3UICA

Crystal structure of fabi, an enoyl reductase from f. tularensis, in complex with a novel and potent inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
b'GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Francisella tularensis subsp. tularensis
publication title Structural and enzymatic analyses reveal the binding mode of a novel series of Francisella tularensis enoyl reductase (FabI) inhibitors.
pubmed doi rcsb
total genus 86
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uicA00
5BNIA 2X9VA 5L4LA 1QV7A 3V2GA 2D8AA 2RAFA 1JKIA 3JQ9C 2IXAA 1Z7BA 1DC6A 3F47A 4TRMA 1H9AA 1R12A 3ZI0A 1QG6A 3NUGA 3ULKA 4YRAA 4MKRA 4BNHA 5IN4A 1WMAA 3RC7A 2NVBA 2GN6A 3FPLA 3I5MA 1T1RA 4HFMA 5CPBA 4MOWA 1RWBA 2NSDA 3CH6A 1KS9A 3KZVA 2GO1A 2X9GA 3N74A 3JQGA 1KIFA 3OJOA 4BKPA 1U7TA 4GX1A 4I9HA 2O48X 4C4OA 3GZ4A 3I6IA 5T57A 4RV9A 3DL2A 4BO2A 1F0YA 1IULA 4XJTA 5JY6A 2G5CA 1VL6A 5DNAA 1LSSA 3QVWA 1HTBA 2Y1GA 1CWUA 3DOCA 3MZ0A 4FN4A 3OA2A 1EUCA 1ONNA 1ZKMA 2V6MA 4J7XA 1P3DA 4YAIA 2WM3A 5KKCA 4W82A 3LT1A 3ZWOA 3Q2KA 3D3WA 2B83A 1N5DA 2QHXA 1HDOA 2DAPA 5FF9A 4M54A 5ES3A 1DHTA 1RYDA 4DTIA 3DBHB 4Y6SA 4EUHA 1V3VA 4J4HA 2RCYA 2O4UX 1FXSA 1LSOA 3HB4X 2Q99A 4Q3NA 5L3ZA 3U4IA 2J5RA 3GVCA 3DC2A 3IP1A 3IL2A 1ZXBA 4WE3A 3IKVA 1IB6A 3ABIA 2DKNA 1DRUA 3OQBA 2ILTA 3FI9A 4C7JA 1M66A 1JWAB 2PFGA 2H1SA 4LRSB 2BFPA 2DBQA 1M76A 2X5KO 4BMSA 2QG4A 2P5UA 5KJEA 3WICA 3AOGA 3A1NA 2DTXA 5GMOA 1E3EA 3PP8A 4B8WA 3PHJA 4CLEA 4F6CA 3WGYA 2Y1CA 3PYMA 4W9NC 1XYGA 4I5FA 1EK5A 2C5EA 3MJTA 5I7EA 5I7FA 3QLJA 1WMBA 3EZYA 4PGFA 1AXGA 1H6DA 4RQTA 4JGBA 2NQTA 1WZEA 3B1KA 4QT0A 2B5WA 5FEUA 1B3RA 3S8MA 4CR6A 1PTJA 1Z74A 4A5OA 4MINA 4LCEA 5JMPA 4B7CA 1PR9A 3WWZA 3RUIA 1WDKA 3ONEA 1J4AA 1O6ZA 5GZ3A 3GVXA 3NDIA 2H9IA 4DA9A 3GZNA 1U28A 2JCXA 3FSRA 4W7IA 2A92A 5IG2A 3VPXA 2D1YA 3JQAD 3B1JA 3RSHA 1JQBA 2RH4A 3KV3O 3K92A 3LDHA 4GQAA 2B4QA 1A4IA 2F1KA 4D0RA 3I9MA 1IOLA 4PLHA 4K6CA 4EDFA 1LEHA 1VI2A 4PG5A 1YQGA 1G1AA 4PLZA 2OUIA 3ZNOA 1ENPA 2Z1NA 3GHYA 5A4DA 4XRGA 1I3NA 4XR4A 4IDAA 4XQGA 2X8LA 3PHLA 1L7DA 1YJQA 3WIDA 2FZEA 3TJRA 2BFAA 3I9NA 1A71A 2O2YA 3EMKA 2V6FA 4WCFA 4L4XA 1B8PA 4N18A 1RPNA 1AN9A 2NNLD 3UCXA 1F17A 3Q9UA 4CUJA 1TI7A 5K6AA 4EUFA 3JQ8B 1FDSA 3O26A 4ZRMA 3H5AA 3MWEB 1DOHA 3VH4A 4JBIA 3AOEC 4R9SA 4FFNA 3E48A 4TKMA 2O50A 3SJUA 5KJ6A 3R1IA 2IYOA 3LU1A 5JCXA 3V2UA 4ZN6A 3M2PA 4XR9A 3PWZA 4KWIA 1EE9A 4D0SA 3AM4A 1T2CA 3P2YA 4XB2A 4YJDA 5ADHA 1ENOA 1ZXLA 4Q9NA 4C7KA 1QYVA 2H63A 1P1IA 1NXQA 3VTFA 4RPLA 2NUAA 5DP1A 1MFZA 2HAEA 2Q1TA 4BV8A 3RFVA 1JDJA 2O3UA 3FNFA 3RBZA 5ICMA 3PFFA 2FR8A 2X1HA 3HDQA 3PPIA 2X6TA 1B3BA 1SMKA 3RUAA 2PGDA 3VTZA 1M6WA 4IDDA 1LX6A 2ZCUA 4HP8A 4JNKA 1U7HA 1M2WA 4NIMA 5EJ2A 4E5NA 2GDZA 4YJGB 3MJCA 4E6PA 2O3SA 2WEKA 4TZTA 1W6UA 2WJPA 5COAA 3K9QO 1JAXA 4CM9A 1ORRA 1KC3A 2B4TO 2RH8A 3NT5A 3RCBA 4AFNA 4AVYA 4FFOA 2DBZA 3FNEA 3DWFA 1WW8A 2NADA 1ZK0A 3VVCA 4MVJG 3DMYA 3JD4A 1TT5B 4R5HA 1FDWA 3SC6A 1E5QA 2P2SA 4D3FA 1ISJA 2ET6A 3PGXA 2HKIA 2ZTMA 3K2EA 4NJMB 4YQYA 2Q45A 5IDQA 1YB1A 4ND3A 3ROKA 4GMGA 2QRLA 3N7UA 3RKRA 3SX2A 3VVBA 4Y98A 1SAYA 1HKUA 3KVOA 4WNCA 5GY7A 1SCUA 2HMVA 2YDYA 3PHGA 1YB4A 2I99A 2E4AA 6LDHA 1O5IA 4BMVA 3GN2A 3BTUA 1ZFNA 1KEVA 1UDBA 1VKNA 4WASA 4E5YA 1Y81A 4L74A 4CMKA 5CDTA 2RBEA 1O8CA 4YJHA 5H82A 3JYNA 1RM5A 1X1EA 4DYDA 3T4EA 1OFGA 4QXMA 2V65A 3PIIA 2VZ9A 4RO0A 4DMLA 5BSGA 2O7SA 2WD8A 3L77A 3FBTA 4WECA 3WBBA 4PRKA 3ZWBA 4DYVA 1UP7A 3L6OO 1ISIA 2IZ1A 4RZHA 2JCVA 1LLUA 3KEOA 5AOVA 3INRA 2HMUA 3PEFA 3F3SA 1MG5A 2WYWA 4J0EA 3HHPA 2QRJA 3LLSA 4FFPA 4YJGA 1WDMA 2AHRA 4IIVA 1LUAA 4HADA 3PI7A 1ZSVA 3GEMA 2HRBA 2UV8A 3EAGA 3GDOA 1BVUA 4RORA 3TZ6A 5A02A 4PG4A 3EK2A 1PQUA 4J90A 4IIUA 2GN4A 1DEHA 4BIIA 1T2AA 4IXWA 2HLPA 4BO3A 2CY0A 3L6EA 2LDXA 1DC4A 1GL3A 3H9EO 4D46A 2V7PA 5BT9A 4E5KA 2VYVD 1PJ3A 3OJEA 4R54A 1YKFA 1GEEA 5DF1A 3RUFA 1MUUA 3BTSA 4K1LA 3PZRA 2PWZA 1YO6A 2JFGA 4DIBA 3F9IA 1CIVA 1K5HA 3UH1A 3VHRA 5H83A 3BAZA 3FR8A 3ZNNA 3IUSA 1R6DA 1IHXA 1EE2A 1LDNA 3VH1A 5A3JA 1N7HA 4EEZA 3ZV3A 2OZPA 4J3FA 3HSKA 3BIOA 5F21A 1AHIA 1VC2A 3ETDA 1NR7A 5CDYA 3INGA 4HKTA 1MA0A 2OFPA 1E7SA 2ZYGA 4JROA 4AJEA 1V0JA 1P77A 1VJ1A 3EC7A 3M1LA 1X1TA 1UR5A 3QVTA 4RF4A 4XYMA 5A1TA 2Y93A 5U1PA 1YXMA 1I2CA 1ARZA 4HV4A 4QQRA 3FNHA 1NNUA 1NBOA 1YRLA 5DP2A 3W4KA 4K28A 1JVBA 1XIVA 3GUCA 2E6UX 1O89A 1UUFA 1B8UA 5KKAA 1PZEA 1XA0A 1UZLA 3BMOB 3IMFA 1QP8A 3RAJA 2IEBA 3VDQA 1DFHA 1SB9A 5JMWA 3IJPA 1ONPA 5LCXA 3Q2IA 5DDIP 2OO5A 2JFFA 3ZN2A 4PZCA 5G0SA 1DC5A 5I9NA 4FC6A 1WDLA 2GZ2A 4XDZA 4CM4A 5IF3A 2C59A 3I4CA 4HWKA 4II2A 4I5DA 4YAGA 1T1SA 3PHIA 4EYEA 3UN1A 4L75A 4B3IA 2ZB7A 5B1YA 1BXZA 1E7RA 3QA9A 4DUPA 1P0FA 4B4OA 3ROMA 1YQDA 2IXBA 4D41A 1EEHA 2DBRA 5CEFA 4XIJA 3K73O 5F5LA 4I9UA 3PJEA 3OMLA 3JQAB 2D5CA 1YL7A 1XHLA 1YWGO 4BNMA 3GRPA 5B4VA 4ESOA 2HMTA 3CZMA 5DBFA 3WMWA 4DWVA 1VSVA 3GY0A 4DBVO 1ZUD1 5JSFA 1Q7CA 2VTEA 4UEKA 3H65A 4MVJH 2GYYA 2I65A 4KDFA 4HNHA 5JAMA 3FN4A 4U0JA 3RQSA 5IZCC 1LXCA 3VKVA 4BO5A 3JSAA 4CV2A 1ULUA 2ZJ1A 4EGFA 1QMGA 5HS6A 5TIIA 2NLOA 2WYVA 3CTMA 4YDRA 