3UICA

Crystal structure of fabi, an enoyl reductase from f. tularensis, in complex with a novel and potent inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and enzymatic analyses reveal the binding mode of a novel series of Francisella tularensis enoyl reductase (FabI) inhibitors.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 86
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uicA00
4A73A 4CMEA 4MVJA 4NFYA 1ZK4A 1P44A 3GAZA 4BNKA 3PGJA 4HFNA 4FFOA 4YTEA 4YJGB 3A14A 4QFCA 1YVEI 4N18A 1P9LA 2VT3A 3RUCA 4MP6A 3UGKA 5DT9A 4BNTA 1JWBB 2JFFA 4IY1A 2NTJA 4RZIA 2SCUA 4EJ6A 3HDYA 2AQKA 4OAQA 1EUCA 3BHIA 4DTIA 2CVZA 3WWYA 3H3FA 4CQMB 1PX0A 4DBZA 5I8ZA 1DAOA 1VE9A 2OGUA 5F3RA 1KERA 4PLYA 3SLGA 1I3NA 1J0XO 1I3MA 3GA0A 4CUJA 3BHMA 4QSMA 2FP4A 4BO6A 2VUUA 4CMIB 1OI7A 1ISJA 3A9WA 3SVTA 3GVCA 4JIGA 4PG7A 5ADHA 2BFAA 1SOWA 4RVHA 5JC1A 4OOFA 3EVNA 5A03A 1XLTA 5CP8A 1YQGA 1MG0A 4B4OA 1PR3A 1EZ4A 3H65A 3PYXA 1UXHA 5U1PA 1XR3A 3GLQA 4J4BA 2UVDA 4PLCA 4WEOA 5IZCA 3R1IA 4KP7A 3B1KA 4Y8VA 3ONEA 2IXBA 3Q9NA 1PGQA 1PL8A 4JBIA 4M8SA 4P4LA 5G0WA 1YOVA 4URFA 4Z0PA 2YV1A 3O38A 2CMDA 4IXWA 3TRIA 1SOVA 1ISGA 2BFMA 2PKQP 2X23A 2CF6A 2O7QA 3LC7O 2VUTA 2NVUA 4J49A 4U6QA 1TT5B 2I6TA 4BO8A 3GAFA 4BHTA 1YXMA 1EBFA 1T1SA 1DLJA 1IZ0A 1YRLA 1ISHA 3IP3A 5ES3A 3L6EA 2FZWA 2VWQA 1NAHA 4WLOA 5T5QA 5C7OO 1IOLA 2IZ0A 5H81A 2E6UX 4UVDA 4AJPA 4A27A 2IXAA 4CM5A 1DIBA 1A5ZA 1ZNQO 3VH3A 3JQAB 2WE8A 4DBVO 4AVYA 4KOAA 2Q2WA 1U8XX 1K3TA 2RHCA 4TZTA 5B1YA 3ZNOA 1K6JA 1FJHA 3BTVA 3ZNNA 1U7HA 3C7CB 3ZWAA 1P31A 4CM4A 3RBXA 5JAZA 4D0RA 4PRKA 4DQVA 3C24A 4AG3A 3WMXA 1U3WA 4BQRA 1HE5A 1A9YA 1OAAA 2NQ8A 3DOOA 1E3WB 1WP4A 3RUAA 3GZNA 1UXIA 3C7AA 1LDMA 2NADA 5DN9A 2BHLA 4DPKA 3Q3CA 3MJSA 4E2XA 3PHHA 4GVLA 1PU2A 4CL3A 3S2IA 3KSUA 4YB8A 2Q49A 5AXAA 2HLPA 4FFPA 1UUFA 2DTEA 4ZN6A 3ICPA 1ZEJA 4EJMA 1PJSA 2FR1A 3VKVA 1Y8RB 1OBFO 3BA1A 3GDGA 3FN4A 5JPIA 1PJ4A 1YQDA 3DAGA 5CPFA 4OIMA 4Z6KA 5KVQA 3OF2A 1Z6ZA 5BSGA 2QHXA 2V6BA 1P33A 2VOEA 4XEHA 2EWMA 1W0CA 3G0OA 4JJIA 5CG2A 1RJWA 4Q3AA 1O95A 3DAFA 4OXNA 4RF4A 1UDBA 1BG6A 2ZK7A 1GUYA 4CMKA 4B3IA 4YAIA 1GY8A 3C1TA 4XYEA 4MDHA 1UXKA 4XZ3A 3U9LA 4W82A 2W2KA 4DIFA 1NM5A 2DQ4A 3JYQA 3ST7A 2VTDA 4G65A 1SEVA 4RPJA 1MB4A 4XDYA 1LRLA 3JQ8A 2HUNA 2LDXA 5KJEA 3O26A 3RFXA 3EGOA 3OMLA 1NPYA 1EMDA 2WDZA 3ZV3A 1D4FA 4IQGA 1PJTA 2O2YA 3V2GA 4DLLA 1WMBA 4HUJA 4HX5A 4WE3A 5HS4A 4BV9A 1FDWA 2QX7A 4D3DA 4FC7A 1M66A 3ETGA 5JAIA 4PRLA 1FDSA 2DM6A 1QLJA 1S6YA 3DFUA 4L74A 3N58A 3PI7A 4BNXA 3HFSA 3NDIA 4IJKA 5ILOA 1M67A 1L7DA 3JQ9A 3LDHA 2EKPA 3F9IA 4G81A 5THKA 3WR5A 4FR5A 3OJLA 4WNIA 5KJFA 3DMTC 2Y0DA 4FS3A 3DBLA 1PZGA 3CMMA 3PEFA 4OKNA 3IUPA 5F5NA 1U8FO 4RF5A 5IF3A 1T2FA 4PVCA 1R4NA 2X5JO 5TT1A 2ZATA 1ZBQA 1T4DA 5JDIA 1P77A 5F1PA 4YR9A 1V3VA 5A1TA 3PYMA 1QYVA 2EJVA 2V6GA 4D3SA 3FPCA 1MGOA 4NPCA 2Q1UA 1P1HA 2RAFA 4HKTA 2HO5A 1WAMA 4J7CA 4ZGWA 3T4EA 3DWFA 1JW9B 4B79A 1DBVO 4AJOA 5GY7A 1WMAA 1EDOA 4OGWA 1ULSA 1MLDA 1UXJA 3U62A 4O5OA 1LSSA 3F4LA 2PZMA 5DDIP 3WFJA 5A9SA 1YBAA 2OL4A 3ANNA 5TJHA 4GWGA 3GNTA 3ZWMA 4BMSA 5KJ6A 4N5LA 1PGJA 1NP3A 1IPEA 5U4QA 3U0BA 4I1IA 3VVCA 3OJFA 3ROMA 1XQ1A 3P2YA 3MOIA 4Y98A 5EINA 3PHIA 2AQIA 3RAJA 3MTJA 1MUUA 2DT5A 3U4IA 1VC2A 4Q9NA 8ADHA 3EK2A 3FNGA 3RUDA 1E7QA 2HCTA 3AY7A 4Y9DA 2B4RO 1EBUA 4E2ZA 3ZN2A 5TX7A 3RVDA 4CLRB 2ZTVA 5I9MA 4I5EA 3BYZA 4BO4A 2X9VA 2YDXA 1ONOA 4FFNA 5A06A 4J90A 1OMOA 2O4CA 3LT2A 1YJQA 4NMHA 4HP8A 4GI2A 3V1YA 4MVJG 4AICA 3OEWA 3TZHA 4IJWA 1C14A 2P5UA 1T2EA 3PRJA 4E4YA 1WZIA 2IE0A 2EW2A 1ZSVA 3GVXA 1J6UA 2GF2A 4BKPA 5JCJD 4RL6A 1ZMTA 3JQ6A 4AJLA 1P0CA 1HDZA 2BGKA 4QTZA 2NU8A 1N2SA 2JKVA 1XDWA 3ONDA 1QKIA 3VZSA 5CDGA 2PGLA 3MWEB 1KC3A 3COSA 3DBHA 3PJEA 3C3XA 1ZSYA 4Z0TA 5A04A 1NVTA 5B4TA 3GHHA 5A3VA 1ORRA 3A1NA 4BO1A 1DOHA 4UULA 4IGEA 3WLEA 1PL7A 3ZU5A 2CF5A 2CUKA 4GGOA 5JYDA 3QV1A 1NFFA 1QP8A 1K6IA 3I4CA 2VHWA 2X0NA 1ZKMA 3KEOA 2X9GA 3TL2A 1DPGA 1P1RA 3MJVA 4PZEA 1V0JA 1LSOA 5JCJA 1ZH8A 5BT9A 4YAJA 5AVOA 5F21A 1TI7A 4PLGA 1H94A 1Q7CA 4GWKA 3M1AA 4GLOA 3A06A 4P4GA 1EVIA 4GVXA 1PWZA 2BFPA 1PZFA 1W6UA 5G0TA 1E6UA 2C2XA 2PH5A 1BVUA 1NAIA 4WKGA 1UR5A 1SB8A 4IIVA 4CMBA 3C7DB 3OM9A 1Q1NA 2JHFA 4OSOA 1X7HA 4WECA 1NHWA 1HEUA 3CPSA 3UCXA 3INRA 4TVBA 1TVEA 3AM3A 2ILTA 3DZKA 3I6IA 4CV2A 3JQ7A 2Z1NA 3QLJA 2ZTLA 5KTKA 3TDKA 3JD1A 3VPFA 3TFQA 3UCEA 1V8BA 2GSDA 1FDTA 3NGLA 3BMNB 5ICMA 5IDQA 3CZMA 3JQEA 4UEJA 3WGZA 4JP3A 1U28A 1YB5A 1BXGB 2R00A 1NNUA 3ZU3A 2GR9A 1ENZA 2QZZA 4I5FA 1EVYA 3HFGA 1YE3A 1VM6A 1RYDA 5GMOA 3AOEA 1N1EA 3NGXA 4PLFA 5A5EA 1AGNA 3RU7A 3ZGYA 2YV3A 1Y8QB 4BGUA 4IS2A 5I7SA 5IDWA 4J43A 3QVWA 2ZCVA 1GV0A 2BGMA 4X54A 1BHSA 1UH5A 2AEMA 3GGPA 3RC9A 4J0FA 3RUIA 3K31A 3I23A 4M87A 3RC1A 3NYWA 2VYND 4B7CA 4OO3A 2FPIA 3EYWA 5TLSA 3AWDA 4BIIA 1XHLA 1OC4A 2HSDA 1X7GA 1EVJA 2O23A 3OQ1A 4BKOA 3WSWA 3WQSB 4EBFA 4U0JA 1PR9A 3TL3A 1Y1PA 2B36A 4ND2A 4NU6A 4IIUA 1E7MA 3PZRA 3RASA 2HK7A 3KEQA 3AU9A 3N7UA 3U4DA 1DIAA 1H2BA 3JQDA 1QR6A 2V6FA 2VHYA 2I65A 5HWSA 3E1KA 2EHDA 2Q1TA 4LCEA 4J2OA 3VZRA 2C20A 2NTNA 