GA 4AMUA 5FUYA 4EFDA 3T0FA 4II2A 3BQMB 2ZYAA 3JQAB 5JI2E 5PGMA 1TKRA 3F9IA 1UBGA 1DC4A 1TAHA 5UKDA 3JVEA 3BKXA 3OCXA 4NZNA 5TIIA 2WZBA 4LJRA 2H85A 4KGVA 3KM0A 1BQ3A 4AKEA 4IOJA 4YDSA 4Y1EA 1T26A 4MZDA 4J1QA 3MPUA 4BVJA 4XJVA 4LYEA 5E1OA 3W8RA 1PYDA 2OWDA 3EC2A 2I6XA 2NXWA 3RVSA 5MGBA 1AF7A 2VT2A 1IJEA 3WYEA 3C5CA 3EWSA 3ZWYA 2PWBA 5D51S 4W6ZA 4RTMA 5BRJA 1QIEA 3WE7A 1H42A 1T5TA 3L1HA 4C0WA 2PUAA 4XRRA 4L95C 3HMQA 2PBZA 4WH0A 2KS6A 1POWA 1VIAA 2HDNB 2MR6A 2C8VA 2YRWA 3AW9A 3ONWA 3Q9SA 1C4WA 3C4VA 2BM9A 2NYAA 3HWSA 4Q9KA 2CXUA 3AR7A 4HNVA 1ONPA 1OZ0A 3ROPA 5CFRA 3BB3A 4NC9A 4YR7A 2AFHE 1CNMA 2HA4A 1SHKA 2HSDA 4KTVE 4YV1A 2CYBA 5IXSA 3TECE 4UHDA 1LBQA 4EHIA 1R0RE 5TEVA 4CM9D 3LSTA 5B1EA 3ZHTA 5EGNA 2IELA 5FOXA 3QU9A 3WKAA 4E88A 1Z4IA 2DUUA 1QV7A 2R3SA 4H3KB 4LW8A 3SN6A 2GVDC 3TQTA 4K26A 3UK0A 4MXDA 3C48A 1JIIA 2YJ6A 4KVFA 1E62A 1D5WA 1R5BA 2LIPA 5ADHA 3DDUA 4EHAA 4IO1A 2WWTA 2KLBA 3GOQA 3K8OE 2BFDA 3TX2A 3R6GA 2BC9A 2I71A 2X76A 1E1LA 1WQ1R 4U2DA 2PL3A 2YV2A 1WDTA 1K8XB 1BH2A 4MUEA 3DNPA 4BUJA 1WUJS 4MYCA 1TM4E 1TC1A 2E82A 2ZXUA 4UASA 2BHSA 3PXUA 1BGXT 2B4AA 2GK6A 2VUIB 2XA1A 2D1QA 3M1LA 4IY1A 2IV7A 2C00A 2O7VA 2E4AA 3AHGA 5BSVA 3FDZA 1VBKA 2Z4SA 4RX1A 2GMWA 2O14A 1M2JA 5GZ1A 4BO4A 1NUAA 2AF3C 1SGWA 3KOYA 1Z83A 5ICFA 5CB6A 2R1TB 2B7BA 1GR0A 1P91A 2GAAA 1VL1A 3BRCA 3OPXA 4NESA 4WY2A 4M7RA 4CI9A 1U90A 1X7GA 4OMCA 5DWDA 1CUXA 2KI5A 4YQEA 3U9LA 1XMIA 4NZYA 1JT9A 4OXQA 2IXEA 2JHPA 4GQIA 3KJEA 2V03A 3EXHA 5TMEA 5JDCA 3U4QB 1N5IA 5AT1A 4OSOA 4P83A 2AXPA 1E6CA 3ZOKA 5FTJA 4ZI2A 4B6SA 1Q74A 1ISSA 5ENZA 3GHYA 1N57A 3DB2A 4BEJA 2EIHA 5FBHA 1SEVA 1HQKA 1TTHA 2PPVA 2WVGA 2ZE8A 1Z5UA 4DFDA 4HUQA 1J2RA 2ATXA 2FUKA 3LIPA 3B1JA 3S2UA 1KQGA 3K0SA 3JAMA 5DB4A 1YIAA 1D4FA 4CCSA 1IIRA 3WL6A 2CLOB 1WHSB 2HSJA 3FJYA 5IUNC 2NZYA 2I4RA 4B73A 2Q0HA 3DEJA 1KZGB 4N7BA 3I6IA 3O74A 5GINE 4QU9A 3CURA 1BMTA 5F9HA 2FETA 4BQPA 1EFLA 4R2XA 2IW1A 3PPWA 4AQDA 3WDKA 3L7YA 3BGOS 1CW2B 1CJCA 2UXCB 3GLFA 