3UIPB

Complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
b'EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 18
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3uipB00
3CSFA 3A9KA 4DK5A 1S3SG 4GMVA 5D7GA 1E8WA 2RR9A 3QCAA 3PZDA 1HE8A 1E5WA 2D11A 2HD5B 2LZ6A 3M62B 1SGHA 3LJ3A 2G3QB 2I1KA 1UD7A 1WI0A 2LXAA 2L0TA 2BYEA 4BOZB 2R2QA 3KYDD 5CHWA 1P9DU 5J17A 1LQBA 3DCGA 4FA6A 4W9JA 3AULA 3L16A 3B1LX 3VQIA 4A20A 1SIFA 3KW5B 4ANXA 4TUUA 1WJNA 3PPAA 2LWPA 3VHTC 4HPMB 4KSLC 4MSMB 3VUXA 2M1MA 3OJ4B 4W9EA 2MBBB 4WJOA 3ZKJC 4DWFA 4HK2A 1CMXB 4GDKB 1WXVA 5IA7A 2MQJA 2N4FA 2Y5BB 3IG3A 2BYFA 4WWPA 2IZVB 2LUEA 4ICVA 4AOFA 3VAWA 3VH4B 4PYZA 4MJSB 2WX0A 1V49A 3HHMA 3JSVA 5HKHA 1KOTA 4W9CA 1UGMA 2AL6A 3I3TB 4AP4C 4TQ1A 5C23A 3V60A 3IHPC 3C0RB 4EOYA 2BWES 2FCNA 2FAZA 2EMTA 1MG8A 5LXIB 1J0GA 2C7HA 2KZRA 2D2QA 2IO3B 2NPTB 2KJRA 2KQ7A 2HJ8A 2BF8B 2MP2A 3JVZX 1Y8RC 1U4AA 3DVGY 2OJRA 4IUMB 4BKGA 3H7PB 4HVBA 1OEYA 1V5TA 3DBSA 4FJVB 4IW0A 4LDTB 4W9LA 5FR6A 3ZO5B 1OQYA 2KFJA 4FJYA 4G50A 2CHZA 2DZMA 2KLGA 2MSED 2KVRA 5CX3A 4M0WB 2K6DB 3B0AA 3CF6E 3DBLI 4RM8A 1A5RA 2DENB 1WXMA 3DVNU 5CHVC 5G55A 3ZW3A 5JH5C 1J8CA 1F9JA 3HK0A 2FCSA 2C9WB 2GBJA 3PSEB 4ICUA 1I35A 1IP9A 2N1WA 5BO4B 4JQWC 1WJ6A 2EKEC 2KMCA 3WANA 4ANUA 2DYMA 3VTUA 1E8XA 2OOBB 3B08A 3RUIB 3OAWA 3VTVA 4BKSA 4B9KA 4FHJA 4MELA 2K1FA 4K7SA 3R66C 4MGZE 2XEWA 1D3ZA 1WH3A 2LVPA 3Q3FA 3TJPA 2C7NB 3SHQA 4II3B 1WZ3A 1RFAA 3ALBA 1L2NA 3ZTCA 1Z5SB 4E71A 1WF9A 4HWIB 1G6JA 2JY6A 3DDCB 2KN5A 3KVFB 4MEMA 4G3XB 2NBVB 1RRBA 4KV2A 3TBLD 3Q3JA 2KDBA 3QC8B 4HDOA 2FUHB 3A4RA 2O6VD 2XK5B 3PV1A 4RMAA 3HM6X 3MJWA 3W1YA 1WFYA 5DPWA 2KD0A 2ZPNA 4MJSA 3W1SC 2WX1A 4GIVA 4WWOA 3MHSD 3PT2B 3SD5A 4A3OA 1WX9A 2JRHA 3SDLC 4CHKA 1V81A 1UBQA 1R4NI 3ZRFA 1WE6A 2KLCA 3N32A 1T0YA 3OLMD 2MBQA 4NAWB 1J19A 2NPTA 3NOBA 3ZDMC 3PGEA 4EZLA 4DHJB 2KJHB 3H7PA 3GOEA 3L08A 4CYEA 1E8YA 3NS8A 1V86A 4JGHB 3V62A 4LJOB 1YQBA 1ZKHA 2FIDA 3UINB 3APCA 2GMIC 3DPDA 4FN2A 1WGDA 2JXXA 3CMMB 3TCAA 2FCMA 2PEAA 3N30A 4BBNC 4FHKA 3A4SC 4KIKB 2ASQA 2CHWA 2MBHA 2MW5A 4AWJA 4FBJB 5D2MB 3M3JA 3WIMA 5J2RA 5IAAC 3EECA 4I6NB 1UH6A 4W9KA 1RLFA 5AZGA 3ECIA 3QIJA 3ZNGC 2GOWA 2UWQA 3APFA 2M8SA 4IM0A 3QX1A 5JZEB 1WGRA 2KHWB 2EMSA 2M17A 3EC8A 1GUAB 3VUWA 2RSUA 2JPHA 4IG7B 1QZEA 2O2VB 3GZNI 1WRDB 3PLUA 4IWOA 2JZZA 3NZUA 4W9HA 2J0JA 2BWFA 1WX7A 3DVGX 3JYUA 3UQBA 1AARA 1SE9A 2K8HA 5LXHA 2V1YA 1ISNA 1KJTA 2B3AA 1E8ZA 3RCZA 1UBIA 2PE9A 4EKUA 3H9DA 2KXJA 3D32A 4II2B 5DPTA 1E7VA 2W9NA 2JRIB 2XK5A 1E7UA 4E3CA 1NI2A 1XQQA 3RULA 2GBMA 2KWVB 1WXAA 3VVWB 4DXAB 2DZIA 2L05A 4BFRA 2IO2B 1GC6A 2KWUB 2YVCA 4MGYE 4XZ4A 4MGKE 2MWSB 4ZDVA 1KM7A 4NAWA 3DQVA 4GU2A 5JHBA 4KZCA 3UGBB 3V61A 4PS3A 1WZ0A 1L7YA 4LJPB 3ML8A 4KZ0A 1P3QU 4PYUA 4W9GA 4WQOB 3NZSA 3VUYA 3ZIMA 1JRUA 2KX0A 2LASA 2ZCBA 4IM2A 4GDLB 2KDFB 1NBFC 2G4SA 4KIKA 3R7RA 2J0KA 1KLVA 3A9JB 2LRWA 3N3KB 2CKHB 4XX5A 3QAQA 3PRPB 2FIFA 2Z59B 3DBRI 4ANVA 2RGFA 2DAFA 3K9OB 3VXWA 1WJ4A 4BBNF 3T9LA 2C60A 1P98A 4J6IA 4EZJA 2IY0B 1ZW7A 2BYVE 5DCNA 2MBOA 1V9JA 2O2VA 2KOXA 3ZNHB 3LDZE 2KKCA 1EUVB 2ZNVC 4HJKA 4XC2A 4K1RB 2BPSA 2KX3A 3PLVA 2PE6B 4KVGB 3WA0A 2DYBA 3DVNV 