1U4SA 5A03A 1WXDA 4ITUA 3F4LA 4IXTA 4NK5A 4NU5A 1NVGA 1ISMA 2BMAA 4Z3DA 2X23A 2B0JA 2HRZA 3C3XA 4Z9FA 4YT4A 2PZLA 4ZQGA 4II3A 1K89A 3TZCA 5DBGA 1F8GA 1ONOA 3LC2O 4RLHA 1GR0A 2TMGA 4WK6A 3EUWA 3LC7O 5FYDA 2OMEA 5ER6A 1PGQA 2VYNA 1FDVA 3PVZA 2A35A 4I5EA 1Z82A 3GEDA 2OP0A 3NT4A 5MDHA 1ADCA 3LLVA 5JDCC 1WP4A 1ZBQA 2VUTA 4ZHSA 3QY9A 2Y1DA 4J7CA 1UXIA 4AJLA 3JQEA 4CLDA 5CAEA 5JC8A 2O2SA 1JAYA 3EVTA 2J5QA 2AEMA 2XPCA 4WOKA 4PLVA 3F5QA 1PGNA 2CF5A 3U09A 4HFNA 3DAPA 3V2HA 2QQ5A 2C29D 1PZHA 4H15A 3FRJA 1BW9A 3V1TC 3ST7A 5DZSA 4J9UE 1HLPA 1F14A 2PNFA 3MTGA 4XDYA 2I5PO 2VOEA 4K6FA 2PH5A 5A05A 2YQ5A 4BO0A 4GGOA 1A9ZA 1KY5A 4QTZA 4ALLA 3I3OA 4OJNA 5EQFA 2D3TA 1Z7EA 4BNYA 1CETA 3K6JA 1H94A 3BMCB 1Z6ZA 5DT9A 3KM0A 1BSVA 1UJMA 3H9QA 1PQWA 3JQ7A 4ND2A 2E82A 4KP7A 1DC3A 3H7AA 2EHDA 4FR5A 5T5QA 4LVUA 1PX0A 1E7QA 1ID1A 1O94A 3IS3A 4DPMA 4IJUA 4J2HA 3WR5A 5A9SA 3NDJA 3PK0A 3C8MA 1Q2XA 5AXAA 4YQZA 1XDWA 1MX3A 3CMCO 3MJEA 1BGVA 3DB2A 2P4HX 2I66A 4Z3KA 1MXFA 1PJ4A 4ND4A 5F1KA 2VNSA 4OQYA 4PRLA 2YV3A 4BVAA 5A06A 4P8RA 2EJWA 4S1VA 4G2NA 3E9QA 4MO2A 2BHLA 4I1IA 4YRDA 1EBUA 2GR9A 3D1LA 2Z5LA 2VHWA 5ILOA 4CLRB 3D64A 4RLSA 1U2GA 3EHEA 3PYXA 4HY3A 1MC5A 1NHGA 3TDKA 4DRYA 1ADFA 4J4BA 4AJIA 1NFQA 2VN8A 5EIOA 1KEWA 2J3JA 3I4FA 1EUDA 4EEXA 2VHYA 4E33A 1BTOA 4A03A 4LGVA 1YL6A 3SLGA 5EPOA 2Q4BA 3ANLA 4E30A 1NPYA 3H9UA 5THQA 3KOUA 4CM3A 3ZWYA 1K2WA 1ZMTA 3GN1A 1VL0A 1ZK4A 4ZD6A 2G17A 2C2YA 1PJQA 1WNTA 2EGHA 4QUKA 2CZCA 3QP9A 1EDZA 4Q39A 4BO8A 4DC1A 3DHEA 5BSHA 1JW9B 1F06A 3WGQA 1MB4A 1J49A 3CXRA 2R00C 3HE3A 3JYOA 2Y0EA 3FR7A 1LLDA 3C85A 1D7OA 2VYND 3Q1LA 2GASA 1LA2A 4M49A 4D45A 2OHXA 4FFRA 3OEWA 1XSEA 4RVHA 3D5QA 3Q0EA 4RPHA 4TZKA 3GGOA 4XIYA 4BKRA 3JQ7B 3WMXA 1GUYA 3K8ZA 2W2LD 3NTOA 2VWPA 4GWGA 3E03A 1I32A 3ZU4A 4CV1A 1XWFA 3E5RA 5F5NA 1NM5A 5IZ4A 4DPLA 4CV3A 2FPPA 3NRCA 3RWBA 3WWYA 1IPFA 3PWKA 3PJDA 5JPIA 3ZU3A 3RFTA 3ZZNA 4OAQA 3RVDA 4YT8A 2Q2VA 1D8AA 3JQAA 1HSOA 2X9NA 5CEEA 3CKYA 3VH2A 3IP3A 2VRBA 3V1YA 2B37A 2PR2A 4NJOA 1V3TA 5TF4A 4CQMD 5DBIA 1CDOA 1IUKA 4W6ZA 3NDRA 1LC0A 4KDEA 4TRRA 2ZCVA 1B14A 4PLTA 1UP4A 2FHSA 1NQ5A 4NI5A 1KVSA 3A9WA 4IS3A 4OM8A 2ZTVA 1C14A 3IDSA 1I8TA 2PY6A 3JQBA 5AYVA 4EJ6A 1YBMA 1Y6JA 1KBZA 2X0IA 1R66A 2ZIZA 4RVSA 2DQ4A 2GUGA 1H2HA 4MIYA 1H6CA 4YAJA 3WSWA 2QW8A 4U7WA 3F1KA 1GAEO 5TT1A 1YBAA 4HUJA 1P45A 5CG2A 3JYQA 2X0NA 4ZU3A 2AG5A 2AA3A 2BGLA 4FJ2A 3VH3A 4R69A 4OMUA 3M1AA 4B3JA 5L40A 4WLEA 3TSCA 2RHRA 3AY6A 3OEYA 1GUFA 1PS0A 4R16A 2ZB3A 3K5PA 1DFIA 1P1KA 3WGOA 4DQUA 4JX8A 2WD7B 4NBTA 1T4BA 1DAPA 1XQ6A 3QWIA 5A9RA 1ZK3A 4XWYA 1F12A 1XEAA 1AHHA 4AJKA 1OBFO 4MKZA 2NM0A 2OOSA 2DU8A 2W8ZA 2YZ7A 1YONA 3GDGA 3KLMX 4JJFA 1HLDA 1PJBA 5C7OO 3WFIA 3WSVA 4YRBA 8LDHA 3NTRA 2CNBA 4BNJA 3QWFA 4HFRA 2HMWA 3VPSA 4OYRA 3HDJA 2CVOA 4FFMA 5B12A 1G0NA 2IYPA 3P2OA 4JP2A 5G4KB 3HDYA 1Y8RA 5JO9A 1HEUA 4NNJA 2YFQA 1DFGA 3ZWPA 3AOEA 1G6KA 4CLOA 5KJ1A 1XQ1A 3TOXA 4XCVA 3S2GA 3ENKA 5C3MA 2ZQYA 4OSPA 3EDMA 4YACA 1PGOA 4BO4A 1E1MA 5A9SB 3OIGA 1DLIA 2BI8A 1RM4A 3KSUA 4R01A 5EQDA 3ROPA 4YPOA 2CMDA 4P4LA 4BQRA 3H9JA 1Y1PA 1SNYA 2WTBA 4AL4A 4BL5A 1VJ0A 5I8WA 1H93A 2Q1UA 4ZJUA 2NVWA 1BXGA 1KVQA 3I6QA 2UUOA 3GNTA 1CEQA 4M86A 5TJHA 3DBLA 1HETA 2Q4EA 3H2SA 4D3SA 2QYTA 1PL6A 3GGPA 3M6IA 3R0IA 4M8SA 1A27A 1QXSA 3DZGA 1HYHA 3INTA 2FRDA 1BXKA 4J16A 2X5JO 4BO7A 3HADA 4AJHA 5KTKA 3AWDA 4DLBA 5C37A 1M6HA 4WKGA 1MXHA 2AE1A 4OL9A 2JD0A 4W4TA 3L6DA 4FW8A 4JXKA 2J3KA 4WLVA 4X54A 1HZJA 4BO1A 2YV2A 4BNTA 1HL3A 4RPGA 3RU7A 2O3TA 4N5MA 2DLDA 4RF3A 3PQEA 4JLWA 3TN7A 2GGSA 1BDMA 1C1XA 4U6QA 5JBIA 3GT0A 4KUGA 1YDWA 1P0CA 4OH1A 1IPEA 3W8EA 3LK7A 4AJPA 2ZK7A 5CEJA 2V6GA 2FP4A 3PTZA 2Z1MA 1NTOA 4MP6A 4QEDA 3U9LA 1SO8A 3AY7A 3QWBA 2I3GA 3WXBA 4YYZA 3LZ6A 2FN7A 1SOWA 4IMRA 5G0UA 3N58A 3BMQB 4CL3A 4GX5A 4Z9XA 4TQGA 2JD2A 1LSUA 3TNLA 4DVJA 3UFXA 3MOGA 3DMTA 4IDFA 3BA1A 4CMCA 4B8ZA 1FK8A 3H4VA 1PS9A 1DHRA 4LVCA 4IMPA 2I67A 1HYEA 3GLQA 4IQ0A 2DFVA 4ALJA 4GLLA 1HDGO 3VPHA 3IIEA 3MEQA 5L4SA 4FGSA 1LRJA 1BVRA 1Y8RB 4TVBA 5KIAA 3HG7A 4FIZA 4ONEA 1Z75A 3RJ5A 3DZIA 1IZ0A 3GMDA 1YE3A 2A9FA 4WEOA 4GVXA 2YV1A 4S3MA 4BB6A 8ADHA 4IINA 5IDXA 3F6YA 4D42A 4D3DA 5T67A 2D2IA 5F1PA 5CFZA 4NDNE 2YJZA 2ZYAA 4W7HA 2EWMA 3FCOA 3AI3A 3GOHA 4YAEA 5HWSA 2FPGA 4URFA 4XGIA 4ZQFA 4R1NA 1Q0LA 3PHHA 1FDTA 3ICCA 4ZQEA 5EESA 3UW3A 3D7LA 2O3JA 3AFMA 2CDAA 3DBLB 4M55A 2D5AA 5F1OA 1GYRA 1P33A 2ZTLA 2C7GA 4XJSA 2PZKA 2WSBA 3WYBA 4MVJI 5JAZA 2VT3A 3KYDA 4GH5A 1VPDA 1I10A 1FDUA 1E7YA 4XB1A 1B26A 3VZPA 2FR0A 2Y0DA 1NFRA 4IPTA 1MG0A 3GQVA 2B69A 1HDZA 2Q50A 4H3VA 2YHIA 3VPGA 3GVPA 1A72A 1PR3A 2Y1FA 3G17A 1Y8QA 4FD3A 3DOJA 3T4XA 3H3JA 4XYEA 1JA9A 1X7DA 5F3RA 5KJCA 4E5MA 2VTDA 2X22A 1T25A 1ZJZA 3EYWA 3OJLA 4BMNA 4CMBA 2EKLA 2ZB8A 1R4MB 3DZKA 3GDFA 5AXCA 3QIVA 4E13A 5G2OA 3ANNA 3L07A 4WLFA 2FSSA 4NU6A 1SEVA 2G76A 1JN0A 1DPGA 1HWYA 2W2KA 3WYCA 2EP7A 4GMFA 4YR9A 3QQPA 2FZWA 2QZ9A 1DIHA 2Y1OA 1MV8A 1BDBA 3F1LA 3S2EA 1GQYA 4J9VA 5DCUA 3LT0A 1LDBA 1Z45A 4CL8A 1GV1A 4L8VA 3BMNB 3C7DB 2WWRA 2NTVA 2HK7A 4NK4A 2PA3A 4PLCA 2AXQA 1NYTA 2EIHA 4CMEC 