1OAAA 1WMAA 3F5MA 3ZYCA 1M76A 1J9GA 4PYIA 2OQRA 1PS8A 6Q21A 4HQLA 3R7WA 3VHXB 5JPDA 3BSWA 4CKZA 2H18A 2O8BA 3M33A 1WO8A 2F43B 4WBSA 5ARCA 3T3IA 4EVSA 6LDHA 4WPGA 1JEEA 1PQUA 2RGUA 4KB5A 5ELMA 5LN1A 1SOWA 2OOKA 2CMGA 2OT3B 2VDWB 1DQRA 5T64A 1Q20A 3ZDAA 4OQQA 5GGYA 2BFBA 3EA5A 2DUMA 5IAKA 3AETA 4JZKA 2Y1EA 2HCTA 1LDBA 2VDVE 2EBHX 2BELA 1Y1TA 1CFZA 5GPBA 2OZLA 3UBMA 2QT1A 2WZCA 1OLUA 4HGYA 1AMNA 1W4ZA 2R48A 3IEKA 5F98A 2IUUA 1R0LA 4PS0A 2JZCA 3EAQA 2GHIA 2C4MA 4KE7A 4N65A 4NAHA 3FWZA 4IJ6A 3HR8A 5EVCA 4UTNA 3RRJA 4LYJA 3SF8B 1U8TA 5TRTA 1TMYA 1ZD4A 4ZPJA 2GM3A 2BJWA 4PRZA 1UJBA 1T1SA 4NZ9A 4XM1A 2QM0A 1V5IA 4BUCA 3U44B 1D0IA 4YUXA 1NAIA 4K9SA 4DV4B 1V39A 4BP3A 2C1EA 3PENA 4IHQA 4MMZB 1X9IA 2C7VA 4N5IX 4XTCS 1Q0UA 4WLFA 4GWKA 3HWWA 3QPBA 2KLHA 2DTDA 2AZDA 4Y6LA 1BMFA 2GFQA 3MINB 5HF8A 4NPAA 4BNDB 3QLUA 5DBEX 3U17A 5EP2A 4GHWA 4GDFA 2OG2A 2FQYA 1XVLA 3W2IA 5T8KA 3OQNA 3SR3A 4AUNA 4KFCA 4KODA 4OHPA 1TAQA 1CPYA 4YUAA 3M2TA 2QJRA 2W11A 2QAIA 2ZE6A 1CS0A 3BRWA 4IDBA 4NFLA 2DTEA 4CKBB 1W19A 2ZXFA 4YJGA 4TLEA 2EL9A 1JV2B 2QMHA 4I3GA 3DL0A 3GJ6A 4NCXA 4G25A 2A1IA 3ZDCA 1ZK4A 4Q9DA 3TSOA 5G0UA 3RSSA 3B53X 4J2HA 2YIJA 1N5RA 4JI5B 3L6OO 1A9SA 1Z4QA 3D6VA 2YWRA 1IK6A 5HK9A 3VOAA 3OICA 4BFXA 1H8HD 1U1EA 3GEIA 2VYFA 1EGAA 4E22A 3AUSA 4IV8A 3K8QA 3PI6A 1F0KA 4J1NA 4L9SA 4X3CA 4MW9A 4UXIA 1JYEA 5AM0A 4ZWNA 4ENVA 1JB9A 4ADSG 2HUPA 2J3DA 5ALVA 2CJPA 1YFKA 2OO7A 1GJRA 2QLTA 1GCIA 5J4VA 3KT6A 5MN5A 4D9CA 2BJHA 2FQXA 4TMVA 2E4WA 1OBFO 2FRDA 1Y8RA 1W0KD 2QAJA 4GOMD 4PQRA 1DC8A 5CA0A 4C4AA 3KIPA 3BL5A 1VCIA 5AP9A 3ZNNA 4DHEA 5DM4A 4FBMA 2PS1A 2YDYA 3K0FB 4RM3A 1VE6A 4WNAA 4E5YA 3VU9A 2A78A 5CVUA 3GGJA 3PPVA 5F3DA 4ES6A 1GGJA 2FRXA 1M6YA 4HT3B 1YQWA 2FW1A 3E22A 3I45A 1IFXA 3AF5A 5BVGA 4AX4A 3IVCA 5AJTA 4GP9A 5HOEA 1GZDA 1Y9ZA 4GSLA 5KYNA 1K9SA 3M83A 2X4IA 3OE7A 5C52B 1CRQA 1SQ0A 5B1SA 3RYCA 4FXPA 3A3KA 3FOAA 5DH9A 3CEPB 5CJJA 2FY8A 3T1OA 3COSA 4C30A 3W7AA 3WMEA 1BCSB 3CZAA 1TAGA 5AIAA 