2XBBC 3PREA 4GSWA 3PVLA 2KTFA 2A4ZA 1GNUA 2QHOA 4I6LB 2K8BA 1VCBA 3AXCA 2K8CA 1WM2A 4GN1A 2MRPA 2L8JA 2DZJA 3VH3B 3V6EB 4JLCA 1WE7A 3CSTA 3RZWC 4E74A 2NBWB 3JW0X 2L0FA 4K7UA 3R3MA 4LDTD 4DDGD 4IWQA 1WYWB 1TBEA 1Q1OA 5D94A 2KTRB 4I6PA 3M95A 4YL8A 5AZFA 3TMPB 2KO3A 2HTHA 4X57B 1YIWA 2KFKB 4AUQC 3L13A 2LXCA 3BINA 2M4NA 1WY8A 3PS6A 2J0MA 2JF5A 2N7DA 2N7EA 1R4MI 2V4LA 2Z0DB 1RAXA 2RPQA 3DBHI 5D6JB 2LGYA 1EO6A 2G45B 3KH0A 4HXDA 4M8MA 4MGIE 2IBIB 1LXDA 3KUDB 3NHEB 4W9FA 3PTFC 2NS5A 1IYFA 3K9PB 2MLBA 3QA8A 3WAOA 1Q5WB 4GB9A 5TR5A 4DDID 1EF5A 5KHQA 1GJZA 5J18A 4GDLA 4ZRJA 2M0XA 4KDIC 1H8CA 3A1QB 3HIZA 2FNJB 2KK8A 3A9JA 5DPRA 3AI5A 1YD8U 2KC1A 3APDA 4N9F4 2C7MB 4MM3A 4HPLB 1P0RA 2VRRB 5KHOA 2KQSA 4ZRIA 5G2NA 3WAMA 2N9PC 4OVUA 1ZGUB 1WGGA 3A33B 4ZYNA 1FXTB 1WMHA 2NBUA 5CTRC 2MA9B 4GGQA 1OGWA 4PS8A 3QARA 4RM9A 4OVVA 4NNJB 2GBRA 2ZJDA 3WAPA 1WM3A 3RZFA 2CR5A 2AWTA 2N9XA 2LGDA 4MH0E 3PRMB 1XD3B 3PRZA 2AYOB 4ANWA 4KDLB 4PS7A 2ZZPB 1VD2A 4TKNA 1TGZB 4DHJD 1S1QB 2DAJA 3OJ3A 3L10B 4HCPB 1TTNA 2L00B 1K8RB 4NJ7A 4MDKE 1WJUA 3ZNID 3KUCB 3ZNZB 3QJZA 4NJ6A 4P7IA 2KTRA 4WJPA 1BT0A 2FCQA 3ZTDA 4CO7A 4DHZB 3PHWB 4JIOU 5E6NA 2KFKA 4ZRKA 1LM8B 2WWZA 3QHTA 1H4RA 3L17A 2MBEA 3AU5A 2LRUA 1C3TA 3H6NA 2A5UA 3U7DA 4BVUC 2KDIA 4B95A 1GG3A 1Q0WB 4AJYB 2KDEB 3H1UA 4FLHA 2C5LC 2KANA 2LVQA 5E6PA 3ZVVA 3U8ZA 3ZDTA 2CU1A 3A1QA 2BKRB 2DZKA 2WYQA 3QWZB 4B6WA 2K6QA 1Z2MA 3W1SA 4GXBA 2MCNB 1M94A 3X0WA 4BKSD 1OTRB 4URKA 2IYDB 2IY1B 4EEWA 3BY4B 1XT9B 4WWNA 1WR6E 3R7QA 2L76A 1YX6B 3X23A 2RD0A 3O65B 3L54A 3V6CB 3M63B 2O6VB 1I42A 1WMHB 2G4DB 1TZ1A 4HDQA 4MSQB 4W9IA 4F1SA 1E90A 4DHZE 4NQKE 5DPSA 4IM3A 2ZPYA 5CHFA 2N1VA 2WDTB 1WIAA 5AZHA 4AJWA 4BOSC 3DOWA 1IPGA 2L7RA 3IFWB 3TIXA 3UF8A 3WALA 1WXSA 4HLEA 3PHXB 2I1JA 4NY0A 2D10A 3A9KB 1GC7A 2AL3A 2JZ3B 5EDSA 5GMVA 2CS4A 3UQAA 3VTWA 3QK0A 3U30A 1V80A 2N9EB 4EZKA 4K81A 1WX8A 2NR2A 2ZEQA 4WAAA 2DYOA 4W9DA 3EFUA 2BGFA 4FADA 2GBKA 3KUZA 4FJZA 2KC2A 2CHXA 4FULA 5LLIA 3TL5A 4EFOA 4GOCA 1NDDA 2ZVOA 4BKTA 2D3GA 3S2AA 2UYZB 3ZRCA 3T8MA 2D07B 2ZCCA 3H7SA 3MTNB 3KYCD 3ML9A 4A3PA 4NQLB 2KJ6A 4DBGA 1LFDA 1V5OA 2ZNVB 1PQSA 1UELA 2GBNA 1YJ1A 2NVUI 2IO1B 2MX2A 2KMAA 4IC7B 5L83A 3UIPB 2LGXA 3QQ8B 4WJNA 1UZXB 2IO0B 1WGHA 1OEYJ 4GDKA 2JT4B 1WR1A 4TQ0A 2NCNA 3EHVA 2PPHA 2AEHA 5E6OA 4M8NA 3RYTA 4LCDE 2LJ5A 3P2BA 4KSKC 4ASWC 1V6EA 2Z0EB 5C1ZA 1C1YB 2LD9A 3ZLZA 2LI5A 3HM3A 3L0WB 5AEKB 3UIOB 3ENEA 1V2YA 2BKFA 2KWCA 4G0NB 2JVCA 4K7WA 3JSVB 1P1AA 4NPNA 3RT3B 3VFKA 3NY5A 2DHZA 4F7ZA 1YX5B 3ONSA 4JL9A 4TV3A 2L3ZA 3AU4A 2ZVNA 3IBEA 3VDZA 2JWZA 1WGYA 2K39A 2O6VA 2R2OA 2PJHA 3IVFA 4WJQA 2REXA 4F8CB 2HE7A 3RD2A 2MP2B 3ZUNA 2J7QB 2KNBA 2K25A 2V3SA 2JUOA 4EUTA 5JHAA 4G11A 4HCNB 2YLMA 2LVOA 1X1MA 4IWPA 3SU8X 2DX5B 5L95C 1EF1A
chains in the Genus database with same CATH superfamily