4LW8A 1YB5A 2V6BA 2ZQZA 3KO8A 1V9LA 1EMDA 4FJ1A 4A27A 4O59O 1PGJA 2Y66A 1C0PA 4PZDA 4E2WA 3AK4A 1GPJA 3B1FA 5FI3A 1WLYA 3DZJA 1P9LA 4XYBA 3D3WB 1K3TA 3ITKA 1L7EA 1W73A 4AICA 4OXKA 1GU7A 2VWQA 2GERA 2P91A 4A2CA 1U3VA 3AM5A 4B3HA 1GPDG 1SC6A 1GTMA 4RVFA 4H7PA 3BTVA 4RDHA 1GV0A 2CDBA 5GZ6A 3G3EA 3A06A 3WYEA 1VKOA 4BNFA 5CDGA 5ICSA 4YJFA 3IAHA 1R4NB 1K6XA 4RVGA 5FFFA 2DVMA 2BD0A 1R4MA 5TGDA 1BWSA 4ROSA 4NBUA 3L9WA 5CG1A 1R0SA 4ILKA 3D5TA 4TWRA 1G0OA 1E77A 3WNQA 1N9GA 1X14A 4QO8A 3AY3A 5T6BA 4P22A 2EG9A 3HN2A 3DBHA 1ENYA 4A10A 1E6WA 3SXPA 5K0ZA 1E6UA 3C1TA 1JKFA 4FJ0A 4GKVA 3TPCA 4EW6A 1E3WB 4JBGA 4BGEA 4GSLA 4B7XA 1GEGA 1MP0A 2I3AA 1ADBA 3FF4A 4J2OA 2AQIA 4MJLA 2JHFA 1BW9B 3ZWMA 3KLPX 2PK3A 3KSZO 3FNGA 4PZEA 4A26A 3HDHA 4BHTA 2R2GA 4IJKA 3P19A 1U5AA 5EMHA 3NJ8A 4WGGA 1NWCA 3NEPX 3OHSX 5KWEA 2X86A 4DIFA 2W2KB 2R6JA 2ZKLA 1TLTA 3UKOA 4UVHA 2QX7A 2HSDA 3ZU2A 1XKQA 1UH5A 3DO5A 3JYLA 3O03A 4GAEA 1PJTA 4AJ1A 4PVDA 4LK3A 1UXGA 2HO5A 1NFFA 1NHWA 1HXHA 4KMSA 1ZW1A 4KQWA 1EK6A 3IQDB 2BFOA 5HBRA 3NAQA 1XU9A 3WS7A 4IM7A 4TVOA 4B79A 1XR3A 1BG6A 3X2FA 1I24A 3K96A 3WJ7A 2XOXA 3E82A 3S2FA 3UGKA 3WLEA 4CQLA 5BSFA 1AGNA 3KBOA 1B7GO 7MDHA 4CM8A 1QV6A 1Y8QB 3HUDA 4WLUA 2Y1EA 3PWSA 2GN8A 1OC2A 2Z95A 3OSUA 1HE2A 1DRWA 1TT5A 2PGJA 1TT7A 3DHYA 4Q3CA 3ZW8A 4BNVA 4IJWA 2Q1WA 1X13A 2PKQO 1HE3A 3ORFA 3QWHA 4XQCA 2XXBA 4BKQA 1DBVO 1ML3A 2JHGA 3GR6A 3Q3CA 3RFXA 5C7LO 1LDMA 5JFOA 1ADGA 1Q0QA 1SZJG 3CSDA 4XGKA 1GD1O 1ZEJA 3LVFO 3QHAA 1QYWA 3A14A 4KTTE 4TRNA 3PLNA 3H3FA 4IDGA 3L4BC 2ZATA 3SLKA 5ENDA 1DIGA 2QIOA 2OXIA 4QFCA 2A94A 1GUZA 3WGTA 1KYQA 1EFKA 3RKUA 1PQPA 1DIRA 1DLJA 4O6VA 3GG2A 4CM6A 1YS4A 4FOOA 2B5VA 3NTQA 1XG5A 5B4UA 4E2ZA 4FCCA 3JQFA 1V35A 5JCJD 3OF2A 4DBZA 1U3UA 1HRDA 1CJCA 1LJ8A 3JTMA 1FJHA 4NH4A 1AE1A 4XRRA 5A3VA 2POQX 3ZV4A 3ZWNA 3ZWAA 2AQ8A 2AQKA 3O38A 4XEHA 3DAGA 5L7TA 4WEQA 2P9CA 3CEAA 1LDEA 3DQPA 3QRWA 3DZFA 5TC4A 3KB6A 1QLHA 5G4LA 4J49A 4AJNA 2Q2QA 1ISHA 2P5YA 5A5EA 4W9NA 1ZVMA 3CPSA 4CM1A 2X5OA 1I33A 4R3WA 2PZJA 3AI2A 5TX7A 1LSJA 2DM6A 1JVSA 2AW5A 4R9RA 3A4VA 5JAIA 3PDJA 3CZRA 3PQDA 3NGXA 3I9LA 4G81A 2IZ0A 1GYQA 2NACA 5U4QA 3GPIA 5JE8A 4AJ4A 2HU2A 2JCYA 4IY1A 4OOFA 4NFHA 3RUEA 3W1VA 3TL3A 4UUNA 1E3JA 2DUUA 3B20A 5G0WA 1EVIA 1IE3A 3UUWA 3BMOA 5JXWA 4MKXA 4IS2A 4KUHA 1R0LA 3WJAA 1U8XX 4NFSA 3ADOA 1ULSA 1R16A 1WZIA 1BHSA 1P44A 4XKJA 1DDOA 3CINA 1IY8A 5IJZA 4CJXA 3TF5A 1PS8A 3SEFA 2JL1A 3PZBA 1E7MA 2OL4A 4G5HA 1UP6A 4WJZA 1S6YA 3RBXA 3RU9A 2W90A 5EINA 5DOZA 2NU7A 3U62A 4A73A 4OKIA 3UF0A 4YJFB 2Q49A 4NHEA 3LC1O 2Y99A 2GLXA 4JK3A 4M89A 3KHUA 1VRWA 2AG8A 3E9NA 3SBOA 3OICA 3WQQA 3B6ZA 4E21A 1RJWA 1EFLA 1T2DA 4L76A 4TROA 5JC1A 3TOZA 2NWQA 4M87A 4MVJE 1H9BA 2BFMA 4YCAA 4BNLA 2P68A 3C1OA 1NAHA 3FHLA 1PJSA 4AJJA 3WGGA 3JD0A 2DC1A 3QSGA 5ITWA 3E9MA 4U5QA 3V5NA 5B37A 4TKLA 1VE9A 1FMCA 2RHCA 1IHYA 3OETA 2CFCA 2J3IA 3KYCB 2ZYDA 3ONDA 1OI7A 3JQFC 4CPDA 4RPKA 4L0QA 5CHEA 3VZQA 4BNZA 2ZTUA 2GRAA 3ZV5A 5MGBA 4F3YA 2QYSA 2YQ4A 1R4NA 4JBHA 1LLQA 2CDCA 4QO7A 1J5PA 1S7CA 3AUUA 3WIEA 2E49A 1WAMA 2VYVA 3T7CA 3W6ZA 4HNGA 1VJTA 4NBWA 1KVTA 3TRIA 1NQTA 2B4RO 1QR6A 2PTGA 4CMJA 5I8ZA 3L0DA 1PL8A 1P1HA 2JAPA 3JQ8A 4PG6A 4KQXA 4CM9D 4ZGWA 4KOAA 4LRTB 1PZFA 2VUUA 3LQFA 5L45A 1TB4A 2YY7A 3RI3A 3JQBC 2IDZA 5KOIA 1JLLA 1HZZA 3JCZA 3K31A 5HS4A 1PL7A 4YTEA 1SOVA 3P5SA 4JIGA 2P9GA 2D4AA 2UDPA 3FTNA 4BNNA 1NVMB 4Q3EA 4IZHA 1VLLA 3D4OA 5KVSA 4WCFB 4E2YA 1UDCA 3BMNA 4GX2A 4YXFA 5KJFA 1KVUA 2BKAA 4DPKA 1W8DA 2IODA 4MIOA 3LYLA 4O1MA 5C7IO 1E3LA 4YWJA 4JCOA 4E12A 4XZ3A 4LISA 5CP8A 3TQHA 3E18A 4UVDA 1KERA 3JYPA 1K0UA 1PSDA 2G0TA 1XLTA 3QJ5A 3STHA 2C07A 3WGZA 3I9JA 4NBRA 4CMGA 1B2LA 4GX0A 2NU6A 4JJIA 1U1IA 4UEJA 1C0IA 2B35A 2PD3A 2XF8A 4PVCA 4CQMA 4WLNA 3C1AA 1A7KA 4ZVVA 3WDSA 3WQRA 2HQ1A 4FPXA 4W99A 5LDHA 3TWOA 1CRWG 4YEDA 3RJ9A 5AXDA 1EQUA 3BYZA 3GVHA 3LF2A 3AUSA 3FBGA 4DXHA 5J23A 1A5ZA 5TNXA 1H0KA 3L4SO 3BHJA 1M67A 1HDCA 1F8FA 3VOSA 1PJ2A 4B4VA 4J7UA 4UAGA 3D0OA 3ZNPA 2CVQA 2UAGA 1O9BA 2HJRA 4AJOA 3I1JA 4BOYA 5IDWA 1ZNQO 1OAAA 2GZ3A 1TEHA 4CLHA 3ZH2A 1PGPA 4E31A 4R68A 3U4HA 1B8VA 3H9GA 1I3MA 3JD1A 4U0KA 5JAQA 2EV9A 4HFJA 4WOJA 4WUVA 1FF9A 4ALIA 1E3SA 1E3WA 2Y68A 4QSMA 1C1DA 4NBVA 1LQTA 4RZIA 4XQ9A 1D1TA 3VC7A 1SPXA 3ETEA 4KUEA 4XGNA 3DOOA 2C54A 2PH3A 1GYPA 4E0BA 1NVTA 1GZ4A 4RCVA 4UREA 5L4NA 4RQUA 2OBNA 1P1FA 1EDOA 1DAOA 2VRCD 1Y5MA 2Y05A 2E37A 1L1FA 4R3NA 1NPTO 4MVJA 3UAGA 2YDXA 3ZU5A 3ZW9A 3G79A 5A5FA 4DQXA 5KNLA 1YBVA 1Z73A 2GCGA 3HB5X 5HM8A 2Q3EA 3BMQA 3HQ4O 2EF1A 5JYEA 1WPQA 4OGWA 5IXYA 1RYEA 4N5NA 4EI2A 1EVJA 4YJHB 1QYCA 2FR1A 1VSUA 5L9AA 4MVJM 3ZWXA 2WMDA 1OZAA 4GKBA 1KEUA 4HXYA 5CDSA 4PFJA 2FWMX 1DB3A 1LI4A 4CM4B 3DBRB 2C0CA 3IJRA 1N7GA 5EERA 2UVDA 1KC1A 4A0SA 2VWHA 4R1SA 3AFNA 3SJ7A 4CLRA 4HBGA 4UVGA 1N1GA 4OHUA 2TMDA 3GRKA 4BNWA 1V8BA 1ZK1A 3DTTA 1R37A 1I3LA 3E6AA 4ND1A 5AXBA 2X7HA 3PDUA 3F5SA 1T26A 4Z0HO 5I7VA 5AQ1A 3JQCA 2PD4A 4EJMA 1GCUA 1CQJA 2DTDA 1E0DA 4TSKA 1GQQA 3IUPA 4B7UA 5FWNA 3AI1A 5I9LA 1LDYA 3AJRA 3BTOA 3DFZA 3I9KA 1CQIA 4FB5A 4FSHA 4P38A 2BF7A 5JDIA 4NR0A 