3W8FA 4UU0A 1QWSA 4OATA 2OV4A 3D0OA 5DNYB 1VHTA 1XZNA 4INOA 4D7AA 3SOPA 3JALB 1CY8A 5EHQA 5HTKA 4BU0A 5IT5A 1PJ2A 1PZXA 4OJKA 5SZHB 3I5AA 5AXDA 2OXEA 1JR3E 2NU6B 2I67A 4JDUA 5HCNA 1F0YA 1VMDA 2FDRA 3X1YA 3RU9A 5DHSA 4PEVA 5DGCA 1VJCA 1M2GA 2ODWA 3I83A 1PUIA 5B57C 1E9RA 2R84A 2J1LA 2ZRQA 1L8QA 4KYIB 4ZPXA 1TKAA 1P7ZA 1QQ5A 4HB3A 3GNSA 3WQQA 4IH9A 3OE1A 1XJWA 3FZYA 1N8KA 4RKEA 4F1WA 2FW6A 4NV0A 4GEGA 4GWLA 4A6DA 4EK9A 4X45A 4EGAA 2L17A 4NJMB 4Q1AA 2I3GA 1BN6A 5K51A 3GDWA 2P0AA 4E5NA 1XDBA 4TL9A 4JA2A 3VR0A 2AZMA 4ZC1A 5JCXA 1IMOA 1ONOA 4CL3A 1DTEA 1NL3A 4UZFA 2RCNA 3USCS 3ZDQA 2HJSA 2E5LB 1X3SA 3PKIA 1ZD3A 4ITRC 5JZVA 3Q5DA 2FPOA 2JGDA 2IVFA 1DIGA 2VXCA 3T41A 6ADHA 3CM0A 5EWLB 1WDMA 1OWPA 2BFPA 3ACBA 3M5PA 4JKOA 4U2KA 3GJ5A 3L8YA 5EG5A 5F73A 5CX1A 2O8CB 2A88A 4I4TA 4D8YA 4DCSA 3PFGA 1XTQA 2QLBA 4RMIA 3AF3A 4IIDA 4CG1A 2CW5A 4PLCA 2MOKA 5AVSA 1ZUD1 3LLUA 2Y0BA 5BVHB 3G9XA 2WTUA 1LX7A 1T25A 4BMYA 2E18A 2OV1A 2R6GA 3NOXA 2ZRBA 2FPXA 2JEZA 3KJIA 3R0ZA 4HN2A 4LZZA 2OESA 4ATNA 3SS7X 4AWXA 1ZIDA 4EG3A 4QQKA 1CZUA 4C7BA 4H0CA 2YHSA 1E3WB 4KLRA 2LVBA 4PC7A 1QR6A 1U3DA 1ZK0A 2D2IA 2FW0A 3JYNA 2R1VA 3TOSA 3ZU4A 1H93A 3P97A 5K0JA 4TKLA 1Z7BA 1RMTA 3FPEA 3OJCA 4DA7A 5LMCA 3U5ZB 1PN3A 2GYVA 2VHQA 3EEIA 2KX7A 1NF3A 1RYYA 2ZT8A 1RWOA 4FGJA 4C07A 5KPDA 4BNHA 2V5AA 2EQ5A 2R6JA 1KZYC 2J9ZB 1XRSB 3MCAA 4I1SA 2Q2WA 4OM8A 3MQ4A 4RUKA 5G3ZA 4MX8A 4TMKA 1JQJC 2Y93A 2ZDGA 3MXTA 4GZ3A 3RYIA 3ZCVA 2XAUA 3FRIA 3S55A 1Y9AA 2WSSA 1PT5A 2O48X 3FUXA 1U0JA 1X38A 3HACA 2GF0A 4TRJA 1OXXK 1QLWA 1R4NB 1E4EB 4WLEA 3NU1A 4MB6A 1NXSA 1LF5A 1QZTA 3I1IA 2C8LA 4Q16A 4UXJA 4WE3A 4CM1A 1HTTA 2M32A 4FTWA 2FHPA 1I7PA 4OHUA 3VH4A 4DLUA 2VDQB 1SR8A 4LZAA 1MAVA 4JK3A 4M22A 1PJRA 1A8SA 4I0WB 1FX1A 4ESEA 3KVYA 2Z57A 1JNYA 5C3UA 5CA1F 3IAM1 5FBKA 1V7PC 5K5EA 3ETLA 1CD5A 2AE2A 3PR2B 1LPPA 4TLDA 3UB4A 3A37A 3OCVA 4QU5A 1FFCA 4LF8B 2CE2X 1ILWA 1CX9B 5CH8A 5EUQB 4X65B 1JDVA 1GOTA 1NG1A 3RFCA 3B9RA 2AKYA 1U7DA 3C70A 