3B2GA 3A9KA 3BWUD 5D7GA 4Q2JA 1RFKA 4WH4A 3QCAA 4P16A 4L23A 1HE8A 1E5WA 2HD5B 4JX1C 2IPKD 2G3QB 2JYEA 1UD7A 3R2TA 2R2QA 3KYDD 5J17A 3HVZA 3Q69A 3L16A 1WJNA 2LWPA 3VUXA 4W9EA 4GLSC 3NRZA 3ZKJC 4HK2A 1CMXB 1WXVA 3URYA 2Y5BB 3EA6A 3IG3A 1XCQL 5HKHA 1KOTA 2R61A 4W9CA 3MFGA 1FIQA 3V60A 3IHPC 3C0RB 4EOYA 2BWES 2FCNA 2FAZA 2NPTB 2MP2A 4BKGA 4IUMB 4RGTA 1ET6A 2QC8A 4LDTB 4ARCA 4FJYA 3RNEC 4RGNA 1ENFA 1FO4A 2D5GA 3DVNU 5G55A 5JH5C 3ZW3A 3PSEB 1KH0A 1WJ6A 2KMCA 1B9RA 3WANA 3B08A 3RUIB 3U4EG 3OAWA 4FHJA 4K7SA 2XEWA 1N5WA 2LVPA 3ALBA 1E6EB 3MC0B 2KN5A 4MEMA 4RGOS 3QC8B 1C4PA 4HDOA 3N1XC 4RMAA 3HM6X 3MJWA 3PT2B 1ZE3D 1V81A 2AQ2B 2GLSA 3ZRFA 1J7CA 2GI9A 3LB8C 2MBQA 4NAWB 1J19A 3NOBA 3PGEA 4EZLA 1YJJA 2KJHB 2QDFA 3H7PA 3HVDA 3GOEA 1E8YA 1FPYA 4JGHB 4JWUC 1HTOA 3UINB 4M0WA 3APCA 2GMIC 2BQQA 1FRDA 2JXXA 3CMMB 3SFDB 2LEKA 2PEAA 4FBJB 2MBHA 2FE8A 2MW5A 3WIMA 2QJLA 3Q8EA 1UH6A 1RLFA 2OEDA 2W82A 2KHWB 1VLBA 3EC8A 4IG7B 4JPSA 3H8HA 3PLUA 2JZZA 4W9HA 2BWFA 1SSNA 1XLPA 1WX7A 3DVGX 5FR3A 2K8HA 1KJTA 2K0PA 4II2B 4ZHOA 1E7VA 4UDUC 2XK5A 1E7UA 1NI2A 1I4XA 1XQQA 1KM7A 1NYQA 3N1YC 4YSZB 2Y5CA 5JHBA 4DQOC 4HEA1 1WZ0A 4LJPB 4W9GA 4RNAA 3AEAB 1NBFC 2G4SA 3Q3NC 3R7RA 1NVID 1TKYA 3N3KB 5G5GA 4OVZA 2FIFA 1YQ4B 2RGFA 2KYWA 1MG4A 2C60A 1ZW7A 2O2VA 3ZNHB 4MACA 1C79A 2V4IB 2DYBA 3DVNV 4C56C 3I63C 2XBBC 4YWGG 2KAJA 3PVLA 1GNUA 4I6LB 1ZDXA 4GN1A 2L8JA 2DZJA 2N9KA 1MPEA 2NBWB 3JW0X 1ACCA 2PTLA 4DDGD 1WYWB 3C8YA 1SJHD 5D94A 4I6PA 4YL8A 2KO3A 3AE1B 3AEDB 3GE8C 3L13A 1VZ7A 1WY8A 1GOZA 2JF5A 2N7DA 3DHIC 1R4MI 2G45B 4WAFA 1FNUA 2K3UA 1LXDA 2BB5A 4ZRJA 1KRHA 1SJED 2LHEA 2FNJB 2KK8A 2PVOD 1JQ4A 4MM3A 4ZRIA 2V3NA 1WGGA 5HI1A 4ZYNA 1WMHA 4L2YA 2K9XA 4RM9A 4NNJB 2GBRA 2ZJDA 3AE9B 2N9XA 2LGDA 3IT6B 1UWMA 3PRZA 1T5XD 2VZKB 4ANWA 4KDLB 4B0MA 3AECB 4PS7A 3N1ZC 1EWYC 1E0ZA 1TGZB 3DHGC 1LGRA 4C80A 4HCPB 1TTNA 1K8RB 1TS4A 4NJ7A 4MDKE 2JU6X 1I4PA 4WJPA 1IGDA 1TJEA 3RPFC 4C4VB 4DHZB 4JIOU 4RF1A 4YSXB 1C3TA 3H6NA 2KDIA 1PGBA 1XCTL 2I38A 5E6PA 1ZPSA 4S17A 2CU1A 3A1QA 3AE4B 2BKRB 2K6QA 1Z2MA 3X0WA 1OFFA 4WWNA 1HXYD 3X23A 3M63B 1KLGD 1F2RC 1TZ1A 1XLNA 2WDVB 4F1SA 4H2AA 2WDTB 3IFWB 3T3NA 1FXAA 2M19A 3A9KB 3UQAA 1GB4A 3AEFB 4K81A 1WX8A 4A9AA 1I4GA 2DYOA 3EFUA 4LNKA 4ZRPA 3W2DA 2CHXA 3KWVA 4FULA 3TL5A 4EFOA 4GOCA 4DXFA 4MT5A 2UYZB 2N0SB 2JXTA 3MTNB 4RH6A 2M0AA 4K3CA 1V1OA 4A6QA 2I2YA 1XEEA 2LGXA 2SAKA 2IO0B 1L6VA 4GDKA 3RYTA 1R4NB 2LJ5A 1V6EA 1FNWA 2LD9A 4LNOA 4HKZE 3HM3A 2E6XA 2RDGA 3UIOB 1P1AA 1V1PA 3VDZA 4CQNA 2WXPA 4KGRA 4XWWA 2K39A 2O6VA 4WJQA 2PJHA 1FRRA 2MP2B 2KNBA 4EUTA 3ZGZA 2WP9B 3AEEB 4GMVA 1E8WA 3NZ3A 4JE3B 4WURA 2L0TA 5CHWA 1P9DU 1PUTA 2AQ3B 3B1LX 3VQIA 1TY0A 3KW5B 3TUOA 3ABVB 3P4QB 2ON8A 3PPAA 3B9JA 4HPMB 5IO9A 3DWMA 1T6BX 4DXGA 3KQ4A 2MBBB 5IA7A 1IBXA 4WWPA 5C2TB 4AOFA 3VAWA 3VH4B 3JSVA 1V49A 3HHMA 1UGJA 2C7HA 2KZRA 2D2QA 2IO3B 2KQ7A 4C7YA 3Q8BA 1SXTA 1U4AA 2CJNA 2OJRA 4HVBA 2WXGA 3DBLB 3H7PB 3DBSA 4W9LA 5FR6A 1T3QA 2KLGA 2MSED 4RGMA 4M0WB 3B0AA 1L0XB 3DBLI 1WXMA 2QMTA 4N58A 2GB1A 2DLBA 2GBJA 1IP9A 2N1WA 4XWTA 5BO4B 3U2SC 4ANUA 5BYSA 1E8XA 4BKSA 4MELA 2CU3A 1JALA 3R66C 4MGZE 1DYQA 3MP9A 2PW9A 1WH3A 2C7NB 3SHQA 1WZ3A 1RFAA 1XXGA 4E71A 4HWIB 4N59A 1HZ5A 1P7FA 4G3XB 1YOVB 4KV2A 1QLBB 5EE9A 2FUHB 3V3XA 2O6VD 2XK5B 3W1YA 2WXNA 5DPWA 1YN3A 4MJSA 5D3DA 3NVVA 2WX1A 4GIVA 1CK1A 2N7JA 1WX9A 4A3OA 1UBQA 1WE6A 3N32A 2IGGA 4US9A 3ZDMC 5IN7A 2HDEA 4CYEA 3NS8A 3V62A 1YQBA 2FIDA 5HHDG 2PLPA 1WYGA 3DPDA 2INDC 4FHKA 3A4SC 2ASQA 4XGAB 5J2RA 1SEBD 