3UIPB

Complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 18
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3uipB00
2JRHA 4WWOA 1SIFA 2D11A 1GC6A 2LI5A 2N4FA 2LZ6A 4TV3A 2LUEA 3MJWA 3W1SA 4PS7A 3PLUA 5HKHA 4G50A 5G2NA 5J2RA 4GDKA 5DPSA 4HCNB 4JIOU 2Z59B 4DHJD 1K8RB 4NAWA 4F7ZA 1WJ4A 2KFKA 4F8CB 1IP9A 3OLMD 1UBIA 2JPHA 5D94A 3ZNID 1SE9A 2BWFA 1UZXB 3A1QA 3JSVB 2KWVB 4KVGB 3PGEA 4DHJB 2MP2B 4GN1A 2KXJA 2YLMA 3IFWB 2WWZA 3HK0A 1CMXB 1KJTA 2L0FA 2MW5A 2K8BA 2CHZA 4LJOB 1WX7A 2NBVB 2ZVOA 4RM9A 3ZW3A 2K8CA 2Z0EB 3W1YA 3ZO5B 4M0WB 3KH0A 3PTFC 1J0GA 4G11A 2K39A 3EECA 2KVRA 2BKFA 2CS4A 1YIWA 2DX5B 2KQSA 3H1UA 5C23A 1Z2MA 2BF8B 2WX1A 4OVVA 4AWJA 4I6NB 2MBOA 3EC8A 3Q3FA 2W9NA 2LRWA 2KO3A 3TIXA 3H7PB 1E90A 3ALBA 4NJ7A 4W9IA 1WH3A 2N1VA 2J7QB 2FCMA 1WX8A 4MSMB 4JL9A 4BKSD 1XQQA 4GU2A 2AEHA 1OEYJ 1Q5WB 4WJNA 5IA7A 4HPMB 4PS8A 2LASA 1YQBA 3RYTA 2NS5A 3L17A 4BBNC 1OEYA 5CHFA 4TQ0A 2C9WB 1HE8A 3KUDB 3NY5A 4ICVA 1WFYA 3VTVA 4ANUA 2GBRA 2KWUB 3JVZX 2FAZA 4MGYE 3VFKA 3ZLZA 3IG3A 3S2AA 3M62B 4N9F4 5TR5A 1J19A 4HDQA 4TUUA 2L76A 4FADA 4B95A 2K6DB 2L0TA 1WGDA 4GGQA 4MM3A 2FCQA 3AXCA 3BINA 4NQLB 1Q1OA 1V80A 1WGYA 5C1ZA 4HLEA 3V6EB 2N1WA 4BKGA 2Z0DB 3D32A 1WMHB 3IVFA 3V61A 3DVNU 4MH0E 3QQ8B 4AJWA 4GOCA 3DCGA 3V62A 2FIDA 2LVPA 3R7QA 2KKCA 4EKUA 4PYUA 2BYVE 1UGMA 3QC8B 2ZNVB 4MDKE 3QHTA 4KZ0A 2BPSA 2EMTA 3ZNHB 2BYEA 2J0MA 3K9PB 2G3QB 4DXAB 1R4MI 4DHZB 3MHSD 4MEMA 3HM3A 1WGRA 2KOXA 2G45B 4K7SA 1P3QU 2KTRA 2OOBB 2ZPNA 1UH6A 4EEWA 2FNJB 3ZRCA 2O2VB 4CO7A 1LFDA 2RR9A 2C7HA 2BYFA 2GMIC 1E8XA 2IZVB 3R66C 4ANVA 4JGHB 4TKNA 4RMAA 5LLIA 2JF5A 1OQYA 3WA0A 4I6LB 4CYEA 3JYUA 1V2YA 3ZIMA 5CHWA 4EZJA 2ZZPB 1XT9B 4A3PA 3WAPA 3OAWA 1WM3A 2ZJDA 3ONSA 3ZKJC 3IBEA 2O6VD 1NDDA 4HK2A 3APDA 3UF8A 3WIMA 1LXDA 4DBGA 3M3JA 4KDLB 2KNBA 2UYZB 3DBHI 3DQVA 1P98A 4AOFA 3N32A 4DDGD 1KLVA 1YX6B 2FCNA 2VRRB 1PQSA 1RAXA 3NS8A 4LJPB 5DPWA 2KHWB 4BKTA 2LVQA 2O6VB 4ZRJA 2NVUI 2KLCA 1NI2A 2KFJA 2D2QA 3EHVA 2NBUA 2WDTB 1EF1A 1RFAA 2KMCA 2ASQA 2KTFA 3A33B 1V9JA 2KFKB 4HDOA 4BOZB 3ZVVA 1F9JA 4G0NB 2HD5B 3PV1A 1EO6A 4ANWA 4TQ1A 2DENB 1WX9A 2IO3B 2KDFB 4HJKA 4W9FA 4YL8A 5AZGA 4BBNF 1V6EA 2AL6A 2B3AA 3LJ3A 1WRDB 3VVWB 2ZCCA 3B1LX 4MJSA 4PS3A 5BO4B 2AWTA 2OJRA 5GMVA 4CHKA 4BFRA 4ICUA 3RD2A 4ANXA 4GDLA 3QCAA 5D7GA 1KM7A 3PZDA 5DPTA 3VH4B 2MWSB 5DCNA 2L8JA 2A4ZA 1V5OA 1A5RA 3WALA 1WGGA 2HTHA 1E7UA 4XZ4A 4WQOB 1LQBA 5CX3A 4BOSC 4KZCA 3ZTCA 3OJ4B 2DZMA 2IO2B 1I42A 2DZJA 1TZ1A 2K25A 3RT3B 3QAQA 4W9DA 2WX0A 4IW0A 3JSVA 1GJZA 3PPAA 2IBIB 5CTRC 1WF9A 3L08A 1C3TA 3JW0X 5JHAA 4LDTD 3NHEB 1MG8A 1WY8A 3QA8A 3VAWA 2N9PC 3CF6E 3M95A 1FXTB 3O65B 4A3OA 1WXMA 3T9LA 3K9OB 3V6CB 1P1AA 4B6WA 4ZRIA 3KUCB 3NOBA 4KV2A 1RRBA 4XC2A 5CHVC 1WGHA 4MGKE 3VXWA 1EF5A 3ZUNA 5L95C 4LDTB 1WJ6A 3L10B 3VUXA 4W9EA 3H7PA 4NY0A 3AI5A 2LGXA 3QJZA 3I3TB 4W9GA 5EDSA 3U30A 1S3SG 5KHOA 3RCZA 1G6JA 4NJ6A 2XBBC 3QK0A 4LCDE 2D3GA 3CMMB 2RGFA 3PVLA 1WE7A 1ZGUB 2KJRA 2KN5A 3A4RA 2ZVNA 4EFOA 2PE6B 4WJPA 5LXHA 3TCAA 2D10A 5D2MB 3UQAA 3GOEA 4KIKA 4W9KA 3RZFA 4E74A 2KX3A 4HVBA 2KD0A 3C0RB 1LM8B 4EZKA 3DBRI 2A5UA 2C7MB 3VTWA 2R2OA 1C1YB 4BKSA 4E71A 2KJHB 2MA9B 2XK5B 3KW5B 3PSEB 3RUIB 4FA6A 2JVCA 4GMVA 4EZLA 3ZDMC 1D3ZA 3SD5A 1WR1A 2N7DA 2KANA 1TBEA 2JWZA 3X0WA 2KJ6A 4MELA 4W9LA 2JRIB 2RD0A 4F1SA 3KVFB 5E6OA 3ML9A 2NPTB 2KTRB 4II2B 5AZHA 2IYDB 1H4RA 2PEAA 3ENEA 5JH5C 2LWPA 2AYOB 3A9KB 1VCBA 1L2NA 5E6PA 3EFUA 3TL5A 1U4AA 1YD8U 3N30A 1UD7A 2JUOA 3B0AA 2V3SA 4ZYNA 2KC1A 3U8ZA 3WANA 2KQ7A 2LGYA 2NBWB 3ZNZB 1P0RA 2GBNA 1JRUA 3HHMA 4IM0A 4ASWC 1WIAA 3CSFA 2IY1B 2M0XA 2KX0A 4IWQA 1Q0WB 2WYQA 3PREA 3UIOB 5KHQA 2PE9A 4P7IA 2PPHA 3VTUA 4DK5A 4KSLC 1WJUA 2BWES 2UWQA 2MSED 3V60A 1YJ1A 2CHWA 4DHZE 1ISNA 1AARA 3H9DA 4IG7B 2N7EA 2HE7A 1ZW7A 2LVOA 3R7RA 4K1RB 2GBJA 1XD3B 2ZNVC 3CSTA 3APCA 3ZNGC 4FJYA 3ZTDA 1L7YA 2C5LC 3RULA 4PYZA 5DPRA 2KDEB 2MRPA 1BT0A 1WXAA 3LDZE 5J17A 1E8ZA 1ZKHA 3P2BA 4GDKB 2LRUA 1V86A 3N3KB 2R2QA 4NAWB 5FR6A 3QWZB 3TJPA 1YX5B 1KOTA 2KWCA 2GBKA 2IY0B 1TTNA 2N9XA 3DBSA 3A9JA 3DVGY 4W9JA 1WXVA 3RZWC 4HCPB 5D6JB 1WR6E 3OJ3A 1E7VA 2L3ZA 3A1QB 4MJSB 1Y8RC 3HM6X 3APFA 3H6NA 3ML8A 4GB9A 1WM2A 2K1FA 3SDLC 2CKHB 2BGFA 1NBFC 3KYCD 4GDLB 3AU5A 5G55A 1WI0A 2LXAA 1WE6A 2FIFA 4NPNA 2O6VA 4ZRKA 2DZIA 4K7WA 2ZEQA 3M63B 4NQKE 2DYBA 1GUAB 2EMSA 3VUYA 2KMAA 3ZRFA 4W9HA 2QHOA 1WZ3A 2JXXA 2ZCBA 4WWPA 1Z5SB 3KYDD 4B9KA 4E3CA 3DVNV 4IWPA 1IPGA 2YVCA 1GNUA 4KSKC 2MLBA 3PHWB 1VD2A 3PT2B 3PHXB 2FUHB 4DDID 2RSUA 3QARA 2KDBA 2ZPYA 4M8NA 4M8MA 4FHJA 2K6QA 3SU8X 2J0JA 4GIVA 2REXA 2MBBB 3DOWA 4II3B 3W1SC 2MP2A 4ZDVA 1GC7A 1V5TA 2MQJA 2DYMA 1X1MA 4GSWA 4GXBA 1WJNA 1V81A 4DWFA 4KDIC 1P9DU 1S1QB 4MSQB 2MBHA 3KUZA 5AEKB 5J18A 1J8CA 3PRPB 2EKEC 2K8HA 3TBLD 3VDZA 4JQWC 4RM8A 3MTNB 4AJYB 4I6PA 4JLCA 3QX1A 2N9EB 2IO1B 4EOYA 2DAFA 2NR2A 2MX2A 3DDCB 2DZKA 2M8SA 4BVUC 3A4SC 4G3XB 4FLHA 3AU4A 4HXDA 2JT4B 4IUMB 3DBLI 3PRMB 4MGZE 2L05A 3GZNI 1OGWA 4KIKB 4AUQC 2MCNB 5LXIB 1T0YA 5AZFA 2LXCA 3H7SA 4X57B 2IO0B 3DVGX 2LGDA 1EUVB 4J6IA 2KC2A 2I1JA 2JZ3B 2CHXA 4URKA 4IC7B 4EUTA 5JZEB 3WAOA 2DAJA 4NNJB 2KLGA 3L13A 1E5WA 1SGHA 1IYFA 2G4DB 2G4SA 2KDIA 1R4NI 2D07B 3PS6A 3UGBB 3TMPB 2GBMA 4HWIB 2BKRB 3HIZA 2L7RA 3Q3JA 5IAAC 1WMHA 2KZRA 2LJ5A 2V4LA 3VUWA 2KK8A 3PLVA 2HJ8A 1GG3A 4IM3A 4IWOA 4AP4C 3R3MA 2GOWA 4FJVB 3L16A 2XK5A 4FULA 3X23A 3DPDA 1UELA 3U7DA 1RLFA 2M1MA 1V49A 4IM2A 2FCSA 2V1YA 2DYOA 2CU1A 4WWNA 1WZ0A 2NPTA 4A20A 4K81A 2JY6A 3NZSA 2MBQA 3BY4B 4WJQA 5L83A 1TGZB 3UQBA 3T8MA 1E8WA 2M4NA 1QZEA 3A9KA 3UINB 4WAAA 4FHKA 2AL3A 2C7NB 2M17A 2O2VA 4K7UA 1WYWB 2DHZA 3QIJA 3B08A 1WXSA 3PRZA 1OTRB 2RPQA 1UBQA 2XEWA 2Y5BB 1H8CA 3ZDTA 3IHPC 2I1KA 3NZUA 4FBJB 5E6NA 1M94A 4MGIE 2CR5A 4HPLB 2NCNA 3AULA 1I35A 2C60A 5JHBA 3L0WB 4OVUA 2LD9A 4FN2A 3A9JB 4FJZA 3SHQA 2PJHA 1E8YA 2J0KA 4WJOA 4W9CA 2JZZA 3ECIA 3UIPB 3VHTC 3WAMA 4XX5A 2L00B 2MBEA 3L54A 3VH3B 3VQIA
chains in the Genus database with same CATH superfamily
2INNE 1XEEA 2N4FA 3MC9A 3RNAC 4TV3A 2KT7A 5G2NA 4Q2JA 2CU3A 1K8RB 2KFKA 1TIFA 5D94A 1CJEA 2DBYA 2BWFA 2WGSA 1UZXB 2Y5PA 4KVGB 3IFWB 2Y3AA 2V0GA 3HK0A 3ZRFA 4RM9A 3ZW3A 3PTFC 3MP9A 3EECA 2L32A 1YIWA 1L0VB 1IBXA 2WX1A 2WDRB 4OZBA 2KO3A 2G1EA 1N5XA 2LEKA 3TIXA 3ALBA 4W9IA 2PKOA 3BVGA 4JL9A 1XQQA 4GU2A 4WJNA 5IA7A 1FXAA 1AYFA 2INDC 3ZXRA 1NYRA 1OEYA 1HE8A 1VZ8A 4ICVA 2ACZB 3RNGC 4MGYE 3ZLZA 3Q6BA 2OEDA 4HDQA 2L0TA 4MM3A 1HZ6A 4NQLB 4BKGA 1L6UA 3V61A 3DVNU 3DHIC 3QQ8B 3B2FA 2FIDA 4PYUA 2BYVE 1QOFA 1SE2A 2BPSA 4ZOHC 2BYEA 2G3QB 2D3CA 4MEMA 2V4IB 3HM3A 3PZ7A 2X8XX 1JWUD 3W2DA 2KTRA 1JWAD 1T5XD 2O2VB 2RR9A 2C7HA 2WXRA 4XWWA 2GMIC 1E8XA 1NVID 1V1PB 4O1NA 2J42A 1GAQB 4TKNA 4I6LB 4CYEA 3JYUA 1V2YA 1JWSD 4EZJA 4XDCA 2KWDA 2WDVB 2WXHA 3ONSA 4AQ7A 3AMZA 1T3QA 1AW7A 5D3DA 3N32A 2VRRB 4NZLB 1RAXA 4LNNA 2KLCA 1NI2A 4N6EB 2D2QA 2YEPF 4P1BC 3A33B 2KFKB 1N63A 3AE7B 1SB3C 1F9JA 4G0NB 1SE3A 3PV1A 2DENB 1WX9A 4HJKA 1V6EA 4B0MA 1WRDB 3DBLB 4MT5A 4MJSA 2AWTA 1TKYA 4ANXA 3KWVA 3PZDA 3VH4B 2XN9C 2MEKA 3WALA 1NENB 1IBXB 1PGBA 3ZTCA 3OJ4B 1L4DB 1XLOA 3DHGC 1UWMA 3IAS1 2WX0A 3PPAA 2IBIB 3V3XA 3NHEB 1WY8A 4YTPB 1N5WA 3H8HA 