3H9UA 4XYMA 3B70A 3LC1O 2B0JA 2VYNA 1LLUA 4YCAA 3NT2A 3OQ6A 2VHVA 4MP3A 4RV9A 4O59O 3UN1A 3RBVA 2AG8A 2C07A 2V7PA 1X13A 1DIHA 7MDHA 3AM4A 3WBFA 4R41A 4BO2A 3ZV6A 1R0LA 2CVOA 3S2FA 5H83A 4CM7A 4RJTA 1BDBA 2BGLA 4GMGA 4AJ1A 1VJ0A 2OP0A 2E82A 1E1KA 1AHHA 1ONNA 3ITDA 3ROPA 1JA9A 4IMRA 4CLDA 4DVJA 4PN3A 3I52A 4A10A 2NM0A 3ZV4A 2GASA 2UUOA 5B4UA 1DHRA 4Y6RA 4NQZA 5B4VA 1DRVA 2AEFA 3ZV5A 1AXGA 5AXCA 3K6JA 4IBOA 2YQ5A 2NNLD 1J49A 1NYTA 2HQ1A 2EP5A 4TZKA 1DFGA 4NBWA 1NQOA 2DC1A 4EDFA 1GYQA 4XR4A 4M54A 2PLAA 3WYBA 2FR8A 1WLYA 2VT2A 4KUHA 2PD3A 3OICA 3DHNA 3DZJA 1DB3A 3AUSA 1ID1A 3B1FA 4CMEC 4ZRMA 2X9NA 1N8KA 5JCXA 1MFPA 1VI2A 4K26A 1KVTA 1TA4A 3WBBA 4JN6B 5G0VA 4BO9A 4XYLA 3SBOA 3U4CA 5HRUA 1ZSNA 4YPOA 2DPGA 2FWMX 3WTBA 1JKIA 1Z73A 4BB6A 1PJQA 3PJFA 3GR6A 4WEQA 3IKTA 3OEYA 3ETEA 3V1UA 3D0OA 4DQXA 1C0PA 1LLQA 3PWKA 3DDNA 4LRSB 2NVUB 1QYDA 4NU5A 4XQ9A 1HDOA 3G17A 4JCOA 4MKZA 4MO2A 4QO7A 4H15A 4BV8A 1KVSA 4GGPA 2OMEA 3S55A 3ZHBA 3OP4A 3RIHA 3P5SA 4IXTA 4E5PA 2Y1DA 4B8WA 1GPDG 1NFQA 2R2GA 4R4JA 1HDGO 5T67A 3NJ4A 2RHRA 1PGOA 3WG9A 4GMFA 1E7SA 1HT0A 5KVSA 5GZ1A 4LW8A 1QSGA 4MIEA 2WYUA 2B69A 3GUCA 3TWOA 2VHZA 1GAEO 4K6CA 2NUAA 2J5RA 4INAA 4CM4B 3DHYA 4CMHA 1JDJA 3RFTA 4E12A 4AL4A 3ZWOA 4E2YA 4RVSA 3HE3A 4NG5A 5L40A 2J3JA 3GC6A 5TIIA 3GZNB 5TS3A 3F5SA 3ZWVA 3FSRA 2CDBA 1NPDA 2HU2A 1ZW1A 4GSKA 4WOKA 3DQPA 3PJDA 2FY8A 1QV7A 3AOGA 5DBGA 1KIFA 4XJSA 5DBIA 4J9VA 1C1XA 3GRPA 1E3SA 3F3SA 3VC7A 1KYQA 2VRBA 4MJLA 4FCCA 2PZKA 4I9UA 2WYWA 3WGYA 1DDOA 4IM7A 2Y66A 3EMKA 2X7HA 2YFHA 4TVOA 4A0SA 3W8FA 3GFBA 2VHXA 4ALIA 1ZZEA 5KIAA 2O3JA 4D45A 1LI4A 1LDYA 1H5QA 5JLAA 3RUEA 3WOHA 3KYCA 4RZHA 5JS6A 1AXEA 2PH3A 4JK3A 2EF1A 1BRMA 4OH1A 3UW3A 5CDSA 2CD9A 2P4QA 2IRWA 4C7JA 1E1LA 1B16A 1IY8A 3WJAA 1N7GA 4ZQFA 5JMPA 1F8FA 5T8KA 3F1KA 3VPHA 2O4UX 3F5QA 2WSBA 4WLVA 3JQ8B 1PS0A 1EQ2A 4NHEA 4R16A 3JD4A 1LDNA 4BNHA 4DLBA 4KQWA 4YAEA 1ENYA 1BMDA 3PDJA 3INGA 2FMUA 5JC8A 2O3TA 4UVGA 1NWCA 3ZWBA 1B7GO 4BKUA 1T24A 3GK3A 4R54A 3QWIA 5DP2A 4QECA 2D5CA 1OC2A 1X0VA 1HKUA 4BVAA 1CEQA 2BI8A 3SC6A 1NVGA 3U09A 1E1NA 4TRNA 4MIYA 4IMPA 4NJMA 1HWYA 5B37A 4E30A 4NFSA 3DBLB 1KBZA 2PGJA 3Q1LA 3C1OA 3RI3A 1R4NB 4NIMA 3GF4A 4GAEA 4IJVA 4LGVA 3VTZA 5JYEA 4GSLA 3ROQA 2GO1A 1E3EA 3K30A 3RBZA 1B3BA 4OQZA 3ONFA 3BMOA 4CM8B 3W4JA 2DVMA 1NQTA 2WYVA 1N1GA 4MP8A 4YA6A 4YJDA 2NWQA 2DTXA 3OHSX 2WD7B 1BWSA 4Z3DA 4I8XA 2WE7A 3FBGA 3PQFA 2CFCA 4AJ4A 3CE6A 1MP0A 5L9AA 3FCOA 3HG7A 4IGFA 4AJ2A 3OA0A 3GDFA 1UAGA 3CXRA 3PLNA 3Q6IA 4PVDA 3I6QA 1A4UA 1I3KA 3WSVA 5A9SB 3NRCA 4BKQA 1A7AA 3AK4A 3U3XA 4PG4A 1Z74A 4HWKA 2I9PA 1GL3A 1NFRA 1E0DA 3X2EA 1IPFA 3A4VA 3UOGA 3M2PA 1CYDA 2Z95A 2I3AA 3WJ7A 3JQ9C 1Z7EA 4A7PA 1O8CA 1WZEA 3AY3A 3FR8A 3VVBA 4FPXA 5HA5A 4CR6A 1PTJA 2EP7A 2FR0A 3VPXA 4QFDA 1SAYA 3K96A 3H9EO 2E48A 1N9GB 4PLPA 2EEZA 2G76A 1HLDA 4RVGA 2D5AA 3DZBA 2DUWA 5L95A 1M76A 3ZH2A 4OQYA 1UDCA 2NV6A 4CLOA 5JDIC 3SLKA 4FFRA 5L4NA 1E6EA 4R5MA 1RM0A 4Q3EA 2GCGA 3WGIA 4HADA 2FHSA 5A9RA 4H16A 5I7FA 4II2A 5AOVA 1P1KA 5A5FA 1F14A 3D4NA 4DPLA 1TXGA 3JYLA 4JJGA 3EHEA 1H2HA 3IOYA 3Q2IA 4PZDA 4W6ZA 4WLEA 4GPD1 3HWRA 2I3GA 1NWHA 4PLTA 3I9NA 1A71A 2C5AA 2GZ2A 3INTA 5DCYA 4F6LA 1C1DA 5BNIA 2VNAA 3U4HA 2VN8A 4YQYA 3DBHB 2YHUA 3ANLA 4RPGA 4WOJA 3EZYA 1GR0A 1QXSA 2AE2A 4KTTE 4PIVA 3WDSA 1HZZA 2ZB7A 3OSUA 4B3HA 3EDMA 3HQ4O 4KUEA 1SZJG 1PEDA 4M49A 1E77A 4XX0A 3LC2O 2Q1WA 3C8MA 3JV7A 4BNLA 4MKRA 1LDEA 4F3YA 2X4GA 4AJJA 1VJTA 3SC4A 4BO3A 1LBEA 4EYEA 4DUPA 1PWXA 3AUTA 3O8QA 4U0KA 4P22A 3H6KA 4DGSA 1HYEA 2FOIA 3WMWA 2HMVA 4C7KA 5I9NA 1P1IA 1XU9A 5JO9A 3GG2A 1I36A 3GNSA 5L7TA 4S3MA 2WJPA 2OUIA 3MZ0A 3UICA 4CQLA 4C4OA 1YJ8A 3FPLA 5DOZA 1RM5A 3TOZA 1PJCA 1BDMA 4J4TA 1F17A 1NTOA 3G1UA 4CV0A 4K28A 4DYDA 3F4BA 5G4KB 3PHGA 2NU7A 3JQ7B 2Q4BA 2YZ7A 2YDYA 3IUSA 4DC1A 4XRGA 1F12A 1YQXA 4BMNA 1DRUA 5IXSA 3V8BA 3EAGA 5CEJA 1CJCA 1GADO 1ZO8A 1HDYA 1FDUA 4P4NA 2PY6A 3VH4A 3I5MA 4W99A 5G0UA 1QMGA 2AA3A 2BRUA 2NLOA 3HNPA 5KKCA 5KNLA 1SEPA 2J8ZA 4CUZA 3OJEA 2HAEA 4BOYA 3HHPA 4FOSA 4Q3CA 5AQ1A 4Q3BA 1PIWA 4XB2A 2O48X 3IIEA 1ZIDA 2VWHA 1X1TA 3DOCA 4UVHA 5ENDA 2YQ4A 5ENVA 4RQUA 4E3ZA 4ZQGA 3KLMX 1EFKA 1ML3A 1CWUA 3EZLA 3WYCA 4E21A 1P45A 3RKRA 1RM3A 1ZXBA 3HB4X 1ADFA 2GN8A 2QG4A 3P2OA 4TQGA 1P1FA 4D46A 4HFRA 2Y1GA 1R16A 2O3UA 4EEXA 1GFSA 1GPJA 2Y67A 3K73O 5L4SA 4FFLA 4RDHA 2XXBA 2EIHA 2AHRA 5L7WA 2YHIA 4D42A 2DUUA 3TZCA 4F46A 5FF9A 3W6UA 2R00C 3DB2A 5DCWA 3U5TA 3LZ6A 2DBRA 1SO8A 3K92A 4UEOA 1F8GA 4OYRA 1R0KA 3AY6A 1E7YA 3BMQA 3FNFA 3AOEC 3OJ0A 5AYVA 1ENOA 4DA9A 3L77A 3WX0A 4I5DA 3D3WA 1E7RA 1VKOA 4JQCA 4YJFB 3F47A 5JBIA 3WGTA 4DRYA 4ND3A 4ND5A 4FB5A 3P7MA 2GERA 1E3IA 1O89A 3RJ5A 1XSEA 1Z45A 2DFVA 1IYZA 2Y1EA 1I3LA 4WCFA 3ADOA 4PFJA 1BW9A 5JSFA 2EG9A 3PJGA 2I76A 5H82A 3V2HA 4GH5A 5FWNA 1XU7A 3KSDO 2Y0EA 3WNQA 4CQMD 4CUKA 4K6FA 2BKAA 4L4SA 2WD8A 1I33A 2Y05A 3HADA 2AW5A 2QZ9A 3PXXA 4J16A 4L76A 3DC2A 1M6WA 4A2CA 4CM3A 2VUSA 2OO5A 5DF1A 3JD3A 1RKXA 1Z7BA 1LC0A 1TT7A 4EEZA 2OBNA 1NQAO 3RC2A 4B7UA 1ZFNA 2O2SA 3VOSA 4DIBA 2PFGA 3KZVA 3EC7A 3QVSA 3VDRA 