4I6NB 5BYQA 3ZJVA 2IGDA 2GOWA 3EUB2 2UWQA 3QX1A 1V97A 2M17A 4R3DA 1GUAB 1R7SA 3VUWA 1ZXIA 1QZEA 4US8A 2O2VB 1WRDB 3NZUA 4ZYSA 2H88B 4OZCA 3AB5A 1SE9A 2J53A 1ISNA 2B3AA 3BVMA 2W3SA 3W5VB 4EKUA 3H9DA 5DPTA 2W9NA 4YTMB 2KWVB 2WQYB 1N60A 2JSVX 1F1HA 2KWUB 4XZ4A 1HA5A 3BYYB 4KZCA 1HTQA 2VZKD 3UGBB 3BVZA 3ML8A 4KZ0A 4PYUA 1MHXA 4WQOB 3VUYA 4ZHPA 3ZIMA 4ARIA 2ZCBA 3AE2B 4RFBA 4YSYB 2KDFB 3EFCA 2J0KA 3RFZB 4MM3B 2CKHB 4KGSA 4BBNF 2ICIA 2W55A 3T3OA 2MBOA 2WXKA 2KOXA 4O1NA 1PGAA 4K1RB 2KX3A 2PE6B 3WA0A 2KN4A 3RN9C 4OHJA 2WU2B 1YN4A 1F2RI 3PZ8A 3VH3B 1CZPA 3V6EB 4JLCA 2L0FA 3R3MA 3P4RB 4IWQA 5EE1A 3DBHB 5AZFA 2M4NA 5BMIA 4A90A 3DBHI 2RPQA 2LGYA 1E7PB 3KH0A 4HXDA 2LJIA 2KQ4X 4KKJA 4W9FA 2MLBA 5KHQA 4GDLA 3Q6BA 2M0XA 4KDIC 1H8CA 3A1QB 2J52A 1C4AA 1P0RA 1OQRA 2VRRB 4NAMA 3WAMA 2N9PC 1OQQA 4XDDA 3A33B 2FBWB 3E56A 2WXRA 2NBUA 3AMZA 2WNMA 3R8BA 2ZW0A 1JROA 4BAXA 4OVVA 1KF6B 2OJWA 1UNSA 2AWTA 4MH0E 1XD3B 2D3AA 3VR8B 2WU5B 5H92C 2B76B 4M02A 3SR6A 2AQ1B 4AQ7A 2DAJA 3L10B 2L00B 2CJOA 5D3IB 1YN5A 3KUCB 4NJ6A 2KTRA 1BT0A 3ZTDA 1TYGB 1T0RC 3PHWB 2KFKA 4ZRKA 1F0ZA 3QHTA 1H4RA 1I4HA 4TMAB 2MBEA 3AU5A 3ZXRA 2A5UA 4USAA 5IOIA 1JWMD 3VRBB 3H1UA 4FLHA 1L5PA 3QWZB 4B6WA 3W1SA 1E9MA 4NZLB 2MCNB 1OTRB 4EEWA 3BY4B 1XT9B 5EE3A 1WR6E 3R7QA 2L76A 1YX6B 2V0GA 1V1PB 1UWXA 4OZBA 2O6VB 3W5UB 3MC8A 1E90A 4NQKE 5DPSA 2ZPYA 1VR9A 5AZHA 4AJWA 3DOWA 3WALA 2L7RA 3TIXA 1WXSA 3PHXB 2I1JA 3SFEB 2D10A 3OG5A 1K52A 5GMVA 1DOYA 3QK0A 1V80A 4C00A 2N9EB 2ZEQA 4WAAA 4W9DA 3KUZA 5LLIA 1CJEA 2GRIA 4HRSA 4BKTA 1SIJA 2E3TA 2ZCCA 3KYCD 3MC9A 3ML9A 3RNBC 1L0VB 2KJ6A 4A3PA 1V5OA 1YJ1A 3Q8FA 2IO1B 3NJTA 2MX2A 2KMAA 1TS3A 4J3OD 3QQ8B 1FM0D 1WGHA 3FKYA 2JT4B 4LNNA 2NCNA 5E6OA 2AEHA 2RDHA 3P2BA 4KSKC 2JYTA 2LGIA 2Z0EB 3ZLZA 3L0WB 1HEZE 2BKFA 2KWCA 3VFKA 3JSVB 2DHZA 4OW0A 4JL9A 1ROEA 1HZ6A 2M56B 1SB3C 3Q8AA 3LYYA 3IVFA 2R2OA 3ZUNA 1BXTA 2J7QB 2JUOA 3RNFC 1XLQA 2KMMA 4P6VF 5TSSA 2LVOA 1EF1A 3CSFA 1S3SG 3AE6B 3PZDA 3R2IA 1JRPA 3OWEB 3J9CA 2D11A 2KACA 2W54A 1SGHA 3LJ3A 2I1KA 2TSSA 1WI0A 2BYEA 4BOZB 3BZDB 1WXQA 1LQBA 3DCGA 1I7HA 3AULA 4W9JA 4ANXA 1SIFA 4TUUA 5JXVA 3VRAB 3VHTC 3RNGC 2JQRB 1NYRA 4HKQA 1GB1A 1QOGA 3BIID 3TSSA 2MQJA 1EWCA 2N4FA 1KFYB 2IGHA 3Q14C 2BYFA 2IZVB 1SE3A 2RPVA 2NMQA 4MJSB 4PYZA 5T8IA 1DOIA 2AX5A 4AP4C 3Q3OC 4TQ1A 3CWIA 5LXIB 2EMTA 1MG8A 1PFDA 2KJRA 4K3BA 2HJ8A 2BF8B 1Y8RC 1V5TA 1ZOYB 1OQYA 2KFJA 4G50A 2DZMA 2KVRA 2JZPA 5CX3A 2K6DB 4RM8A 4B0EA 2QSDA 2FCSA 2QILA 2KWDA 3UI3A 2BYTA 1I35A 2X8XX 4JQWC 3NG0A 2DYMA 3VTUA 2OOBB 3VTVA 1E10A 4B9KA 1PYWD 1N63A 2V9HA 2INNE 4II3B 1L2NA 3ZTCA 1Z5SB 4PT5A 2PMVA 3DDCB 3P4PB 2NBVB 1RRBA 2MJDA 3Q3JA 2KDBA 4ZOHC 2YEPF 3PV1A 1WFYA 1MJDA 1WSPA 2KD0A 2WHIA 4WWOA 1FMAD 2WXOA 3MHSD 2JRHA 3SDLC 4CHKA 1N61A 3I5JC 2X38A 1R4NI 2ACZB 2KLCA 2H89B 4XDCA 1YQ3B 4P1BC 3HRDD 2PKOA 1V86A 4LJOB 2HJ1A 1L6UA 1IGCA 3AE5B 4FN2A 1WGDA 3LXFA 1C9FA 3M3JA 4W9KA 3GZNB 3ECIA 3QIJA 1ZDVA 2L1AA 1WGRA 2DBYA 1N6ZA 3BK1A 2RSUA 2JPHA 1YMHE 1SF0A 2BS2B 3GZNI 4IWOA 3JYUA 4FXCA 5LXHA 2V1YA 1TS2A 2L83A 3RCZA 1TIFA 1UBIA 2WDQB 2KXJA 3D32A 4C7ZA 2WGSA 2JRIB 4M01A 1WXAA 2DZIA 2HTME 1WWTA 1GC6A 2IO2B 2JX5A 2YVCA 3DHHC 