1WXMA 3T9LA 1T0SC 4ACFA 3KUCB 2QCZA 1RRBA 1NYQA 1EF5A 2BS4B 1VJKA 2WNMA 1JROA 2N7JA 4NY0A 3AI5A 1D4BA 1M4VA 4YWGG 1G6JA 3CMMB 2RGFA 3PVLA 3AE5B 2KJRA 2KN5A 1ET6A 2EKIA 3A4RA 4WJPA 3RZFA 1MI0A 4A90A 5G5GA 2C7MB 1C1YB 4BKSA 3RUIB 2MA9B 4L1BA 4EZLA 4GMVA 2RDGA 5AUKA 3BK1A 2VZKD 3X0WA 4W9LA 4F1SA 2NPTB 2KTRB 4II2B 3BWUD 5AZHA 2PEAA 3ENEA 2LWPA 1VCBA 2VZKB 1UD7A 4HKQA 4ZYNA 2KQ7A 1IGCA 2NBWB 4ASWC 2IY1B 2KX0A 4ZRPA 3PREA 3UIOB 2PE9A 1TYGB 2BWES 1EWCA 3AEGB 3Q3OC 1ISNA 2V3NA 4K1RB 2GBJA 4WAFA 1K51A 3CSTA 3ZNGC 1MVKA 1FCLA 2C5LC 4PK1A 5J17A 1PDXA 1E8ZA 3P2BA 3C8YA 1E0ZA 1V86A 2WDQB 3Q2AC 1L5PA 1YX5B 2IY0B 3DVGY 1V1OA 3RZWC 1I4GA 1E7VA 4MJSB 1Y8RC 1FRRA 3AE2B 4A55A 2CKHB 2WQYB 4KX6B 4NPNA 3SFEB 4K7WA 3M63B 4NQKE 1SXTA 2I38A 1Z5SB 2N9KA 2YVCA 2FUG1 3P1MA 1KF6B 3PHWB 1VD2A 3PT2B 1LO5D 3Q14C 2FUHB 4DDID 2K6QA 3SU8X 2REXA 4II3B 3W1SC 2BYTA 1V81A 4DWFA 1JQ4A 2WXFA 3AECB 2MBHA 3KUZA 4USAA 1R4MB 2PVOD 1DOXA 3TBLD 1F0ZA 4RM8A 4I6PA 4EOYA 2NR2A 5IKCM 2DZKA 2M8SA 1UNSA 3A4SC 3BVZA 3ZJTA 3AU4A 1YJJA 4HXDA 3DBLI 3U7ZA 4MGZE 4AUQC 5LXIB 1QILA 1T0YA 4M00A 3DVGX 3SEBA 1EUVB 2I1JA 2CHXA 1UUPA 2DAJA 3TEYA 2BT6A 2KLGA 3I63C 2QIEB 3PS6A 3UGBB 2K3UA 2GBMA 5IAAC 3O13A 4P6VF 1JALA 3PLVA 1GG3A 2PIAA 1UWXA 3W5VB 1PFDA 4FJVB 2AX5A 3U7DA 1GB4A 3EA6A 3NZSA 3BY4B 4WJQA 5L83A 4DXGA 4OZCA 3T8MA 3B2GA 3A9KA 4KGRA 2L1AA 2DHZA 3B08A 1WXSA 2RPQA 2AQ2B 2Y5BB 2BVCA 3ZDTA 1D6EC 3IHPC 5E6NA 1HTQA 3Q8AA 3NVZA 4ITKA 2NCNA 2PTLA 3AULA 1I35A 5JHBA 4FN2A 3ABVB 2J0KA 3ECIA 3UIPB 2HTME 4OVZA 3L4PA 2JRHA 4WWOA 4C80A 2LI5A 2G9HD 4WWMA 3RFZB 3W1SA 4YSZB 4RGNA 5HKHA 4GDKA 5DPSA 4HCNB 3IXSA 1ZDXA 4JIOU 2J4XA 4F8CB 2JPHA 3ZNID 2GRIA 3A1QA 3JSVB 4IDIA 3PGEA 2KN4A 2JQRB 2KXJA 2WWZA 4LJOB 2MW5A 2L0FA 1WX7A 3W1YA 4M0WB 3KH0A 1J0GA 2K39A 1E6EB 4BZAA 2TSSA 2KQSA 3H1UA 3W9CB 2BF8B 4OVVA 2SAKA 1C79A 2INPE 1WH3A 4JWUC 1CK1A 1YN3A 1VDVA 4A8XC 4HPMB 4DQOC 2E3TA 2NS5A 3L17A 4BBNC 3DWGC 4TQ0A 1ZPSA 3GE3C 3VTVA 1EU3A 2GBRA 4N9F4 4KGSA 1TY0A 2L76A 2LGIA 2RDBC 4GGQA 2FCQA 4C56C 2K5PA 4HLEA 3V6EB 4MH0E 3DCGA 4EKUA 1Q10A 2GLSA 3QHTA 4MDKE 4B0EA 3ZNHB 2J0MA 2W54A 2QC8A 1PUTA 1R4MI 1FPYA 4YSYB 2BS2B 3RNEC 2OOBB 1UH6A 3AE4B 2FNJB 1VLBA 4JWSC 1DYQA 1ZDVA 5H8YE 3OG5A 4KKJA 4JGHB 1MPEA 4WIPA 1I4PA 4IOIE 3KQ4A 3WCQA 1L6VA 4N59A 1KLUD 3WAPA 2ZJDA 1C4PA 3ZKJC 2O6VD 2LUMA 4DBGA 1LXDA 4KDLB 1RYJA 1YX6B 1PQSA 2NMQA 2LVQA 2O6VB 1KLGD 4ARIA 3NVVA 4ANWA 1RFAA 2KMCA 1V9JA 2AQ1B 1CQVA 3N20C 3NUHB 2HD5B 1RWSA 2KDFB 2UU7A 4YXDB 3VVWB 3GZNB 2BW2A 2OJRA 1J7BA 5GMVA 1WWTA 4ICUA 4GDLA 2FBWB 3AEBB 2HTHA 4XZ4A 4LNFA 4K3BA 4WQOB 2IGDA 3BK2A 4BOSC 2JXTA 1R4NB 4IW0A 5CTRC 1WF9A 3JW0X 4LDTD 1DGJA 1MG8A 2N9PC 3CF6E 1FXTB 1K53A 1ZOYB 3V6CB 4TSSA 3NOBA 3N1XC 3VXWA 1WGHA 4MGKE 1L0XB 3ZUNA 5L95C 4LDTB 2KAJA 4D2KA 1HQRD 3L10B 3H7PA 4W9GA 2ICIA 1S3SG 5KHOA 3RCZA 4NJ6A 2D3GA 2NTTA 3AE9B 1WE7A 1ZGUB 5LXHA 4HROA 2D10A 5D2MB 3UQAA 4KIKA 4W9KA 1XXGA 1YOVB 3ETRA 4E74A 3ZQ4A 1LM8B 2A5UA 2R2OA 4XWTA 3SD5A 2V9HA 1TBEA 4RGMA 4MELA 2JRIB 2RPVA 2RD0A 5E6OA 3ML9A 2MJDA 4ARCA 1SBBB 3P63A 2IYDB 1H4RA 2KVZA 1XO3A 5E6PA 1L2NA 3VR9B 4AS1A 5H92C 3P4RB 2D3AA 2V3SA 2INCC 3WANA 3IT4B 2LGYA 3ZNZB 3UI3A 1WIAA 2M0XA 1I4XA 4IWQA 1J7CA 1DOIA 2PPHA 3VTUA 1WJUA 4REZA 2MSED 1YJ1A 2CHWA 4DHZE 4M02A 1ET9A 1KH0A 3H9DA 2N7EA 1TT5B 2LVOA 2JSVX 5DPRA 2MRPA 1BT0A 4YSXB 2DLBA 3TJPA 5LNK1 1L0YB 2N9XA 4C7ZA 5IN7A 5D6JB 1OFFA 1T0RC 5C2TB 1WM2A 2W3SA 2BGFA 1TJEA 4GDLB 1JMLA 5G55A 3V05A 5FKAC 1GUAB 3VUYA 4W9HA 1FM0D 2ZCBA 3IT6B 1LGRA 4B9KA 3PHXB 2RSUA 3QARA 3SR6A 2J0JA 4GIVA 2MBBB 3NRZA 1GC7A 4GSWA 4GXBA 1WJNA 1S1QB 4EE2A 5J18A 4A9AA 4FXCA 1J8CA 2EKEC 1PGXA 4WURA 2M0AA 2W3RA 3NJTA 3OWEB 2DAFA 5FR3A 4MM3B 2MX2A 3HVZA 4LTUA 1FMAD 3VR8B 4C00A 2M56B 3GZNI 4KIKB 5AZFA 4US8A 1B1ZA 2LGDA 2WHIA 5IOIA 1D5XC 2JZ3B 4IC7B 3WAOA 1A70A 2R61A 1SGHA 1R4NI 2KDIA 2L7RA 1WMHA 2V4LA 3BVMA 3VUWA 4KKIA 4YTMB 2BBCA 1MG4A 5IP4D 2BS3B 3NS1A 4HJGE 4H2AA 1VZ7A 2XK5A 3AEFB 3X23A 1UELA 4L2YA 2J52A 4J3OD 1E7PB 2V1YA 2DYOA 2CU1A 4A20A 2RDHA 2MBQA 2BB5A 1QZEA 3N1YC 1WYWB 1OTRB 1H8CA 3NZUA 1I7HA 3PZ8A 1M94A 5HI1A 2LD9A 3SHQA 4WJOA 4ZHPA 2JZZA 3VHTC 1ZXHA 4XX5A 3L54A 1E9MA 4HRSA 4RF1A 2WXNA 2LZ6A 2LUEA 3MHZA 2DWQA 4JPSA 1TS2A 4DHJD 4NAMA 1TY2A 4NAWA 4F7ZA 3NVWA 3OLMD 1FNVA 2KACA 3RI7C 3U52E 2KWVB 4DHJB 2IGGA 2YLMA 5EE0A 1CMXB 2CHZA 2ZVOA 2NBVB 5BMHA 3DBRB 2Z0EB 3ZO5B 4G11A 2KVRA 4US9A 3MC8A 3SFDB 2J53A 4AWJA 1QLBB 2MBOA 4I6NB 3Q3FA 2W9NA 3MC0B 2LRWA 2GB1A 1E90A 2FE8A 4NJ7A 1FD6A 2J7QB 2FCMA 1WX8A 3U4EG 3EGRA 4BKSD 2AEHA 1OEYJ 5C3JB 1Q5WB 2K9XA 4PS8A 3KLSX 2LHEA 3RYTA 5CHFA 3KUDB 4ANUA 2WXQA 3JVZX 2FAZA 3VFKA 3EUB2 4K3CA 5TR5A 1NI3A 4B95A 1WGDA 4LK0M 3BINA 4ZRQA 1YN5A 2N1WA 1WMHB 2X38A 2VH2A 3IVFA 4AJWA 4P16A 1RFKA 2LVPA 1P7FA 4OHJA 1QQRA 4HKZE 2SEBD 4DHZB 3MHSD 1WGRA 2G45B 4LNIA 4K7SA 1P3QU 5BMIA 1JW9D 2QJLA 4EEWA 3ZRCA 1OQRA 2WXKA 1SF0A 4RGOS 2IZVB 3R66C 4ANVA 1AN8A 2JF5A 1OQYA 4XYCA 3BYYB 1XT9B 1MFWA 1T6BX 3OAWA 1F52A 1YN4A 2IPKD 3IBEA 3R2TA 1NDDA 3UF8A 1YNTE 3FAHA 3KWLA 3M3JA 2N9LA 3DQVA 3EFCA 1P98A 4AOFA 4DDGD 1KLVA 3NS8A 2QDFA 4LJPB 2IDYA 1JRPA 4ZRJA 2NVUI 2KFJA 3EHVA 2NBUA 1I4HA 1EF1A 1ZUD2 2KTFA 2WDTB 1EU4A 3ZVVA 2VH1A 4TQ1A 1JWBD 3TSSA 3PO0A 5BYSA 3LJ3A 2ZCCA 3B1LX 4PS3A 2EELA 4XGAB 5D7GA 1C9FA 1TS4A 2ZW1A 2L8JA 1WGGA 1E7UA 2JWUA 1LQBA 4M01A 3Q8BA 3R2IA 4KZCA 5HG2A 1I42A 2IO2B 2PW9A 1TZ1A 2K25A 2D3BA 3HRDD 1QF6A 1C3TA 5JHAA 1AWDA 3QA8A 3VAWA 3M95A 3O65B 1YQ4B 3K9OB 1P1AA 4B6WA 4ZRIA 4KV2A 2QEJC 3AB5A 1I4QA 5CHVC 1F2RC 3Q3NC 2LGXA 3I3TB 2XBBC 4LCDE 1P7EA 4N58A 3TCAA 3GOEA 3P4QB 2V3PA 2KX3A 2Y5CA 2KD0A 3C0RB 3R8BA 3FC4A 3DBRI 3GB1A 2BQQA 3PSEB 2JYEA 3KW5B 4FA6A 2JVCA 1D3ZA 2KANA 4WH4A 2K0PA 1C4AA 2KJ6A 3KVFB 5JH5C 2AYOB 3A9KB 1U4AA 1YD8U 2CJNA 1E10A 1HZ5A 3B0AA 3U8ZA 2KC1A 2ZW0A 2WXLA 1F77A 1P0RA 2GBNA 1YQ3B 1HA5A 3N9YC 3CSFA 1Q0WB 2IGHA 5KHQA 1EWYC 3Q8EA 4DK5A 2H89B 2KQ4X 2UWQA 1ZP0B 3VRBB 1AARA 1BUIC 2HE7A 3R7RA 3ZJUA 1XD3B 1YJIA 1V1PA 2ZNVC 3APCA 3ZTDA 1L7YA 2MH7A 1FFVA 4KGTA 4PYZA 2PLPA 1WXAA 1ZKHA 4GDKB 3GP7A 2R2QA 3QWZB 3ZXVA 1SSNA 1KOTA 2GBKA 3A9JA 1WXVA 1KRHA 4HCPB 4WQMA 1WR6E 5BMGA 5JXVA 3A1QB 1WXQA 3HM6X 4GB9A 2K1FA 3TEXA 1NBFC 2YEPB 1WI0A 2LXAA 2FIFA 2ZEQA 2DYBA 2EMSA 2KMAA 1WZ3A 2JXXA 1GB1A 1ACCA 3KYDD 3DVNV 4IWPA 1GNUA 1PGAA 4KSKC 2MLBA 5TSSA 3W5UB 1DOYA 2KDBA 1TKEA 3LYYA 2MP2A 2MQJA 1X1MA 4KDIC 1P9DU 3NZ3A 4OW0A 5AEKB 1ESFA 4CQNA 4BAXA 1MJDA 3LB8C 3MTNB 2WXPA 4AJYB 3NVYA 3QX1A 4R3DA 5MPOA 1PYWD 2IO1B 2CJOA 4BVUC 1YMHE 3HVDA 3ZJVA 1Y56A 4L23A 4IUMB 4RFBA 2WLBA 1OGWA 2LXCA 3H7SA 1XLNA 4NJCA 4X57B 2IO0B 3T3OA 4MH8A 4YT0B 2KC2A 4URKA 4EUTA 5JZEB 2MJEA 1KFYB 3BZDB 3DBHB 2QILA 1L4ZB 2D07B 3RMKC 3FILA 2AQ3B 3TMPB 2LGSA 2BKRB 3HIZA 3Q3JA 3RPFC 2KDMA 2KZRA 2LJ5A 1K52A 2HJ8A 4IM3A 4IWOA 3R3MA 1N61A 1V8CA 2I2YA 2ONQA 4PT5A 1XCQL 3GS2A 2RMMA 4WWNA 2NPTA 4K81A 2JY6A 1E8WA 2M4NA 3NG0A 1R7SA 3UINB 1FO4A 4FHKA 2M17A 3QIJA 1J7AA 5BYQA 2OJWA 1UBQA 2XEWA 1OQQA 1KTKA 2I1KA 4FBJB 4JX1C 4MGIE 3A9JB 4FJZA 4P1CC 1E8YA 2D5GA 1VRAB 3BYTB 3WAMA 2L00B 2MBEA 3VQIA 1SIFA 2D11A 1GC6A 3Q3MC 1TS3A 2W55A 3MJWA 4PS7A 3PLUA 4G50A 