3NYWA 1UZMA 1JWBB 5LC1A 1BXGB 4YT5A 3OP4A 4E4YA 5CPFA 1Y7TA 3QE3A 4CMHA 5GZ1A 2OBYA 3TFQA 3JQDA 3BZUA 3VKUA 3ZHYA 3OA0A 2PD6A 4GWKA 3UVEA 2EERA 1GCOA 2DBVO 2HMSA 2O3RA 4EJ0A 5FI5A 4XD2A 3GPDG 4IUYA 3LSYA 2G82A 1JTVA 3A28A 4CUZA 1DRVA 5BR7A 1HF3A 4Y67A 4YA6A 3E5MA 4N7RA 2VCYA 4IGFA 2RIRA 4FQ8A 5BNFA 3CIFA 3CUKA 3G1UA 4YT2A 2BGMA 2D0IA 3FWNA 5A04A 5JNLA 1MFPA 1QKIA 2AEFA 2FMUA 3VZSA 2J5KA 4WLOA 3KETA 4J6FA 3I23A 2DPGA 5I9MA 4BNGA 3ICPA 4R5MA 3SVTA 3K30A 4Y6PA 2X4GA 4IBOA 2UUPA 1E6EA 3JD3A 4GBJA 1DJQA 3BHIA 1YVEI 3HNPA 3WOHA 1B0AA 4AG3A 1V3UA 2BRUA 1N2SA 4I08A 3WTBA 4BKUA 3U4CA 4FOSA 3UCFA 5CDUA 5IAAA 4IGEA 2EKPA 2C82A 1I0ZA 4MPDA 2BGKA 3PFWO 3OIFA 4IQ8A 5C5IA 4EZBA 2PLAA 3OH8A 4PLGA 5K9ZA 1NWHA 3ZDFA 3AM3A 2O3QA 3R6DA 1W4ZA 1N1EA 3ZNQA 1KY4A 2Y67A 2BELA 3C7AA 4IZIA 1ZMOA 1B16A 1P1JA 2I76A 2WDZA 1DO8A 2HK8A 3MJVA 1GFSA 3PGJA 4EUEA 4XX0A 3DZBA 3TZKA 2GNAA 3AUTA 2PV7A 2VRCA 1I01A 3H5NA 4TRJA 4ZRNA 4DMMA 1HYGA 4DREA 3ZHXA 2CD9A 5DCWA 1QRRA 3WLFA 4XYLA 4AJ2A 3FTPA 1QORA 3ANMA 3HFGA 1JU9A 1O95A 3WG9A 1CF2O 2AMFA 3GAZA 1V6AA 4OIMA 2IEDA 4ALKA 3OBBA 1H6BA 3PJFA 1ZH8A 4O5OA 3RROA 5L51A 1NQOA 3FD8A 1R0KA 5U9CA 2Q46A 4Z6KA 3O8QB 1UAGA 1GQ2A 3DMTC 4L73A 5BNTA 4R51A 3FWZA 3ZCXA 3ON5A 4NMHA 4F46A 3OECA 3DZHA 3I52A 3OJ0A 4OXYA 2EXXA 4HX5A 4UVIA 5KVQA 1EUZA 2BI7A 1ENZA 4DIOA 1GZ6A 3C7CB 4D79A 4UUMA 3O9ZA 3U49A 3I9OA 3GMSA 4CODB 3GK3A 2CSUA 2FSVA 5JW6A 2A4KA 5ITVA 1M75A 4IQGA 3DTYA 4J1SA 4LMRA 2EW2A 4DC0A 1MLDA 1ZO8A 4ALMA 1E5LA 1E92A 4K26A 3R3JA 5A9TA 4BNUA 4RF5A 1H6AA 4D44A 3GF4A 4IDCA 3H5RA 1TVEA 4E3ZA 3V1UA 4RJTA 2IZZA 2ZB4A 1I2ZA 4NFYA 1U9JA 3F4BA 4J1NA 3MJSA 3EY4A 5TRTA 5I7SA 5ER9A 1AXEA 4GGPA 1ZSYA 2FOIA 3T7EA 3PJGA 1LQUA 3OIDA 5THKA 4OKNA 1Y9AA 4GPD1 4CMIA 3ZWCA 4BV9A 1PJLA 4A7PA 2EEZA 4Y8VA 3V8BA 5HRUA 1I30A 1K6IA 4PLFA 2AQHA 3IKTA 3PYLA 1N92A 2EGGA 2YW9A 5IXSA 5JCJA 1I5RA 4U6SA 5KCZA 3GAFA 1W0CA 4CQMB 4DL9A 3RD5A 3G49A 2O7QA 3G1TA 2NTNA 4CLXA 1Q1NA 2DUWA 2Y0CA 3BMCA 1E1LA 1RKXA 3PIDA 1JKJA 2NVUA 9LDBA 2XXJA 3IOYA 3NGLA 3RC1A 5BSEA 4ID9A 1A4UA 1HE4A 4D7AA 4MVJF 3KEQA 4PLPA 1LTHR 3GVIA 4TMFA 1YOVA 4JQCA 1HDXA 1LDGA 4G65A 1U4OA 1YQXA 2YHIB 3RUCA 3B70A 4QFDA 2PKQP 1WVGA 2EP5A 5KVVA 1ISFA 1YDEA 1ZEMA 2JKVA 4U8GA 1WWKA 5IDYA 1ZCJA 2ZJ0A 3HJAA 3RUHA 1PU2A 2YHUA 2J3HA 3QWAA 1EBFA 3H8VA 3QVXA 4Y6RA 4UUPA 1U3WA 2HDHA 3DBVO 1TA4A 5DULA 5T8KA 4F45A 3ONFA 3RC9A 4EITA 2QZZA 1ZZEA 3JQGB 4OQZA 1D3AA 1IYZA 3OQ6A 5LDGA 2IE0A 3P7MA 1X7HA 2QRKA 1NX6A 5BQFA 3L9XA 3HFSA 1K6JA 3C24A 4OSOA 3DXFA 1NAIA 5AVOA 5G0TA 3CMMA 2EKQA 3KTDA 3DFUA 4IJVA 3R3SA 1R15A 4IDEA 3GC6A 4CV0A 3DR3A 3DHNA 1C0KA 4BGUA 2OP1A 2I6TA 1DJNA 4NG5A 4O63O 4PLYA 4J4TA 2C2XA 2DPHA 4EBFA 3WX0A 3KYCA 4B4WA 4ZQHA 1ZIDA 3WNVA 4KZPA 4RL6A 3E1KA 1MGOA 2YUTA 3DAFA 3KYDB 4E32A 3QVSA 3W8FA 4ZICA 2VNAA 4BNIA 4RVUA 4Z0PA 3TZHA 4RVDA 4NQZA 5ILGA 1CYDA 2DT5A 3UXYA 1MC4A 5H81A 3QVOA 3UOGA 1KVRA 1OC4A 4Y9DA 4CMAA 1LRKA 3HN7A 3EW7A 4K9DA 3RASA 1OMOA 2OGUA 3GG9A 4YVFA 3MOIA 4UULA 1LLCA 4LN1A 4CR8A 1UXJA 2VHZA 4XQEA 2JD1A 2W2LA 3HWRA 4BQPA 4RF2A 3NV9A 3W4IA 1Q7GA 4MVJP 2R00A 1DXYA 3AU8A 1LBEA 2VHXA 1SEPA 2EJVA 2YFHA 4PG8A 1DIBA 4CMEA 3GHHA 1HDRA 4O0LA 4P4GA 4CM7A 2XAAA 1NR1A 4WNIA 4Q3DA 2HJSA 1J6UA 4JP3A 3OM9A 4MIEA 3S55A 1EVZA 5DCYA 1GZ3A 5JS6A 1E3IA 3GFBA 1XGKA 4RDIA 4XYGA 1Q0HA 3MJ4A 2FPIA 1P1RA 2FY8A 3Q6IA 3ZV6A 1B15A 2VUSA 3I83A 3QV1A 2Q1SA 2JFHA 4INAA 5TJ9A 3WGHA 1I2BA 1ISGA 3FPCA 4CMIB 3H2ZA 4Z9YA 3VAZA 4BGIA 3GNQA 3OJFA 3AU9A 5TS3A 4J91A 1EQ2A 1NQAO 3IC5A 2CF6A 4KWHA 3NX4A 2PGLA 3BXXA 2DTEA 3ZWWA 2GN9A 3GZNB 4JJGA 1PWXA 3L4BA 3U3XA 1NPDA 4J1TA 4L9RA 2GD1O 2J6IA 2AEJA 4GLOA 4N5LA 4QECA 3WTCA 4LSWA 3D3EA 3F46A 2VT2A 3X2EA 5HA5A 2GSDA 1TXGA 4GVLA 3ZWVA 3RC2A 4R1TA 4D43A 4BO6A 2BH9A 3Q9NA 4NPCA 3ZGYA 2F00A 3MCVA 2P9EA 2UYYA 1T2EA 4Z0TA 2AE2A 3ETGA 4CLOB 2H5LA 3WQSB 1E1NA 4CM5A 5COBA 3U0BA 4CR7A 3LT4A 2Q2WA 3NT2A 4M1QA 1P74A 1BMDA 4RGBA 1A9YA 2HK9A 3KSDO 4L4SA 4MDHA 1QSGA 1X0XA 2J8ZA 2NTJA 3VDRA 3WBFA 5T64A 3KUXA 3CE6A 1NP3A 2WE8A 4FFLA 2C20A 3GFGA 2HUNA 2SCUA 4OO3A 5G4KA 4I9NA 5KVCA 5DOVA 5L53A 1HE5A 1A7AA 1HT0A 1AUPA 4BUCA 1E1KA 4FDAA 1HSZA 4YBZA 3VPFA 1ZK2A 2PZMA 3U5TA 1LU9A 5JDCA 1Q7BA 4BGVA 4BO9A 2WE7A 3D4PA 4JN6B 1YOVB 3W4JA 1GDHA 5T8KC 2X0RA 4DQVA 1LNQA 3AUAA 1ZJYA 5JDIC 4GL4A 5JLAA 3W8DA 1H2BA 2W98A 3K2BA 2B36A 1N8KA 3WB9A 4DLLA 4J1QA 1BRMA 1QLJA 2W4QA 2CVZA 2O23A 1UZNA 2YYYA 4I5GA 4IDBA 2HCTA 5IFLA 3S1LA 2E48A 3ASUA 2C7VA 1J0XO 1T2FA 4BNXA 1I3KA 3RUDA 4PN3A 2PKRA 1PWZA 3GGGA 3NKLA 7ADHA 1U2DA 3OFSA 2BLLA 5TSDA 5B4TA 2X0JA 3MTJA 5EN4A 3EZLA 2NU8A 3KRTA 4DGSA 3JQ6A 1UXHA 1KETA 1U3TA 5JY1A 3GEGA 4OOEA 3MWDB 2WD7A 3ADPA 4PIVA 4MP3A 5K6AC 4CM8B 4KTVE 4E2XA 4R4JA 2DFDA 3O8QA 4Q3BA 3GUYA 1C1XB 1LC3A 4N54A 4WCFC 1DSSG 4BS9A 3VZRA 1X7GA 3GA0A 3RIHA 4E5PA 4F6LA 4FGWA 1PJCA 2IRWA 2VOJA 3TZQA 1X0VA 4L4RA 3COSA 1YL5A 3H6KA 1YGYA 4LCJA 1UXKA 3KXDA 3BHMA 5TLSA 1VL8A 1D4FA 5L7YA 4CQLB 3TFOA 5ENVA 5COQA 1RM3A 4MVJD 5IZCA 4YB8A 4GSKA 3WGIA 5DN9A 3UCEA 1CERA 2JJYA 1GY8A 4LMPA 3DBRA 1PEDA 1P31A 4PCVA 1T4DA 