2MJ3A 4MGYE 2MWSB 4ZDVA 4LTUA 2LMCA 4GU2A 1L0YB 3TEWA 1TT5B 3V61A 1L7YA 2RMMA 1YJIA 1P3QU 3GP7A 1Y56A 3NZSA 3DBRB 3NUHB 4GDLB 2L52A 4KIKA 1B1ZA 2K22A 4XX5A 5AUIA 5C3JB 2WXQA 1FCCC 3DBRI 4ANVA 3AEGB 2DAFA 3VXWA 2IDYA 4J6IA 2IY0B 2BYVE 5DCNA 3FILA 1RM6C 2KKCA 1EUVB 5FK9C 4XC2A 4HJKA 2BPSA 3P42A 3PLVA 4WWMA 4A55A 3PREA 4GSWA 2EELA 1QOBA 2KTFA 2WDRB 1N5XA 1KTKA 2A4ZA 2QHOA 2K8BA 1VCBA 1WM2A 4ITKA 3RZWC 4E74A 1IUEA 4K7UA 1RWSA 3DWGC 1TBEA 2KTRB 3M95A 4S0RA 2HTHA 4X57B 1YIWA 2KFKB 3BINA 2BBCA 3PS6A 2J0MA 2Z0DB 5D6JB 1EO6A 4MGIE 3PTFC 2NS5A 3WAOA 3QA8A 1Q5WB 4GB9A 5TR5A 1GJZA 2WXFA 5J18A 3A9JA 4N6EB 3AI5A 5E6JA 1YD8U 4N9F4 1M4VA 2KQSA 4RCOA 1STEA 4OVUA 1ZGUB 1FXTB 1UF0A 3Q8CA 1FFVA 2MA9B 4GGQA 5IKCM 2WXMA 4PK1A 1P7EA 2NTTA 1WM3A 3RZFA 2CR5A 2QCZA 3RI7C 2AYOB 2G9HD 2ZZPB 3I57A 2BVCA 2KDMA 1VD2A 2MJEA 3FC4A 4MH8A 4DHJD 3OJ3A 3W9CB 4BZAA 3ZNZB 1AWDA 4ZRQA 2DNFA 3IAM1 2FCQA 4CO7A 2SEBD 5E6NA 1QT9A 2PVGC 3O13A 1LM8B 3L17A 2OHFA 1VZ8A 1SE4A 4BVUC 1C77A 3U7DA 4B95A 2ONQA 1GG3A 4AJYB 2KDEB 2KANA 2LVQA 3ZVVA 3NS1A 2DZKA 2WYQA 3U7ZA 4GXBA 3P4SB 4BKSD 2IY1B 1MI0A 3ZXVA 3BK2A 3L54A 3V6CB 4XYCA 2BW2A 1I42A 4HROA 1WMHB 2G4DB 4HDQA 4KKIA 4IM3A 2N1VA 1WIAA 4BOSC 1IPGA 4HLEA 4NY0A 1GC7A 2AL3A 3U30A 1I4QA 3Q2AC 2NR2A 4FADA 1RYJA 1QKZA 2GBKA 2KC2A 5BMGA 3GB1A 1NDDA 3ZRCA 3H7SA 4DBGA 1LFDA 2ZNVB 1PQSA 1JMLA 1UELA 3PZ7A 4WJNA 1UZXB 1WR1A 4TQ0A 3EHVA 2PPHA 4ASWC 3BVGA 1JWBD 3AE8B 1F52A 2LI5A 1JCKB 4K7WA 3KWLA 2J42A 2MH7A 2JVCA 4G0NB 4NPNA 1YX5B 2L32A 5GXGB 3RNAC 4QAYA 1J7BA 1SE2A 2ZVNA 3AE7B 3GS2A 4ACFA 2JWZA 3IT4B 4F8CB 2HE7A 3RD2A 3IAS1 3MHZA 2V3SA 3EGRA 4G11A 2EKIA 1ZXHA 4IWPA 3SU8X 2LGSA 2D3BA 4DK5A 1MHHE 3CIRB 1VDVA 2MEKA 2RR9A 3NVZA 1C76A 4YT0B 2LZ6A 3M62B 2FUG1 1TS5A 2LXAA 2XN9C 4LK0M 3ZYYX 4FA6A 4WIPA 4A20A 1LO5D 3NVWA 4MSMB 4KSLC 3C19A 2D3CA 1BUIC 2M1MA 1GPXA 3OJ4B 1C4CA 3AN1A 4WJOA 3N9YC 4DWFA 4GDKB 3AEBB 3VR9B 4IDIA 4P1CC 2LUEA 4ICVA 2K5PA 4LNFA 2WX0A 4JWSC 1PGXA 5I4DA 1UGMA 2AL6A 3I3TB 5C23A 1C78A 1K53A 1JWSD 1FCLA 1J0GA 1DOXA 1FXIA 1XO3A 5AUKA 3JVZX 3DVGY 4IOIE 1OEYA 4FJVB 4IW0A 3ZO5B 1FFUA 2CHZA 4D2KA 3CF6E 5MPOA 3RNCC 1XLOA 1A5RA 2IJ0A 2DENB 2Q5WD 5BMHA 1D4BA 3HUIA 5CHVC 1J8CA 2BS3B 1F9JA 3HK0A 2C9WB 4ICUA 1L4DB 1VZ6A 3WCQA 1XF5L 2EKEC 2WS3B 4RF0A 1DGJA 2K1FA 1JWUD 1D3ZA 3Q3FA 3TJPA 2BB6A 3BYTB 1WF9A 2WLBA 1G6JA 1QILA 2JY6A 3KVFB 3ZQ4A 3SEBA 3TBLD 3A4RA 1IBXB 1NENB 2ZPNA 3W1SC 3SD5A 1ZUD2 1AN8A 1R4MB 1V8CA 1ET9A 3AV8A 4XE0A 1T0YA 3OLMD 2W3RA 2NPTA 4DHJB 1MFWA 3L08A 1ZKHA 3ETRA 5EE0A 3AE3B 3TCAA 2FCMA 3N30A 2Z8LA 4BBNC 3TEYA 1QQRA 4KIKB 2CHWA 4AWJA 2BTEA 5D2MB 1L4ZB 1JWAD 5IAAC 3EECA 5AZGA 3ZNGC 4YXDB 3APFA 2M8SA 4IM0A 5JZEB 4WQMA 2EMSA 3FILB 1EU4A 2WXJA 4KGTA 2J0JA 2NTSA 1VJKA 4AS1A 1A70A 3UQBA 1AARA 2G1EA 1TZOA 5LNK1 1E8ZA 2VH1A 4OZAA 2PE9A 1ZP0B 3NVYA 1VRAB 3AH7A 4E3CA 1HQRD 3RULA 2GBMA 3VVWB 4DXAB 4BFRA 2L05A 4IKGA 4MGKE 4NAWA 3DQVA 5H8YE 1Q10A 3ZJTA 2YEPB 1KLUD 4PS3A 3FAHA 3KLSX 3P1MA 2BT6A 1JRUA 2KX0A 1GAQB 2LASA 4IM2A 1KLVA 2KT7A 3A9JB 2LRWA 3QAQA 3PRPB 2Z59B 3K9OB 3PO0A 5HG2A 1WJ4A 3T9LA 1NEKB 1UUPA 3I9V1 1P98A 4EZJA 1V9JA 3LDZE 2ZNVC 5IP4D 4KVGB 3V05A 2INCC 1WGKA 5HFYA 