2PWZA 3LU1A 4PLZA 1NX6A 4DREA 1UXGA 5KWEA 2VYVD 4PZCA 5KKAA 1I10A 3AFNA 3QJ5A 1YDWA 3L4SO 2HMTA 1GZ6A 1ZK1A 1YB1A 3B6ZA 3HN2A 4GX5A 4ROSA 4CQMA 5JMWA 5L53A 3VH2A 2JFGA 2C0CA 4XKJA 2PZJA 1JQBA 3ITKA 4BQPA 2TMGA 4CMIA 4M1QA 4J6FA 5HM8A 2ZKLA 3D3EA 4K1LA 1U5AA 1X14A 2VZ0A 4YJHA 3IL2A 4EW6A 2PZLA 3KV3O 2QQ5A 4MVJE 2OOSA 3N74A 4Z0HO 2CDCA 4NBUA 4H7PA 5DP1A 2PA3A 4ND4A 1D7OA 2W8ZA 3ULKA 3Q2KA 3GRKA 4E6PA 3NDRA 1GDHA 3L07A 1HL3A 2VRCD 2FRDA 3AU8A 2RCYA 2VYVA 4B3JA 1E3JA 4EGFA 4Z9FA 3GUYA 3RWBA 3NTQA 3LSYA 2HRBA 1KC1A 3PPIA 5K0ZA 1YO6A 2I67A 3GVHA 2P2SA 4MPDA 3JQAD 2O50A 4RQTA 2Q46A 4ONEA 4DPMA 5BNTA 1FF9A 4EZBA 2XAAA 4TROA 2FZEA 8LDHA 3FHLA 2C82A 3BMCA 1X7DA 2J3HA 4W7HA 1KEWA 4TRMA 3TZQA 2POQX 1NR7A 4HFJA 4IDDA 4IINA 2QRJA 3NV9A 1KVRA 2G17A 2EJWA 2JD0A 4QQRA 4XDZA 3TOXA 4AFNA 4J91A 5GZ3A 1YH3A 2VRCA 4E5NA 4WLUA 4FOOA 4QEDA 3KHUA 1YONA 2HMWA 2G82A 1M6HA 1C1XB 4GX2A 1PJLA 4FFMA 1U5CA 3JQAA 1KS9A 3K9QO 5EERA 5ER6A 5K6AA 4B4UA 1B15A 4D7AA 1B2LA 1QYWA 1DJNA 3E03A 3WIDA 3IJPA 2HRZA 1G6KA 3HJAA 5DULA 4IPTA 5TNXA 4QO8A 1IL0A 3BXXA 4UVIA 4OOEA 3STHA 3KYCB 3W8DA 2WEKA 1KEPA 3L9WA 2C5EA 1PQUA 3ASVA 1A72A 4E32A 5EN4A 4QX6A 4FD3A 3UFXA 3OH8A 4NZ9A 4R1TA 3TQHA 2BD0A 2OORA 3KLPX 4QUKA 5ICSA 2CVQA 2BFOA 3GOHA 3I1JA 3WQRA 1DIRA 1PZEA 3HDQA 1IZ9A 5I8WA 1ZK3A 3DBRA 3DXFA 2Z5LA 4UAGA 5LC1A 1UAYA 2X5OA 4E0BA 2FN7A 3IMFA 5IN5A 4BNJA 1W73A 2EGHA 2QW8A 4TRRA 4R3WA 2Y1CA 4P38A 2YW9A 2Q2VA 3AI3A 4OM8A 3HN7A 3ZWPA 3D4OA 1HLPA 4TMFA 3KM0A 4CMCA 2J6IA 1ZJZA 2GUGA 2GGSA 3I9JA 3AFMA 2GN9A 4XGKA 2NSDA 4MVJM 1PL6A 1P0FA 1FMCA 2LDBA 3MJEA 5JAMA 4UVEA 4NJMB 3C85A 3FNEA 4E5MA 2NU6A 5C5IA 1O5IA 3FTPA 1R15A 1LRJA 1MC4A 4NBRA 4OKIA 4RVUA 2D4AA 5G0SA 1IHYA 4GKVA 4YRBA 3I83A 1VL6A 1SBYA 1D8AA 3UCFA 3BMOB 4LRTB 1DAPA 1L7EA 4BNGA 5T8KC 3IJRA 3I9OA 2C59A 5EMHA 2XOXA 1Y7TA 1KEUA 1LQUA 5IG2A 2PTGA 3UAGA 4YT8A 1DXYA 1LXCA 4B4VA 3CUKA 1DFHA 3H3JA 1GUFA 4ZQHA 3WGGA 1H9AA 2IODA 3NDJA 1I2BA 3G79A 1Y9AA 4CL8A 4ZQBA 2GNAA 2VCYA 5TRTA 3VPGA 4MIOA 5TGDA 3AUAA 2ZTMA 4ITUA 4YXFA 1PSDA 2BI7A 1PS8A 2IEBA 4FJ2A 1PZHA 4NK5A 1HF3A 2X8LA 2EKQA 4D43A 4OL9A 1IULA 3G3EA 1CDOA 4IJUA 3Q0EA 1YL6A 2D0IA 3ZCXA 4FJ1A 4YBZA 4EUHA 4MKXA 4R69A 4XYBA 3QIVA 3GDOA 3GY0A 2E49A 3OFSA 1XG5A 1JWAB 5BNFA 4E5KA 1U9JA 4JGBA 4GBJA 3V1TC 3DZGA 2O3SA 1HDXA 2G1UA 1AE1A 4OHUA 2IYPA 2FSVA 3O9ZA 2D3TA 4RGBA 5T64A 5CFZA 1S7CA 2B35A 4FW8A 9LDTA 5MGBA 3LVFO 3L4BA 2ZYDA 3JQGA 2P68A 3ROKA 1YOVB 2AQ8A 2PD6A 4RORA 3NTRA 4XCVA 2E4AA 1MG5A 2C7GA 4LVCA 3FI9A 3QRWA 1X15A 3ABIA 4O6VA 2DTDA 4L8VA 4LMPA 3QWFA 4E33A 4CLRA 5JO0A 4EUFA 5GZ6A 3V5NA 3FBTA 3QHAA 4IDCA 4RLSA 2ZYGA 3QW2A 5I7VA 1T26A 1CQIA 2OXIA 4HNHA 1GUZA 4W4TA 1KY5A 2JAPA 4IDBA 3L9XA 1V3UA 3BHJA 4BGIA 4UUNA 4N5MA 4BMVA 5TSDA 2VWPA 4YWJA 4R68A 2Q45A 4NI5A 5ITWA 3KVOA 4F45A 1K5HA 1NASA 2DBQA 1N7HA 3G49A 3DO5A 5AXDA 5LDHA 3FF4A 4Q3DA 2JFHA 2X1HA 5JDCA 3O8QB 1QYCA 1BTOA 3VPSA 1YWGO 2B37A 4W9NA 4Y6PA 4BO7A 4U6SA 5IZCC 3GGGA 2OFPA 3JQBA 4UUPA 3D4PA 1PQWA 4XQEA 4TWRA 1VLLA 3KYDA 3PHJA 1SMKA 3LT4A 4CLEA 2D1YA 4FDAA 2B5WA 4L9RA 1MV8A 2Z1MA 3PVZA 3MWDB 1V3TA 2P5YA 3GGOA 4J9UE 4W7IA 5IDXA 2YV2A 2RBEA 1SPXA 4JP2A 5DCUA 1O9BA 3JQFA 2YUTA 3NT4A 3OJOA 4NH4A 3WIEA 4ZQEA 2R6JA 3A28A 1GEEA 2H6EA 3GHYA 1DLIA 5BR7A 3R0IA 3GG9A 4L75A 3PK0A 1R4MA 4P8RA 1HSOA 5CG1A 2P9EA 2XXJA 3E5MA 4GKBA 4DQUA 1JAYA 3H7AA 4RVFA 4UEKA 3I9MA 1A27A 4L0QA 5EQFA 1DO8A 3L0DA 3F1LA 1Y6JA 1F06A 1AN9A 3GEMA 4IDFA 2JL1A 3QWBA 1GV1A 3TSCA 4IQ0A 5FI5A 4Y67A 1R12A 2W2KB 3GZ4A 4BGVA 1EFLA 3MCVA 3QP9A 4J1SA 1P74A 4DYVA 4HV4A 1AHIA 1KY4A 4ILKA 4CLHA 1LQTA 2JAHA 4NNJA 3KBOA 2X22A 1B8PA 2J3KA 2EKLA 4FC6A 3ZHXA 3NUGA 4D0SA 4DIOA 3K2BA 1XA0A 3DONA 1LJ8A 4JJFA 1E5LA 1O6ZA 4BNYA 1R66A 3ZW9A 4XWYA 2B4QA 5COBA 1I01A 3U49A 1ZVMA 3QE3A 3WB9A 1E7WA 3GEGA 3MEQA 2IEDA 4RPKA 3DR3A 2YHIB 3ZNPA 1TEHA 1Y8QA 5TC4A 2Y93A 1KOLA 1TB4A 3VKUA 3ENNA 5EPOA 1U3VA 1ZEMA 1QYXA 1G0OA 2NVWA 3DZFA 2AEJA 1V35A 3BMQB 4HXYA 4CM1A 3VH1A 3E6AA 5A3JA 1B26A 2H1SA 2WTBA 4F6CA 1LDGA 1YGYA 4LN1A 1WDKA 1OFGA 3ORFA 3K5PA 1T1RA 1NBOA 4GLLA 1W8DA 2VQ3A 3GFGA 2BMAA 1FK8A 1YKFA 4RPLA 1Q0QA 1N92A 2QYTA 4RLHA 1H6BA 3D5TA 1NPTO 1Q0HA 3QVXA 2PK3A 1U4OA 4WCFB 3I3OA 1BW9B 4TKMA 3WWZA 5JE8A 3E9NA 4XGIA 4JNKA 3IAHA 1QRRA 4XRRA 4YAGA 3GEDA 3PGXA 3AW9A 3T4XA 4ALLA 4YEDA 4CR8A 4CR7A 5JNLA 4N7RA 2UDPA 1HETA 3R3JA 1H93A 2XF8A 4FSHA 5JXWA 4WLFA 2ZJ1A 1VKNA 1XEAA 3UXYA 1ISFA 2I66A 3TZKA 3QVTA 3RJ9A 5BSFA 1CRWG 2X0IA 2B5VA 2NVBA 2Y68A 1E5QA 4IUYA 4IS3A 3KRTA 5DBFA 1C3VA 2H63A 2ZIZA 5IAAA 1PJ3A 4GQAA 2CSUA 3VTFA 3ZHZA 3JTMA 1QG6A 2J5QA 3NAQA 1ULUA 1UP6A 3QWAA 4GX0A 2RIRA 3AUUA 3IQDB 4WCFC 3ANMA 3EVTA 4EI2A 3W1VA 3WLFA 1VL0A 2GN6A 3HSKA 3IC5A 3RFVA 1YB4A 4YJHB 4R5HA 2Y99A 1T2DA 2C2YA 3E18A 2ZB4A 3F6YA 3PLRA 3PQEA 4PG5A 4IZIA 4RPHA 5L3ZA 1DIGA 2ZQYA 2CZCA 3T7EA 3CTMA 4A03A 2VNSA 3BTUA 1AUPA 4J2HA 2Q50A 4MVJI 3ZW8A 1JLLA 2RH8A 3T7CA 4LVUA 2DU8A 4S1VA 1HRDA 1LLCA 3KSZO 2AQHA 4BNMA 3M6IA 3I9LA 1KVUA 1LRKA 3I9KA 1ADBA 4PGFA 1I2ZA 2NACA 3WYEA 1RYEA 1WXDA 4NFHA 3UVEA 3IKVA 1C0KA 