3ASVA 1D1SA 3O4RA 3ENNA 2VQ3A 4XA8A 2JAHA 3PXXA 2O4CA 4NZ9A 1ZSNA 3SC4A 1C3VA 5IN5A 3ZHBA 5JO0A 2VZ8A 4NJMA 1C0LA 3E8XA 4PG7A 3PQFA 3DEYX 3JQ9A 1O0SA 9LDTA 4BNKA 3JV7A 3GNSA 3RBVA 4ZQBA 1T24A 2EW8A 1EVYA 2GF2A 3GH3A 1N9GB 2D59A 4R41A 2GZ1A 4BKOA 3KYBA 3WFJA 3HZZA 4UEOA 1GADO 5TQVA 1UAYA 1RM0A 4WCDA 3W6UA 1U5CA 1DIAA 1UDAA 1SB8A 1Y9EA 2X58A 4RPJA 4DLAA 1KEPA 1KOLA 1PZGA 1YJ8A 2GPTA 1U8FO 4J0FA 1EZ4A 2G1UA 2P4QA 3EVNA 3U4DA 1XU7A 2CUKA 4J43A 1YH3A 2WYUA 4P4NA 4GI2A 5L95A 2NV6A 2OORA 2H6EA 3Q11A 3M2TA 4ND5A 3ROQA 2VZ0A 1XCBA 1X15A 3ITDA 3ZHZA 2VHVA 4LSMA 5JYDA 4FC7A 3NJ4A 3UICA 1OOEA 3EGOA 5L7WA 3TL2A 2NVUB 4YAKA 1IL0A 1IZ9A 4CUKA 3PRJA 1XELA 4R1UA 5G0VA 1SBYA 2NQ8A 2C5AA 4Q3AA 1C1DB 4WPGA 3DONA 3AW9A 4BB5A 3D4NA 2LDBA 3PLRA 4QX6A 3LT2A 1QYDA 1H5QA 4ZA2A 4I8XA 4PLWA 3JD2A 6ADHA 3G0OA 4MP8A 3S2IA 1E7WA 1PIWA 4OXNA 4UVEA 1HDYA 1VM6A 5EL0A 4FS3A 1Y5RA 5HTOA 3LF1A 2I9PA 3QW2A 2VWGA 2NU9A 4H16A 4ALNA 1LRLA 1I36A 5TT0A 4B4UA 3UHAA 3DDNA 4FBGA 1QYXA 1NASA 3OQ1A 4UUOA
chains in the Genus database with same CATH superfamily
4LNUB 4C4AA 1J8VA 1DBQA 2X9VA 1RXUA 1FL9A 1QV7A 3V2GA 1I4OA 3W3ZB 1JKIA 4N0QA 5KYTA 5FWXA 3F47A 2OHHA 2JLWA 1CS4C 4TRMA 1RRPA 1T2UA 3QXSA 3ZI0A 1W8IA 1QG6A 3NUGA 4KO1S 3FIUA 4LDQA 3QEBZ 1AGPA 1EVKA 2LV8A 1Y7IA 2HLDA 1XKLA 2Z5GA 3HBAA 1TCVA 1F9EA 1TKCA 1WMAA 2QTZA 4BJ5A 4KRXA 5CPBA 3FPLA 3CF2A 1FJGB 4B83A 3VOAA 1RWBA 1RHMA 1KFBB 1YRWA 2QQFA 4MGHA 1WXEA 4P5DA 2EJTA 3IBFA 2X9GA 2N9UA 4KJXA 1QIGA 3EY9A 3UV7A 3CH7A 1U7TA 4L28A 4GX1A 1AV7A 4FMCF 1I94B 2O48X 2WD9A 1J42A 1SKYB 1PT8A 4OU4A 4KIUA 2Q0SA 4KQ6A 4BO2A 4YAOA 4QVIA 3M5PA 4XJTA 5JY6A 1VL6A 3CLTD 3UJNA 3QVWA 1PUXA 3HABA 4UHFA 4C4XA 3DOCA 2B8NA 1G66A 3OA2A 5JD4A 1ONNA 5LQNA 3ZBUA 1USWA 2OCBA 3T7SA 2FWRA 4HDRA 5CA0F 1G291 3RQIA 1IJFA 1P3DA 3QLEA 2B4YA 2WM3A 5KKCA 3LT1A 2J0QA 3TR0A 2HLHA 2QRPA 4BLPA 2WP0A 3ITNA 4KFUA 1CR0A 3UB4A 3A6GA 2B83A 4MDFA 3SZUA 2WUFA 4NCHA 1UM8A 1SKYE 2L42A 2EX0A 5A3SA 2GBLA 4BB9A 3GX1A 3U7RA 4CIYA 1FP4A 3TSZA 1M33A 3P2MA 1RYDA 4HL6A 1QCYA 1NZDA 1POWA 1RXSA 4Y6SA 1F2TA 2YWXA 3E5HA 5BOVA 5JVDB 2QNRA 3LBAA 1H8HA 2Q99A 1CEXA 2P5TB 3H97A 2PT9A 2RB5A 2XV1A 1FYXA 2J5RA 4L8FA 4Q21A 2QAGC 3DC2A 5SZJA 3VU9A 2G36A 3RLFA 2H7CA 5HKLA 1ZXBA 1IB6A 1QQTA 4R2MA 2CBGA 4BEWA 4KVAA 2CK3A 1V47A 4FI3F 5IHXA 2PFGA 1WUIS 4LRSB 1U0FA 4O5AA 4WL0A 5KJEA 3KZKA 2ZIWB 3BGWA 2F64A 2R25B 3A1NA 2DTXA 4ES6A 5KU7A 3VA7A 1AJEA 4EKNB 1VHWA 4YP7A 1BROA 2PLWA 3PHJA 4IJ6A 4A6EA 5AVUA 4C6TA 2IQ5A 5MN5A 3WGYA 3PYMA 2G6BA 2I54A 1JIQA 4HWPA 4KO4S 1XYGA 1A82A 4NYMQ 5CLIA 2QRHA 4CF3A 4F11A 1HNZB 2YYZA 2JFXA 1L1EA 2C5EA 1XPUA 3C3BA 1TPYA 1WMBA 4GMKA 2XKKA 3LG2A 5LP6F 1QIIA 1AXGA 3GJTA 1H6DA 1QHHA 4J7AA 1M9NA 1QG2A 3ZDQA 1XD8A 4D4KA 4G07A 5KNBD 2NQTA 1F0PA 1RJFA 3B1KA 2EFJA 4R8LA 4N49A 3T7DA 5E4TA 5DJ5A 5ALYA 4ZDKA 3FY4A 4H60A 1J9EA 5TQJA 2BUAA 4PPYA 1ZQ1A 3SDBA 1Z74A 4A5OA 4MR7A 1E2FA 4KKVA 2XA1A 2BJHA 1PR9A 4GKAA 4B7CA 2CUNA 2NTYC 3OWXA 4YNBA 1GNQA 2EL9A 5AVTA 2A6PA 5GZ3A 3ZDRA 2CNKA 2H9IA 2VJBA 3T3PB 2C8KA 4IEEA 1SCDA 1ZN7A 3P2EA 4FNOA 2A92A 1KE2A 3HVRA 2AFIA 3WV5A 1A9TA 3U1VA 2O0HA 5LMCA 2OGSA 3J81A 4MMXB 2XUGA 3NAZA 2QUHA 2PRYA 4NRDA 1Z28A 2F9LA 2XTNA 3N2GA 3RSHA 3R09A 2ISQA 1Y9DA 3K92A 1UPCA 1OCEA 2JEZA 3I9MA 4B3GA 1O03A 2IBMA 1W35A 1HV8A 4K6CA 4EDFA 5H4GA 2IT1A 3T3OA 4DIKA 2WNIA 1YQGA 3QKIA 1G3UA 2QN6A 4OJYA 2YV4A 5FTKA 4GR4A 1XRLA 5TXGA 3I1FA 4JI8B 4IV8A 1PCXA 1BMQA 3GHYA 3V55A 1KOFA 5A4DA 1BU5A 4XR4A 4IDAA 2P27A 3Q7QA 1TO1E 5C5EA 1ZP6A 2FMHA 1FFXB 1U1DA 2F17A 2WU8A 3Q2OA 3Q8WA 3RNOA 1QKJA 5EXSA 4F71A 3PXBA 4UTVA 2OAEA 4P81A 3DNMA 2BGNA 3EMVA 2IGBA 2HX1A 1D5CA 1CBUA 1KRWA 1U7PA 3PI6A 4WCFA 3CLHA 2Z2JA 3GD7A 4N18A 1N2GA 1RPNA 1L5SA 4ND8A 1UWLA 1F17A 1MGPA 4CUJA 2AFIB 3B1XA 3C3CA 3IAM6 4XJVA 3FI0A 2ONKA 3H5IA 1KWGA 4JI0B 3KPWA 4JVNA 1DOHA 3PDIB 3U48A 2NUBA 2R7NA 4R9SA 5BVHB 5HOEA 2XE7A 3E48A 5I3CA 2O50A 3EZ6A 5KYUA 5KJ6A 2BKLA 3K6SA 2WTNA 2IYOA 5JCXA 4N3CA 1Z39A 1OXXK 4ZN6A 2OCIA 2R6HA 5KC9A 5KTPA 1BVHA 1REQA 1M1YE 5IUNC 3PWZA 4KWIA 4S35A 4EL0A 1JG3A 2VKQA 1T2CA 1V43A 3S40A 4YJDA 5ADHA 2B2XA 4N7MA 4QRDA 1NC3A 4KRGA 2Z3WA 5KQMA 3AIOA 1HRKA 2H63A 4POOA 2ZYRA 1DTSA 2ZSEA 4RPLA 4ZI7B 4J6EA 1NRIA 2Q1TA 4YQEA 2PMFA 3GUVA 1VI5A 5AKKA 1U28C 1DC7A 1WSAA 1YJ5A 3WGMA 5ICMA 2BM9A 2QF7A 2X1HA 4R84A 4HDKA 4EG5A 3HJGA 3RYHA 2N1BA 2HF9A 2X6TA 2FMKA 4DUZB 3RUAA 3VTZA 2R8RA 1UC4B 2QVLA 9MHTA 5BYJA 1LX6A 2ZCUA 4HP8A 4JNKA 4DHEA 3W5AA 1JU4A 1VPWA 1M2WA 3JVIA 3AETB 2VDUE 3QMMA 1M6VA 1SKBA 3DAYA 4RY0A 5EJ2A 4E5NA 2QJRA 3V6LA 4GMDA 3RS2A 4WVFA 3AVUA 2O3SA 4C0XA 2XCOA 3VR2D 2XT0A 2WJPA 1IRIA 5DTRA 4F5EA 3DE7X 3G23A 4CM9A 1CR6A 1ORRA 1KC3A 5TQ0A 2B4TO 3NT5A 3RCBA 3G2PA 4FOLA 4JSYA 1VLVA 4LJ9A 3GQBB 2A5JA 4X20A 4AVYA 1ISSA 1U1CA 3T4PA 3A2MA 4PE5B 3UWKA 3VVCA 3KQVA 1RABA 4H0NA 1PFQA 3MW8A 4R5HA 4RZUA 1FDWA 1P7PA 1TAHA 4D3FA 1ISJA 1LTKA 3C14C 3C6ZA 1IZYA 2ET6A 3FDXA 3K2EA 2QWXA 4GZMA 4NJMB 5FI0B 2AT1A 2Q45A 2XY4A 2RH5A 5IDQA 4A36A 3OZTA 2IV3A 3TPFA 5AICA 5E8JA 3RSCA 1OU4A 1MC8A 3AGPA 4UZSA 4ITRC 2HSJA 3SX2A 4JU9A 