4YTPB 1SBBB 4KX6B 3AXCA 2K8CA 2N9LA 2MRPA 5BYRA 2Y5PA 2QEJC 1WE7A 3CSTA 1AYFA 4YTNB 4LDTD 1Q1OA 3TMPB 4AUQC 1TKGA 2LXCA 1PDXA 2N7EA 2V4LA 1RAXA 4M8MA 3Q3MC 2IBIB 3ZJUA 3KUDB 3NHEB 1IYFA 3K9PB 4DDID 1EF5A 2QIEB 4TSSA 3U52E 1D6EC 3HIZA 5DPRA 2KC1A 3APDA 3GE3C 2C7MB 2PIAA 4HPLB 5G5HA 5KHOA 1CQVA 3IXSA 5G2NA 1NI3A 1AW7A 2LFIA 5CTRC 5FKAC 1OGWA 4PS8A 3QARA 2Y3AA 1FNVA 3WAPA 2LUMA 4LNIA 1QOFA 2KVZA 3PRMB 1QOAA 2V3PA 2LHDA 4TKNA 3AM9A 1S1QB 4LLGM 2UU7A 3E9SA 1T0SC 1WJUA 3ZNID 3QJZA 4P7IA 4REZA 2WWZA 3TEZA 1J7AA 2LRUA 1K51A 1Q0WB 2BS4B 2C5LC 3U8ZA 3ZDTA 1QF6A 1F77A 3TEXA 3B2FA 1M94A 1FD6A 4URKA 1JW9D 1FEHA 2IYDB 2MHJA 4NJCA 2RD0A 3O65B 2XNAC 1T0QC 4MSQB 4W9IA 1MVKA 4DHZE 1N62A 2J4XA 5CHFA 4EE2A 3UF8A 3MJ5A 1EM7A 2JZ3B 5EDSA 2CS4A 3VTWA 4EZKA 3L4PA 2BGFA 4FJZA 2INPE 1WRIA 2ZVOA 1TY2A 2D3GA 3S2AA 2VH2A 1D5XC 3T8MA 2D07B 4M00A 4NQLB 4C4VA 2GBNA 1YNTE 4A8XC 2NVUI 2WXHA 4HJGE 5L83A 4IC7B 3UIPB 2RDBC 1D5ZC 1OEYJ 2JWUA 1TKEA 2ZW1A 4M8NA 4LCDE 1D5MC 5C1ZA 1C1YB 4L1BA 3P63A 5AEKB 3ENEA 1V2YA 1I4RA 4F7ZA 3RT3B 4HPPA 2WXIA 3NY5A 3ONSA 4TV3A 2L3ZA 3AU4A 3IBEA 1EU3A 1K50A 1ESFA 1WGYA 3RMKC 2REXA 1BMLC 2K25A 3N20C 2WXLA 5JHAA 2DWQA 4HCNB 2YLMA 1X1MA 2DX5B 5L95C
chains in the Genus database with same CATH topology
3CSFA 3A9KA 4DK5A 1S3SG 4GMVA 5D7GA 1E8WA 2RR9A 3QCAA 3PZDA 1HE8A 1E5WA 2D11A 2HD5B 2LZ6A 3M62B 1SGHA 3LJ3A 2G3QB 2I1KA 1UD7A 1WI0A 2LXAA 2L0TA 2BYEA 4BOZB 2R2QA 3KYDD 5CHWA 1P9DU 5J17A 1LQBA 3DCGA 4FA6A 4W9JA 3AULA 3L16A 3B1LX 3VQIA 4A20A 1SIFA 3KW5B 4ANXA 4TUUA 1WJNA 3PPAA 2LWPA 3VHTC 4HPMB 4KSLC 4MSMB 3VUXA 2M1MA 3OJ4B 4W9EA 2MBBB 4WJOA 3ZKJC 4DWFA 4HK2A 1CMXB 4GDKB 1WXVA 5IA7A 2MQJA 2N4FA 2Y5BB 3IG3A 2BYFA 4WWPA 2IZVB 2LUEA 4ICVA 4AOFA 3VAWA 3VH4B 4PYZA 4MJSB 2WX0A 1V49A 3HHMA 3JSVA 5HKHA 1KOTA 4W9CA 1UGMA 2AL6A 3I3TB 4AP4C 4TQ1A 5C23A 3V60A 3IHPC 3C0RB 4EOYA 2BWES 2FCNA 2FAZA 2EMTA 1MG8A 5LXIB 1J0GA 2C7HA 2KZRA 2D2QA 2IO3B 2NPTB 2KJRA 2KQ7A 2HJ8A 2BF8B 2MP2A 3JVZX 1Y8RC 1U4AA 3DVGY 2OJRA 4IUMB 4BKGA 3H7PB 4HVBA 1OEYA 1V5TA 3DBSA 4FJVB 4IW0A 4LDTB 4W9LA 5FR6A 3ZO5B 1OQYA 2KFJA 4FJYA 4G50A 2CHZA 2DZMA 2KLGA 2MSED 2KVRA 5CX3A 4M0WB 2K6DB 3B0AA 3CF6E 3DBLI 4RM8A 1A5RA 2DENB 1WXMA 3DVNU 5CHVC 5G55A 3ZW3A 5JH5C 1J8CA 1F9JA 3HK0A 2FCSA 2C9WB 2GBJA 3PSEB 4ICUA 1I35A 1IP9A 2N1WA 5BO4B 4JQWC 1WJ6A 2EKEC 2KMCA 3WANA 4ANUA 2DYMA 3VTUA 1E8XA 2OOBB 3B08A 3RUIB 3OAWA 3VTVA 4BKSA 4B9KA 4FHJA 4MELA 2K1FA 4K7SA 3R66C 4MGZE 2XEWA 1D3ZA 1WH3A 2LVPA 3Q3FA 3TJPA 2C7NB 3SHQA 4II3B 1WZ3A 1RFAA 3ALBA 1L2NA 3ZTCA 1Z5SB 4E71A 1WF9A 4HWIB 1G6JA 2JY6A 3DDCB 2KN5A 3KVFB 4MEMA 4G3XB 2NBVB 1RRBA 4KV2A 3TBLD 3Q3JA 2KDBA 3QC8B 4HDOA 2FUHB 3A4RA 2O6VD 2XK5B 3PV1A 4RMAA 3HM6X 3MJWA 3W1YA 1WFYA 5DPWA 2KD0A 2ZPNA 4MJSA 3W1SC 2WX1A 4GIVA 4WWOA 3MHSD 3PT2B 3SD5A 4A3OA 1WX9A 2JRHA 3SDLC 4CHKA 1V81A 1UBQA 1R4NI 3ZRFA 1WE6A 2KLCA 3N32A 1T0YA 3OLMD 2MBQA 4NAWB 1J19A 2NPTA 3NOBA 3ZDMC 3PGEA 4EZLA 4DHJB 2KJHB 3H7PA 3GOEA 3L08A 4CYEA 1E8YA 3NS8A 1V86A 4JGHB 3V62A 4LJOB 1YQBA 1ZKHA 2FIDA 3UINB 3APCA 2GMIC 3DPDA 4FN2A 1WGDA 2JXXA 3CMMB 3TCAA 2FCMA 2PEAA 3N30A 4BBNC 4FHKA 3A4SC 4KIKB 2ASQA 2CHWA 2MBHA 2MW5A 4AWJA 