1VRWA 3ZWCA 3KTDA 3BMCB 3NEPX 2HMSA 2Y1OA 4L73A 4I9NA 1E6WA 2X5KO 1UJMA 4N54A 4O0LA 3GMSA 1H0KA 4XQCA 5DNAA 1CETA 4EJ0A 5AXBA 2WM3A 2Q1SA 3PIIA 3S2EA 3S2GA 4CV1A 4YT2A 2IZ1A 3GPIA 3JD0A 3RU9A 3PQDA 3HB5X 3HDHA 5A9TA 3RUHA 1XELA 4D3FA 4DWVA 3H9QA 4PCVA 4CMGA 1HE2A 4RCVA 4OMUA 3P19A 1VSUA 4RO0A 4ZD6A 4MVJH 1LSJA 2D8AA 3DFZA 5A05A 4BNUA 3E5RA 1M75A 2Y1FA 5TT0A 3G1TA 3SEFA 3DMYA 3H9JA 4PG6A 1EUDA 5BSEA 4XQGA 4R1NA 3JCZA 3WNVA 1UZLA 1DC5A 3B20A 4B4WA 5MDHA 3D64A 2NTVA 4WCDA 4J0EA 2HK9A 3H5NA 5IFLA 3PDUA 4AJNA 3VHRA 1GEGA 1JVSA 1HE3A 3FNHA 3IS3A 5KJ1A 3CSDA 4FGWA 1HE4A 4XB1A 2PKQO 4PLVA 4BNFA 5ITVA 1F0YA 1DRWA 2DAPA 4MINA 4DLAA 5C3MA 3CZRA 4Q39A 3DBRB 3Q11A 1Q7BA 4BNVA 4DL9A 2EXXA 1O94A 2X0RA 2ZTUA 1LDBA 3NJ8A 1WDLA 3BTOA 3LT1A 1KVQA 1ISIA 2P9GA 3KYBA 4XA8A 3VDQA 5K6AC 2X58A 4BO0A 3RUFA 3WQQA 5EESA 3ASUA 5FEUA 1VL8A 3W4IA 2F1KA 3DZIA 3ZDFA 1EK6A 1GZ3A 5FYDA 4LMRA 2JHGA 1EK5A 1BGVA 3CKYA 3L6OO 4J4HA 4AJEA 1ONPA 2W90A 1HXHA 3LT0A 4ESOA 2C7VA 3PP8A 5C37A 4AJKA 2BELA 5A02A 4II3A 3UUWA 3FR7A 2QRLA 2UUPA 4ALMA 2IYOA 5THQA 3JQCA 1DEHA 2EGGA 4CLXA 5U9CA 1U7TA 3RD5A 1EDZA 1EE2A 1FDVA 2H5LA 1JKJA 3PHLA 1GQ2A 2J5KA 1I5RA 1DSSG 4ZU3A 5FI3A 3SJUA 1ISMA 1EE9A 3GMDA 1LTHR 4U7WA 2X0JA 3QWHA 2IDZA 2DFDA 4EUEA 5ER9A 5IDYA 3L6DA 1XIVA 1K2WA 4MVJF 3ZWYA 1Q7GA 1BXKA 1XWFA 2A9FA 4FIZA 3E8XA 3KUXA 2F00A 4I08A 2DBVO 3EUWA 4FQ8A 4HBGA 4BKRA 3KXDA 4D41A 2GPTA 1B0AA 2O3QA 3BAZA 1IHXA 1GYRA 3UH1A 4ZA2A 4CM8A 4ALJA 4KMSA 1SB9A 1K89A 1H6CA 1VPDA 5T6BA 3E82A 3OBBA 1D1TA 1DHTA 1EEHA 2Q3EA 1RM4A 2TMDA 3IDSA 5DZSA 2NU9A 1KETA 4R3NA 1ZUD1 2WD7A 2A94A 3FWNA 1LEHA 4KDEA 1T4BA 3K8ZA 2D2IA 4R9SA 2JCXA 4B8ZA 4YJGA 4B7XA 3JYOA 5KVCA 3WTCA 1C0LA 4XYGA 1UDAA 1R0SA 1C0IA 4RDIA 4ZRNA 4E2WA 5I7EA 1WVGA 1IUKA 1SC6A 4LK3A 4G2NA 3PFWO 3MTGA 4QXMA 1JVBA 3WGHA 3LLVA 3ON5A 2ZQZA 1E92A 3GN1A 4ZJUA 1UZMA 3JQGB 1MFZA 3LLSA 4CM6A 1I2CA 1DJQA 3AI2A 3LF2A 4G5HA 5F1KA 3DTTA 1UZNA 2J3IA 4DC0A 4E13A 4ZHSA 3DTYA 1YL7A 3AJRA 2WWRA 1N9GA 3FTNA 5EIOA 1HTBA 4CJXA 2DPHA 4R1SA 3K2EA 2YYYA 5I9LA 4J7XA 2XPCA 3W4KA 5JY6A 2IZZA 4IDAA 1G0NA 1XCBA 3BTSA 2OZPA 1GYPA 3WGQA 4YACA 1B14A 2JD2A 2JCYA 3FD8A 3OETA 4IDGA 5L4LA 2PNFA 2B4TO 1NR1A 1VJ1A 2Q4EA 1J4AA 3PWSA 1LSUA 4R1UA 3DL2A 2GD1O 2QYSA 1PQPA 4YT4A 4LISA 1HZJA 4TKLA 2BLLA 3TN7A 2PD4A 2GYYA 3DEYX 3H2SA 1D1SA 4QT0A 2DBZA 1NXQA 2O7SA 2YFQA 6LDHA 4Q3NA 4CPDA 3EW7A 4D79A 2FPGA 3RROA 3GVPA 3KYDB 4FGSA 4M86A 1PGPA 5JAQA 5L45A 4DMMA 3MOGA 3L4BC 1K0UA 1WNTA 1TT5A 3D5QA 4CODB 1WPQA 3ZI0A 1GU7A 5KCZA 2EW8A 1A7KA 3E9QA 4FBGA 4YAKA 1RPNA 4HFMA 4J1TA 2FSSA 4L4XA 1Y81A 2EERA 3QVOA 2VZ8A 2X86A 1YDEA 5F1OA 2Q99A 3LF1A 3E9MA 1GZ4A 1QV6A 1CF2O 5G4LA 1DFIA 3IP1A 1R4MB 3ZNQA 2AG5A 1FXSA 3CINA 4CMJA 5LDGA 2VWGA 1V9LA 1I32A 2UYYA 3WXBA 4E31A 5J23A 1Y5RA 4CMAA 3WGOA 5JDCC 3SX2A 4ALKA 3BIOA 3JSAA 1E3WA 3OECA 1WWKA 3F46A 4J1QA 4W9NC 2HJRA 4CM9D 2YY7A 3JQBC 4JLWA 1ZCJA 4XD2A 5KVVA 1TLTA 4NDNE 1U3UA 2ZCUA 4KWIA 3S8MA 5G4KA 5L7YA 2HKIA 3QSGA 1PJBA 2X6TA 3EY4A 3AM5A 5IXYA 4BGEA 1EUZA 1LNQA 3OQBA 1Y9EA 3PTZA 3ZWNA 5CEEA 4PLWA 3JQFC 1SCUA 4K9DA 1Y8RA 1B8UA 1LLDA 1OOEA 1H9BA 4IDEA 4R01A 4UREA 2VTEA 1Z75A 3D1LA 5CDTA 2G0TA 1I0ZA 1YS4A 2PKRA 2W2LD 5JW6A 2A4KA 3W6ZA 5L51A 3DMTA 3DHEA 3I4FA 3JYPA 1T25A 1JTVA 2Y0CA 3O4RA 4CM9A 1MXFA 1U2GA 4I5GA 5CDUA 4PG8A 5IZ4A 1ENPA 4XIJA 1JU9A 1A9ZA 1JAXA 4KZPA 1M2WA 1J5PA 2HMUA 3ICCA 4YVFA 2QIOA 4Z9YA 4BNNA 1MA0A 1NQ5A 5FFFA 2A92A 1PJ2A 1GTMA 4ALNA 4JBGA 4WK6A 2P4HX 4BNZA 3GQVA 3LQFA 1HYHA 4R51A 1RWBA 4OXKA 2ZJ0A 4WGGA 4O1MA 2YJZA 4TRJA 4HY3A 2CNBA 4FN4A 4O63O 3TJRA 1HYGA 1PS9A 2VOJA 2W2LA 2ZB3A 2W4QA 1XQ6A 2H9IA 3ZU2A 1HDCA 4E5YA 4A26A 3GPDG 4MOWA 4YDRA 1QLHA 1YL5A 1DC3A 4M55A 5K9ZA 1T2AA 4KQXA 2WMDA 4Z9XA 1E1MA 1W4ZA 3HUDA 2OP1A 4Y6SA 5IN4A 4U8GA 4YJFA 1OZAA 4IZHA 5G2OA 3TZ6A 3OA2A 3QQPA 4GL4A 4HNGA 1LC3A 3M2TA 3VAZA 2JCVA 2OHXA 5EQDA 4JROA 4BL5A 1H6AA 5COQA 4GX1A 2PR2A 4CLOB 3DBVO 3MJTA 3GH3A 4CV3A 1MXHA 2GLXA 5JFOA 2C54A 1ZJYA 3SXPA 2HJSA 4J1NA 4ZICA 1CQJA 3ENKA 3RCBA 3CEAA 4BB5A 3OIGA 3RC7A 3TPCA 5B12A 9LDBA 1X1EA 4BUCA 3H5AA 5CAEA 5TQVA 4ND1A 4WASA 2GDZA 1HDRA 4NR0A 1U2DA 3NTOA 3H8VA 3V2UA 4YQZA 3WFIA 4NK4A 1ZMOA 3KB6A 3BZUA 4D44A 1C1DB 5KOIA 1EVZA 1DC6A 3HZZA 2AXQA 1SNYA 2W98A 5CDYA 2I5PO 5F5LA 1LA2A 1EQUA 5KJCA 1UP4A 3H2ZA 3TFOA 4KUGA 5HS6A 1YBVA 2CY0A 1GCUA 3D7LA 4JBHA 1B3RA 5HBRA 3CIFA 3PIDA 2E37A 3ZWWA 1A4IA 1BVRA 3VZPA 1CERA 1H6DA 2UAGA 4ID9A 1Q0LA 4KDFA 4BO5A 1N5DA 1P3DA 2GN4A 1MC5A 4RF3A 4WLNA 1VSVA 1O0SA 4H3VA 3H4VA 2JJYA 2NQTA 1GCOA 3PZBA 5BQFA 3GT0A 3PWZA 3X2FA 4BS9A 4OSPA 1R37A 5A4DA 4NJOA 1WW8A 4R9RA 1YBMA 3DOJA 4FJ0A 2O3RA 4DXHA 3UHAA 3TF5A 1E3LA 3DZHA 5T57A 1ZK2A 1NVMB 3HDJA 2EV9A 4CQLB 4XGNA 3NKLA 2PGDA 3SJ7A 1B8VA 5COAA 3Q9UA 4I9HA 5DOVA 1U4SA 3GVIA 4LSMA 2I99A 4KTVE 4BNWA 4DMLA 3VZQA 1ZXLA 4UUOA 1XKQA 1JKFA 1LU9A 1LUAA 2V6MA 3WICA 3MJCA 1G1AA 5HTOA 1Z82A 1JN0A 4M89A 3ZWXA 3KOUA 1GD1O 1I24A 1BSVA 1IB6A 4J3FA 3CH6A 3B1JA 4RF2A 1ADGA 3M1LA 4L4RA 2QRKA 4AJHA 2G5CA 2GZ1A 2JD1A 4WUVA 4Z3KA 4A5OA 1I30A 4XR9A 4AJIA 1Q2XA 