3PF9A 4L8LA 4PV7A 4WA8A 4ZCMA 4Q34A 1IG3A 4OBXA 2XNJA 2R2GA 3MUFA 1RBZA 1U7ZA 1TPYA 1EA5A 1PF7E 2A67A 2E6KA 2PZKA 1MCZA 2REBA 3BXZA 3MELA 4NULA 2RC5A 4P84A 4R1OA 1LWNA 4WDQA 1Y3IA 1UJ4A 2ONCA 2V6JA 5F78A 1Y34E 2A0YA 3SR4A 2G63A 4ZOQI 3FMVA 4YP7A 4HPWA 1O8BA 1P18A 3ZJVA 2VZ9A 3ZX4A 2IKSA 1JHQA 2XRYA 4XKJA 5BXQC 4LF4B 2CXSA 1YL5A 2KWIA 4GOND 1GNQA 4EI7A 3ZW7A 3VV3A 3ZH9B 3FB4A 3CYFA 3F4KA 4QBIA 3RKUA 2IHZA 3IDSA 3OOJA 2WIAA 4YWHA 3UQZA 4LZWA 3VKGA 1WU8A 4MR7A 1G5IA 4ZD6A 1NBWB 5IBCA 3LT1A 1MH9A 4I55B 4ZZIA 1E2PA 1M2KA 4KSYA 1KO8A 4RCYA 3I9V1 4LJSA 4NJOA 3HA2A 1S3GA 2B6NA 3L84A 3VZQA 1GL7A 1XQWA 3VA7A 3DKPA 1IN1A 4EKEA 4C87A 3W5VA 5KNCA 2VBFA 3CLTC 3AK4A 4UCFA 5E6SB 1ZRHA 1WTAA 2BP7B 4QPZA 4Q48A 5EUCA 1DTWB 3Q8XB 4MITA 1APBA 3CONA 1UDWA 3RJ5A 1RZRD 5GOTA 1BWQA 2NO7A 1WKVA 3CW8X 3NNNA 5DHFA 4DMMA 4NYJR 1X42A 2H63A 1M1UA 2QV7A 4IMJB 1FFSA 4Q0MA 3TXYA 3HP4A 2ETVA 2GNPA 5AVRA 2XB8A 1ZQ9A 2JFVA 1XL1A 3I3OA 4JMLA 4NVRA 4KSCA 2HZ7A 1NUHA 5AO9A 2FTKE 4YP6A 3VDNB 2R8BA 5AVQA 2Z6AA 2ZT5A 1YT5A 5A4DA 1MIOA 2ETXA 3RTGA 1QAMA 4EPYA 3ZGZA 2GKOA 3OP1A 2NVOA 2PLWA 1RKXA 2VJDA 3LPDA 8LDHA 3C6ZA 4GX5A 1TT7A 4FFWA 3IT2A 1W6UA 1A5TA 3USZA 3ZXIA 4MJ7A 4ND7A 2UYGA 1HZJA 3EE6A 3OLQA 4WKNA 3IT1A 1T8TA 3MRXA 3O9MA 3R3YA 2WKWA 4Z9XA 4QRDA 4TL8A 3FTQA 1OROA 1CR1A 1IVNA 4NFSA 3GEMA 4PFJA 1SC9A 5H68A 2R8OA 2DY0A 3RKRA 3Q7EA 3SQMA 4NL4H 4P4NA 1ILEA 3R5SA 1XNJA 2FVYA 3GBSA 4C5CA 1IQPA 5CVVA 1SUFA 3SEQA 3Q9NA 1COZA 1Q7RA 3CC8A 2CSUA 4OOEA 2P2CA 3UV6A 2XUQA 1LC0A 4E5VA 3JQQA 3ZUGA 3C3KA 4ZU3A 4QGHA 1BMFD 4MNTA 4F04A 1R0SA 5JDIC 4YMUA 1MENA 4FGZA 4BFVA 1MVNA 1XUOA 2B5VA 4F9GA 4BLSA 2X19A 4LRSB 3O4VA 4BASA 5K0FA 3CLSC 4MW2A 4NYIQ 1EDBA 2I2AA 2AKEA 1ZGJA 4YQZA 1YJCA 4TM7A 1GZHB 4MKIA 4RPIA 3H16A 3DZDA 3V5NA 1T5SA 3BRWD 4Q7KA 1GUDA 1TF2A 1KP9A 3BF7A 5FA5A 3GXBA 3QMWA 5F77A 1NYTA 3L77A 1P4AA 3MM4A 2J48A 2B69A 1KH3A 2A0WA 4DZTA 4F91B 4L07A 5TGDA 1H2RS 3ZCRA 1LU9A 1OBHA 2NU9B 2GOYA 3D4IA 2NUAA 4JQYA 