5J2RA 1XCTL 2H88B 1D5MC 2Z59B 4RF0A 1WJ4A 3AM9A 4XDDA 1N62A 1IP9A 1HEZE 1UBIA 5BYRA 2B76B 1SE9A 2HDEA 1BMLC 1NEKB 5G5HA 1FEHA 3AN1A 3MFGA 2MP2B 4GN1A 1KJTA 2K8BA 2K8CA 1MHHE 2WU5B 1SJHD 2BKFA 2CS4A 1HTOA 1I4RA 2DX5B 5C23A 1B9RA 1Z2MA 3AE3B 2QMTA 3EC8A 1ZXIA 5IO9A 3H7PB 4S17A 4MACA 2N1VA 4MSMB 4XE0A 4GLSC 2LASA 1YQBA 1ENFA 2KYWA 2C9WB 3NY5A 1WFYA 1SEBD 2KWUB 1VZ6A 2BTEA 3IG3A 3S2AA 1WRIA 3M62B 3Q8CA 4C4VA 1J19A 4TUUA 4FADA 2WU2B 2K6DB 1SIJA 3AXCA 1Q1OA 1V80A 1WGYA 3FILB 5C1ZA 3HUIA 2Z0DB 3D32A 3RNBC 4GOCA 3V62A 3R7QA 3P42A 2KKCA 1C4CA 1UGMA 3FKYA 3QC8B 2ZNVB 2HJ1A 4KZ0A 2EMTA 2PVGC 4ZHOA 3K9PB 5EE9A 4DXAB 4DXFA 3CIRB 1JCKB 1N60A 1FFUA 5HHDG 2KOXA 3URYA 2ZPNA 4CO7A 1LFDA 2BYFA 4YTNB 1ROEA 5EE3A 1FCCC 4RMAA 5LLIA 3WA0A 3E56A 3ZIMA 1C78A 2LHDA 5CHWA 2ZZPB 2LJIA 1UGJA 4A3PA 1WM3A 2L52A 2Z8LA 4HK2A 2WXOA 3APDA 3WIMA 3T3NA 4HPPA 2KNBA 2ON8A 2UYZB 3DBHI 4RGTA 4C7YA 2FCNA 4IKGA 5DPWA 2KHWB 4BKTA 1QOGA 2ASQA 4HDOA 5EE1A 1C76A 1MHXA 4BOZB 3RNCC 1EO6A 1HXYD 1UF0A 2IO3B 4W9FA 4YL8A 5AZGA 4BBNF 2AL6A 2B3AA 4QAYA 3BIID 5BO4B 5AUIA 4CHKA 4BFRA 3RD2A 3QCAA 1KM7A 5DPTA 2MWSB 5DCNA 2A4ZA 1V5OA 2N0SB 1A5RA 3U2SC 5CX3A 2DZMA 2DZJA 2WXIA 4LNKA 3RT3B 3QAQA 4ZYSA 4W9DA 3JSVA 1GJZA 3P4PB 1QOBA 2GI9A 4OZAA 3L08A 2M19A 2L83A 3VRAB 4HEA1 2WP9B 4M0WA 4A3OA 1K50A 1C77A 4XC2A 3TUOA 2BB6A 3DHHC 4JE3B 1T0QC 3AEAB 2XNAC 4C4VB 1WJ6A 4UDUC 3VUXA 4W9EA 3QJZA 2JX5A 5EDSA 3U30A 3QK0A 1FXIA 1F2RI 3I57A 1N6ZA 2ZVNA 4EFOA 2PE6B 2KMMA 4HVBA 4EZKA 3B9JA 3VTWA 4E71A 2KJHB 2XK5B 3ZDMC 3ZGZA 3IAM1 1WR1A 2N7DA 1FNUA 2JWZA 1WSPA 3TEWA 2WXGA 3LXFA 2NTSA 1TS5A 3P4SB 3EFUA 3TL5A 3N30A 2JUOA 3AE1B 3C19A 2DNFA 1BXTA 1IGDA 1JRUA 3HHMA 4IM0A 2WYQA 4S0RA 2LFIA 4A6QA 4P7IA 4KSLC 3V60A 2JZPA 1TZOA 2W82A 4IG7B 5GXGB 1ZW7A 3AEDB 4RNAA 1EM7A 2WS3B 4FJYA 3RULA 1F1HA 2KDEB 3LDZE 2LRUA 3N3KB 4NAWB 5FR6A 3CWIA 3TEZA 2KWCA 3DBSA 1TTNA 5T8IA 4W9JA 3OJ3A 3RNFC 1IUEA 2L3ZA 1ZE3D 2JU6X 3APFA 3H6NA 3ML8A 3I5JC 3SDLC 1FNWA 3KYCD 3AU5A 1WE6A 4LNOA 2O6VA 4ZRKA 2MHJA 2DZIA 4TMAB 5FK9C 3AH7A 3GE8C 2QHOA 4RCOA 1XLQA 4WWPA 1FIQA 4E3CA 1IPGA 3Q8FA 2ZPYA 1FRDA 4M8NA 1CZPA 4FHJA 4M8MA 1QKZA 2PMVA 3DOWA 4RH6A 4ZDVA 1V5TA 2DYMA 1V97A 1RM6C 1XF5L 4MSQB 3J9CA 4LLGM 3PRPB 2E6XA 2K8HA 3VDZA 4JQWC 1GOZA 2JYTA 4JLCA 5D3IB 2N9EB 3DDCB 4G3XB 4FLHA 1QT9A 1XLPA 2QSDA 1QOAA 2JT4B 3MJ5A 3PRMB 2L05A 2MCNB 3N1ZC 1VR9A 3AE8B 4J6IA 2WXJA 2MJ3A 1SJED 4NNJB 3L13A 1E5WA 3RN9C 1IYFA 2G4DB 2G4SA 3ZYYX 4HWIB 2Q5WD 2WXMA 2KK8A 3E9SA 2OHFA 2LMCA 4AP4C 1D5ZC 2GOWA 3L16A 4FULA 3DWMA 1SE4A 1WYGA 3DPDA 1RLFA 2M1MA 2IJ0A 1V49A 4IM2A 2FCSA 1WZ0A 1TGZB 1WGKA 3UQBA 5HFYA 3I9V1 3Q69A 3AE6B 4WAAA 2AL3A 2C7NB 2O2VA 4K7UA 3PRZA 1GPXA 1TKGA 1STEA 2CR5A 4HPLB 2K22A 2C60A 3L0WB 4OVUA 3AEEB 2PJHA 5E6JA 3AV8A 4W9CA 1JWMD 5I4DA 3VH3B
chains in the Genus database with same CATH topology
2JRHA 4WWOA 1SIFA 2D11A 1GC6A 2LI5A 2N4FA 2LZ6A 4TV3A 2LUEA 3MJWA 3W1SA 4PS7A 3PLUA 5HKHA 4G50A 5G2NA 5J2RA 4GDKA 5DPSA 4HCNB 4JIOU 2Z59B 4DHJD 1K8RB 4NAWA 4F7ZA 1WJ4A 2KFKA 4F8CB 1IP9A 3OLMD 1UBIA 2JPHA 5D94A 3ZNID 1SE9A 2BWFA 1UZXB 3A1QA 3JSVB 2KWVB 4KVGB 3PGEA 4DHJB 2MP2B 4GN1A 2KXJA 2YLMA 3IFWB 2WWZA 3HK0A 1CMXB 1KJTA 2L0FA 2MW5A 2K8BA 2CHZA 4LJOB 1WX7A 2NBVB 2ZVOA 4RM9A 3ZW3A 2K8CA 2Z0EB 3W1YA 3ZO5B 4M0WB 3KH0A 3PTFC 1J0GA 4G11A 2K39A 3EECA 2KVRA 2BKFA 2CS4A 1YIWA 2DX5B 2KQSA 3H1UA 5C23A 1Z2MA 2BF8B 2WX1A 4OVVA 4AWJA 4I6NB 2MBOA 3EC8A 3Q3FA 2W9NA 2LRWA 2KO3A 3TIXA 3H7PB 1E90A 3ALBA 4NJ7A 4W9IA 1WH3A 2N1VA 2J7QB 2FCMA 1WX8A 4MSMB 4JL9A 4BKSD 1XQQA 4GU2A 2AEHA 1OEYJ 1Q5WB 4WJNA 5IA7A 4HPMB 4PS8A 2LASA 1YQBA 3RYTA 2NS5A 3L17A 4BBNC 1OEYA 5CHFA 4TQ0A 2C9WB 1HE8A 3KUDB 3NY5A 4ICVA 1WFYA 3VTVA 4ANUA 2GBRA 2KWUB 3JVZX 2FAZA 4MGYE 3VFKA 3ZLZA 3IG3A 3S2AA 3M62B 4N9F4 5TR5A 1J19A 4HDQA 4TUUA 2L76A 4FADA 4B95A 2K6DB 2L0TA 1WGDA 4GGQA 4MM3A 2FCQA 3AXCA 3BINA 4NQLB 1Q1OA 1V80A 1WGYA 5C1ZA 4HLEA 3V6EB 2N1WA 4BKGA 2Z0DB 3D32A 1WMHB 3IVFA 3V61A 3DVNU 4MH0E 3QQ8B 4AJWA 4GOCA 3DCGA 3V62A 2FIDA 2LVPA 3R7QA 2KKCA 4EKUA 4PYUA 2BYVE 1UGMA 3QC8B 2ZNVB 4MDKE 3QHTA 4KZ0A 2BPSA 2EMTA 3ZNHB 2BYEA 2J0MA 3K9PB 2G3QB 4DXAB 1R4MI 4DHZB 3MHSD 4MEMA 3HM3A 1WGRA 2KOXA 2G45B 4K7SA 1P3QU 2KTRA 2OOBB 2ZPNA 1UH6A 4EEWA 2FNJB 3ZRCA 2O2VB 4CO7A 1LFDA 2RR9A 2C7HA 2BYFA 2GMIC 1E8XA 2IZVB 3R66C 4ANVA 4JGHB 4TKNA 4RMAA 5LLIA 2JF5A 1OQYA 3WA0A 4I6LB 4CYEA 3JYUA 1V2YA 3ZIMA 5CHWA 4EZJA 2ZZPB 1XT9B 4A3PA 3WAPA 3OAWA 1WM3A 2ZJDA 3ONSA 3ZKJC 3IBEA 2O6VD 1NDDA 4HK2A 3APDA 3UF8A 3WIMA 1LXDA 4DBGA 3M3JA 4KDLB 2KNBA 2UYZB 3DBHI 3DQVA 1P98A 4AOFA 3N32A 4DDGD 1KLVA 1YX6B 2FCNA 2VRRB 1PQSA 1RAXA 3NS8A 4LJPB 5DPWA 2KHWB 4BKTA 2LVQA 2O6VB 4ZRJA 2NVUI 2KLCA 1NI2A 2KFJA 2D2QA 3EHVA 2NBUA 2WDTB 1EF1A 1RFAA 2KMCA 2ASQA 2KTFA 3A33B 1V9JA 2KFKB 4HDOA 4BOZB 3ZVVA 1F9JA 4G0NB 2HD5B 3PV1A 1EO6A 4ANWA 4TQ1A 2DENB 1WX9A 2IO3B 2KDFB 4HJKA 4W9FA 4YL8A 5AZGA 4BBNF 1V6EA 2AL6A 2B3AA 3LJ3A 1WRDB 3VVWB 2ZCCA 3B1LX 4MJSA 4PS3A 5BO4B 2AWTA 2OJRA 5GMVA 4CHKA 4BFRA 4ICUA 3RD2A 4ANXA 4GDLA 3QCAA 5D7GA 1KM7A 3PZDA 5DPTA 3VH4B 2MWSB 5DCNA 2L8JA 2A4ZA 1V5OA 1A5RA 3WALA 1WGGA 2HTHA 1E7UA 4XZ4A 4WQOB 1LQBA 5CX3A 4BOSC 4KZCA 3ZTCA 3OJ4B 2DZMA 2IO2B 1I42A 2DZJA 1TZ1A 2K25A 3RT3B 3QAQA 4W9DA 2WX0A 4IW0A 3JSVA 1GJZA 3PPAA 2IBIB 5CTRC 1WF9A 3L08A 1C3TA 3JW0X 5JHAA 4LDTD 3NHEB 1MG8A 1WY8A 3QA8A 3VAWA 2N9PC 3CF6E 3M95A 1FXTB 3O65B 4A3OA 1WXMA 3T9LA 3K9OB 3V6CB 1P1AA 4B6WA 4ZRIA 3KUCB 3NOBA 4KV2A 1RRBA 4XC2A 5CHVC 1WGHA 4MGKE 3VXWA 1EF5A 3ZUNA 5L95C 4LDTB 1WJ6A 3L10B 3VUXA 4W9EA 3H7PA 4NY0A 3AI5A 2LGXA 3QJZA 3I3TB 4W9GA 5EDSA 3U30A 1S3SG 5KHOA 3RCZA 1G6JA 4NJ6A 2XBBC 3QK0A 4LCDE 2D3GA 3CMMB 2RGFA 3PVLA 1WE7A 1ZGUB 2KJRA 2KN5A 3A4RA 2ZVNA 4EFOA 2PE6B 4WJPA 5LXHA 3TCAA 2D10A 5D2MB 3UQAA 3GOEA 4KIKA 4W9KA 3RZFA 4E74A 2KX3A 4HVBA 2KD0A 3C0RB 1LM8B 4EZKA 3DBRI 2A5UA 2C7MB 3VTWA 2R2OA 1C1YB 4BKSA 4E71A 2KJHB 2MA9B 2XK5B 3KW5B 3PSEB 3RUIB 4FA6A 2JVCA 4GMVA 4EZLA 3ZDMC 1D3ZA 3SD5A 1WR1A 2N7DA 2KANA 1TBEA 2JWZA 3X0WA 2KJ6A 4MELA 4W9LA 2JRIB 2RD0A 4F1SA 3KVFB 5E6OA 3ML9A 2NPTB 2KTRB 4II2B 5AZHA 2IYDB 1H4RA 2PEAA 3ENEA 5JH5C 2LWPA 2AYOB 3A9KB 1VCBA 1L2NA 5E6PA 3EFUA 3TL5A 1U4AA 1YD8U 3N30A 1UD7A 2JUOA 3B0AA 2V3SA 4ZYNA 2KC1A 3U8ZA 3WANA 2KQ7A 2LGYA 2NBWB 3ZNZB 1P0RA 2GBNA 1JRUA 3HHMA 4IM0A 4ASWC 1WIAA 3CSFA 2IY1B 2M0XA 2KX0A 4IWQA 1Q0WB 2WYQA 3PREA 3UIOB 5KHQA 2PE9A 4P7IA 2PPHA 3VTUA 4DK5A 4KSLC 1WJUA 2BWES 2UWQA 2MSED 3V60A 1YJ1A 2CHWA 4DHZE 1ISNA 1AARA 3H9DA 4IG7B 2N7EA 2HE7A 1ZW7A 2LVOA 3R7RA 4K1RB 2GBJA 1XD3B 2ZNVC 3CSTA 3APCA 3ZNGC 4FJYA 3ZTDA 1L7YA 2C5LC 3RULA 4PYZA 5DPRA 2KDEB 2MRPA 1BT0A 1WXAA 3LDZE 5J17A 1E8ZA 1ZKHA 3P2BA 4GDKB 2LRUA 1V86A 3N3KB 2R2QA 4NAWB 5FR6A 3QWZB 3TJPA 1YX5B 1KOTA 2KWCA 2GBKA 2IY0B 1TTNA 2N9XA 3DBSA 3A9JA 3DVGY 4W9JA 1WXVA 3RZWC 4HCPB 5D6JB 1WR6E 3OJ3A 1E7VA 2L3ZA 3A1QB 4MJSB 1Y8RC 3HM6X 3APFA 3H6NA 3ML8A 4GB9A 1WM2A 2K1FA 3SDLC 2CKHB 2BGFA 1NBFC 3KYCD 4GDLB 3AU5A 5G55A 1WI0A 2LXAA 1WE6A 2FIFA 4NPNA 2O6VA 4ZRKA 2DZIA 4K7WA 2ZEQA 3M63B 4NQKE 2DYBA 1GUAB 2EMSA 3VUYA 2KMAA 3ZRFA 4W9HA 2QHOA 1WZ3A 2JXXA 2ZCBA 4WWPA 1Z5SB 3KYDD 4B9KA 4E3CA 3DVNV 