4FBJB 5D2MB 3M3JA 3WIMA 5J2RA 5IAAC 3EECA 4I6NB 1UH6A 4W9KA 1RLFA 5AZGA 3ECIA 3QIJA 3ZNGC 2GOWA 2UWQA 3APFA 2M8SA 4IM0A 3QX1A 5JZEB 1WGRA 2KHWB 2EMSA 2M17A 3EC8A 1GUAB 3VUWA 2RSUA 2JPHA 4IG7B 1QZEA 2O2VB 3GZNI 1WRDB 3PLUA 4IWOA 2JZZA 3NZUA 4W9HA 2J0JA 2BWFA 1WX7A 3DVGX 3JYUA 3UQBA 1AARA 1SE9A 2K8HA 5LXHA 2V1YA 1ISNA 1KJTA 2B3AA 1E8ZA 3RCZA 1UBIA 2PE9A 4EKUA 3H9DA 2KXJA 3D32A 4II2B 5DPTA 1E7VA 2W9NA 2JRIB 2XK5A 1E7UA 4E3CA 1NI2A 1XQQA 3RULA 2GBMA 2KWVB 1WXAA 3VVWB 4DXAB 2DZIA 2L05A 4BFRA 2IO2B 1GC6A 2KWUB 2YVCA 4MGYE 4XZ4A 4MGKE 2MWSB 4ZDVA 1KM7A 4NAWA 3DQVA 4GU2A 5JHBA 4KZCA 3UGBB 3V61A 4PS3A 1WZ0A 1L7YA 4LJPB 3ML8A 4KZ0A 1P3QU 4PYUA 4W9GA 4WQOB 3NZSA 3VUYA 3ZIMA 1JRUA 2KX0A 2LASA 2ZCBA 4IM2A 4GDLB 2KDFB 1NBFC 2G4SA 4KIKA 3R7RA 2J0KA 1KLVA 3A9JB 2LRWA 3N3KB 2CKHB 4XX5A 3QAQA 3PRPB 2FIFA 2Z59B 3DBRI 4ANVA 2RGFA 2DAFA 3K9OB 3VXWA 1WJ4A 4BBNF 3T9LA 2C60A 1P98A 4J6IA 4EZJA 2IY0B 1ZW7A 2BYVE 5DCNA 2MBOA 1V9JA 2O2VA 2KOXA 3ZNHB 3LDZE 2KKCA 1EUVB 2ZNVC 4HJKA 4XC2A 4K1RB 2BPSA 2KX3A 3PLVA 2PE6B 4KVGB 3WA0A 2DYBA 3DVNV 2XBBC 3PREA 4GSWA 3PVLA 2KTFA 2A4ZA 1GNUA 2QHOA 4I6LB 2K8BA 1VCBA 3AXCA 2K8CA 1WM2A 4GN1A 2MRPA 2L8JA 2DZJA 3VH3B 3V6EB 4JLCA 1WE7A 3CSTA 3RZWC 4E74A 2NBWB 3JW0X 2L0FA 4K7UA 3R3MA 4LDTD 4DDGD 4IWQA 1WYWB 1TBEA 1Q1OA 5D94A 2KTRB 4I6PA 3M95A 4YL8A 5AZFA 3TMPB 2KO3A 2HTHA 4X57B 1YIWA 2KFKB 4AUQC 3L13A 2LXCA 3BINA 2M4NA 1WY8A 3PS6A 2J0MA 2JF5A 2N7DA 2N7EA 1R4MI 2V4LA 2Z0DB 1RAXA 2RPQA 3DBHI 5D6JB 2LGYA 1EO6A 2G45B 3KH0A 4HXDA 4M8MA 4MGIE 2IBIB 1LXDA 3KUDB 3NHEB 4W9FA 3PTFC 2NS5A 1IYFA 3K9PB 2MLBA 3QA8A 3WAOA 1Q5WB 4GB9A 5TR5A 4DDID 1EF5A 5KHQA 1GJZA 5J18A 4GDLA 4ZRJA 2M0XA 4KDIC 1H8CA 3A1QB 3HIZA 2FNJB 2KK8A 3A9JA 5DPRA 3AI5A 1YD8U 2KC1A 3APDA 4N9F4 2C7MB 4MM3A 4HPLB 1P0RA 2VRRB 5KHOA 2KQSA 4ZRIA 5G2NA 3WAMA 2N9PC 4OVUA 1ZGUB 1WGGA 3A33B 4ZYNA 1FXTB 1WMHA 2NBUA 5CTRC 2MA9B 4GGQA 1OGWA 4PS8A 3QARA 4RM9A 4OVVA 4NNJB 2GBRA 2ZJDA 3WAPA 1WM3A 3RZFA 2CR5A 2AWTA 2N9XA 2LGDA 4MH0E 3PRMB 1XD3B 3PRZA 2AYOB 4ANWA 4KDLB 4PS7A 2ZZPB 1VD2A 4TKNA 1TGZB 4DHJD 1S1QB 2DAJA 3OJ3A 3L10B 4HCPB 1TTNA 2L00B 1K8RB 4NJ7A 4MDKE 1WJUA 3ZNID 3KUCB 3ZNZB 3QJZA 4NJ6A 4P7IA 2KTRA 4WJPA 1BT0A 2FCQA 3ZTDA 4CO7A 4DHZB 3PHWB 4JIOU 5E6NA 2KFKA 4ZRKA 1LM8B 2WWZA 3QHTA 1H4RA 3L17A 2MBEA 3AU5A 2LRUA 1C3TA 3H6NA 2A5UA 3U7DA 4BVUC 2KDIA 4B95A 1GG3A 1Q0WB 4AJYB 2KDEB 3H1UA 4FLHA 2C5LC 2KANA 2LVQA 5E6PA 3ZVVA 3U8ZA 3ZDTA 2CU1A 3A1QA 2BKRB 2DZKA 2WYQA 3QWZB 4B6WA 2K6QA 1Z2MA 3W1SA 4GXBA 2MCNB 1M94A 3X0WA 4BKSD 1OTRB 4URKA 2IYDB 2IY1B 4EEWA 3BY4B 1XT9B 4WWNA 1WR6E 3R7QA 2L76A 1YX6B 3X23A 2RD0A 3O65B 3L54A 3V6CB 3M63B 2O6VB 1I42A 1WMHB 2G4DB 1TZ1A 4HDQA 4MSQB 4W9IA 4F1SA 1E90A 4DHZE 4NQKE 5DPSA 4IM3A 2ZPYA 5CHFA 2N1VA 2WDTB 1WIAA 5AZHA 4AJWA 4BOSC 3DOWA 1IPGA 2L7RA 3IFWB 3TIXA 3UF8A 3WALA 1WXSA 4HLEA 3PHXB 2I1JA 4NY0A 2D10A 3A9KB 1GC7A 2AL3A 2JZ3B 5EDSA 5GMVA 2CS4A 3UQAA 3VTWA 3QK0A 3U30A 1V80A 2N9EB 4EZKA 4K81A 1WX8A 2NR2A 2ZEQA 4WAAA 2DYOA 4W9DA 3EFUA 2BGFA 4FADA 2GBKA 3KUZA 4FJZA 2KC2A 2CHXA 4FULA 5LLIA 3TL5A 4EFOA 4GOCA 1NDDA 2ZVOA 4BKTA 2D3GA 3S2AA 2UYZB 3ZRCA 3T8MA 2D07B 2ZCCA 3H7SA 3MTNB 3KYCD 