5J47A 5FRDA 1RXWA 2ZUVA 3BREA 4NAUA 3IJRA 3GCXA 1ZNYA 1P4JA 3BL8A 1WJGA 4BLOA 3ZDBA 3WKCA 2AN1A 4CHGA 3ZGNA 2BMFA 1ORHA 4G8JA 5B12A 2YYZA 4XJXA 3LFTA 4LOIA 4RV9A 2QVBA 4LFBB 3CCBA 4MRSA 3QWBA 4BQOA 2Y0DA 3V6MA 5C53B 4K1XA 2C2KA 3IP5A 3BUSA 2H2AA 5CCDA 4B45A 3WNDA 1FMJA 5AW2A 5KKCA 3OIDA 2QORA 4QOSA 4BO9A 4BQEA 4LGVA 3R7SA 3NXKA 2O50A 1W8IA 3HYTA 4JEIA 4P9NA 2O4CA 4R98A 1PGNA 4HJXA 3RRNA 1GFZA 3DOHA 4TYYA 3SY8A 4M9SA 3SBOA 3SMQA 4O6VA 4DTIA 3EA4A 3A2KA 3P9ZA 2VHJA 3S2EA 3WLNA 4YAGA 5AW3A 2B8TA 1KDPA 1SIOA 4DADA 2W22A 1NJ2A 2CNOA 1FFWA 4X54A 3DG9A 4B87A 1WL8A 5EEHA 2C42A 4C3VA 3NTXA 1WB9A 4A0GA 1GGFA 1K6JA 4U4AA 2TECE 1O9BA 3HJGA 2F55A 5CLHA 1MUUA 1RZ3A 2QZZA 2BGRA 1IBMB 2XITA 4JB8A 3ROTA 4OHXA 2Q4RA 3OOEA 2VF8A 1AKWA 1EQ2A 3H5IA 5AFSA 4RCZA 1M1YB 4L08A 3OEWA 1TU3A 1GA1A 5BT9A 2EF0A 4LC9A 3I61A 4CKWB 3ZU5A 1VJGA 3LC7O 3OZIA 1TE2A 4Q1FA 1IZ0A 4XYLA 5B6JA 1GQSA 1LEHA 2DBRA 3DHYA 4F60A 4YDQA 2XGJA 2OCGA 2CVHA 4XWAA 5REQB 4L22A 1R8QA 1UPCA 3D7SA 2OGWA 3NJ4A 1BS2A 1XTBA 5E95A 2GPWA 3GXOA 2FPKA 4O1HA 4BLVA 1N7IA 2YV5A 5AW5A 3EPJA 2PZEA 4PZ9A 2ZFUA 3S2ZA 3R09A 1U2GA 2AKAB 4YBZA 3GUHA 4BGIA 2J3JA 3S6JA 1MA0A 2XRFA 3OM1A 3VO8A 4C22A 3RVMA 2PRSA 1XZFA 2HRQA 2JH8A 4TROA 1KJ9A 3S4YA 4IOKA 3TAHA 3CNHA 1G98A 3TS1A 1A0OA 2IL1A 3HB1A 5B64A 4GPBA 3GQBB 1OF1A 3QXGA 4ZTBA 3RIYA 2WFAA 2Y68A 1U0RA 3KBOA 3QBTA 1I6WA 2IYNA 3DL4A 3WL4A 4D9FA 4ARVA 4L3VA 2P5SA 5HVNA 5LVAA 3DMGA 4UKDA 3F4BA 5TE9A 1KJ8A 4B3RB 2ZYVX 4M6WB 2L69A 1C0PA 1EWKA 2BFEA 2OZVA 3HE3A 3KVOA 4NCBA 3LH5A 4CVNA 2V7QA 2XPCA 3DEFA 3LCUA 4R1TA 4B76A 7GPBA 2WG2A 4N8DA 4QFBA 3GJYA 4P93A 2FFBA 2H4FA 3GNTA 2NSHA 2VWHA 2YDXA 3PXEA 2OL4A 4XVQA 2VP9A 1NN0A 1G59A 3GLHE 2FMHA 2VSXA 1E6KA 2J46A 4S1OA 5A4KA 2OCDA 2EERA 3K70B 3EAGA 3TXAA 4P36A 1E7SA 4Y1RA 1GGHA 3LRPA 5FBQB 3M7IA 3U4AA 3IIJA 1BXRB 1QF6A 3BK7A 1I2MA 2BEWA 3KJHA 1YASA 4IV0A 5DLQC 3V4ZA 1NFRA 1XFAA 3KTOA 4DM4A 1CU1A 2WYWA 2CNLA 5G4KB 3L4JA 1Y80A 1YJBA 1YZTA 2WHPB 4PZ0A 