4IWPA 1IPGA 2YVCA 1GNUA 4KSKC 2MLBA 3PHWB 1VD2A 3PT2B 3PHXB 2FUHB 4DDID 2RSUA 3QARA 2KDBA 2ZPYA 4M8NA 4M8MA 4FHJA 2K6QA 3SU8X 2J0JA 4GIVA 2REXA 2MBBB 3DOWA 4II3B 3W1SC 2MP2A 4ZDVA 1GC7A 1V5TA 2MQJA 2DYMA 1X1MA 4GSWA 4GXBA 1WJNA 1V81A 4DWFA 4KDIC 1P9DU 1S1QB 4MSQB 2MBHA 3KUZA 5AEKB 5J18A 1J8CA 3PRPB 2EKEC 2K8HA 3TBLD 3VDZA 4JQWC 4RM8A 3MTNB 4AJYB 4I6PA 4JLCA 3QX1A 2N9EB 2IO1B 4EOYA 2DAFA 2NR2A 2MX2A 3DDCB 2DZKA 2M8SA 4BVUC 3A4SC 4G3XB 4FLHA 3AU4A 4HXDA 2JT4B 4IUMB 3DBLI 3PRMB 4MGZE 2L05A 3GZNI 1OGWA 4KIKB 4AUQC 2MCNB 5LXIB 1T0YA 5AZFA 2LXCA 3H7SA 4X57B 2IO0B 3DVGX 2LGDA 1EUVB 4J6IA 2KC2A 2I1JA 2JZ3B 2CHXA 4URKA 4IC7B 4EUTA 5JZEB 3WAOA 2DAJA 4NNJB 2KLGA 3L13A 1E5WA 1SGHA 1IYFA 2G4DB 2G4SA 2KDIA 1R4NI 2D07B 3PS6A 3UGBB 3TMPB 2GBMA 4HWIB 2BKRB 3HIZA 2L7RA 3Q3JA 5IAAC 1WMHA 2KZRA 2LJ5A 2V4LA 3VUWA 2KK8A 3PLVA 2HJ8A 1GG3A 4IM3A 4IWOA 4AP4C 3R3MA 2GOWA 4FJVB 3L16A 2XK5A 4FULA 3X23A 3DPDA 1UELA 3U7DA 1RLFA 2M1MA 1V49A 4IM2A 2FCSA 2V1YA 2DYOA 2CU1A 4WWNA 1WZ0A 2NPTA 4A20A 4K81A 2JY6A 3NZSA 2MBQA 3BY4B 4WJQA 5L83A 1TGZB 3UQBA 3T8MA 1E8WA 2M4NA 1QZEA 3A9KA 3UINB 4WAAA 4FHKA 2AL3A 2C7NB 2M17A 2O2VA 4K7UA 1WYWB 2DHZA 3QIJA 3B08A 1WXSA 3PRZA 1OTRB 2RPQA 1UBQA 2XEWA 2Y5BB 1H8CA 3ZDTA 3IHPC 2I1KA 3NZUA 4FBJB 5E6NA 1M94A 4MGIE 2CR5A 4HPLB 2NCNA 3AULA 1I35A 2C60A 5JHBA 3L0WB 4OVUA 2LD9A 4FN2A 3A9JB 4FJZA 3SHQA 2PJHA 1E8YA 2J0KA 4WJOA 4W9CA 2JZZA 3ECIA 3UIPB 3VHTC 3WAMA 4XX5A 2L00B 2MBEA 3L54A 3VH3B 3VQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRH A;  4WWO A;  1SIF A;  2D11 A;  1GC6 A;  2LI5 A;  2N4F A;  2LZ6 A;  4TV3 A;  2LUE A;  3MJW A;  3W1S A;  4PS7 A;  3PLU A;  5HKH A;  4G50 A;  5G2N A;  5J2R A;  4GDK A;  5DPS A;  4HCN B;  4JIO U;  2Z59 B;  4DHJ D;  1K8R B;  4NAW A;  4F7Z A;  1WJ4 A;  2KFK A;  4F8C B;  1IP9 A;  3OLM D;  1UBI A;  2JPH A;  5D94 A;  3ZNI D;  1SE9 A;  2BWF A;  1UZX B;  3A1Q A;  3JSV B;  2KWV B;  4KVG B;  3PGE A;  4DHJ B;  2MP2 B;  4GN1 A;  2KXJ A;  2YLM A;  3IFW B;  2WWZ A;  3HK0 A;  1CMX B;  1KJT A;  2L0F A;  2MW5 A;  2K8B A;  2CHZ A;  4LJO B;  1WX7 A;  2NBV B;  2ZVO A;  4RM9 A;  3ZW3 A;  2K8C A;  2Z0E B;  3W1Y A;  3ZO5 B;  4M0W B;  3KH0 A;  3PTF C;  1J0G A;  4G11 A;  2K39 A;  3EEC A;  2KVR A;  2BKF A;  2CS4 A;  1YIW A;  2DX5 B;  2KQS A;  3H1U A;  5C23 A;  1Z2M A;  2BF8 B;  2WX1 A;  4OVV A;  4AWJ A;  4I6N B;  2MBO A;  3EC8 A;  3Q3F A;  2W9N A;  2LRW A;  2KO3 A;  3TIX A;  3H7P B;  1E90 A;  3ALB A;  4NJ7 A;  4W9I A;  1WH3 A;  2N1V A;  2J7Q B;  2FCM A;  1WX8 A;  4MSM B;  4JL9 A;  4BKS D;  1XQQ A;  4GU2 A;  2AEH A;  1OEY J;  1Q5W B;  4WJN A;  5IA7 A;  4HPM B;  4PS8 A;  2LAS A;  1YQB A;  3RYT A;  2NS5 A;  3L17 A;  4BBN C;  1OEY A;  5CHF A;  4TQ0 A;  2C9W B;  1HE8 A;  3KUD B;  3NY5 A;  4ICV A;  1WFY A;  3VTV A;  4ANU A;  2GBR A;  2KWU B;  3JVZ X;  2FAZ A;  4MGY E;  3VFK A;  3ZLZ A;  3IG3 A;  3S2A A;  3M62 B;  4N9F 4;  5TR5 A;  1J19 A;  4HDQ A;  4TUU A;  2L76 A;  4FAD A;  4B95 A;  2K6D B;  2L0T A;  1WGD A;  4GGQ A;  4MM3 A;  2FCQ A;  3AXC A;  3BIN A;  4NQL B;  1Q1O A;  1V80 A;  1WGY A;  5C1Z A;  4HLE A;  3V6E B;  2N1W A;  4BKG A;  2Z0D B;  3D32 A;  1WMH B;  3IVF A;  3V61 A;  3DVN U;  4MH0 E;  3QQ8 B;  4AJW A;  4GOC A;  3DCG A;  3V62 A;  2FID A;  2LVP A;  3R7Q A;  2KKC A;  4EKU A;  4PYU A;  2BYV E;  1UGM A;  3QC8 B;  2ZNV B;  4MDK E;  3QHT A;  4KZ0 A;  2BPS A;  2EMT A;  3ZNH B;  2BYE A;  2J0M A;  3K9P B;  2G3Q B;  4DXA B;  1R4M I;  4DHZ B;  3MHS D;  4MEM A;  3HM3 A;  1WGR A;  2KOX A;  2G45 B;  4K7S A;  1P3Q U;  2KTR A;  2OOB B;  2ZPN A;  1UH6 A;  4EEW A;  2FNJ B;  3ZRC A;  2O2V B;  4CO7 A;  1LFD A;  2RR9 A;  2C7H A;  2BYF A;  2GMI C;  1E8X A;  2IZV B;  3R66 C;  4ANV A;  4JGH B;  4TKN A;  4RMA A;  5LLI A;  2JF5 A;  1OQY A;  3WA0 A;  4I6L B;  4CYE A;  3JYU A;  1V2Y A;  3ZIM A;  5CHW A;  4EZJ A;  2ZZP B;  1XT9 B;  4A3P A;  3WAP A;  3OAW A;  1WM3 A;  2ZJD A;  3ONS A;  3ZKJ C;  3IBE A;  2O6V D;  1NDD A;  4HK2 A;  3APD A;  3UF8 A;  3WIM A;  1LXD A;  4DBG A;  3M3J A;  4KDL B;  2KNB A;  2UYZ B;  3DBH I;  3DQV A;  1P98 A;  4AOF A;  3N32 A;  4DDG D;  1KLV A;  1YX6 B;  2FCN A;  2VRR B;  1PQS A;  1RAX A;  3NS8 A;  4LJP B;  5DPW A;  2KHW B;  4BKT A;  2LVQ A;  2O6V B;  4ZRJ A;  2NVU I;  2KLC A;  1NI2 A;  2KFJ A;  2D2Q A;  3EHV A;  2NBU A;  2WDT B;  1EF1 A;  1RFA A;  2KMC A;  2ASQ A;  2KTF A;  3A33 B;  1V9J A;  2KFK B;  4HDO A;  4BOZ B;  3ZVV A;  1F9J A;  4G0N B;  2HD5 B;  3PV1 A;  1EO6 A;  4ANW A;  4TQ1 A;  2DEN B;  1WX9 A;  2IO3 B;  2KDF B;  4HJK A;  4W9F A;  4YL8 A;  5AZG A;  4BBN F;  1V6E A;  2AL6 A;  2B3A A;  3LJ3 A;  1WRD B;  3VVW B;  2ZCC A;  3B1L X;  4MJS A;  4PS3 A;  5BO4 B;  2AWT A;  2OJR A;  5GMV A;  4CHK A;  4BFR A;  4ICU A;  3RD2 A;  4ANX A;  4GDL A;  3QCA A;  5D7G A;  1KM7 A;  3PZD A;  5DPT A;  3VH4 B;  2MWS B;  5DCN A;  2L8J A;  2A4Z A;  1V5O A;  1A5R A;  3WAL A;  1WGG A;  2HTH A;  1E7U A;  4XZ4 A;  4WQO B;  1LQB A;  5CX3 A;  4BOS C;  4KZC A;  3ZTC A;  3OJ4 B;  2DZM A;  2IO2 B;  1I42 A;  2DZJ A;  1TZ1 A;  2K25 A;  3RT3 B;  3QAQ A;  4W9D A;  2WX0 A;  4IW0 A;  3JSV A;  1GJZ A;  3PPA A;  2IBI B;  5CTR C;  1WF9 A;  3L08 A;  1C3T A;  3JW0 X;  5JHA A;  4LDT D;  3NHE B;  1MG8 A;  1WY8 A;  3QA8 A;  3VAW A;  2N9P C;  3CF6 E;  3M95 A;  1FXT B;  3O65 B;  4A3O A;  1WXM A;  3T9L A;  3K9O B;  3V6C B;  1P1A A;  4B6W A;  4ZRI A;  3KUC B;  3NOB A;  4KV2 A;  1RRB A;  4XC2 A;  5CHV C;  1WGH A;  4MGK E;  3VXW A;  1EF5 A;  3ZUN A;  5L95 C;  4LDT B;  1WJ6 A;  3L10 B;  3VUX A;  4W9E A;  3H7P A;  4NY0 A;  3AI5 A;  2LGX A;  3QJZ A;  3I3T B;  4W9G A;  5EDS A;  3U30 A;  1S3S G;  5KHO A;  3RCZ A;  1G6J A;  4NJ6 A;  2XBB C;  3QK0 A;  4LCD E;  2D3G A;  3CMM B;  2RGF A;  3PVL A;  1WE7 A;  1ZGU B;  2KJR A;  2KN5 A;  3A4R A;  2ZVN A;  4EFO A;  2PE6 B;  4WJP A;  5LXH A;  3TCA A;  2D10 A;  5D2M B;  3UQA A;  3GOE A;  4KIK A;  4W9K A;  3RZF A;  4E74 A;  2KX3 A;  4HVB A;  2KD0 A;  3C0R B;  1LM8 B;  4EZK A;  3DBR I;  2A5U A;  2C7M B;  3VTW A;  2R2O A;  1C1Y B;  4BKS A;  4E71 A;  2KJH B;  2MA9 B;  2XK5 B;  3KW5 B;  3PSE B;  3RUI B;  4FA6 A;  2JVC A;  4GMV A;  4EZL A;  3ZDM C;  1D3Z A;  3SD5 A;  1WR1 A;  2N7D A;  2KAN A;  1TBE A;  2JWZ A;  3X0W A;  2KJ6 A;  4MEL A;  4W9L A;  2JRI B;  2RD0 A;  4F1S A;  3KVF B;  5E6O A;  3ML9 A;  2NPT B;  2KTR B;  4II2 B;  5AZH A;  2IYD B;  1H4R A;  2PEA A;  3ENE A;  5JH5 C;  2LWP A;  2AYO B;  3A9K B;  1VCB A;  1L2N A;  5E6P A;  3EFU A;  3TL5 A;  1U4A A;  1YD8 U;  3N30 A;  1UD7 A;  2JUO A;  3B0A A;  2V3S A;  4ZYN A;  2KC1 A;  3U8Z A;  3WAN A;  2KQ7 A;  2LGY A;  2NBW B;  3ZNZ B;  1P0R A;  2GBN A;  1JRU A;  3HHM A;  4IM0 A;  4ASW C;  1WIA A;  3CSF A;  2IY1 B;  2M0X A;  2KX0 A;  4IWQ A;  1Q0W B;  2WYQ A;  3PRE A;  3UIO B;  5KHQ A;  2PE9 A;  4P7I A;  2PPH A;  3VTU A;  4DK5 A;  4KSL C;  1WJU A;  2BWE S;  2UWQ A;  2MSE D;  3V60 A;  1YJ1 A;  2CHW A;  4DHZ E;  1ISN A;  1AAR A;  3H9D A;  4IG7 B;  2N7E A;  2HE7 A;  1ZW7 A;  2LVO A;  3R7R A;  4K1R B;  2GBJ A;  1XD3 B;  2ZNV C;  3CST A;  3APC A;  3ZNG C;  4FJY A;  3ZTD A;  1L7Y A;  2C5L C;  3RUL