4EITA 2BF7A 3JYNA 1LX6A 3C1AA 1Y5MA 4KWHA 7ADHA 3LK7A 4J7UA 6ADHA 1R6DA 3R3SA 4U5QA 4BNIA 1QORA 2A35A 1I8TA 4RVDA 5EJ2A 1U3TA 1XYGA 3ZZNA 1ADCA 5CHEA 1KEVA 1GQYA 3BMNA 3GNQA 1L1FA 4YRAA 2BH9A 3ADPA 1NHGA 3FRJA 3MJ4A 3H5RA 1MX3A 5ILGA 1T2CA 4NBVA 1BXGA 3ZHYA 4MVJP 1XGKA 2Q2QA 5C7IO 2HDHA 3JD2A 4JX8A 1V6AA 5TJ9A 1U1IA 1GQQA 3NT5A 4ZVVA 2C29D 3RQSA 2D59A 4NBTA 4TSKA 3UKOA 2HK8A 3O03A 3W8EA 5IJZA 3NX4A 1WDMA 1D3AA 4WNCA 1HSZA 1K6XA 3RKUA 3AI1A 3LYLA 4JXKA 1X0XA 4IQ8A 2ET6A 1P1JA 2V65A 2FPPA 3D3WB 1DC4A 3TNLA 4WJZA 5JY1A 3OIFA 3PYLA 4YYZA 3KO8A 1ZK0A 4LSWA 1IE3A 4PLHA 3PFFA 4MVJD 5EL0A 4UUMA 1PGNA 3S1LA 2UV8A 3OIDA 4OXYA 3UF0A 3DAPA 4XJTA 4WPGA 4YT5A 2PV7A 2RH4A 2OBYA 4N5NA 1ARZA 2AE1A 5BSHA 2GZ3A 2GRAA 3QA9A 2CDAA 2AMFA 5C7LO 5CEFA 5LCXA 2ZB8A 2DLDA 3GN2A 4XIYA 2B83A 3QY9A 3R6DA 3RSHA 2DKNA 3H9GA 1BXZA 3FWZA 2VZ9A 2ZYAA 4OJNA 3KETA 3E48A 3WS7A 2P91A 4YRDA 5CPBA 3CMCO 1UP7A 3ZU4A 2P9CA 4LCJA 5TF4A 3ETDA 1CIVA
chains in the Genus database with same CATH superfamily
1TUGA 4A73A 4CMEA 4I99A 1ZK4A 2CHQA 4EHFA 4EAAA 1P44A 5I3CA 3T06B 3T41A 3K0CC 1VE7A 1YOBA 4FFOA 1CUGA 2M6SA 2AJDA 4PHCA 2ZBRA 3A14A 4W5JA 4YJGB 1P9LA 2VT3A 5DGTA 4B5LA 4M1EA 5DT9A 4CVNA 1SXJB 4NECA 2GMWA 4OFWA 4IY1A 5AVZA 2NTJA 2SCUA 1U7WA 3ECSA 1UJNA 3F7OA 3HDYA 4JJAA 5EWJA 4B35A 3ENVA 4DUGA 4EJ6A 6REQA 2J7PA 5JPDA 1D4OA 2ZCJA 3RJTA 1CUDA 4D0LB 2CVZA 4Z3OA 4CQMB 1SPBS 2DF8A 4OJQA 1FNNA 1KK2A 5BMVA 1VE9A 5CBPA 1GGFA 3L0ZA 4PCUA 4LDJA 1I3NA 5F3RA 3SLGA 2IF0A 5EGNA 3U40A 1ZISA 4YIHA 3C4QA 3JASB 1TZJA 4BE4A 4BO6A 4KQ2A 1IBKB 1KYIA 1ZM9A 3BM5A 3EH1A 3G0BA 5AVYA 4WWHA 3SVTA 2V7WA 1RXVA 4JIGA 5ALOA 4FYIA 2PQ6A 5ADHA 1HH4A 1MEOA 4JELA 3FPKA 3DDUA 5A03A 1XLTA 3BEOA 4RQBA 2H5EA 1OVMA 3HV2A 2XBLA 3IAM1 2AZTA 3L41A 4Q9DA 3X1WA 1PR3A 4B4OA 2JZNA 4C03A 4RKYA 4IDPA 3R41A 2PS9A 2EFHB 3PYXA 1UXHA 3D6UA 4I19A 4YAWA 5U1PA 3GLFE 2I62A 2QG6A 4WEOA 5IZCA 4BFTA 3Q3JB 2HPZA 3R1IA 3AVQA 1QNFA 4L3WA 2DGDA 2VSXA 2XGJA 3ONEA 3HRIA 4KQIA 3W06A 2H1LA 3PC7A 3Q9NA 2YOHA 4A82A 4O2BB 3GXBA 1KP3A 3T7AA 3W6PA 2J46A 4Z0PA 2Q4DA 3ZCQA 5IJ0B 1C9JA 1KU6A 4RD2A 1SOVA 2C78A 2BFMA 1VL5A 3L8GA 1TMYA 2Z3ZA 4NAHA 2CF6A 2O7QA 5FJJA 5K0SA 1TM7E 1ZS9A 3LC7O 4Q7MB 4D8XA 4F2HA 3I72A 1Q19A 1B73A 1G55A 4U6QA 2I6TA 4BO8A 4EI8A 2AGVA 3RIGA 4JT4A 4JLUA 3ELWA 2P9BA 3KSRA 2N1BA 1HNXB 1KI4A 1IZ0A 1ISHA 4U5XA 1S2LA 1PT9A 4FHCA 2FUEA 1NAHA 1UKEA 5C7OO 4ESVA 5TMEA 1TYEB 1ZGZA 4YX9A 4FUQA 3CVWA 2DPYA 2X2PA 4CM5A 2IXDA 2IXAA 2NZ8A 2ZFUA 3MLAA 2W2PA 2M6KA 2PVPA 3VH3A 3JQAB 4BU1A 1AKYA 4AVYA 4KOAA 2Q2WA 2WHPB 3RHTA 1AQIA 4ENRA 2EX4A 1L5QA 1ZHOA 3U44B 1K3TA 5D7NA 2JEYA 4NZYA 4FYVA 4NZPA 4DCVA 1K6JA 2BFEB 1YRAA 1V5WA 1FJHA 1L9KA 1XDDA 2IYVA 1VG8A 5JSKA 3THSA 1OXMA 1U7HA 3LY5A 1FZQA 4UASA 2IVFA 1M34E 4PRKA 3VSAA 2BZ1A 2UVPB 3F90A 3ZHQA 4CTJA 3WI7A 1BDHA 4V39A 5BR4A 4G07A 1A9YA 2NQ8A 2XYHA 4P3PA 1E3WB 1WP4A 3ZCRA 2P40A 3FYTA 1UXIA 2C7QA 1LDMA 2NADA 4BFXA 2BHLA 4K6GA 1O95D 5IKXA 3MJSA 2VCHA 1BIFA 3EGEA 3PHHA 4BN0A 4ZCRA 4CL3A 1G2PA 1HYQA 1U0HC 4HDSB 3HB0A 3T1YB 2QQGA 5C4MA 2DPXA 5AXAA 2HLPA 3UMSA 2V7VA 3MWGA 4FFPA 3IUBA 4FHGA 2H07A 4YONB 4Q47A 1OD6A 1MBZA 3MOSA 4UU1A 4WQMA 2PPVA 2HL6A 2XJ9A 3FYDA 1ZEJA 3RUPA 4C4ZA 4J1TC 3EPHA 3TH5A 1PJSA 4XDGA 3B3GA 2FR1A 2WFLA 3VKVA 1T8WA 4C7OB 3BA1A 4ID3A 4YHBA 1YQDA 3SCZA 1GQSA 3L6CA 5KC8A 3C70A 2ZSUA 5BSGA 2Y1XA 3TEMA 5JXHA 3KZKA 3PQ8A 2W58A 2CJWB 2NN3C 3ZW7A 2NXCA 2VOEA 1T8SA 1I9GA 4XEHA 4ZAWA 1JH8A 1VPVA 1QAOA 2GKSA 4CZ2A 2K2WA 3CISA 5CG2A 5CCXA 5AVSA 4XSVA 4OXNA 4RF4A 3PC3A 5IJAA 1BG6A 2EZ4A 4Z1OA 4LYYA 1W5TA 4MDHA 4XZ3A 3I2YX 4XSHA 3ZCPA 4IJ5A 4LKRA 3LQYA 1QR2A 2DQ4A 2EYQA 1JEQB 4UTOA 1SEVA 3O8BA 5KSYA 3B2QA 4DA8A 5AVRA 2FMFA 3QEMB 5EWLB 1LRLA 3R3HA 1IVSA 4MHTA 1CDDA 1FP4B 2CYCA 2LDXA 2W37A 3O26A 3QTTA 4NYMR 3RFXA 1AS2A 1JR6A 3PXBA 2PEYA 1SVIA 2C9MA 1EMDA 2WDZA 3K70D 1D4FA 2R1VA 2XQGA 4HJXA 5K6TA 3MFYA 4LRUA 2NTYC 5HS4A 4BV9A 5JTTA 5HGXA 1RWWA 4D3DA 4FC7A 4AN4A 3UJHA 1G38A 3H2KA 1GZUA 4NYMQ 4PRLA 1HGXA 5CX1A 4ZCTA 2BCJQ 4LG1A 1FDSA 3OCVA 3W8NA 1P6XA 1QLJA 1T1JA 1F38A 1SCDA 5FOVA 2VYCA 4U02A 5ILOA 1L7DA 2KHZA 3D8NA 4NY1A 4DEYA 5THKA 3F9IA 1MENA 4G81A 5HM6A 4TN1A 4ZQIA 3WR5A 4FR5A 4WKOA 3NO4A 1I51A 1CS0A 1PZGA 4KHZA 4U9HS 5CH3A 3LUFA 2HUPA 3SIRA 4RF5A 2VPPA 3E2MA 1R4NA 4PVCA 2VHUA 1FYXA 3ILYA 1U99A 1Z0JA 1LVGA 2YIJA 2RGEA 4F71A 5JDIA 1YJAA 1P77A 4K9LA 3AEXA 5EIFA 4ZI7F 4O3FA 1EFDN 3V9PA 1N1MA 1DX9A 4LOJA 4YR9A 5A1TA 3RGWS 1WSWA 1F0KA 4OP2A 3SYNA 3GB9A 1MGOA 2VDUE 4B6RA 1JEDA 2QUIA 2CLFB 2Q1UA 4C4YA 5TQ0B 5ALDA 4YASA 2HO5A 3W78A 1X39A 5BMVF 1BX3A 2VSNA 4LGCA 1Z8HA 4TLMB 1EG2A 1T0UA 1CQJB 2NYUA 3U62A 1EA7A 1EDDA 3EXAA 3AT1A 1XZAA 1V16B 2PZMA 2XDAA 3D2LA 3KPWA 2AMLA 1TW3A 2W0SA 1M5TA 4KSBA 4XVCA 5L3SA 3B3FA 1MOQA 3K8YA 4RYDA 2COEA 4N5LA 2WD9A 1PGJA 2DWOA 2FSFA 3LDUA 2R6CA 4ZO9A 4I1IA 1X7ZA 4D2IA 1RQXA 4BQNA 3FKJA 1E1DA 4EB6A 3P2YA 4Y98A 1YDGA 2VH1A 3PHIA 4YRRA 3TFWA 4C0JA 1JSZA 3GW8A 3NOOA 1O7JA 1NNI1 4Q9NA 4AWBA 5K8VA 1D2EA 2EKBA 3K0HA 1FP2A 1TPYA 1WOYA 4LXTA 4U7TB 3AY7A 2R4QA 2A9RA 