4UPVA 1X74A 4MWCA 1FS5A 1DX6A 3KVOA 1VKZA 5GY7A 2VK2A 2XNJA 3BIWA 1L4GA 3V4FA 4B2YA 1OLSB 2Y4OA 3PGVA 6LDHA 3TECE 3GN2A 3QTTA 4WASA 4XPIB 2Z8XA 3DOIA 3TNDA 3WL7A 4E5YA 4L74A 5CDTA 3MTAA 3EWSA 1BHQ1 1O8CA 1QGOA 2C4NA 3PX3A 4YJHA 3FMVA 1RM5A 1XMXA 2JIDA 3C15C 4C6HA 1A8PA 4JEHA 4REMA 5FUBA 3T4EA 1AF7A 2OHOA 3OOJA 3ZZTA 4BTLA 2JCBA 2V65A 4CQJA 3H5OA 2IH5A 3CUEF 1EFVB 2ZYUX 5KYVA 2HDOA 3WBBA 4JBWA 3CQ9A 2C97A 3LQYA 4FMDF 3ZWBA 3WWEA 1HY3A 1FU7A 2ASEA 3L4EA 5F2OA 2IZ1A 2XRMA 3RVQA 2HCRA 5AOVA 4NCXA 3I2IA 3DDCA 3HFJA 2F2TA 3KOZA 3NVAA 3GJYA 2P2GA 1BD3A 4YK7A 2QRJA 3JVEA 1RZ3A 3A3YA 4PSKA 1LUAA 1NATA 1KIMA 2P9ZA 4LV5B 5E0OA 4EDHA 4FZ5A 3HUFA 1X3LA 3EAGA 1DBIA 4AX4A 1TVKA 3K0AB 3EK2A 3O95A 4O02B 3RSOA 4B3BA 4IIUA 1PFVA 3HRHA 5FEMA 3ZK9A 4RVCA 3SM9A 1DEHA 4BIIA 4G0UA 2XAUA 4NXMB 1XA4A 1HFJA 2G7MC 2YINC 1S2IA 1T2AA 4IXWA 3RFFA 3ZG6A 4BO3A 3KXLA 721PA 1OTXA 3WGKA 1OV4A 4D9CA 5JZBA 5EPUA 1I9CA 2IEYA 2HRCA 2VYVD 4YXWD 1PJ3A 3OJEA 2VTVA 1PUJA 2VFAA 2O8CA 3OU2A 4L6AA 2OO7A 1JG1A 1IQUA 3GJQA 3BTSA 4L3OA 1M2NA 5DF1A 3TW8B 1U9CA 3IXQA 2G4CA 3WB1A 3AJEA 2PWZA 3H5TA 2YCLA 3CRNA 3RRXA 1RS0A 2Q6LA 3QYAA 1CIVA 1K5HA 4H17A 3UTDA 1SIWA 5H83A 3HYSA 3R6GA 2ZUWA 3BAZA 3ZNNA 2V7VA 3IUSA 4LWPA 2HPVA 1UWVA 4FIDA 1EE2A 1A4XA 4PWZA 1DARA 5EVCA 5A3JA 4EEZA 1QK5A 1U1GA 5ALDA 3TX2A 2V58A 4J3FA 1GQSA 5DX1A 2M2IA 1XDBA 1AHIA 4N8SA 1C3XA 2DSNA 3SJZA 1VC2A 2C98A 4CEJA 1LV7A 2MJLA 3GAMA 4HKTA 1F8YA 1MA0A 1G21B 4DE5A 1E7SA 1MN6A 3UWOA 4JROA 1WV1A 2FZ4A 2X40A 3GZJA 1MT0A 2AUTA 1OVMA 3HXLA 4Q82A 4Y18A 2CEKA 3QVTA 4XYMA 3ZLJA 3GP8A 1K9SA 2Y93A 2GJAA 3C4QA 4CNQA 3VOTA 2QRMA 2O5CA 2NIPA 3GLUA 4FI3C 1ARZA 1GGVA 1XXHE 2GPNA 4ZXPA 4HV4A 1IBRA 4QQRA 2PQMA 2IUEA 3LX8A 4O1IA 4P3KA 2RB4A 1NNUA 4Z7JA 1YRLA 2VR1A 3EXG2 4RTSA 4KQMA 2FEWB 1VBFA 3CA8A 4XTCS 4DV6B 2WZDA 1O89A 2HQBA 4GOJA 3VKFA 5ED4A 3BQMB 4MRMB 3SG0A 5IX8A 3OKCA 4F5ZA 1UZLA 3IMFA 3H8WA 4WK0B 5EWMB 5AM5A 1BA2A 4N03A 2YS7A 4QUIA 4MARA 2XHZA 4DJJA 1N0IA 1NYRA 2WFLA 5CT4A 5HPYB 1S8AA 3EW9A 3KXIA 1K2VN 4PZZA 3ZN2A 1T13A 3HCOA 2IL1A 1JDUA 1Z0IA 3K1AB 3NM4A 4EF4A 5I9NA 5FBQB 5CD9A 4MQMA 4HLDA 3V8PA 1T9CA 4HWKA 3DKKA 5JADA 1IVYA 2WSMA 5LLSA 3ETLA 2RHTA 4Q7LA 1YIOA 1Y6ZA 1NF3A 2REQA 2PWBA 3QVMA 1WOYA 2P67A 2ZB7A 1UODA 1C30A 2AG1A 4KPUA 3ZH9B 4KPGA 4M36A 3QA9A 1Z08A 2IYUA 1K8YB 3LXUX 3OUUA 1CP2A 2YMPA 5CDHA 4HK4A 2MSNA 4P54A 4XIIA 3H2KA 7AT1A 2IXBA 4D41A 4ER5A 1P6UA 5L3RA 1NBHA 4GXQA 4FUTA 4QBGB 1SWWA 3ZS8A 2Z08A 5F5LA 3TS1A 1Y82A 3JRNA 1V1RB 4PXAA 2P65A 1Q19A 4P35A 3MC1A 3QXHA 3OMLA 4MEBA 4ZQCB 3VOBA 1UT6A 5ALSA 3OQPA 4ENSA 3QPAA 2WIJA 2YW2A 5ISMA 4KR7A 1XHLA 3ECAA 1S9HA 2XA9A 3H75A 5AHWA 4B35A 4E88A 2HMTA 2XLBA 3X1KA 4ESOA 5F2NA 3I2GA 2BLNA 4XAQA 2ZBRA 1Q7CA 4UEKA 2FFAA 4MVJH 2NP6A 3EQ8A 4PS0A 5JAMA 2YJTD 1KZ7B 3PQ8A 5BW8A 2W2PA 3OLQA 4EUKA 4TSFA 3RQSA 4EPVA 3QH4A 4Q01A 5A2QA 2QM3A 1T29A 4ZC1A 1B73A 1ULUA 3ZTWA 2UZAA 4RQAA 4W1SA 3RS8A 3ZCSA 3V34A 4EF6A 2QUAA 4ODIA 4WNYA 5TIIA 4YDRA 2OK8A 5A03A 3NBAA 2G25A 2V74B 2AR9A 1D2HA 4ITUA 1NVGA 3GA5A 2WJWA 3VDXA 2ZU6A 2X23A 3GRRA 4RPCA 5CH8A 1Z7WA 4C04A 4EENA 4HGOA 5C9ZA 1LVHA 3IBCA 3QF4B 2AF4C 1QNLA 3HXTA 3BA6A 3SHVA 1ONOA 3WKCA 2ZTSA 3NHAA 2TMGA 2J5XA 4DLUA 3FDZB 4RK0A 1C9DB 2FSIA 2BC9A 3G2KA 1PGQA 3TRKA 1VIDA 2Q3HA 2BR3A 1UQRA 4MVXA 3KZCA 4LV8B 1DJLA 4XGRA 3JAWA 5FPYA 3GEDA 2JF0A 2OP0A 3NT4A 3GH1A 4M0DA 2CL6X 4Q24A 3T0GA 1ADCA 3CLRD 4W5TA 1MPTA 1WP4A 1ZBQA 3QY9A 4IJMA 4F96A 5CIWA 5SZKB 3GJ4A 1M8GA 4R31A 5BUCA 2WHYA 3EGVA 5JC8A 2BPOA 2NSLA 2O2SA 3EVTA 2WILA 2J5QA 1IJBA 1N0UA 4Z1OA 3OZCA 1AVTA 5H0IA 2XGSA 1GZUA 1I14A 3F5QA 1Z5ZA 2CCGA 2CF5A 4HFNA 4IKPA 3U09A 1FRNA 2GPBA 5I9SA 2R62A 2GESA 1XJ0A 3LUAA 3TZLA 1BW9A 3V1TC 4IOMA 2WTXA 4L08A 2A30A 2CXUA 2Q21A 4J9UE 1BCRA 1HLPA 2VPXA 3B8EA 4O3MA 1JHPA 1VECA 2HHHB 3DOEA 4MJXA 6YASA 1HQKA 1NSYA 2V6JA 3FTEA 5AHKA 3U9SA 4US1R 1SUSA 4PZ9A 5AW7A 4MYDA 1YZQA 5CYFA 3BD9A 5A05A 1EFPB 3FMPB 4AO7A 4BO0A 1ZD4A 3UK7A 4QTZA 2X2FA 3F2IA 3PQ3A 4L0CA 3UK1A 4ALLA 1MAHA 4LOIA 2PLNA 2RIPA 3DP7A 4LZAA 5AI4A 3WISA 1YF3A 5AKXA 4YC7A 5KTTA 1RWMA 4HZUA 4NS4A 2JFPA 3LTEA 1JDBC 1Z6ZA 2MU1A 1UC8A 3BWVA 3DT6A 3H9QA 3KM0A 2INGX 3OZXA 4G8BA 1T9HA 3JQ7A 3LWDA 4ND2A 3T4UA 1VHTA 4B74A 1KEEA 2CXNA 2VAVA 4YH1A 1E7QA 2Z9BA 1VHJA 3IS3A 3MGCA 3AC0A 4J2HA 1R88A 3WR5A 4R40A 1TJ5A 3U3JA 4BVKA 2P3QA 1ES9A 4MQBA 5JPCA 3O4FA 2FRVA 5AXAA 4LXXA 4DMHA 2FK8A 1T0PA 4CDNA 1W4RA 1Z2EA 1T8YA 3B7GA 3CMCO 1BGVA 2WG2A 2WU1A 4M37A 3TXXA 2P4HX 2ZR0A 5C1BA 3MLBA 1MAAA 1ZQ9A 3U3DA 3WYNA 2QSJA 2VDPB 2ZIXA 3W2TA 4CHTA 2VNSA 3TUZC 3KWJA 2YV3A 1LS6A 1KKMA 4M1EA 5EP3A 3TKAA 4P8RA 4BVAA 5A06A 4EP1A 4O25A 2BFCA 1NVWQ 4G2NA 1DDIA 1SD2A 1E6MA 5B7NA 1PJZA 2GR9A 4QDTA 2Z5LA 1QHSA 2CWWA 5KNCH 2CHUA 4CLRB 4MJ7A 4PSCA 5JWHA 2YV5A 4ZCMA 1T5OA 1XCMA 1ADFA 4J4BA 1NFQA 1GSOA 2PKXA 1CJTC 2VN8A 3NB0A 2J3JA 3I4FA 4HB0A 5FTJA 3GBPA 4EEXA 3SVZA 1FZQA 5J47A 2DE0X 2XIJA 5KNBA 4LGVA 1YL6A 5EPOA 1RTKA 2Q4BA 2Y2UA 1MH1A 1GVHA 2VBIA 4U4AA 3VU3A 3UA4A 1M3SA 1HGXA 3KOUA 4DJ5X 3KFXA 4CM3A 3B78A 4W1RA 1SKAA 1VL0A 3QOFA 5CX4A 