A;  4PYZ A;  5DPR A;  2KDE B;  2MRP A;  1BT0 A;  1WXA A;  3LDZ E;  5J17 A;  1E8Z A;  1ZKH A;  3P2B A;  4GDK B;  2LRU A;  1V86 A;  3N3K B;  2R2Q A;  4NAW B;  5FR6 A;  3QWZ B;  3TJP A;  1YX5 B;  1KOT A;  2KWC A;  2GBK A;  2IY0 B;  1TTN A;  2N9X A;  3DBS A;  3A9J A;  3DVG Y;  4W9J A;  1WXV A;  3RZW C;  4HCP B;  5D6J B;  1WR6 E;  3OJ3 A;  1E7V A;  2L3Z A;  3A1Q B;  4MJS B;  1Y8R C;  3HM6 X;  3APF A;  3H6N A;  3ML8 A;  4GB9 A;  1WM2 A;  2K1F A;  3SDL C;  2CKH B;  2BGF A;  1NBF C;  3KYC D;  4GDL B;  3AU5 A;  5G55 A;  1WI0 A;  2LXA A;  1WE6 A;  2FIF A;  4NPN A;  2O6V A;  4ZRK A;  2DZI A;  4K7W A;  2ZEQ A;  3M63 B;  4NQK E;  2DYB A;  1GUA B;  2EMS A;  3VUY A;  2KMA A;  3ZRF A;  4W9H A;  2QHO A;  1WZ3 A;  2JXX A;  2ZCB A;  4WWP A;  1Z5S B;  3KYD D;  4B9K A;  4E3C A;  3DVN V;  4IWP A;  1IPG A;  2YVC A;  1GNU A;  4KSK C;  2MLB A;  3PHW B;  1VD2 A;  3PT2 B;  3PHX B;  2FUH B;  4DDI D;  2RSU A;  3QAR A;  2KDB A;  2ZPY A;  4M8N A;  4M8M A;  4FHJ A;  2K6Q A;  3SU8 X;  2J0J A;  4GIV A;  2REX A;  2MBB B;  3DOW A;  4II3 B;  3W1S C;  2MP2 A;  4ZDV A;  1GC7 A;  1V5T A;  2MQJ A;  2DYM A;  1X1M A;  4GSW A;  4GXB A;  1WJN A;  1V81 A;  4DWF A;  4KDI C;  1P9D U;  1S1Q B;  4MSQ B;  2MBH A;  3KUZ A;  5AEK B;  5J18 A;  1J8C A;  3PRP B;  2EKE C;  2K8H A;  3TBL D;  3VDZ A;  4JQW C;  4RM8 A;  3MTN B;  4AJY B;  4I6P A;  4JLC A;  3QX1 A;  2N9E B;  2IO1 B;  4EOY A;  2DAF A;  2NR2 A;  2MX2 A;  3DDC B;  2DZK A;  2M8S A;  4BVU C;  3A4S C;  4G3X B;  4FLH A;  3AU4 A;  4HXD A;  2JT4 B;  4IUM B;  3DBL I;  3PRM B;  4MGZ E;  2L05 A;  3GZN I;  1OGW A;  4KIK B;  4AUQ C;  2MCN B;  5LXI B;  1T0Y A;  5AZF A;  2LXC A;  3H7S A;  4X57 B;  2IO0 B;  3DVG X;  2LGD A;  1EUV B;  4J6I A;  2KC2 A;  2I1J A;  2JZ3 B;  2CHX A;  4URK A;  4IC7 B;  4EUT A;  5JZE B;  3WAO A;  2DAJ A;  4NNJ B;  2KLG A;  3L13 A;  1E5W A;  1SGH A;  1IYF A;  2G4D B;  2G4S A;  2KDI A;  1R4N I;  2D07 B;  3PS6 A;  3UGB B;  3TMP B;  2GBM A;  4HWI B;  2BKR B;  3HIZ A;  2L7R A;  3Q3J A;  5IAA C;  1WMH A;  2KZR A;  2LJ5 A;  2V4L A;  3VUW A;  2KK8 A;  3PLV A;  2HJ8 A;  1GG3 A;  4IM3 A;  4IWO A;  4AP4 C;  3R3M A;  2GOW A;  4FJV B;  3L16 A;  2XK5 A;  4FUL A;  3X23 A;  3DPD A;  1UEL A;  3U7D A;  1RLF A;  2M1M A;  1V49 A;  4IM2 A;  2FCS A;  2V1Y A;  2DYO A;  2CU1 A;  4WWN A;  1WZ0 A;  2NPT A;  4A20 A;  4K81 A;  2JY6 A;  3NZS A;  2MBQ A;  3BY4 B;  4WJQ A;  5L83 A;  1TGZ B;  3UQB A;  3T8M A;  1E8W A;  2M4N A;  1QZE A;  3A9K A;  3UIN B;  4WAA A;  4FHK A;  2AL3 A;  2C7N B;  2M17 A;  2O2V A;  4K7U A;  1WYW B;  2DHZ A;  3QIJ A;  3B08 A;  1WXS A;  3PRZ A;  1OTR B;  2RPQ A;  1UBQ A;  2XEW A;  2Y5B B;  1H8C A;  3ZDT A;  3IHP C;  2I1K A;  3NZU A;  4FBJ B;  5E6N A;  1M94 A;  4MGI E;  2CR5 A;  4HPL B;  2NCN A;  3AUL A;  1I35 A;  2C60 A;  5JHB A;  3L0W B;  4OVU A;  2LD9 A;  4FN2 A;  3A9J B;  4FJZ A;  3SHQ A;  2PJH A;  1E8Y A;  2J0K A;  4WJO A;  4W9C A;  2JZZ A;  3ECI A;  3UIP B;  3VHT C;  3WAM A;  4XX5 A;  2L00 B;  2MBE A;  3L54 A;  3VH3 B;  3VQI A; 
#chains in the Genus database with same CATH topology
 2INN E;  1XEE A;  2N4F A;  3MC9 A;  3RNA C;  4TV3 A;  2KT7 A;  5G2N A;  4Q2J A;  2CU3 A;  1K8R B;  2KFK A;  1TIF A;  5D94 A;  1CJE A;  2DBY A;  2BWF A;  2WGS A;  1UZX B;  2Y5P A;  4KVG B;  3IFW B;  2Y3A A;  2V0G A;  3HK0 A;  3ZRF A;  4RM9 A;  3ZW3 A;  3PTF C;  3MP9 A;  3EEC A;  2L32 A;  1YIW A;  1L0V B;  1IBX A;  2WX1 A;  2WDR B;  4OZB A;  2KO3 A;  2G1E A;  1N5X A;  2LEK A;  3TIX A;  3ALB A;  4W9I A;  2PKO A;  3BVG A;  4JL9 A;  1XQQ A;  4GU2 A;  4WJN A;  5IA7 A;  1FXA A;  1AYF A;  2IND C;  3ZXR A;  1NYR A;  1OEY A;  1HE8 A;  1VZ8 A;  4ICV A;  2ACZ B;  3RNG C;  4MGY E;  3ZLZ A;  3Q6B A;  2OED A;  4HDQ A;  2L0T A;  4MM3 A;  1HZ6 A;  4NQL B;  4BKG A;  1L6U A;  3V61 A;  3DVN U;  3DHI C;  3QQ8 B;  3B2F A;  2FID A;  4PYU A;  2BYV E;  1QOF A;  1SE2 A;  2BPS A;  4ZOH C;  2BYE A;  2G3Q B;  2D3C A;  4MEM A;  2V4I B;  3HM3 A;  3PZ7 A;  2X8X X;  1JWU D;  3W2D A;  2KTR A;  1JWA D;  1T5X D;  2O2V B;  2RR9 A;  2C7H A;  2WXR A;  4XWW A;  2GMI C;  1E8X A;  1NVI D;  1V1P B;  4O1N A;  2J42 A;  1GAQ B;  4TKN A;  4I6L B;  4CYE A;  3JYU A;  1V2Y A;  1JWS D;  4EZJ A;  4XDC A;  2KWD A;  2WDV B;  2WXH A;  3ONS A;  4AQ7 A;  3AMZ A;  1T3Q A;  1AW7 A;  5D3D A;  3N32 A;  2VRR B;  4NZL B;  1RAX A;  4LNN A;  2KLC A;  1NI2 A;  4N6E B;  2D2Q A;  2YEP F;  4P1B C;  3A33 B;  2KFK B;  1N63 A;  3AE7 B;  1SB3 C;  1F9J A;  4G0N B;  1SE3 A;  3PV1 A;  2DEN B;  1WX9 A;  4HJK A;  1V6E A;  4B0M A;  1WRD B;  3DBL B;  4MT5 A;  4MJS A;  2AWT A;  1TKY A;  4ANX A;  3KWV A;  3PZD A;  3VH4 B;  2XN9 C;  2MEK A;  3WAL A;  1NEN B;  1IBX B;  1PGB A;  3ZTC A;  3OJ4 B;  1L4D B;  1XLO A;  3DHG C;  1UWM A;  3IAS 1;  2WX0 A;  3PPA A;  2IBI B;  3V3X A;  3NHE B;  1WY8 A;  4YTP B;  1N5W A;  3H8H A;  1WXM A;  3T9L A;  1T0S C;  4ACF A;  3KUC B;  2QCZ A;  1RRB A;  1NYQ A;  1EF5 A;  2BS4 B;  1VJK A;  2WNM A;  1JRO A;  2N7J A;  4NY0 A;  3AI5 A;  1D4B A;  1M4V A;  4YWG G;  1G6J A;  3CMM B;  2RGF A;  3PVL A;  3AE5 B;  2KJR A;  2KN5 A;  1ET6 A;  2EKI A;  3A4R A;  4WJP A;  3RZF A;  1MI0 A;  4A90 A;  5G5G A;  2C7M B;  1C1Y B;  4BKS A;  3RUI B;  2MA9 B;  4L1B A;  4EZL A;  4GMV A;  2RDG A;  5AUK A;  3BK1 A;  2VZK D;  3X0W A;  4W9L A;  4F1S A;  2NPT B;  2KTR B;  4II2 B;  3BWU D;  5AZH A;  2PEA A;  3ENE A;  2LWP A;  1VCB A;  2VZK B;  1UD7 A;  4HKQ A;  4ZYN A;  2KQ7 A;  1IGC A;  2NBW B;  4ASW C;  2IY1 B;  2KX0 A;  4ZRP A;  3PRE A;  3UIO B;  2PE9 A;  1TYG B;  2BWE S;  1EWC A;  3AEG B;  3Q3O C;  1ISN A;  2V3N A;  4K1R B;  2GBJ A;  4WAF A;  1K51 A;  3CST A;  3ZNG C;  1MVK A;  1FCL A;  2C5L C;  4PK1 A;  5J17 A;  1PDX A;  1E8Z A;  3P2B A;  3C8Y A;  1E0Z A;  1V86 A;  2WDQ B;  3Q2A C;  1L5P A;  1YX5 B;  2IY0 B;  3DVG Y;  1V1O A;  3RZW C;  1I4G A;  1E7V A;  4MJS B;  1Y8R C;  1FRR A;  3AE2 B;  4A55 A;  2CKH B;  2WQY B;  4KX6 B;  4NPN A;  3SFE B;  4K7W A;  3M63 B;  4NQK E;  1SXT A;  2I38 A;  1Z5S B;  2N9K A;  2YVC A;  2FUG 1;  3P1M A;  1KF6 B;  3PHW B;  1VD2 A;  3PT2 B;  1LO5 D;  3Q14 C;  2FUH B;  4DDI D;  2K6Q A;  3SU8 X;  2REX A;  4II3 B;  3W1S C;  2BYT A;  1V81 A;  4DWF A;  1JQ4 A;  2WXF A;  3AEC B;  2MBH A;  3KUZ A;  4USA A;  1R4M B;  2PVO D;  1DOX A;  3TBL D;  1F0Z A;  4RM8 A;  4I6P A;  4EOY A;  2NR2 A;  5IKC M;  2DZK A;  2M8S A;  1UNS A;  3A4S C;  3BVZ A;  3ZJT A;  3AU4 A;  1YJJ A;  4HXD A;  3DBL I;  3U7Z A;  4MGZ E;  4AUQ C;  5LXI B;  1QIL A;  1T0Y A;  4M00 A;  3DVG X;  3SEB A;  1EUV B;  2I1J A;  2CHX A;  1UUP A;  2DAJ A;  3TEY A;  2BT6 A;  2KLG A;  3I63 C;  2QIE B;  3PS6 A;  3UGB B;  2K3U A;  2GBM A;  5IAA C;  3O13 A;  4P6V F;  1JAL A;  3PLV A;  1GG3 A;  2PIA A;  1UWX A;  3W5V B;  1PFD A;  4FJV B;  2AX5 A;  3U7D A;  1GB4 A;  3EA6 A;  3NZS A;  3BY4 B;  4WJQ A;  5L83 A;  4DXG A;  4OZC A;  3T8M A;  3B2G A;  3A9K A;  4KGR A;  2L1A A;  2DHZ A;  3B08 A;  1WXS A;  2RPQ A;  2AQ2 B;  2Y5B B;  2BVC A;  3ZDT A;  1D6E C;  3IHP C;  5E6N A;  1HTQ A;  3Q8A A;  3NVZ A;  4ITK A;  2NCN A;  2PTL A;  3AUL A;  1I35 A;  5JHB A;  4FN2 A;  3ABV