4R8KA 3B48A 3V8RA 5B6JA 5HIKA 1EXDA 1G3IA 1N3BA 3F6RA 3ZN2A 3KPUA 2XWSA 2JFNA 3E84A 3JVUA 4QT4A 1E9RA 1NY6A 4PIMA 2Q3CA 1A2QA 4BO4A 1GXSB 2OV1A 1CLEA 4Q1CA 1LPPA 2R66A 3O1LA 3IEKA 3TEFA 4ROTA 3KHTA 4J90A 1ORVA 1GNRA 1T6BY 3FPAA 4DEXA 4Q24A 1EXVA 2G67A 1YJQA 4MYCA 4UC0A 3CRQA 5ALRA 4HP8A 3TB6A 2JIOA 4CDNA 3IV6A 3FGNA 3SN6A 1N5OX 1VG0B 1TVKA 1C14A 2HA3A 4B74A 2GD0A 3H11B 1V95A 3U3DA 1PHPA 2RGUA 2KBEA 2YWCA 4BKPA 5JCJD 2VJMB 1ZMTA 3TQQA 3JQ6A 3OCXA 3ZS9A 1MX9A 5LIRA 1J97A 3D4IA 4KLZA 2ZYRA 3CCBA 2JKVA 3FYCA 4N40A 4UZSA 1NI4A 4JVSB 3VZSA 4ZV4A 4F5ZA 5CDGA 1AUOA 1NLMA 2PGLA 3MWEB 2FPXA 1LFDB 2Z83A 1RXSA 3BAFA 3FA2A 3FWPA 3IPCA 4UXHA 3O95A 5K3OA 4RTSA 3GWGA 1JF8A 2X19A 2QPOA 3U9TA 5HJ5A 2IITA 1JPNA 3OFND 2E4WA 3OQIB 3E5HA 4GHWA 3WRXA 5A3VA 3RJMA 5EQTA 5C35A 4KYTA 4BO1A 2XECA 2RH9B 3WLEA 3NMUF 4I3GA 1QIIA 2CF5A 3BD8A 1U8YA 2CUKA 2IUFA 4NARA 4GGOA 4IVRA 4M2LA 5JYDA 1K6IA 4U2CA 3C97A 4BAUA 4C22A 4Y30A 1ZKMA 3LX8A 3CNNA 1V3QE 4BX3A 4AN1A 1IXKA 1E2BA 3PXUA 3PNLA 5A2GA 2ODNA 1LSOA 4FSXA 1D1QA 2Y4NA 5BT9A 1ZH8A 4J0GA 4BX8A 4PPGA 4PLGA 4GWKA 2R68A 2VSYA 3OF5A 4HZUB 2BFPA 3NEJA 3HRHA 1MO4A 4IQ4A 1KI6B 2V7QD 3KQPA 3EE6A 3VNBA 2EWWA 4X1IA 2PH5A 3AL3A 5BVGB 1F2UB 1SB8A 1YF3A 1Y42X 2PT5A 2RC6A 2JHFA 3LH5A 2WT4A 4OSOA 1X7HA 2G06A 4E3WA 1JHPA 1F6WA 2WF9A 2D74A 2E4ZA 1HTTA 1R6BX 2R8OA 1SKYB 3QF4A 3HS3A 3QU2A 3AM3A 3DZKA 4MGKR 3D8TA 4NCNA 3V97A 4CV2A 4Q4HB 2ZTLA 2X41A 3CY6A 5KAPA 1ZIPA 3JD1A 7AT1A 3TFQA 4MWEA 3UCEA 4B3XA 1V8BA 2X9LA 1XI2A 3HFRA 4I50B 2HPHA 2W8BA 2ZS9A 3NGLA 3BMNB 2CLLB 4G4JA 3CZMA 3JQEA 1K7EB 4BQFA 3WGZA 1J8QA 4MQ6A 3UHFA 4DDUA 1L7VC 1R5BA 4RJ2A 3BFPA 2BBSA 1U28A 1T9CA 2WY2D 4FFBA 3ZHCA 4EW3A 3PTAA 5FBQB 2R00A 3DV0B 1NNUA 1FMJA 1G6HA 1Z6YA 2WMOB 5EIBC 3RW9A 4AMUA 5LJIA 1ENZA 3WYFA 2OV3A 2XYVA 1V8DA 2AT1A 3TTXA 5CBKA 1RYDA 1H3EA 3MTIA 2VTBB 5ED4A 1AGNA 1E2JA 1LZKA 4P31A 1Y8QB 3VDMA 2CEAA 4PBTA 3TINA 4CW7A 5I7SA 2YYSA 2Y3IA 1SC9A 5EIEA 5IYZA 2VT6A 1S4MA 2BUBA 4F9TA 2QM0A 2RHBA 1BHSA 2CCKA 1UH5A 3RC9A 4EEKA 5KWVA 1OXUA 1HA3A 2ZIVB 4M87A 3RC1A 3ZOKA 3SSNA 3B38A 2I2DA 4NZOA 3TS1A 2FPIA 2HXGA 3E8SA 2QWXA 5DNVA 1ZMRA 4F2DA 4CKBB 4BIIA 3RM3A 3STTA 4MWSA 2FE4A 3OQ1A 3V1LA 2CNDA 1H0HA 2N47A 1EHYA 4EBFA 3OPYA 2NO4A 1PR9A 3KUCA 3AUKA 2B36A 1GNSA 4ND2A 5A3QA 1X7WB 3RASA 1A8UA 2F1OA 1ZH2A 4B46A 4LFAB 5FPTA 1FFSA 3DLPX 3GLRA 1MX5A 1XT6A 2EBWA 2RFLA 2W7TA 1DTWB 1U04A 1X1BA 3SLRA 4EHAA 2C20A 4IIHA 5CB8A 3RODA 3VYWA 2YVKA 1UT6A 4R98A 3QVMA 4WNYA 2VYNA 4OBEA 3RRFA 4PZPA 2OBMA 3U37A 3U4QA 4D82A 2H1OA 2VJPA 1JQEA 1P3JA 3MCTA 3V4SA 2ZIFA 3I0ZA 1TU3A 3AM4A 3WBFA 3WL3A 3DMPA 4MLPA 4HAVA 2Z8ZA 4HS9A 3JAKB 4PQYA 2FG6C 4ZDIA 1SGWA 3SX0A 4O2AB 4LRWA 4RJTA 4BIMA 3UG6A 4P4UA 5FLYA 3KEGA 4BFCA 4ARZA 2VL7A 1CNMA 1CB0A 3B13B 3VJMA 1XEFA 2E82A 3F7TA 3KD3A 4IMIB 4X20B 1V1JA 1Z4NA 1EUCB 1NSYA 3GFTA 3HCFA 3KKNA 4OY3A 4PS1A 3HBLA 3FDJA 1VJGA 4DVJA 1NKVA 4EG1A 4XWWA 2JG3A 4JI7B 2UUOA 4DMHA 1N6KA 1FP1D 1IH8A 3P9QA 4NQZA 4QYMA 5B4UA 3QYFA 3E9YA 5I7UA 4LDRA 4ACBA 1LPOA 1DRVA 2AEFA 2OHGA 1S3FA 1VGRA 2XRMA 5FBZA 4CCYA 3K6JA 1KYWA 1OYVA 2QTMA 3G13A 3TLKA 2FP4B 4FNGA 2Y76A 5E2BA 1JFVA 5IVKA 1DFGA 1EAYA 2QS9A 3NVAA 1CFJA 5AK6A 3RVSA 5A6VA 1KEKA 4RK4A 3QX8A 2FUKA 5HFJA 3WNBA 4B3FX 3NIWA 1GTSA 1B8NA 4CTMA 1RD4A 1RIIA 1WLYA 2FR8A 1QPGA 2FJPA 2VT2A 4P82A 3ZK8A 2I80A 4E14A 4V24A 1WE2A 2VHTA 1PEYA 2IYYA 4QDXA 5JQGF 3N1UA 1R10A 1K8ZB 1DB3A 4IKPA 2ODTX 3B1FA 5AVKA 4CMEC 5TQ2A 2X9NA 1N8KA 1XZIA 2VDKB 1XZ8A 4LSZA 1THTA 3RB8A 1QP4A 4HNAA 4JN6B 2R4UA 3SD7A 5HSGA 3KQUA 1L8QA 3HXPA 2RGBA 5HRUA 2EQAA 2VXYA 5TF4A 1KMQA 2DPGA 4YFYA 4ZP1A 1P2BA 4KPYA 2HSWA 1Z73A 2Q07A 2YVQA 2YIMA 3GPLA 4MB6A 2AYXA 2MOKA 1HQKA 2AN9A 1C4KA 4E4RA 1EWTA 2QQ0A 3RGGA 3DDNA 3VJRA 4L9AA 3HWX1 4LRSB 4XQ9A 1OKKD 1XHEA 4QUBA 4B82A 1HDOA 1H3FA 4EZIA 2XDYA 3CCFA 2HA5A 5B6IA 2JLWA 1V26A 2PMCA 4DDHA 4FNAA 4BV8A 5JH7B 1DWQA 1EFRD 3PL5A 3KZOA 4ODIA 1THGA 5GOZA 3S55A 1CY4A 1YDMA 4DJ5X 3RIHA 3VMMA 4LZAA 2QX9A 1M1YE 1QK4A 4QDOA 1IBSA 4E11A 1QIKA 1CZLA 4R4JA 2TMKA 2YYAA 5T67A 5BV2P 3AR7A 3OP1A 2CNWA 1KH2A 1G60A 4IHJA 2RGCA 4OFBA 3WG9A 5IUNC 4GMFA 4HATA 4JI8B 1XLTC 3OZRA 1Z2DA 5KVSA 4OJMX 5GZ1A 2XVAA 1WCWA 2ALJA 3Q15C 4PO3X 4XUCA 2A3RA 1AUXA 2B69A 3GUCA 3TWOA 4UNIA 3KAKA 1GKYA 1JXQA 2VHZA 2X13A 4N6NA 5EJMA 5M34A 2GYUA 4INAA 5CGQB 3DHYA 2EDAA 3A6KA 4BLUA 1G8GA 3PA8A 4E2YA 2C96A 2WSMA 1RI5A 2H4WA 1N5IA 3MRVA 4NG5A 2J3JA 4RVSA 5L40A 2ZREA 1PW5A 2IDMA 3GZNB 2J9ZB 2YNMC 3ZWVA 1DC7A 2HSEA 2RHOA 5AW9A 4Y2RA 2CDBA 2GHTA 3MHPA 4RLQA 4GSKA 3U13A 4UQLA 3ESAA 3JPWA 4BLOA 2P2NA 3DQPA 3I04M 2VH2A 3L1VA 2PL3A 1MC8A 3SDZA 3PITA 1C1XA 1NBHA 1BCRA 3BSWA 3E4DA 4U00A 3H19A 4CQMA 2H4FA 4KXLA 2VRBA 4N8EA 4FCCA 2WYWA 4DR1B 5IVHA 2ZE8A 2AFVA 3NC0C 3O3CA 4FE4A 3EMKA 1QH0A 4ILEA 4IM7A 2F67A 2XNJA 1JWLA 2ZJ6A 4A0SA 2OSBA 5EKUA 4D99A 5DM1A 4AUKA 3Q5DA 2A1TS 1ZY2A 2VHXA 3QJYA 1NTRA 3SFZA 4QXOA 1OGYA 5C34B 1T9HA 2O3JA 4YQFA 2WF5A 5IH7A 1LDYA 4RVOA 2QE7A 5JLAA 3G23A 2VDPB 1E20A 1NRIA 3KYCA 1Z07A 1AK1A 4YMSA 3DMGA 1MX1A 1PQ4A 1YUBA 3CG4A 3UW3A 2IOFA 