5DO9A 1W5BA 1Z4NA 2G80A 2C2YA 2BMFA 3GWGA 3LRPA 1ORDA 1QAMA 2GEBA 3PE3A 1D0IA 3UIEA 4QUKA 4KDCA 3EQZA 3A58B 3GUZA 3QP9A 4DC1A 1F06A 4NG4A 4CEHA 1J49A 4GP7A 1BYUA 3HE3A 4QICA 2Y0EA 3C85A 2HFKA 5CW1A 5JYCA 2VYND 3VUFA 1I1QB 2JB9A 4EY5A 1P4AA 2VA8A 3FDFA 1OBCA 3N5KA 4FFRA 4QULA 3D5QA 3Q0EA 1BGXT 4XIYA 3VR4H 4ABTA 3KL2A 4RFVA 3WMXA 1GUYA 3ESXA 3LUBA 1GVNB 1CR1A 3E03A 3GGSA 1I32A 1ZA2A 3O84A 4GWGA 4MITA 3ZX5A 2QGFA 2ZVPX 4YRPA 5IZ4A 2V5VA 1TM2A 1D2RA 1RYBA 2FPPA 1A8SA 2FN9A 2JFBA 2XIQA 3NRCA 3PWKA 3PJDA 3C87A 2WHEA 3C6XA 4EW3A 1RWQA 1EAYA 3P9ZA 2TS1A 5EEGA 1IIRA 1RI4A 1Z6PA 2JANA 3DL4A 4BDTA 3N2NA 5FUQA 1D8AA 2MINB 2XUZA 4MRRA 4PONA 5KYNA 2X9NA 4JDPA 3P71T 4RTMA 2PKEA 3HV0A 3IP3A 1PO7A 2B37A 4ZU1X 3MA0A 2WNHA 3RRNA 2E4XA 3H6HA 3KVYA 5FXMA 4CQMD 4C0HA 2HQRA 3P0FA 5HIIA 1TW2A 2AHOA 1TYBE 3L0CA 3QVLA 4J0KA 4W6ZA 4ZAYA 3AYZB 3QY0A 3SS9X 1EZZA 4HEHA 5GOZA 1B14A 4OG2A 2FHSA 1E6CA 4NI5A 5EFZA 2J3QA 3A9WA 1VMAA 4HAUA 4IS3A 2FW8A 2JIBA 2FKNA 2ZTVA 3FPFA 1A2BA 3IDSA 4DQKA 1I8TA 5DK6A 5K8JB 1JKJB 2WB2A 2A4MA 3K70C 3LQ4A 5IJXA 1T5BA 4H7FA 4YALA 3S8YA 1VCOA 4CKZA 4AI6A 3E81A 3LD9A 2X0IA 3BFXA 2Z4RA 1QUFA 4N3GA 4QD3A 5C46F 2ZIZA 3RNLA 2P90A 3T6KA 1GLNA 5F1YA 3RG2A 5DTQA 1OBHA 1ZW6A 1H2HA 1T4CB 2BONA 2MR5A 2R7AA 3ABQB 3IEUA 3QNMA 3NHLA 1G8YA 1GCGA 1VJDA 3KJFA 3N3AC 5SICE 4ZYYA 2B8EA 2J9ZB 1BC5A 2ZJ4A 3WSWA 1U7DA 5EZSA 1E62A 4IHAA 2ANBA 2QRZA 3ZXYA 3BXPA 1GAEO 5B1EA 4BKMA 4IHJB 2GWRA 4YP6A 2X0NA 1N9ZA 3JASB 3ZZ1A 4UM7A 4R69A 2PQ6A 3NYQA 1RBYA 1J09A 4GOLD 2ID7A 2IOFA 5FBRB 2GF9A 4CFYA 4YMGA 3K0SA 1JHZA 4FYWA 5BPFA 3AY6A 3T3DA 2MSKA 2K6GA 5JSYA 2RHBA 3WL4A 2WPDD 2CNLA 4GZLA 1NU6A 1HEYA 4YV2A 1K68A 3H1FA 1L8OA 4JX8A 4MUNA 2WD7B 4NBTA 4PO3X 1RMQA 1DAPA 1XQ6A 2PPVA 1TVKB 1FYVA 4DRZA 4L9AA 5A9RA 1N34B 1ZK3A 2R1VB 4JMLA 3OF5A 4XUEA 4XWYA 1XEAA 4DLKA 3H04A 1S1CA 2H4XA 4U2FA 2EP8A 3AJDA 2W43A 2XB4A 2ZRMA 1AA6A 4KO8A 3DJYA 1MX9A 2WZBA 3TXYA 5F98A 2W8ZA 1LFDB 3SICE 4DAEA 2R4TA 3LP8A 4LZNA 3P20A 1YSCA 2PV0A 3KLMX 4W5QA 1HLDA 5C7OO 4NV0A 3JARB 1II9A 4AWBA 1V25A 5LQDA 1E94E 2ONCA 4AKEA 2RBGA 4X6LA 4BNJA 3QWFA 4LYGA 1R4ZA 3GPLA 4KN8A 5AW6A 2HMWA 3LMKA 4OYRA 4ZYLA 1VYHA 3EOAI 1HO3A 4FFMA 1VE7A 1SQSA 4MW4A 4MQ5A 3B2EA 4KFSA 2RHMA 5G4KB 4YJKA 3RADC 4HWOA 5JO9A 1HEUA 4NNJA 2ZM6B 4LJ6A 3LUHA 5AQEA 3ZWPA 4PYOA 2AEEA 3G8YA 4QATA 5DK4A 1RWWA 3A2LA 2B8JA 3ENKA 1D09A 3LFTA 4I3HA 3EDMA 4OFWA 4BO4A 4FP9A 1E1MA 1PK8A 4MDYA 5ESXA 2IELA 2BI8A 1SKQA 4R01A 1PTKA 2H5EA 1J06A 5DEOA 1P9WA 4P4LA 2RGAA 3LYHA 2CNWD 1ZD5A 4RE6A 3V4PB 3L7OA 4BZWA 3HDTA 3CGGA 2BTEA 4OD0A 2DGDA 3P9RA 1XZQA 4LWOA 1JGTA 4BQOA 4ZJUA 5K7SA 2UUOA 3GNTA 1N3LA 2G07A 2OENG 3BE6A 1HETA 3DBLA 5CVCA 1Z9BA 1YT5A 2XKAA 3AKCA 4TLMB 1M1NA 1TQ8A 2DPYA 1Z88A 2LKCA 2HLNA 3F3YA 4MCIA 1WP9A 3NMUF 4OUDB 4D25A 1D6MA 1P4SA 3R3VA 5ALOA 3D4LA 4LXGA 4ZOQI 1VXRA 1R74A 3L93A 4RSGA 1PWEA 1XZKA 2WJ6A 5EP4A 2X5JO 1MEEA 3ZVMA 4DEXA 1H2EA 5FOWA 4MS3A 1JIVA 5KTKA 1YFKA 4DLBA 5C37A 1SXJD 4OL9A 2GNPA 4HDSA 5LZ2A 3L6DA 1OIXA 4J8PA 5KKNB 2ZUFA 2EVWX 3ESZA 4X54A 3RFUA 4LZLA 2IITA 1S4MA 2H1OA 4MWZA 2WIAA 3PQEA 4G09A 4JT4A 4F5DA 3TN7A 2Z6QA 5CHYA 1C1XA 5KSPA 3R7NA 2C96A 1TLLA 1YDWA 1ECPA 3CURA 3W8EA 1PSWA 3E05A 3D4BA 3BCSA 5P21A 1YZVA 4AJPA 1X86B 2ZK7A 1IJKA 5H9WA 1FCJA 1W9MA 2JLCA 3P9IA 2Z1MA 1NTOA 3LVRE 4MP6A 5LBIA 3U9LA 1TNDA 1T43A 5LUBA 3AY7A 5LQCA 2PKWA 5KO2A 4CEHB 1CRLA 4YYZA 1T2NA 4C3OB 4Z4CA 5G0UA 2UZ4A 3EUFA 5BUZA 3BMQB 2JFOA 3KQWA 4DSUA 1V9CA 1VZ3A 3C3YA 2RJOA 4OHPA 5DLQC 1MT3A 2JD2A 1SZCA 1Q1GA 3TNLA 5M3BA 4DVJA 1NJ5A 3AF2A 3ZQKA 3ZZUA 3BFJA 2YOHA 3IILA 2JZOA 2B9EA 3EGCA 1JYSA 2WHQA 4Q9DA 1N3BA 4IMPA 3L7BA 4X7BA 3CT6A 4IQ0A 4GLLA 3CH5A 4DT1B 2M6LA 1I0IA 4PWYA 1YS1X 3DYVA 2IIPA 1I7PA 3M3PA 3FB4A 3TM4A 3CF0A 3PNPA 4WEOA 3VKWA 2IBTA 4GVXA 4S3MA 4ZT4A 1TKBA 3GRCA 4DGQA 2H48A 5C81A 2XNHA 4MS1B 3TO5A 3TYXA 4AG6A 4D42A 1FFXA 2YZMA 4G56A 1A1VA 5JI3E 2BFFA 4NNPA 1VP3A 2C78A 2JKYA 3LHFA 4OXRA 5GQSA 4OHXA 5K3AA 2ZYAA 3EXEA 1Y4SA 2XUAA 1A76A 2AYZA 1TTHA 4GM4A 4M1ZA 1Z5WA 3GOHA 3LPAA 5FR1A 1AKYA 3JZMA 2RKBA 2GVZC 2E21A 4F72A 3PHHA 2D5LA 5KMGA 3UW3A 5KTOA 2XTMA 2O3JA 2EYUA 3HLTA 2HA0A 2OV6A 3B12A 1OH7A 2D5AA 3K4QA 5F1OA 1CZKA 3ANYB 1NVVR 4XJSA 1DAGA 4M7OA 3H18A 1RYNA 5A4KA 3B36A 1KRHA 3RVSA 2QL6A 5IP5A 2XZPA 1I10A 4RY8A 1YRHA 4QHTA 4Y3UA 2FR0A 1WW3A 3EBOA 2DZDA 1MG0A 1TCAA 1N5RA 2B69A 2GPWA 2XKBA 4IPTA 3REQB 4ESVA 1X19A 3DKRA 4H3VA 2IUFA 3U6BA 2VSNA 4R1LA 1XEWX 2Y1FA 2GTHA 3K1JA 1Y8QA 4FD3A 1C9KA 1RIIA 2FR8C 3M4XA 4FLMA 1G3MA 1EJ6A 1P17A 3D0QA 5DTJA 3UMGA 4DNQA 3ZLUA 2X22A 4YXWA 1GQRA 3A9VA 4M8NE 4N3BA 4UPDA 1T25A 3BWMA 1K4KA 2PGIA 1N8SA 5IARA 4EI9A 3GDFA 5BNZA 4E13A 3QIVA 4IVQA 3BJMA 1IMJA 3L07A 3NWBA 1WZCA 4OBWA 4S2EA 4NU6A 5BSKA 5JS1A 1K7XB 4XD7D 4DNOA 1PDWA 2FPXA 2YJ5A 1G2IA 1M8FA 3EH2A 2VJDA 1HWYA 3IOMA 4KE7A 4B45A 1OTYA 3I01A 5AWFC 4BN4A 4YR9A 1UT5A 2WINI 3IUBA 3PPWA 5LQMA 1H3EA 4O4JB 1BDBA 1RHJA 3V32A 2OY0A 4R1PA 2DFLA 4RMHA 4JBXA 1N3IA 1Z63A 4B3TB 3V00A 3I6YA 5DCUA 3GFTA 2AX3A 2JEYA 3NAMA 1AA9A 3LT0A 3U17A 1VJCA 1LDBA 3A9UA 3BJZA 4CL8A 