B;  2J0K A;  3ECI A;  3UIP B;  2HTM E;  4OVZ A;  3L4P A;  2JRH A;  4WWO A;  4C80 A;  2LI5 A;  2G9H D;  4WWM A;  3RFZ B;  3W1S A;  4YSZ B;  4RGN A;  5HKH A;  4GDK A;  5DPS A;  4HCN B;  3IXS A;  1ZDX A;  4JIO U;  2J4X A;  4F8C B;  2JPH A;  3ZNI D;  2GRI A;  3A1Q A;  3JSV B;  4IDI A;  3PGE A;  2KN4 A;  2JQR B;  2KXJ A;  2WWZ A;  4LJO B;  2MW5 A;  2L0F A;  1WX7 A;  3W1Y A;  4M0W B;  3KH0 A;  1J0G A;  2K39 A;  1E6E B;  4BZA A;  2TSS A;  2KQS A;  3H1U A;  3W9C B;  2BF8 B;  4OVV A;  2SAK A;  1C79 A;  2INP E;  1WH3 A;  4JWU C;  1CK1 A;  1YN3 A;  1VDV A;  4A8X C;  4HPM B;  4DQO C;  2E3T A;  2NS5 A;  3L17 A;  4BBN C;  3DWG C;  4TQ0 A;  1ZPS A;  3GE3 C;  3VTV A;  1EU3 A;  2GBR A;  4N9F 4;  4KGS A;  1TY0 A;  2L76 A;  2LGI A;  2RDB C;  4GGQ A;  2FCQ A;  4C56 C;  2K5P A;  4HLE A;  3V6E B;  4MH0 E;  3DCG A;  4EKU A;  1Q10 A;  2GLS A;  3QHT A;  4MDK E;  4B0E A;  3ZNH B;  2J0M A;  2W54 A;  2QC8 A;  1PUT A;  1R4M I;  1FPY A;  4YSY B;  2BS2 B;  3RNE C;  2OOB B;  1UH6 A;  3AE4 B;  2FNJ B;  1VLB A;  4JWS C;  1DYQ A;  1ZDV A;  5H8Y E;  3OG5 A;  4KKJ A;  4JGH B;  1MPE A;  4WIP A;  1I4P A;  4IOI E;  3KQ4 A;  3WCQ A;  1L6V A;  4N59 A;  1KLU D;  3WAP A;  2ZJD A;  1C4P A;  3ZKJ C;  2O6V D;  2LUM A;  4DBG A;  1LXD A;  4KDL B;  1RYJ A;  1YX6 B;  1PQS A;  2NMQ A;  2LVQ A;  2O6V B;  1KLG D;  4ARI A;  3NVV A;  4ANW A;  1RFA A;  2KMC A;  1V9J A;  2AQ1 B;  1CQV A;  3N20 C;  3NUH B;  2HD5 B;  1RWS A;  2KDF B;  2UU7 A;  4YXD B;  3VVW B;  3GZN B;  2BW2 A;  2OJR A;  1J7B A;  5GMV A;  1WWT A;  4ICU A;  4GDL A;  2FBW B;  3AEB B;  2HTH A;  4XZ4 A;  4LNF A;  4K3B A;  4WQO B;  2IGD A;  3BK2 A;  4BOS C;  2JXT A;  1R4N B;  4IW0 A;  5CTR C;  1WF9 A;  3JW0 X;  4LDT D;  1DGJ A;  1MG8 A;  2N9P C;  3CF6 E;  1FXT B;  1K53 A;  1ZOY B;  3V6C B;  4TSS A;  3NOB A;  3N1X C;  3VXW A;  1WGH A;  4MGK E;  1L0X B;  3ZUN A;  5L95 C;  4LDT B;  2KAJ A;  4D2K A;  1HQR D;  3L10 B;  3H7P A;  4W9G A;  2ICI A;  1S3S G;  5KHO A;  3RCZ A;  4NJ6 A;  2D3G A;  2NTT A;  3AE9 B;  1WE7 A;  1ZGU B;  5LXH A;  4HRO A;  2D10 A;  5D2M B;  3UQA A;  4KIK A;  4W9K A;  1XXG A;  1YOV B;  3ETR A;  4E74 A;  3ZQ4 A;  1LM8 B;  2A5U A;  2R2O A;  4XWT A;  3SD5 A;  2V9H A;  1TBE A;  4RGM A;  4MEL A;  2JRI B;  2RPV A;  2RD0 A;  5E6O A;  3ML9 A;  2MJD A;  4ARC A;  1SBB B;  3P63 A;  2IYD B;  1H4R A;  2KVZ A;  1XO3 A;  5E6P A;  1L2N A;  3VR9 B;  4AS1 A;  5H92 C;  3P4R B;  2D3A A;  2V3S A;  2INC C;  3WAN A;  3IT4 B;  2LGY A;  3ZNZ B;  3UI3 A;  1WIA A;  2M0X A;  1I4X A;  4IWQ A;  1J7C A;  1DOI A;  2PPH A;  3VTU A;  1WJU A;  4REZ A;  2MSE D;  1YJ1 A;  2CHW A;  4DHZ E;  4M02 A;  1ET9 A;  1KH0 A;  3H9D A;  2N7E A;  1TT5 B;  2LVO A;  2JSV X;  5DPR A;  2MRP A;  1BT0 A;  4YSX B;  2DLB A;  3TJP A;  5LNK 1;  1L0Y B;  2N9X A;  4C7Z A;  5IN7 A;  5D6J B;  1OFF A;  1T0R C;  5C2T B;  1WM2 A;  2W3S A;  2BGF A;  1TJE A;  4GDL B;  1JML A;  5G55 A;  3V05 A;  5FKA C;  1GUA B;  3VUY A;  4W9H A;  1FM0 D;  2ZCB A;  3IT6 B;  1LGR A;  4B9K A;  3PHX B;  2RSU A;  3QAR A;  3SR6 A;  2J0J A;  4GIV A;  2MBB B;  3NRZ A;  1GC7 A;  4GSW A;  4GXB A;  1WJN A;  1S1Q B;  4EE2 A;  5J18 A;  4A9A A;  4FXC A;  1J8C A;  2EKE C;  1PGX A;  4WUR A;  2M0A A;  2W3R A;  3NJT A;  3OWE B;  2DAF A;  5FR3 A;  4MM3 B;  2MX2 A;  3HVZ A;  4LTU A;  1FMA D;  3VR8 B;  4C00 A;  2M56 B;  3GZN I;  4KIK B;  5AZF A;  4US8 A;  1B1Z A;  2LGD A;  2WHI A;  5IOI A;  1D5X C;  2JZ3 B;  4IC7 B;  3WAO A;  1A70 A;  2R61 A;  1SGH A;  1R4N I;  2KDI A;  2L7R A;  1WMH A;  2V4L A;  3BVM A;  3VUW A;  4KKI A;  4YTM B;  2BBC A;  1MG4 A;  5IP4 D;  2BS3 B;  3NS1 A;  4HJG E;  4H2A A;  1VZ7 A;  2XK5 A;  3AEF B;  3X23 A;  1UEL A;  4L2Y A;  2J52 A;  4J3O D;  1E7P B;  2V1Y A;  2DYO A;  2CU1 A;  4A20 A;  2RDH A;  2MBQ A;  2BB5 A;  1QZE A;  3N1Y C;  1WYW B;  1OTR B;  1H8C A;  3NZU A;  1I7H A;  3PZ8 A;  1M94 A;  5HI1 A;  2LD9 A;  3SHQ A;  4WJO A;  4ZHP A;  2JZZ A;  3VHT C;  1ZXH A;  4XX5 A;  3L54 A;  1E9M A;  4HRS A;  4RF1 A;  2WXN A;  2LZ6 A;  2LUE A;  3MHZ A;  2DWQ A;  4JPS A;  1TS2 A;  4DHJ D;  4NAM A;  1TY2 A;  4NAW A;  4F7Z A;  3NVW A;  3OLM D;  1FNV A;  2KAC A;  3RI7 C;  3U52 E;  2KWV B;  4DHJ B;  2IGG A;  2YLM A;  5EE0 A;  1CMX B;  2CHZ A;  2ZVO A;  2NBV B;  5BMH A;  3DBR B;  2Z0E B;  3ZO5 B;  4G11 A;  2KVR A;  4US9 A;  3MC8 A;  3SFD B;  2J53 A;  4AWJ A;  1QLB B;  2MBO A;  4I6N B;  3Q3F A;  2W9N A;  3MC0 B;  2LRW A;  2GB1 A;  1E90 A;  2FE8 A;  4NJ7 A;  1FD6 A;  2J7Q B;  2FCM A;  1WX8 A;  3U4E G;  3EGR A;  4BKS D;  2AEH A;  1OEY J;  5C3J B;  1Q5W B;  2K9X A;  4PS8 A;  3KLS X;  2LHE A;  3RYT A;  5CHF A;  3KUD B;  4ANU A;  2WXQ A;  3JVZ X;  2FAZ A;  3VFK A;  3EUB 2;  4K3C A;  5TR5 A;  1NI3 A;  4B95 A;  1WGD A;  4LK0 M;  3BIN A;  4ZRQ A;  1YN5 A;  2N1W A;  1WMH B;  2X38 A;  2VH2 A;  3IVF A;  4AJW A;  4P16 A;  1RFK A;  2LVP A;  1P7F A;  4OHJ A;  1QQR A;  4HKZ E;  2SEB D;  4DHZ B;  3MHS D;  1WGR A;  2G45 B;  4LNI A;  4K7S A;  1P3Q U;  5BMI A;  1JW9 D;  2QJL A;  4EEW A;  3ZRC A;  1OQR A;  2WXK A;  1SF0 A;  4RGO S;  2IZV B;  3R66 C;  4ANV A;  1AN8 A;  2JF5 A;  1OQY A;  4XYC A;  3BYY B;  1XT9 B;  1MFW A;  1T6B X;  3OAW A;  1F52 A;  1YN4 A;  2IPK D;  3IBE A;  3R2T A;  1NDD A;  3UF8 A;  1YNT E;  3FAH A;  3KWL A;  3M3J A;  2N9L A;  3DQV A;  3EFC A;  1P98 A;  4AOF A;  4DDG D;  1KLV A;  3NS8 A;  2QDF A;  4LJP B;  2IDY A;  1JRP A;  4ZRJ A;  2NVU I;  2KFJ A;  3EHV A;  2NBU A;  1I4H A;  1EF1 A;  1ZUD 2;  2KTF A;  2WDT B;  1EU4 A;  3ZVV A;  2VH1 A;  4TQ1 A;  1JWB D;  3TSS A;  3PO0 A;  5BYS A;  3LJ3 A;  2ZCC A;  3B1L X;  4PS3 A;  2EEL A;  4XGA B;  5D7G A;  1C9F A;  1TS4 A;  2ZW1 A;  2L8J A;  1WGG A;  1E7U A;  2JWU A;  1LQB A;  4M01 A;  3Q8B A;  3R2I A;  4KZC A;  5HG2 A;  1I42 A;  2IO2 B;  2PW9 A;  1TZ1 A;  2K25 A;  2D3B A;  3HRD D;  1QF6 A;  1C3T A;  5JHA A;  1AWD A;  3QA8 A;  3VAW A;  3M95 A;  3O65 B;  1YQ4 B;  3K9O B;  1P1A A;  4B6W A;  4ZRI A;  4KV2 A;  2QEJ C;  3AB5 A;  1I4Q A;  5CHV C;  1F2R C;  3Q3N C;  2LGX A;  3I3T B;  2XBB C;  4LCD E;  1P7E A;  4N58 A;  3TCA A;  3GOE A;  3P4Q B;  2V3P A;  2KX3 A;  2Y5C A;  2KD0 A;  3C0R B;  3R8B A;  3FC4 A;  3DBR I;  3GB1 A;  2BQQ A;  3PSE B;  2JYE A;  3KW5 B;  4FA6 A;  2JVC A;  1D3Z A;  2KAN A;  4WH4 A;  2K0P A;  1C4A A;  2KJ6 A;  3KVF B;  5JH5 C;  2AYO B;  3A9K B;  1U4A A;  1YD8 U;  2CJN A;  1E10 A;  1HZ5 A;  3B0A A;  3U8Z A;  2KC1 A;  2ZW0 A;  2WXL A;  1F77 A;  1P0R A;  2GBN A;  1YQ3 B;  1HA5 A;  3N9Y C;  3CSF A;  1Q0W B;  2IGH A;  5KHQ A;  1EWY C;  3Q8E A;  4DK5 A;  2H89 B;  2KQ4 X;  2UWQ A;  1ZP0 B;  3VRB B;  1AAR A;  1BUI C;  2HE7 A;  3R7R A;  3ZJU A;  1XD3 B;  1YJI A;  1V1P A;  2ZNV C;  3APC A;  3ZTD A;  1L7Y A;  2MH7 A;  1FFV A;  4KGT A;  4PYZ A;  2PLP A;  1WXA A;  1ZKH A;  4GDK B;  3GP7 A;  2R2Q A;  3QWZ B;  3ZXV A;  1SSN A;  1KOT A;  2GBK A;  3A9J A;  1WXV A;  1KRH A;  4HCP B;  4WQM A;  1WR6 E;  5BMG A;  5JXV A;  3A1Q B;  1WXQ A;  3HM6 X;  4GB9 A;  2K1F A;  3TEX A;  1NBF C;  2YEP B;  1WI0 A;  2LXA A;  2FIF A;  2ZEQ A;  2DYB A;  2EMS A;  2KMA A;  1WZ3 A;  2JXX A;  1GB1 A;  