2IRWA 1TGVA 1HMYA 4C7JA 2CXSA 2OILA 3OX3A 2HDNB 2RGRA 1VCOA 3K8OE 1IY8A 1IM2A 1VMEA 2LVBA 3GRVA 1QZUA 3WJAA 3FSGD 1RI1A 2CFOA 3QA3E 3HMQA 1RLUA 3L05A 4YS6A 1Z6TA 1PNRA 1CYEA 5K03A 1F8FA 3G89A 2VAVA 3HA7A 4WV3A 4RTJA 3F1KA 2FQYA 3VPHA 4C0XA 4D57A 4WLVA 3CVVA 4HAXA 4F3RA 2IHYA 2C4TA 3N0VA 4R16A 4TS3A 4WZAE 5K8IA 4U8HA 4DLBA 4JYZA 4Q19A 4W8HA 2JAXA 2A9JA 2FMHA 3VU8A 5C1PA 2BE9A 3PDJA 3Q5EA 1OLOA 1OROA 2O3TA 4M6WA 1JT2A 4HEA1 4UVGA 5LA6B 2XE8A 4N0DA 3ZWBA 4X8OA 1B7GO 4F12A 4H1WA 1HQYE 2ANBA 4OBWA 4BKUA 3O75A 1UBJS 1OXVA 3P27A 2W6ZA 1J06A 5DP2A 4M1WA 3VHXB 3IAUA 4UXJA 1X0VA 2BFCA 2B8JA 1CEQA 2BDEA 3ACDA 1NVGA 3CF6R 3ET5A 3M5CA 4TRNA 3SG0A 3TDNA 1DKNA 3BICA 5BSUA 2DYKA 2VDLB 1TU0A 4HLUA 3AW8A 4XM1A 1Z6XA 4NFSA 1YQUA 3IODA 4NE2A 4TWIA 1E9BA 1THMA 1NZDA 1JR3D 2IVZA 3N2ZB 3NHFA 5EWMB 4HDOB 4RD4A 4F60A 1A1VA 1KBZA 3Q1LA 4I1SA 1C7IA 4NIMA 4TTTS 3U31A 5JYEA 4KOEC 1XRNA 2I33A 2R48A 4GSLA 1XRMA 2GO1A 3OSZA 3ROQA 3TZBA 3KTAA 2W6OA 3AKDA 4EY4A 3ONFA 3BMOA 1GTL1 3W4JA 1FSGA 1HE1C 1U0SY 3ORYA 4PRYA 2PL9A 1EXWA 2X8WA 2CHFA 2NWQA 3H17A 4GOOD 5CM9C 5GQSA 3LFHA 4MZXA 4H3KB 4Z3DA 3A10A 4UUQA 2ZXFA 3CE6A 4MKGA 4HRXA 5L9AA 5ADUS 3GPCA 2OM6A 1U1CA 2DH5A 3GDFA 3MGKA 3PV0A 4KC0A 1NNSA 2J09A 4PVDA 3I6QA 1O87A 1E1CA 5IAAA 3NRCA 4Z4FA 1ZG3A 2Q7XA 5DASA 3F0TA 2XZTA 5TPZA 1IQ0A 1SXGA 1DP4A 3E22A 1M8KA 3FVQA 4KU4A 4UM7A 5M2QA 4PG4A 2Q5IA 4HWKA 4C30A 1U0RA 1ZX1A 4M9QA 1NFRA 1XRJA 1JIIA 4YXWD 3UOGA 1CYDA 1KEZA 2Z95A 2BVNA 3C0KA 3LY8A 1Z7EA 3AERA 3L2OB 3N53A 4MAAA 2H3HA 5AOAA 3UC9A 3FR8A 4A7PA 2EBFX 5HA5A 1RWNA 4NCKA 1OFUX 2EP7A 4KPEC 1RAEA 2VKTA 3IP7A 1BD4A 1SAYA 3FTQA 3K96A 5KYUA 4X7MA 1CRZA 1B41A 1L3IA 3SX4A 3AJEA 5IC6A 1TYCA 2VP4A 3SPXA 1JEYA 1QB7A 1ESNA 2DUWA 2OB2A 2XOKD 4JL8A 2AVDA 1XMSA 3F4KA 3H0KA 5L3VA 3L40A 5JDIC 1S1CA 3SLKA 2IOYA 2ZVPX 1E6EA 4Q3EA 3PQ4A 2JGIA 3RYFA 4D9IA 3WGIA 1WB4A 2ERYA 3OCUA 1FBTA 4XFDA 3I28A 3JWEA 1M54A 3QV2A 4H16A 4DCTA 5A5FA 4C4RA 3P97A 4MWTA 3D4NA 4JYMA 5TB5A 4DAEA 2BEVA 5FUMA 1PN3A 1H2HA 1YAJA 1CUBA 3IOYA 2BIFA 3Q2IA 4FEYA 2PJUA 4NENA 5FI1B 2IUUA 3H83A 1XTBA 3B12A 3R7WA 1KH3A 1RRFA 3G5TA 1YRBA 4GPD1 2RHHA 3C5WP 2ZJ3A 3HVKA 4MUMA 4YIKA 3BQ9A 1TVCA 5AK3A 4YJ2A 4MGYR 4DB4A 3U61B 4WFJA 4DLTA 1I0IA 2GZ2A 1J2JA 4G09A 3INTA 3SNKA 4J0IA 5HK8A 4EA8A 2WILA 3FLEA 3KIPA 3DDOA 4LZPA 4GXQA 2I34A 4P6VF 4QBHA 1NXSA 2VN8A 4YMGA 1ZN2A 3DBHB 3DQZA 2YHUA 4WOJA 2F9FA 4BVKA 3EZYA 4NL4H 1QXSA 5ALZA 3YASA 3WO0A 1EFTA 3DFMA 3TOCA 1K6EA 4PW0A 4DWJA 5BRAA 4RH0A 1T91A 3KDSE 5AP9A 1DMSA 3GARA 1JQAA 2WSSA 3ZY5A 5JSUA 4B40A 1W25A 5IULC 4PC3A 1KTVA 4KUEA 1PEDA 2V03A 3SKVA 1L6IA 1JNXX 3C8MA 4NPAA 1TZKA 3NONA 3UWDA 3KUUA 4BNLA 4MKRA 4CDGA 4UATA 2P78A 5CVVA 4ZQCB 2GB4A 3RVLA 3SC4A 3MUOA 1BN7A 3DL4A 1LBEA 1FTGA 4EYEA 3O8QA 4U0KA 3BJIC 3H6KA 1AA9A 5E7JA 4LC9A 1G4AE 2HMVA 4C7KA 3SBXA 4WFIA 5C3UA 1LK5A 2NX2A 3Q7RA 3R5XA 4WUTA 4WBXC 1PBNA 4FGKA 2AYZA 1KJIA 1Z4JA 4WI1A 1NUPA 3FOBA 4RMHA 2HGSA 5JV5A 1RXWA 1SVOA 3UICA 3ETCA 4JL6A 4CQLA 2P9QA 3TKYA 1PZMA 5K8LA 1D07A 1BQ4A 4K6MA 1HV8A 4Q9AA 3FZQA 2QLBA 3LW7A 3S7ZA 5BXQC 4ENSA 3TCXB 4BWFB 1K75A 1NTOA 1ZUIA 4K28A 4DYDA 4XWTA 3F4BA 4NABA 3PHGA 5HFAA 2NU7A 2V0CA 4QRDA 1P7CA 2Q4BA 3SR4A 2O2ZA 5KI6A 1OPRA 1T3TA 2XBUA 2YZGA 3HNRA 3IBGA 4DG8A 3KKLA 4BEWA 2YS6A 3P9NA 3AUFA 4XRGA 3WRXC 4ZGBA 5DHTA 2FQ1A 4JSYA 2ZUVA 4YV1A 1SCQA 3THXB 3GLVA 3QMVA 5CEJA 1CJCA 3D2CA 3IEMA 3FB1A 3DZDA 3ZK7A 1E2PA 3K1ZA 2IKQA 5T3UA 1HDYA 2WLSA 4RHEA 4UM9B 5JALA 3E8MA 1ZYUA 3H2JA 4DJAA 2JLXA 4BCBA 3GFRA 4PQEA 3I5MA 4IIJA 1LCIA 2NLOA 2WUVA 3HNPA 1KJNA 3V8MA 1X8KA 2EZ9A 4US1R 4D3YA 4Q05A 5DTQA 5JECA 2HAEA 3FFBA 5CLHA 2ETXA 3VKGA 3WKEA 5CT9A 4FZ5A 1KHHA 1QUEA 1V1MB 4K9OA 2IYUA 1D03A 2BSXA 1L7OA 2A5JA 3UB2A 5KS2A 3KKEA 1J8VA 4UVHA 1GCIA 2YQ4A 3QOXA 4KO8A 4Y6GB 3V42A 4A0HA 1EFKA 3L92A 1BAPA 3KUDA 1Q7RA 1O08A 1P1CA 3LHDA 1NW3A 4AMGA 3K6SA 3WYCA 4E21A 3RKRA 1W44A 1ESEA 3HB4X 1XTJA 1ADFA 2GN8A 2H17A 5ALWA 4TQGA 1P1FA 4D46A 2GVZC 3EA5A 3H86A 3SYTA 2I3ZA 2XDQB 2L69A 2ZVDA 5I9BA 4DR4B 4D9GA 4K6OA 5K20A 1FPMA 4GE0A 2XAUA 4XX1A 4DCCA 1R16A 4DF3A 1ULHA 5IH3A 2C95A 1GPJA 2Y67A 3FCEA 3QELA 2WU3A 4EGJA 5L4SA 3HYCA 3EXFA 1WX1A 2WFMA 1K7SN 3FNBA 4AZ3B 1GUAA 3S2YA 1A4XA 3H0EA 3P45A 2JJ8A 4F46A 1U28C 4EMTA 4Z7OB 5CD1A 1AZTA 1G9TA 3W6UA 4B2LA 2R00C 4TL8A 4EKDA 4TTPA 1C4OA 4EG8A 1GARA 5FOQA 4C7BA 1VBNA 4G9EA 1VXRA 4CI0B 1OVGA 4O25A 4UTPA 1E7YA 5M29A 3FNFA 4BFSA 4I5IA 2YV4A 3BXGA 1P5FA 5EA2A 3SEZA 1QFYA 3PXAA 3BK1A 4WGFA 3R6WA 1XA4A 5IAOA 3M4JA 1US8B 3LKDA 5GGYA 4MQFA 5JBIA 3F47A 3IAAA 1QYIA 3WGTA 4Y1GA 2WWYA 1V7ZA 5G3ZA 4ND3A 1K27A 1Z62A 1NURA 5C8YB 1LS1A 4R0MA 2AC2A 3FPHA 1JDBB 3SBDA 2GERA 5AESA 1MN6A 3CJQA 1E3IA 1O89A 1WTCA 1XSEA 2FG5A 5GVRA 4FILA 1IYZA 1FFXB 3OEHD 3F96A 5MGNA 4UFPA 2Y1EA 3TSOA 4IF4A 3ADOA 3Q6MA 3UFBA 1E0AA 3E1GA 2PKCA 1KYTA 2X5XA 1XMPA 1EXNA 5JSFA 2ADOA 3V2HA 4BVEA 3PC6A 1CUZA 1JI3A 1TMOA 1XU7A 2W2MA 3EUAA 5B1SA 2N75A 4E5SA 4CUKA 5LB2A 3C3YA 4KHPB 2V96A 5CAEB 3HADA 4RY9A 4DLVA 4Y9SA 4JJEA 4J16A 1M6WA 3LBFA 4A2CA 1FYEA 2DT8A 2VUSA 2B6NA 