4JP5A 5HCIA 2G0NA 2XE4A 4CW7A 5JFTA 3FHTA 1T8RA 4BTEA 1OCEA 2NPOA 3CH6A 1WUYA 3IILA 4MRNA 4ZZ0A 3D7RA 4OHMA 4R6XA 4PCUA 1GZ7A 1RPNA 2PS3A 4HH0A 1XMSA 4Z86A 2QSZA 1QPZA 1P29A 1UFRA 1N7HA 2IUYA 4G4IA 4GR4A 1VRCA 1RPZA 4ZYWA 2VJPA 3BYZA 1MJFA 3H19A 1N2SA 1YVEI 4POAA 1C1YA 1W35A 3TQIA 1IHUA 3R9KA 4YRCA 3RBVA 4O5OA 5JXGA 2BM1A 3IHLA 4EPXA 3NIWA 3NTRA 1N32B 1XZPA 4GZ5A 1OFVA 4TS3A 3HU3A 1UK8A 1VPEA 2ZB7A 2ENUA 3NJ8A 3PGMA 2G6BA 2GPAA 3A0UA 4G0ZA 4QYSA 4I9UA 5JEEA 1NTOA 4I4NA 3SKXA 1ZR4A 2C7GA 1VFNA 2Z1DA 3HR7A 4J16A 2IK8A 1XRNA 2PMWB 4HQ0A 5A7HA 3N3AC 4LDAA 5CK5A 5BW6B 5BSKA 4GVPA 1PR6A 4KDRA 1SKYB 2IYXA 1G8AA 2Q1WA 1U8XX 3FPAA 3W34A 4YRSA 1PNVA 3OZBA 1K3UB 1ZOLA 4GDMA 3PXXA 4FFVA 5ALSA 4C4ZA 1KY3A 1WP4A 3S40A 1ZC3A 1PL8A 3AV3A 3AUJB 4ZHQA 1H4SA 2YXEA 3N0RA 1Z3CA 3EN0A 1KDZA 3FVRA 4PG8A 3R44A 3DMYA 3RLIA 3U7RA 2OKGA 2ZCVA 3EMKA 4FX2A 4G5OA 2UZIR 3R0JA 4BNYA 1DMRA 4D25A 1JDTA 1SKAA 4I8IA 3E9CA 3JYQA 4RZXA 4F45A 1XJCA 5JY1A 4P7FA 1J7KA 2K87A 3QZUA 4KLCA 4J9VA 3LXMA 4QBFA 4KJZA 2KPOA 3L4KA 1UJCA 3NVAA 3PC7A 4LYHA 5FADA 2OLKA 1MG5A 4BB0A 2GZ1A 4LXIA 3CR7A 5P8WA 2IOFA 2WSMA 2FB9A 4BMZA 4BCBA 1A3CA 3U39A 5JRZA 4Q9AA 2GBFA 1KSGA 4JLOA 4E4RA 4F9TA 3HY3A 3T9EA 3CLHA 1P6XA 1WSBA 1R3UA 4J8PA 2HA7A 3VMFA 1I0IA 1LLFA 4FKMA 2VLIA 2FPIA 3IUYA 5EKXA 3RJTA 4L57A 1H0SA 1T9GS 2OXTA 1P7YA 4U6SA 4DJEC 4DCNA 3KV1A 4P33A 4RW0A 3IE1A 5BMVF 1W47A 2OBYA 1KDVA 2Z6VA 3HJBA 3NHLA 3MAJA 4GOXA 4AG5A 4IVQA 1TEVA 1BH6A 3HKBA 2VRBA 1W29A 5EIWA 3GJ4A 1XXHA 5HF5A 5SICE 2PRJA 3G8AA 3AB7A 1GTMA 1J33A 1NZFA 3FTFA 2W37A 3G13A 3L6EA 5BXYA 4FN4A 4FYIA 4G1EB 3NPMA 4US0R 1KDOA 3DWEX 4WACA 3K09A 4QDTA 1Y82A 1WE2A 3SS8A 3CUSA 3KQVA 4P54A 3EAFA 3RSQA 4GPIB 3TQQA 2DP4E 5CVEA 1H9BA 3IEVA 1DCMA 2DPGA 4H77A 5JDCC 1JG7A 5IANA 4XW2A 3EXHC 2ONZA 3AUUA 4L5BA 1CUVA 2D0IA 1RYEA 3HNOA 4JUCA 1IHOA 5JTTA 4YP0A 3BH0A 2C7QA 3CPSA 4NDAA 1G1AA 4FOSA 1YVPA 3B9BA 3CF4G 1F4PA 2XXAB 4MRMA 4JLSA 2JB9A 3I09A 5IDWA 3BJEA 3VJRA 1DVRA 