1ACC A;  3KYD D;  3DVN V;  4IWP A;  1GNU A;  1PGA A;  4KSK C;  2MLB A;  5TSS A;  3W5U B;  1DOY A;  2KDB A;  1TKE A;  3LYY A;  2MP2 A;  2MQJ A;  1X1M A;  4KDI C;  1P9D U;  3NZ3 A;  4OW0 A;  5AEK B;  1ESF A;  4CQN A;  4BAX A;  1MJD A;  3LB8 C;  3MTN B;  2WXP A;  4AJY B;  3NVY A;  3QX1 A;  4R3D A;  5MPO A;  1PYW D;  2IO1 B;  2CJO A;  4BVU C;  1YMH E;  3HVD A;  3ZJV A;  1Y56 A;  4L23 A;  4IUM B;  4RFB A;  2WLB A;  1OGW A;  2LXC A;  3H7S A;  1XLN A;  4NJC A;  4X57 B;  2IO0 B;  3T3O A;  4MH8 A;  4YT0 B;  2KC2 A;  4URK A;  4EUT A;  5JZE B;  2MJE A;  1KFY B;  3BZD B;  3DBH B;  2QIL A;  1L4Z B;  2D07 B;  3RMK C;  3FIL A;  2AQ3 B;  3TMP B;  2LGS A;  2BKR B;  3HIZ A;  3Q3J A;  3RPF C;  2KDM A;  2KZR A;  2LJ5 A;  1K52 A;  2HJ8 A;  4IM3 A;  4IWO A;  3R3M A;  1N61 A;  1V8C A;  2I2Y A;  2ONQ A;  4PT5 A;  1XCQ L;  3GS2 A;  2RMM A;  4WWN A;  2NPT A;  4K81 A;  2JY6 A;  1E8W A;  2M4N A;  3NG0 A;  1R7S A;  3UIN B;  1FO4 A;  4FHK A;  2M17 A;  3QIJ A;  1J7A A;  5BYQ A;  2OJW A;  1UBQ A;  2XEW A;  1OQQ A;  1KTK A;  2I1K A;  4FBJ B;  4JX1 C;  4MGI E;  3A9J B;  4FJZ A;  4P1C C;  1E8Y A;  2D5G A;  1VRA B;  3BYT B;  3WAM A;  2L00 B;  2MBE A;  3VQI A;  1SIF A;  2D11 A;  1GC6 A;  3Q3M C;  1TS3 A;  2W55 A;  3MJW A;  4PS7 A;  3PLU A;  4G50 A;  5J2R A;  1XCT L;  2H88 B;  1D5M C;  2Z59 B;  4RF0 A;  1WJ4 A;  3AM9 A;  4XDD A;  1N62 A;  1IP9 A;  1HEZ E;  1UBI A;  5BYR A;  2B76 B;  1SE9 A;  2HDE A;  1BML C;  1NEK B;  5G5H A;  1FEH A;  3AN1 A;  3MFG A;  2MP2 B;  4GN1 A;  1KJT A;  2K8B A;  2K8C A;  1MHH E;  2WU5 B;  1SJH D;  2BKF A;  2CS4 A;  1HTO A;  1I4R A;  2DX5 B;  5C23 A;  1B9R A;  1Z2M A;  3AE3 B;  2QMT A;  3EC8 A;  1ZXI A;  5IO9 A;  3H7P B;  4S17 A;  4MAC A;  2N1V A;  4MSM B;  4XE0 A;  4GLS C;  2LAS A;  1YQB A;  1ENF A;  2KYW A;  2C9W B;  3NY5 A;  1WFY A;  1SEB D;  2KWU B;  1VZ6 A;  2BTE A;  3IG3 A;  3S2A A;  1WRI A;  3M62 B;  3Q8C A;  4C4V A;  1J19 A;  4TUU A;  4FAD A;  2WU2 B;  2K6D B;  1SIJ A;  3AXC A;  1Q1O A;  1V80 A;  1WGY A;  3FIL B;  5C1Z A;  3HUI A;  2Z0D B;  3D32 A;  3RNB C;  4GOC A;  3V62 A;  3R7Q A;  3P42 A;  2KKC A;  1C4C A;  1UGM A;  3FKY A;  3QC8 B;  2ZNV B;  2HJ1 A;  4KZ0 A;  2EMT A;  2PVG C;  4ZHO A;  3K9P B;  5EE9 A;  4DXA B;  4DXF A;  3CIR B;  1JCK B;  1N60 A;  1FFU A;  5HHD G;  2KOX A;  3URY A;  2ZPN A;  4CO7 A;  1LFD A;  2BYF A;  4YTN B;  1ROE A;  5EE3 A;  1FCC C;  4RMA A;  5LLI A;  3WA0 A;  3E56 A;  3ZIM A;  1C78 A;  2LHD A;  5CHW A;  2ZZP B;  2LJI A;  1UGJ A;  4A3P A;  1WM3 A;  2L52 A;  2Z8L A;  4HK2 A;  2WXO A;  3APD A;  3WIM A;  3T3N A;  4HPP A;  2KNB A;  2ON8 A;  2UYZ B;  3DBH I;  4RGT A;  4C7Y A;  2FCN A;  4IKG A;  5DPW A;  2KHW B;  4BKT A;  1QOG A;  2ASQ A;  4HDO A;  5EE1 A;  1C76 A;  1MHX A;  4BOZ B;  3RNC C;  1EO6 A;  1HXY D;  1UF0 A;  2IO3 B;  4W9F A;  4YL8 A;  5AZG A;  4BBN F;  2AL6 A;  2B3A A;  4QAY A;  3BII D;  5BO4 B;  5AUI A;  4CHK A;  4BFR A;  3RD2 A;  3QCA A;  1KM7 A;  5DPT A;  2MWS B;  5DCN A;  2A4Z A;  1V5O A;  2N0S B;  1A5R A;  3U2S C;  5CX3 A;  2DZM A;  2DZJ A;  2WXI A;  4LNK A;  3RT3 B;  3QAQ A;  4ZYS A;  4W9D A;  3JSV A;  1GJZ A;  3P4P B;  1QOB A;  2GI9 A;  4OZA A;  3L08 A;  2M19 A;  2L83 A;  3VRA B;  4HEA 1;  2WP9 B;  4M0W A;  4A3O A;  1K50 A;  1C77 A;  4XC2 A;  3TUO A;  2BB6 A;  3DHH C;  4JE3 B;  1T0Q C;  3AEA B;  2XNA C;  4C4V B;  1WJ6 A;  4UDU C;  3VUX A;  4W9E A;  3QJZ A;  2JX5 A;  5EDS A;  3U30 A;  3QK0 A;  1FXI A;  1F2R I;  3I57 A;  1N6Z A;  2ZVN A;  4EFO A;  2PE6 B;  2KMM A;  4HVB A;  4EZK A;  3B9J A;  3VTW A;  4E71 A;  2KJH B;  2XK5 B;  3ZDM C;  3ZGZ A;  3IAM 1;  1WR1 A;  2N7D A;  1FNU A;  2JWZ A;  1WSP A;  3TEW A;  2WXG A;  3LXF A;  2NTS A;  1TS5 A;  3P4S B;  3EFU A;  3TL5 A;  3N30 A;  2JUO A;  3AE1 B;  3C19 A;  2DNF A;  1BXT A;  1IGD A;  1JRU A;  3HHM A;  4IM0 A;  2WYQ A;  4S0R A;  2LFI A;  4A6Q A;  4P7I A;  4KSL C;  3V60 A;  2JZP A;  1TZO A;  2W82 A;  4IG7 B;  5GXG B;  1ZW7 A;  3AED B;  4RNA A;  1EM7 A;  2WS3 B;  4FJY A;  3RUL A;  1F1H A;  2KDE B;  3LDZ E;  2LRU A;  3N3K B;  4NAW B;  5FR6 A;  3CWI A;  3TEZ A;  2KWC A;  3DBS A;  1TTN A;  5T8I A;  4W9J A;  3OJ3 A;  3RNF C;  1IUE A;  2L3Z A;  1ZE3 D;  2JU6 X;  3APF A;  3H6N A;  3ML8 A;  3I5J C;  3SDL C;  1FNW A;  3KYC D;  3AU5 A;  1WE6 A;  4LNO A;  2O6V A;  4ZRK A;  2MHJ A;  2DZI A;  4TMA B;  5FK9 C;  3AH7 A;  3GE8 C;  2QHO A;  4RCO A;  1XLQ A;  4WWP A;  1FIQ A;  4E3C A;  1IPG A;  3Q8F A;  2ZPY A;  1FRD A;  4M8N A;  1CZP A;  4FHJ A;  4M8M A;  1QKZ A;  2PMV A;  3DOW A;  4RH6 A;  4ZDV A;  1V5T A;  2DYM A;  1V97 A;  1RM6 C;  1XF5 L;  4MSQ B;  3J9C A;  4LLG M;  3PRP B;  2E6X A;  2K8H A;  3VDZ A;  4JQW C;  1GOZ A;  2JYT A;  4JLC A;  5D3I B;  2N9E B;  3DDC B;  4G3X B;  4FLH A;  1QT9 A;  1XLP A;  2QSD A;  1QOA A;  2JT4 B;  3MJ5 A;  3PRM B;  2L05 A;  2MCN B;  3N1Z C;  1VR9 A;  3AE8 B;  4J6I A;  2WXJ A;  2MJ3 A;  1SJE D;  4NNJ B;  3L13 A;  1E5W A;  3RN9 C;  1IYF A;  2G4D B;  2G4S A;  3ZYY X;  4HWI B;  2Q5W D;  2WXM A;  2KK8 A;  3E9S A;  2OHF A;  2LMC A;  4AP4 C;  1D5Z C;  2GOW A;  3L16 A;  4FUL A;  3DWM A;  1SE4 A;  1WYG A;  3DPD A;  1RLF A;  2M1M A;  2IJ0 A;  1V49 A;  4IM2 A;  2FCS A;  1WZ0 A;  1TGZ B;  1WGK A;  3UQB A;  5HFY A;  3I9V 1;  3Q69 A;  3AE6 B;  4WAA A;  2AL3 A;  2C7N B;  2O2V A;  4K7U A;  3PRZ A;  1GPX A;  1TKG A;  1STE A;  2CR5 A;  4HPL B;  2K22 A;  2C60 A;  3L0W B;  4OVU A;  3AEE B;  2PJH A;  5E6J A;  3AV8 A;  4W9C A;  1JWM D;  5I4D A;  3VH3 B; 
#chains in the Genus database with same CATH homology
 2JRH A;  4WWO A;  1SIF A;  2D11 A;  1GC6 A;  2LI5 A;  2N4F A;  2LZ6 A;  4TV3 A;  2LUE A;  3MJW A;  3W1S A;  4PS7 A;  3PLU A;  5HKH A;  4G50 A;  5G2N A;  5J2R A;  4GDK A;  5DPS A;  4HCN B;  4JIO U;  2Z59 B;  4DHJ D;  1K8R B;  4NAW A;  4F7Z A;  1WJ4 A;  2KFK A;  4F8C B;  1IP9 A;  3OLM D;  1UBI A;  2JPH A;  5D94 A;  3ZNI D;  1SE9 A;  2BWF A;  1UZX B;  3A1Q A;  3JSV B;  2KWV B;  4KVG B;  3PGE A;  4DHJ B;  2MP2 B;  4GN1 A;  2KXJ A;  2YLM A;  3IFW B;  2WWZ A;  3HK0 A;  1CMX B;  1KJT A;  2L0F A;  2MW5 A;  2K8B A;  2CHZ A;  4LJO B;  1WX7 A;  2NBV B;  2ZVO A;  4RM9 A;  3ZW3 A;  2K8C A;  2Z0E B;  3W1Y A;  3ZO5 B;  4M0W B;  3KH0 A;  3PTF C;  1J0G A;  4G11 A;  2K39 A;  3EEC A;  2KVR A;  2BKF A;  2CS4 A;  1YIW A;  2DX5 B;  2KQS A;  3H1U A;  5C23 A;  1Z2M A;  2BF8 B;  2WX1 A;  4OVV A;  4AWJ A;  4I6N B;  2MBO A;  3EC8 A;  3Q3F A;  2W9N A;  2LRW A;  2KO3 A;  3TIX A;  3H7P B;  1E90 A;  3ALB A;  4NJ7 A;  4W9I A;  1WH3 A;  2N1V A;  2J7Q B;  2FCM A;  1WX8 A;  4MSM B;  4JL9 A;  4BKS D;  1XQQ A;  4GU2 A;  2AEH A;  1OEY J;  1Q5W B;  4WJN A;  5IA7 A;  4HPM B;  4PS8 A;  2LAS A;  1YQB A;  3RYT A;  2NS5 A;  3L17 A;  4BBN C;  1OEY A;  5CHF A;  4TQ0 A;  2C9W B;  1HE8 A;  3KUD B;  3NY5 A;  4ICV A;  1WFY A;  3VTV A;  4ANU A;  2GBR A;  2KWU B;  3JVZ X;  2FAZ A;  4MGY E;  3VFK A;  3ZLZ A;  3IG3 A;  3S2A A;  3M62 B;  4N9F 4;  5TR5 A;  1J19 A;  4HDQ A;  4TUU A;  2L76 A;  4FAD A;  4B95 A;  2K6D B;  2L0T A;  1WGD A;  4GGQ A;  4MM3 A;  2FCQ A;  3AXC A;  3BIN A;  4NQL B;  1Q1O A;  1V80 A;  1WGY