2I71A 2QY6A 4M1YA 1II8B 3NBAA 5DF1A 2B3TA 3JD3A 4B7AA 1RKXA 1UQRA 4YC7A 5E0KB 3V7FA 2JLBA 4KE6A 2NYRA 4LOHA 2IIVA 2VJLA 4TUYB 3ZZMA 2O2SA 3EISA 3VOSA 4Y1RA 4DIBA 3OZWA 1DVRA 2V7UA 5KO2A 1TF5A 2RG7A 1KF0A 4WTOA 1K3UB 2PWZA 1UJBA 3LU1A 3ZBTA 3G5UA 1M1YA 2G28A 4TXHA 2YWJA 1U7DA 1W8IA 2OGTA 1EUQA 2ZUFA 2JEZA 3E7WA 1GAXA 4OHRA 3W5CA 4A8PA 4ZVPA 3P2JA 1YDWA 2W6JA 1OAOA 6NULA 4UU8A 2FN4A 1CULC 3HWSA 3QHPA 1ZK1A 2LRHA 5EKSA 2B99A 2FEAA 2Q0SA 3K1AA 3WB1A 4FMDF 8AT1A 2QUAA 4PSUA 4JLPA 3VR2D 1XZPA 3C6MA 3S40A 2NOAA 1ZI8A 3TKLA 1UZAA 3SQWA 1JQBA 1RRGA 4AO7A 1W2HA 1E2KA 1QC5B 2TMGA 1UJ2A 3D4BA 4CMIA 4K1LA 1U5AA 2VZ0A 4YJHA 3AB8A 2RB4A 2QQ5A 4M8LA 3TE6A 3DT9A 3PCXA 4NZMA 4NBUA 1VRCA 4H7PA 5AVJA 4EELA 4YP6A 1GDDA 3CEJA 3WLLA 4EMBA 1ODLA 2GPSA 3EZ6A 2A0YA 2QTAA 1Z16A 2JGMA 2RARA 3Q2KA 3GRKA 4KBGA 3ULKA 3B6KA 1R0ZA 5FLKA 4XLLA 3F6EX 2PX6A 2X0EA 4JT2A 2FQWA 2RCYA 1R8JA 4RXTA 4M38A 4B4KA 4Y0VA 4Z9FA 4DQ0A 2FR8C 2HRBA 1NE7A 1WBJB 1YO6A 1YUNA 3D0QA 1J07A 3I6MA 5LZ5A 1SXIA 4RQTA 2Q46A 4ONEA 4DPMA 2WAOA 1FF9A 1LTQA 2CJPA 3AX6A 2VPWA 4G5XA 4EZBA 4G0MA 1NUTA 2ORED 3DHVA 4HNSA 2C3YA 3RAEC 8MHTA 3ES9A 1AIPA 1J0DA 2GRJA 5G1NA 4F06A 3U7GA 1WZ2A 3T7DA 4U63A 1N6NA 1V47A 3AVOA 2Q5QA 4W7HA 5FV7A 3TZQA 2W9XA 3KC2A 2Q3MA 3ZY2A 4IXDA 2FTKE 3GEIA 3HM2A 1QH8A 3G7UA 3U7RA 4BLQA 5JI3E 2KLBA 3MXOA 1GPYA 2LV8A 1X1DA 3GFFA 4QBGB 1VLHA 3ETLA 1RBYA 4P5DA 4RYLA 1DL5A 5E6RB 1U7UA 4AU1A 4XDZA 1YFKA 4HR7A 3TVDA 4DADA 1YHZA 4XPIB 5GZ3A 4IHAA 3A2LA 2C2ZA 3QFFA 4AY3A 4DWWA 2ZYWX 1BKDR 2HMAA 1I6MA 3PX2A 4GX2A 4FFMA 2FJUA 2P6OA 3A6ZA 2OOKA 1P2SA 4NEQA 4TMYA 3RJZA 3FPEA 2CK3D 1KS9A 4IIJF 3H2GA 4CIAA 3EJWA 5ER6A 3NHWA 3F98A 2WG0A 3LK6A 2BM0A 1GKIA 2DFPA 5FO0A 1WMDA 1B2LA 1DJNA 3S1SA 4V2UA 3VPBA 2UZ1B 4IPTA 2YJ3A 5TNXA 1X3LA 4QO8A 3IP8A 4S1OA 1C7RA 1MAAA 3W8DA 3IOBA 2H2DA 3MMZA 1KEPA 4P84A 2G04A 3U3KA 4ZIRB 2ZUUA 5HKKD 4HN9A 1P0IA 1G8AA 1L4NA 2X7JA 1F4PA 1BROA 4PYNA 1SQGA 2VF2A 1PX2A 5CNIA 4JXXA 5L3RA 2DERA 4UBJA 1DX6A 3HL4A 4E1VA 4TLLB 1GT6A 3OH8A 4LDZA 4LYJA 4N8SA 4YCMA 5IVPA 1UPAA 1N0VC 1WKCA 1NQUA 3I1JA 3WQRA 4Z4CA 1DIRA 2XY4A 1PZEA 4Q1DA 3REOA 5JU6A 4EZEA 5EXTA 2WJVA 1GRCA 5FTMA 2Z5LA 5LC1A 3HJGA 2XCRB 5C1OA 2FN7A 3FZGA 3OTQA 2YWGA 3GJ7A 4HX2A 5IN5A 2CMFA 2QW8A 1AMNA 1BH6A 3OT1B 3SC3A 2BGJA 2R6GA 2Y1CA 2A57A 1VJDA 1YFZA 4M1SA 3GAMA 4OM8A 1JB1A 3AV3A 4H7DA 1SC1A 2AMJA 3ZWPA 3X1KA 1PSZA 3KM0A 4CMCA 3I5UA 1DG3A 5FWXA 4U7GA 4AAYA 3EQ9A 1E1YA 4XGKA 2ZBUA 4MVJM 1P0FA 2LDBA 3MJEA 2QTFA 1GRNA 3U56A 2YN0A 1DO0A 1TO1E 1LRJA 4DV6B 3DA8A 4HPXB 5G0SA 3HGTA 1IHYA 3CN9A 4OXXA 2ZWPA 3I83A 2IYSA 4LYDA 1AQ6A 1D8AA 2YXPX 2VDMB 3UCFA 2Q3FA 1R6VA 2BGIA 3O83A 2QB5A 3MW8A 3Q41A 1Z4MA 2AOUB 2V45A 4TYMA 2C59A 1C9EA 2O7NA 5EMHA 2C31A 2WSLA 4MUBA 2ZPAA 5BSKA 1NRJB 1KE2A 5IG2A 4LJRA 1GGVA 2PTGA 4D9FA 3ANYB 1LF0A 3NEAA 3JARA 4QPCA 2ZPTX 3ZEAA 1RAAA 1U0FA 4PF1A 2R7KA 4B4VA 1GG5A 5BUQA 4RH1A 1IWBB 5HBGA 5KHOC 3GLGE 2MINA 1S4QA 1B42A 3G79A 2WTUA 2D5IA 1Y9AA 4X90A 3AVXA 3QH4A 2ZYHA 1C1HA 4MYRA 4ZQBA 3IURA 5SZJA 3FYUB 3OLCX 1W0KD 3V32A 2P4EA 3INYA 4FGUA 2H2AA 2CL6X 2OD2A 3K09A 1WY5A 3KVVA 2HDWA 1G5IA 4HGOA 4ZMSA 4ITUA 3GELA 1EUYA 1HI9A 3UOWA 5FULA 1YIOA 4L8FA 4HLUC 4HI0E 1WB5A 4FZ3A 5CLQA 3W9YA 2X8LA 2MT9A 4R8LA 4OL9A 3OM0A 1TMKA 1M2VB 5IMBA 2ZETA 1GZSA 4OUDA 1NRXA 3I4LA 5EZYA 3K5IA 4IJUA 1F48A 2B25A 3IVCA 3Q0EA 1C7FA 1W94A 4KI0A 4FJ1A 4YBZA 3ZCXA 3GDOA 3GY0A 3DB1A 1OSNA 4MJXA 1M8PA 1L7AA 1WABA 5F1YA 1G41A 4JGBA 4ZT3A 2P6RA 1PVOA 1GTZA 1HDXA 1Z0DA 1M2KA 4DNPA 2OBBA 2OHOA 2WUGA 5EE0A 5IKEA 2FSVA 3O84A 5JXJA 4CEHB 5CFZA 3CZ4A 2C7OA 1P19A 4Y6LA 4D9HA 3W2IA 2DRIA 2E5FA 2AWOA 5MGBA 2JI7A 4B3RB 2W6ID 1JIVA 1QGUA 1CF9A 2BCGY 2JC3A 1V5IA 3EXG2 1I6KA 4FW9A 2P68A 4DJJA 2HRQA 2AQ8A 5EKXA 3L1UA 4RORA 2EJUA 3ADKA 2E4AA 2HK6A 1MG5A 3K1YA 2YJ6A 2BEKA 3QRWA 2VHCA 3PEWA 3QWFA 3FUTA 4A6XA 1NUUA 1OBVA 1YU9A 4W5HA 1NY5A 1Q1GA 2WKSA 3W5SA 1PR1A 2IGTA 5BSVA 1QTQA 4AKTA 1CEEA 1ZBDA 1FFYA 2PUJA 5IBPA 1C3LA 2I8LA 4LWOA 4OXIA 2OXIA 1IHDA 4D1YA 1V3UA 3C8DA 3NWBA 5JNTA 4N5MA 4YN3A 4E09A 1RMQA 3MT0A 4P34A 2CE7A 2XCQA 3T7RA 1CB7A 1WPRA 2ZROA 1K5HA 3L1KA 5DX1A 1NASA 3V3KA 4CU2A 3O8NA 5LDHA 1WA5A 1P2DA 2GK3A 3Q98A 2G80A 2X1HA 3QXHA 4A0GA 1S2NA 5DVZA 3FGOA 2YC4C 1JFTA 3PJRA 1KRXA 1IEVA 2MSKA 5FAXA 3OZVA 4FI3C 1W87A 3NTLA 2BYTA 4P0QB 3N8GA 4PN7A 1BTOA 1F2TB 2QVXX 1XBTA 3O4FA 2M1XA 2GXSA 3GZTB 4O8CA 4W9NA 3AYXB 5DYIA 3OTHA 5E7MA 4BO7A 2ZZKA 3GGGA 4LTNA 5F51A 1GSOA 2ZGVA 4UUAA 3D4PA 5FL7A 3VHLB 1BS1A 1PQWA 4B3CA 4EFDA 3O7WA 1BU5A 3BF7A 3BRSA 3VU0A 1SMKA 5KX5A 4EO7A 4CLEA 1QANA 3HUTA 1WR8A 2F1RA 1OLXA 3CCCA 5K8JB 2B5OA 1TA9A 1ZM3A 4IR7A 2KWIA 1G2QA 3GRYA 1MV8A 3M6LA 1W0JD 2F3QA 3TNYA 3IUYA 3MWDB 3Q9LA 4W7IA 1XMQB 1KZ1A 2GAJA 1KEEA 1OI2A 2RBEA 5DCUA 4JP2A 1O9BA 3JQFA 1EGQA 1JTFA 3WDMA 2YUTA 3RK0A 1QCZA 1AG9A 5ALEA 3Q88A 2JH8A 4NH4A 1CR6A 2WLTA 3NTUA 3R7BA 4ZQEA 4TV8A 3KOWA 3A28A 3OJWA 1DEAA 3VGJA 5BR7A 2GPWA 1IPHA 3VSDA 5FP0A 1R4MA 2C5HA 1RQNA 1HSOA 3C8ZA 3E81A 4E07A 2P9EA 2AVNA 5EAIA 2PZFA 1EU1A 4NH0A 1X77A 3BWXA 1OU4A 2XD4A 1MW8X