4YRLA 4H7EA 5ED4A 4L4ZA 1UXIA 4CCYB 5DSZA 4DF3A 1ZHFA 5M04A 2BZGA 4KBYA 4YJFB 1LW7A 1GNTA 2W6CX 1E3DA 2GJKA 3AEUA 1FFDA 2QR5A 3QHQA 3H3JA 3LVRE 4HDKA 4N6GA 4JNCA 5DSXA 3TTVA 4R1UA 4DYDA 3TZQA 5DHQA 5BMOA 4LDNA 2QRJA 5DZSA 1KGSA 3L0PA 4PANA 1Z7YA 4RVHA 2ZRLA 4Y6QA 3DLBA 1SK9A 4H7FA 5BPFA 1YKSA 2FPGB 3IR5A 3QU2A 4BNWA 4R8RA 1RRMA 3EUWA 1P1CA 3QKSB 2FN3A 4CODB 5DRYA 4D0GA 3V2IA 4MTCA 4PSUA 4FBGA 1GT91 3GZNA 3V8MA 2QLLA 1G20A 4BLUA 1Y0BA 1E9FA 2WJHA 3ONVA 3PR1A 4S2EA 4WXYB 3F74A 1KMNA 4XCQA 4F6RB 3BD6A 3KOOA 5CLIA 2F00A 3QVVA 5AOAA 1GFWA 4HB4A 5EMLA 5JI3E 4MV9A 1ZI8A 3E5RA 4F8EA 3QU4A 1ODSA 3V55A 4MR9B 1RHRA 5DX1A 5IYZA 1CY0A 5JNSA 2AMLA 2OCYC 3PBKA 1GTG1 5EHXA 1WCYA 5KYTA 2W48A 4FC7A 4Y1FA 2CMFA 1CRZA 1I1OA 1UXGA 3ECSA 3QEJA 4RA6B 1QKIA 1RHUA 1Z8HA 3L7JA 2VZ0A 4QIHA 5IABA 5JAPA 3MMNA 1IHYA 3H04A 5BWOA 4YP9A 2QMOA 4MI9A 5CB4F 4ACAA 4FFBA 3AUTA 3RRXA 2CLHB 6REQA 4MQLA 3FYDA 5HJEA 1ZAKA 3KPJA 4JBNA 4ZOLA 2R6HA 1GGMA 1U3CA 1VA5A 1UKZA 4MW4A 1QDLB 1Z8NA 3WB1A 4UHEA 4E30A 1DQNA 3WIBA 3OKPA 3MTJA 3ND5A 1T3ZA 2VF5X 3HA3A 4V03A 2GHRA 1FDWA 1NV9A 2CNDA 1E5LA 2C3UA 3RK4A 5JO0A 3JRWA 1VGRA 4MS3A 2OE2A 1T2DA 2B4YA 3TD2A 1X1BA 4FEEA 4R0MA 3LUGA 5B7PA 4YXWD 5FX2A 2NV2B 4LZJA 4V3BA 3QYJA 5ALUA 1YB7A 3QTTA 3F9RA 4KVZA 2ZM5A 821PA 4NECA 3QLUC 1VE1A 4EKGA 2SHKA 1T0HB 3ORYA 2AX4A 3DGFC 4IXDA 5T8KC 3H1TA 2WG1A 3PEVA 1V5EA 5C8XA 2A58A 5DEIA 1P7VA 3P9YA 4C1BA 1XNRB 3JYOA 1YDHA 1PZFA 2RGGA 3CZ9A 3KEQA 3HA7A 5LKAA 1OWMA 4IIGA 3WB9A 2P6OA 2CUKA 1YGPA 2GEJA 4RFLA 1JU9A 2X1HA 2FHSA 3H86A 5KMGB 2QX7A 4HC4A 1UDCA 3T38A 1JN0A 2ZREA 2XB4A 1K06A 3A25A 4ZMSA 1DRVA 4PPGA 4HDQB 1F6BA 4KQWA 1SQGA 5AHWA 1X92A 3D6UA 1ABBA 3A1WA 2XZOA 1VI5A 2EFEB 2ORIA 1RLTA 1DV2A 3IURA 5JC1A 5AQEA 3UAOA 4QUDA 1SUPA 2K7FA 5I8ZA 5JD5A 2X5JO 1UOEA 3HVKA 3LPLA 1EZ1A 3VKWA 2Q6OA 1PKXA 2FRDC 1LLUA 2DHRA 4YX9A 4R81A 5FJIA 4Z7NB 4KK3A 2ALJA 4P3XA 3OPYI 5HR5A 1P2BA 2WFLA 1FW8A 2CN1A 2Q0XA 2H1VA 3FGNA 4GUAA 5JASA 5LFAA 1NSTA 