A;  5C1Z A;  4HLE A;  3V6E B;  2N1W A;  4BKG A;  2Z0D B;  3D32 A;  1WMH B;  3IVF A;  3V61 A;  3DVN U;  4MH0 E;  3QQ8 B;  4AJW A;  4GOC A;  3DCG A;  3V62 A;  2FID A;  2LVP A;  3R7Q A;  2KKC A;  4EKU A;  4PYU A;  2BYV E;  1UGM A;  3QC8 B;  2ZNV B;  4MDK E;  3QHT A;  4KZ0 A;  2BPS A;  2EMT A;  3ZNH B;  2BYE A;  2J0M A;  3K9P B;  2G3Q B;  4DXA B;  1R4M I;  4DHZ B;  3MHS D;  4MEM A;  3HM3 A;  1WGR A;  2KOX A;  2G45 B;  4K7S A;  1P3Q U;  2KTR A;  2OOB B;  2ZPN A;  1UH6 A;  4EEW A;  2FNJ B;  3ZRC A;  2O2V B;  4CO7 A;  1LFD A;  2RR9 A;  2C7H A;  2BYF A;  2GMI C;  1E8X A;  2IZV B;  3R66 C;  4ANV A;  4JGH B;  4TKN A;  4RMA A;  5LLI A;  2JF5 A;  1OQY A;  3WA0 A;  4I6L B;  4CYE A;  3JYU A;  1V2Y A;  3ZIM A;  5CHW A;  4EZJ A;  2ZZP B;  1XT9 B;  4A3P A;  3WAP A;  3OAW A;  1WM3 A;  2ZJD A;  3ONS A;  3ZKJ C;  3IBE A;  2O6V D;  1NDD A;  4HK2 A;  3APD A;  3UF8 A;  3WIM A;  1LXD A;  4DBG A;  3M3J A;  4KDL B;  2KNB A;  2UYZ B;  3DBH I;  3DQV A;  1P98 A;  4AOF A;  3N32 A;  4DDG D;  1KLV A;  1YX6 B;  2FCN A;  2VRR B;  1PQS A;  1RAX A;  3NS8 A;  4LJP B;  5DPW A;  2KHW B;  4BKT A;  2LVQ A;  2O6V B;  4ZRJ A;  2NVU I;  2KLC A;  1NI2 A;  2KFJ A;  2D2Q A;  3EHV A;  2NBU A;  2WDT B;  1EF1 A;  1RFA A;  2KMC A;  2ASQ A;  2KTF A;  3A33 B;  1V9J A;  2KFK B;  4HDO A;  4BOZ B;  3ZVV A;  1F9J A;  4G0N B;  2HD5 B;  3PV1 A;  1EO6 A;  4ANW A;  4TQ1 A;  2DEN B;  1WX9 A;  2IO3 B;  2KDF B;  4HJK A;  4W9F A;  4YL8 A;  5AZG A;  4BBN F;  1V6E A;  2AL6 A;  2B3A A;  3LJ3 A;  1WRD B;  3VVW B;  2ZCC A;  3B1L X;  4MJS A;  4PS3 A;  5BO4 B;  2AWT A;  2OJR A;  5GMV A;  4CHK A;  4BFR A;  4ICU A;  3RD2 A;  4ANX A;  4GDL A;  3QCA A;  5D7G A;  1KM7 A;  3PZD A;  5DPT A;  3VH4 B;  2MWS B;  5DCN A;  2L8J A;  2A4Z A;  1V5O A;  1A5R A;  3WAL A;  1WGG A;  2HTH A;  1E7U A;  4XZ4 A;  4WQO B;  1LQB A;  5CX3 A;  4BOS C;  4KZC A;  3ZTC A;  3OJ4 B;  2DZM A;  2IO2 B;  1I42 A;  2DZJ A;  1TZ1 A;  2K25 A;  3RT3 B;  3QAQ A;  4W9D A;  2WX0 A;  4IW0 A;  3JSV A;  1GJZ A;  3PPA A;  2IBI B;  5CTR C;  1WF9 A;  3L08 A;  1C3T A;  3JW0 X;  5JHA A;  4LDT D;  3NHE B;  1MG8 A;  1WY8 A;  3QA8 A;  3VAW A;  2N9P C;  3CF6 E;  3M95 A;  1FXT B;  3O65 B;  4A3O A;  1WXM A;  3T9L A;  3K9O B;  3V6C B;  1P1A A;  4B6W A;  4ZRI A;  3KUC B;  3NOB A;  4KV2 A;  1RRB A;  4XC2 A;  5CHV C;  1WGH A;  4MGK E;  3VXW A;  1EF5 A;  3ZUN A;  5L95 C;  4LDT B;  1WJ6 A;  3L10 B;  3VUX A;  4W9E A;  3H7P A;  4NY0 A;  3AI5 A;  2LGX A;  3QJZ A;  3I3T B;  4W9G A;  5EDS A;  3U30 A;  1S3S G;  5KHO A;  3RCZ A;  1G6J A;  4NJ6 A;  2XBB C;  3QK0 A;  4LCD E;  2D3G A;  3CMM B;  2RGF A;  3PVL A;  1WE7 A;  1ZGU B;  2KJR A;  2KN5 A;  3A4R A;  2ZVN A;  4EFO A;  2PE6 B;  4WJP A;  5LXH A;  3TCA A;  2D10 A;  5D2M B;  3UQA A;  3GOE A;  4KIK A;  4W9K A;  3RZF A;  4E74 A;  2KX3 A;  4HVB A;  2KD0 A;  3C0R B;  1LM8 B;  4EZK A;  3DBR I;  2A5U A;  2C7M B;  3VTW A;  2R2O A;  1C1Y B;  4BKS A;  4E71 A;  2KJH B;  2MA9 B;  2XK5 B;  3KW5 B;  3PSE B;  3RUI B;  4FA6 A;  2JVC A;  4GMV A;  4EZL A;  3ZDM C;  1D3Z A;  3SD5 A;  1WR1 A;  2N7D A;  2KAN A;  1TBE A;  2JWZ A;  3X0W A;  2KJ6 A;  4MEL A;  4W9L A;  2JRI B;  2RD0 A;  4F1S A;  3KVF B;  5E6O A;  3ML9 A;  2NPT B;  2KTR B;  4II2 B;  5AZH A;  2IYD B;  1H4R A;  2PEA A;  3ENE A;  5JH5 C;  2LWP A;  2AYO B;  3A9K B;  1VCB A;  1L2N A;  5E6P A;  3EFU A;  3TL5 A;  1U4A A;  1YD8 U;  3N30 A;  1UD7 A;  2JUO A;  3B0A A;  2V3S A;  4ZYN A;  2KC1 A;  3U8Z A;  3WAN A;  2KQ7 A;  2LGY A;  2NBW B;  3ZNZ B;  1P0R A;  2GBN A;  1JRU A;  3HHM A;  4IM0 A;  4ASW C;  1WIA A;  3CSF A;  2IY1 B;  2M0X A;  2KX0 A;  4IWQ A;  1Q0W B;  2WYQ A;  3PRE A;  3UIO B;  5KHQ A;  2PE9 A;  4P7I A;  2PPH A;  3VTU A;  4DK5 A;  4KSL C;  1WJU A;  2BWE S;  2UWQ A;  2MSE D;  3V60 A;  1YJ1 A;  2CHW A;  4DHZ E;  1ISN A;  1AAR A;  3H9D A;  4IG7 B;  2N7E A;  2HE7 A;  1ZW7 A;  2LVO A;  3R7R A;  4K1R B;  2GBJ A;  1XD3 B;  2ZNV C;  3CST A;  3APC A;  3ZNG C;  4FJY A;  3ZTD A;  1L7Y A;  2C5L C;  3RUL A;  4PYZ A;  5DPR A;  2KDE B;  2MRP A;  1BT0 A;  1WXA A;  3LDZ E;  5J17 A;  1E8Z A;  1ZKH A;  3P2B A;  4GDK B;  2LRU A;  1V86 A;  3N3K B;  2R2Q A;  4NAW B;  5FR6 A;  3QWZ B;  3TJP A;  1YX5 B;  1KOT A;  2KWC A;  2GBK A;  2IY0 B;  1TTN A;  2N9X A;  3DBS A;  3A9J A;  3DVG Y;  4W9J A;  1WXV A;  3RZW C;  4HCP B;  5D6J B;  1WR6 E;  3OJ3 A;  1E7V A;  2L3Z A;  3A1Q B;  4MJS B;  1Y8R C;  3HM6 X;  3APF A;  3H6N A;  3ML8 A;  4GB9 A;  1WM2 A;  2K1F A;  3SDL C;  2CKH B;  2BGF A;  1NBF C;  3KYC D;  4GDL B;  3AU5 A;  5G55 A;  1WI0 A;  2LXA A;  1WE6 A;  2FIF A;  4NPN A;  2O6V A;  4ZRK A;  2DZI A;  4K7W A;  2ZEQ A;  3M63 B;  4NQK E;  2DYB A;  1GUA B;  2EMS A;  3VUY A;  2KMA A;  3ZRF A;  4W9H A;  2QHO A;  1WZ3 A;  2JXX A;  2ZCB A;  4WWP A;  1Z5S B;  3KYD D;  4B9K A;  4E3C A;  3DVN V;  4IWP A;  1IPG A;  2YVC A;  1GNU A;  4KSK C;  2MLB A;  3PHW B;  1VD2 A;  3PT2 B;  3PHX B;  2FUH B;  4DDI D;  2RSU A;  3QAR A;  2KDB A;  2ZPY A;  4M8N A;  4M8M A;  4FHJ A;  2K6Q A;  3SU8 X;  2J0J A;  4GIV A;  2REX A;  2MBB B;  3DOW A;  4II3 B;  3W1S C;  2MP2 A;  4ZDV A;  1GC7 A;  1V5T A;  2MQJ A;  2DYM A;  1X1M A;  4GSW A;  4GXB A;  1WJN A;  1V81 A;  4DWF A;  4KDI C;  1P9D U;  1S1Q B;  4MSQ B;  2MBH A;  3KUZ A;  5AEK B;  5J18 A;  1J8C A;  3PRP B;  2EKE C;  2K8H A;  3TBL D;  3VDZ A;  4JQW C;  4RM8 A;  3MTN B;  4AJY B;  4I6P A;  4JLC A;  3QX1 A;  2N9E B;  2IO1 B;  4EOY A;  2DAF A;  2NR2 A;  2MX2 A;  3DDC B;  2DZK A;  2M8S A;  4BVU C;  3A4S C;  4G3X B;  4FLH A;  3AU4 A;  4HXD A;  2JT4 B;  4IUM B;  3DBL I;  3PRM B;  4MGZ E;  2L05 A;  3GZN I;  1OGW A;  4KIK B;  4AUQ C;  2MCN B;  5LXI B;  1T0Y A;  5AZF A;  2LXC A;  3H7S A;  4X57 B;  2IO0 B;  3DVG X;  2LGD A;  1EUV B;  4J6I A;  2KC2 A;  2I1J A;  2JZ3 B;  2CHX A;  4URK A;  4IC7 B;  4EUT A;  5JZE B;  3WAO A;  2DAJ A;  4NNJ B;  2KLG A;  3L13 A;  1E5W A;  1SGH A;  1IYF A;  2G4D B;  2G4S A;  2KDI A;  1R4N I;  2D07 B;  3PS6 A;  3UGB B;  3TMP B;  2GBM A;  4HWI B;  2BKR B;  3HIZ A;  2L7R A;  3Q3J A;  5IAA C;  1WMH A;  2KZR A;  2LJ5 A;  2V4L A;  3VUW A;  2KK8 A;  3PLV A;  2HJ8 A;  1GG3 A;  4IM3 A;  4IWO A;  4AP4 C;  3R3M A;  2GOW A;  4FJV B;  3L16 A;  2XK5 A;  4FUL A;  3X23 A;  3DPD A;  1UEL A;  3U7D A;  1RLF A;  2M1M A;  1V49 A;  4IM2 A;  2FCS A;  2V1Y A;  2DYO A;  2CU1 A;  4WWN A;  1WZ0 A;  2NPT A;  4A20 A;  4K81 A;  2JY6 A;  3NZS A;  2MBQ A;  3BY4 B;  4WJQ A;  5L83 A;  1TGZ B;  3UQB A;  3T8M A;  1E8W A;  2M4N A;  1QZE A;  3A9K A;  3UIN B;  4WAA A;  4FHK A;  2AL3 A;  2C7N B;  2M17 A;  2O2V A;  4K7U A;  1WYW B;  2DHZ A;  3QIJ A;  3B08 A;  1WXS A;  3PRZ A;  1OTR B;  2RPQ A;  1UBQ A;  2XEW A;  2Y5B B;  1H8C A;  3ZDT A;  3IHP C;  2I1K A;  3NZU A;  4FBJ B;  5E6N A;  1M94 A;  4MGI E;  2CR5 A;  4HPL B;  2NCN A;  3AUL A;  1I35 A;  2C60 A;  5JHB A;  3L0W B;  4OVU A;  2LD9 A;  4FN2 A;  3A9J B;  4FJZ A;  3SHQ A;  2PJH A;  1E8Y A;  2J0K A;  4WJO A;  4W9C A;  2JZZ A;  3ECI A;  3UIP B;  3VHT C;  3WAM A;  4XX5 A;  2L00 B;  2MBE A;  3L54 A;  3VH3 B;  3VQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...