4M1YA 5LU8A 2F8SA 3R5JA 3O83A 2ZVQX 1KDTA 2F1HA 3C7DB 2QDKA 2VT7A 3G5AA 4TV8A 3WNCA 3X44A 3CRRA 2RCNA 3TE6A 4DJTA 1U8UA 3PFHA 4JC0A 2WUGA 1PFGA 1FDOA 3FCUB 1RHQA 3DC7A 5K8VA 2V6BA 3TEFA 4DCCA 3I5YA 4DG8A 1Z12A 3CUWA 3AKZA 1GGNA 2D7DA 2V3CC 4PTZA 2Y66A 1RPAA 4X1OA 4NBNA 1EFAA 1UKAA 1GPJA 3OZEA 3FYDA 1P9LA 3FXAA 4MKHA 5ICFA 4FB4A 3E4DA 3ITKA 1RRKA 4PZ0A 5CMLA 4KYVA 2P1DA 4A6XA 2BCJQ 3HYTA 1SHUX 1U3FA 4U2DA 5IU6A 2WSSA 4JELA 4QHSA 3RTAA 3QKWA 5HK9A 4BYMA 1A5SB 1GU7A 1NT2A 1G8MA 1AKQA 1P9NA 1W29A 1OXBB 2HZBA 2AFHB 2XVAA 3FOCA 4C4ZA 2JCSA 3AM5A 1GDDA 1GPDG 2XSZD 2ZRCA 3FLAA 3NTLA 3R6TA 4URHA 4PGHA 4DJEC 2DQKA 4RVFA 1RCFA 2GETA 1GV0A 3WYEA 2XUPA 4TMKA 4BPBA 1UM9B 4ZTBA 4N0EA 3FTCA 4L78A 2H1LA 4F6RA 4YJFA 4MZXA 4EG7A 4HF7A 4MB6A 2DVMA 3N2ZB 1XQYA 3QYJA 4Y6LA 5JAUA 5SYMA 4QU9A 4AXBA 5LXTB 1BWSA 1HK7A 5E1BA 1VIVA 2QRNA 5BURA 3DB1A 2C4KA 3B60A 1S0UA 3AY0A 5AJVB 2IU3A 2I33A 3WNQA 1N9GA 2FSHA 2QTLA 4IDQA 1V5GA 4P22A 3KT6A 4O4LA 5SV2A 3U4QA 1THGA 4RY2A 3KUKA 1QHNA 4AZVA 5K0ZA 2F48A 3BVPA 1E6UA 1YMVA 3C1TA 3GLVA 4P7FA 3THXB 4MYRA 4F4IA 1SG6A 2DX7A 3PQ6A 4HLCA 3RSQA 4BGEA 5AIBA 1GEGA 3R41A 2I3AA 1ADBA 3GROA 2AQIA 2I2DA 4B5LA 3D2LA 1QK4A 1NKVA 2IF2A 4ZCLA 4ZK2A 1JI3A 2ATCA 2V03A 5FIUA 3W5VA 5HVNA 2JHFA 1D8TA 3F7MA 4ZKEA 1BW9B 3KLPX 1KZYC 2PK3A 2Q4RA 3N8IA 1JPJA 1CUUA 3FNGA 3TOVA 1C9MA 3ETCA 5JEDA 2QLFA 1Q22A 1KXZA 5EMHA 1NVEA 3EDQA 2FMXA 4RXTA 3QX3A 4IKOA 4X44A 3OHSX 3CZAA 2E9SA 3IEKA 1U0NA 1KJQA 3A37A 3UKOA 3I28A 3D2CA 4UVHA 3J7TA 1RHRA 3JYLA 3DO5A 3O03A 5FBWB 1TRHA 2J0EA 5J2UB 4PVDA 1BWPA 2QRVB 3TNJA 4J0DA 1DAIA 3KPVA 3PD7A 1OZHA 2ZS9A 4KQWA 1BCSB 1EK6A 2WABA 3IQDB 1INLA 4KACA 1JHUA 1M73E 3IALA 4TN5A 4TVOA 1DDGA 5DGXA 4WERA 1GG8A 4DLYA 1J9ZA 4LF9B 1XXHB 3DEAA 4B34A 1WNFA 4DZZA 1K4YA 3WLEA 3LQ2A 5BSFA 5EE0A 3CRQA 5ABPA 3E7DA 4C7OA 2K5UA 3I42A 2QTMA 4PXYA 1MRZA 4M9XA 5IW8A 1QV6A 2UZ3A 1NURA 3C5EA 2Q9UA 1QZ3A 2AF3C 4WLUA 5IBQA 4FWTA 3D5EA 1UFRA 1XP5A 4POAA 2Z95A 3OSUA 1J0AA 1HE2A 1LNSA 5AI9A 3T06B 1QP7A 2XJ4A 2PX5A 3DHYA 2CMGA 3R0JA 4IJWA 2ZXUA 3K35A 1MQ8B 3K9GA 5CGZA 4OJMX 3WZ2A 2R8EA 3ILVA 3ORFA 4M8IA 4NS1A 1D07A 4QXPA 4TT3A 4BKQA 2BFDA 1DBVO 2MHCA 5K01A 4MV9A 1K7EB 4H6WA 4NOLA 1KQGA 1SJ9A 5DISB 4YMHA 3U60B 4TXMA 1L9KA 4X97A 3RTGA 4DLSA 1YDHA 2CXOA 3GJ7A 3JY6A 5C7LO 3H1BA 1J1ZA 4IIYA 1XLTC 4WA7A 3RVNA 4LJLA 3UJAA 4BEJA 1S2NA 1JIUA 3OQNA 4UTZA 2UVQA 1ZEJA 5IBRA 2QGZA 3PR3A 1X7WB 1O96B 2XEDA 1ZICA 2VSQA 3FZNA 5BN3B 2E87A 2RK4A 1PW5A 3CLRC 3H3FA 3KG2A 1ZR4A 1ZRSA 3SLKA 2BUCA 1NJSA 1L8AA 3HM2A 4FDTA 3RRJA 5DM2A 1RVDA 4AS3A 4ARCA 4OBBA 3W6NA 2R96A 5BW5A 2OR3A 3Q6NA 1UFOA 1KYQA 3PT9A 1CFZA 3HKCB 3OPYA 2IS2A 3GG2A 2DQZA 3EQ2A 4FOOA 1G6Q1 2AJTA 2ZRAA 1XG5A 2GXUA 2VJYA 2H8GA 3RIMA 4U2EA 3L1VA 4EMTA 3IQGX 2FRXA 1V35A 1TK2A 2W6CX 4FYIA 5JCJD 4HGRA 3PCTA 4DBZA 3TD9A 1T9BA 5J4HA 1LJ8A 2GXAA 2POQX 4IKEA 1IWPB 2AQ8A 4P33A 3SBEA 3LKVA 1Z36A 3DAGA 3CEAA 2GBCA 1LDEA 2HWKA 2X2PA 2XMRA 2IYFA 3DQPA 4GZ3A 1VCIA 2BMDA 3DZFA 3SSNA 3RWMB 2IIVA 1PN3A 4JVOA 3KB6A 3REQA 2FZ5A 5HDQA 5G4LA 4H7DA 3ZZ0A 2Q2QA 2CMHA 3L84A 2VAPA 4TV8B 1QOZA 3CPSA 4CM1A 2PSJA 3FX2A 3PU6A 4QOIA 4H4DA 4EGCB 4ZFNA 5G02A 3VNRA 2J46A 3AI2A 1CNEA 1WCV1 2R9VA 4WA8A 2GKGA 1RP1A 5EKTA 2JVKA 4Y7CA 4E11A 5JAIA 4B4KA 4JVLA 4B40A 1U5BB 3PQDA 3KSBC 4G81A 1GYQA 4TLDA 5JE8A 2XCTB 3D8NA 3RH0A 4R0MA 2X15A 2JCYA 2QVGA 1SCKA 3AYXB 4KWEA 4RD2A 3T41A 3MF4A 4B2LA 3W1VA 4AUMA 2FGJA 3N0TA 1JXMA 5CAEB 2DUUA 4MCAA 3B20A 5G0WA 1XTBA 2YJGA 4EFMA 4X90A 5KHOC 2BYTA 1NLYA 4XQ0A 4IS2A 3CZQA 4A0FA 2C2KA 4IZ6A 4DCOA 3KKOA 4ESEA 1ZAYA 1Y6FA 2ZBGA 1FLDA 5IFKA 2Q9AA 1N6RA 1A9SA 1GRQA 1WZIA 1ZVJA 4A2PA 2W6OA 1XK6A 1IY8A 5IJZA 4G5OA 5NULA 4EYQA 1KSJA 4IMIB 3SEFA 4J07A 1YTUA 2WUDA 2WQ7A 4LSZA 5EINA 2BDEA 3HMKA 3LGXA 2UYGA 3FUTA 4MQEA 5E6RB 1OY1A 4OKIA 1IN7A 4QGGA 3I37X 1QANA 3LC1O 3FYTA 2IY7A 2GLXA 4NHEA 5EJFA 1RRVA 3B6KA 4JK3A 2ACKA 2W2MA 3B3GA 4M0EA 4ZAFA 3V1LA 1Y5LA 3SBOA 1I4LD 2GX6A 3GIDA 1E2JA 3EQ7A 1W0JA 3PQ5A 3O74A 2CXSA 3BSSA 1HL7A 3MB5A 3E53A 3NBFA 4GHWA 4L76A 2NWQA 4M87A 1HOXA 3A9CA 4IHQA 1JDTA 5CVEA 1OIVA 3KR2A 4DUGD 1QPGA 3FHLA 3UT5B 4B87A 3JD0A 1W93A 4EBBA 3QSGA 4EGJA 2K2WA 4ZI3A 5LD2B 4YV0A 3UJ6A 1YBFA 2IYXA 4U5QA 2XADA 3WK9A 4GICA 4TKLA 3RTDA 2J59A 1FMCA 1NBMD 4BVLA 3OETA 2BBTA 1OILA 2DH5A 4KIJA 4AJKA 5JH7F 2ZYDA 3K9WA 2Q62A 3ONDA 5JALA 4EMBA 3SQNA 1J21A 1J9GA 3O2QB 3ZV5A 4F3YA 1WXXA 2QYSA 1SKMA 2CDCA 1UPXA 3CWCA 5AW3A 4BAGA 2AOTB 2WJAA 2E49A 4QC2A 2CXTA 2PCJA 3O4IA 3M6XA 5CW2A 3W6ZA 1TO6A 1YVDA 4WOPA 3EEIA 3KXPA 3CG4A 2ZB2A 3E9RA 4N6GA 2W4MA 4TTPA 1IM5A 3SQWA 1EX9A 1QR6A 3BK2A 5I8ZA 4CMJA 3T5AA 1SUCA 1NQXA 1T3GA 3QMVA 5KYYA 1D6SA 4LRTB 1BKDR 1PZFA 3K1YA 4I8DA 4LMAA 4UHKA 5L45A 3JQBC 1FE8A 3NLLA 3JCZA 3K31A 2Q3BA 5CLQA 5LQUA 2VHTA 4LAFA 4JIGA 3ER8A 3PR2B 3FTNA 4BNNA 4IZHA 5EEHA 5KHAA 2QK4A 4NCAA 2IX9A 3AJ9A 2WUEA 3U13A 1GTJ1 4I4NA 4QYSA 1P60A 3F74A 2ZDQA 5K0TA 3F90A 5ADVA 2FJUA 1C3EA 2I80A 4N6NA 2KW5A 3BWXA 2YHBA 2B20A 2VLIA 4JUCA 4MIOA 1JQJC 2XTAA 2MSCB 4JKIA 1E69A 1P5HA 2R8ZA 3ZWQA 1HTTA 3F71A 4AMBA 4B9AA 5C7IO