3WGTA 4AJOA 4LHXA 1EZ4A 4UE6A 3ZV7A 2IH4A 2OCKA 1V7ZA 2V7QD 2NTYC 2ODBA 3BFXA 2YWXA 3RSGA 3IVAA 5B1DA 1XX6A 1JFSA 1P5HA 3EYAA 4WZAE 2X6TA 1N2IA 1Z06A 2CMDA 3Q87B 1XJ5A 3DNFA 3ESYA 4RK7A 5EIFA 4Q7MB 1PU2A 2B1IA 2VS1A 1S7GA 4W9RA 4BZPA 1Y6QA 3IAAA 2X8JB 4I4IA 4B7UA 3CHYA 4ER0A 1C7JA 1QQBA 3DLIA 2UYOA 2ZYDA 2DSNA 2PU7A 3AU8A 5H70A 3S0JA 4D9EA 2XJ9A 5CB0A 3A6KA 3D8UA 3R0IA 4OXNA 1D3AA 2WVJA 3LVFO 4HVTA 2OSBA 1WDWB 1J2EA 2FFQA 1E5XA 4P58A 4R84A 3TLCA 4EZEA 2PE5A 2BEVB 4NZPA 5AW7A 2AEMA 2P62A 3DV9A 1MF7A 4QXRA 1T3SA 3ZHYA 4L9AA 1AURA 1CDDA 1NNLA 3WGHA 3EVBA 1DKLA 4YACA 3PLAE 1ODJA 5FA8A 1JXOA 5C46F 3VHRA 1FVXA 3L1KA 2GYUA 4DIEA 3ZGLA 1JEQA 5IT0A 1THMA 2FZKA 1AKRA 1Z39A 1DKUA 3H6HA 3S3TA 1KS2A 4LJAA 3ZGOA 1G55A 1UIMA 2GZSA 1XI2A 1KNXA 4IIFA 3ZQ6A 3DF9A 5K3FB 4IEIA 3A32A 5IVIA 3IUPA 4GE3A 4P4LA 3LQYA 1F5NA 4K46A 2R86A 1XCMA 3T5MA 4JEUA 4WOPA 4GL2A 1MR3F 2JAHA 1MJGM 1JVSA 4BFZA 4EAQA 3AHFA 3H9UA 1I9CA 1ULHA 3ANYB 1ISIA 4MP8A 2CCGA 2X14A 3N0WA 1GRNA 1UKAA 4Z4CA 4IW3B 5E8RA 2QTHA 3PDIA 3PUVA 3I8OA 3E2IA 1L7NA 4EJSA 1GZ5A 3E81A 5FPKA 2D0OB 3UMSA 5KX5A 1FUIA 3ZGYA 5H1YA 4KWTA 3VNAA 1ZLXA 2COKA 4MKHA 2O20A 2QRUA 4WLOA 2WUGA 3KLOA 4HGPA 4Q47A 3OPMA 1CB7A 1FS6A 4L0DA 2P0EA 1E61A 4A15A 3ZHBA 3H83A 2O23A 5B3KA 5A06A 1I3OA 4A6XA 2YHIA 4Z4GA 1A82A 3HR4A 4W9MC 5A3QA 4RH3A 4WLVA 3BMOA 1KIMA 4B6FA 1QYRA 1JBKA 1O4VA 2FKNA 3U0VA 1PGOA 2R47A 4DMUB 4P2BA 3AW8A 3VSAA 1XU4A 3P19A 4MH0R 1XKTA 4NBTA 2QW1A 1T2NA 1WMDA 3MOSA 1XTIA 2JHGA 3M70A 1I7DA 2ID7A 3D2AA 1SCUB 4FOOA 1Z07A 2ZDHA 1CERA 4QTZA 1DCFA 5EKUA 4A91A 4ER5A 2ASEA 3IKVA 3O92A 3IAXA 3FUCA 1SJ9A 3PNKA 4W5HA 4F21A 5KJ1A 2X4DA 5KYYB 1QTQA 1CEYA 4UE3S 2QVCA 4OLJA 3ZG6A 3TL3A 5EMJA 3D6HA 3EVDA 4YLEA 2YZ7A 1YK0A 4MULA 5FWNA 3VR5A 1X7ZB 1Y7PA 5AD1A 1M9NA 2BMDA 2IZ5A 2ZBQA 5HIAA 4UHKA 4F2WA 1O4WA 2GS9A 3JZIA 1R8XA 1WCV1 3M1YA 3ANTA 1CNEA 1E2NA 4YPFA 3SYLA 4EMUA 2YXNA 4NAVA 3E8XA 1PFVA 2AMVA 3IEIA 4JL8A 5K20A 4FMBB 4NARA 4XYEA 4NK5A 1C1DB