3ML9A 4A3PA 4NQLB 2KJ6A 4DBGA 1LFDA 1V5OA 2ZNVB 1PQSA 1UELA 2GBNA 1YJ1A 2NVUI 2IO1B 2MX2A 2KMAA 4IC7B 5L83A 3UIPB 2LGXA 3QQ8B 4WJNA 1UZXB 2IO0B 1WGHA 1OEYJ 4GDKA 2JT4B 1WR1A 4TQ0A 2NCNA 3EHVA 2PPHA 2AEHA 5E6OA 4M8NA 3RYTA 4LCDE 2LJ5A 3P2BA 4KSKC 4ASWC 1V6EA 2Z0EB 5C1ZA 1C1YB 2LD9A 3ZLZA 2LI5A 3HM3A 3L0WB 5AEKB 3UIOB 3ENEA 1V2YA 2BKFA 2KWCA 4G0NB 2JVCA 4K7WA 3JSVB 1P1AA 4NPNA 3RT3B 3VFKA 3NY5A 2DHZA 4F7ZA 1YX5B 3ONSA 4JL9A 4TV3A 2L3ZA 3AU4A 2ZVNA 3IBEA 3VDZA 2JWZA 1WGYA 2K39A 2O6VA 2R2OA 2PJHA 3IVFA 4WJQA 2REXA 4F8CB 2HE7A 3RD2A 2MP2B 3ZUNA 2J7QB 2KNBA 2K25A 2V3SA 2JUOA 4EUTA 5JHAA 4G11A 4HCNB 2YLMA 2LVOA 1X1MA 4IWPA 3SU8X 2DX5B 5L95C 1EF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSF A;  3A9K A;  4DK5 A;  1S3S G;  4GMV A;  5D7G A;  1E8W A;  2RR9 A;  3QCA A;  3PZD A;  1HE8 A;  1E5W A;  2D11 A;  2HD5 B;  2LZ6 A;  3M62 B;  1SGH A;  3LJ3 A;  2G3Q B;  2I1K A;  1UD7 A;  1WI0 A;  2LXA A;  2L0T A;  2BYE A;  4BOZ B;  2R2Q A;  3KYD D;  5CHW A;  1P9D U;  5J17 A;  1LQB A;  3DCG A;  4FA6 A;  4W9J A;  3AUL A;  3L16 A;  3B1L X;  3VQI A;  4A20 A;  1SIF A;  3KW5 B;  4ANX A;  4TUU A;  1WJN A;  3PPA A;  2LWP A;  3VHT C;  4HPM B;  4KSL C;  4MSM B;  3VUX A;  2M1M A;  3OJ4 B;  4W9E A;  2MBB B;  4WJO A;  3ZKJ C;  4DWF A;  4HK2 A;  1CMX B;  4GDK B;  1WXV A;  5IA7 A;  2MQJ A;  2N4F A;  2Y5B B;  3IG3 A;  2BYF A;  4WWP A;  2IZV B;  2LUE A;  4ICV A;  4AOF A;  3VAW A;  3VH4 B;  4PYZ A;  4MJS B;  2WX0 A;  1V49 A;  3HHM A;  3JSV A;  5HKH A;  1KOT A;  4W9C A;  1UGM A;  2AL6 A;  3I3T B;  4AP4 C;  4TQ1 A;  5C23 A;  3V60 A;  3IHP C;  3C0R B;  4EOY A;  2BWE S;  2FCN A;  2FAZ A;  2EMT A;  1MG8 A;  5LXI B;  1J0G A;  2C7H A;  2KZR A;  2D2Q A;  2IO3 B;  2NPT B;  2KJR A;  2KQ7 A;  2HJ8 A;  2BF8 B;  2MP2 A;  3JVZ X;  1Y8R C;  1U4A A;  3DVG Y;  2OJR A;  4IUM B;  4BKG A;  3H7P B;  4HVB A;  1OEY A;  1V5T A;  3DBS A;  4FJV B;  4IW0 A;  4LDT B;  4W9L A;  5FR6 A;  3ZO5 B;  1OQY A;  2KFJ A;  4FJY A;  4G50 A;  2CHZ A;  2DZM A;  2KLG A;  2MSE D;  2KVR A;  5CX3 A;  4M0W B;  2K6D B;  3B0A A;  3CF6 E;  3DBL I;  4RM8 A;  1A5R A;  2DEN B;  1WXM A;  3DVN U;  5CHV C;  5G55 A;  3ZW3 A;  5JH5 C;  1J8C A;  1F9J A;  3HK0 A;  2FCS A;  2C9W B;  2GBJ A;  3PSE B;  4ICU A;  1I35 A;  1IP9 A;  2N1W A;  5BO4 B;  4JQW C;  1WJ6 A;  2EKE C;  2KMC A;  3WAN A;  4ANU A;  2DYM A;  3VTU A;  1E8X A;  2OOB B;  3B08 A;  3RUI B;  3OAW A;  3VTV A;  4BKS A;  4B9K A;  4FHJ A;  4MEL A;  2K1F A;  4K7S A;  3R66 C;  4MGZ E;  2XEW A;  1D3Z A;  1WH3 A;  2LVP A;  3Q3F A;  3TJP A;  2C7N B;  3SHQ A;  4II3 B;  1WZ3 A;  1RFA A;  3ALB A;  1L2N A;  3ZTC A;  1Z5S B;  4E71 A;  1WF9 A;  4HWI B;  1G6J A;  2JY6 A;  3DDC B;  2KN5 A;  3KVF B;  4MEM A;  4G3X B;  2NBV B;  1RRB A;  4KV2 A;  3TBL D;  3Q3J A;  2KDB A;  3QC8 B;  4HDO A;  2FUH B;  3A4R A;  2O6V D;  2XK5 B;  3PV1 A;  4RMA A;  3HM6 X;  3MJW A;  3W1Y A;  1WFY A;  5DPW A;  2KD0 A;  2ZPN A;  4MJS A;  3W1S C;  2WX1 A;  4GIV A;  4WWO A;  3MHS D;  3PT2 B;  3SD5 A;  4A3O A;  1WX9 A;  2JRH A;  3SDL C;  4CHK A;  1V81 A;  1UBQ A;  1R4N I;  3ZRF A;  1WE6 A;  2KLC A;  3N32 A;  1T0Y A;  3OLM D;  2MBQ A;  4NAW B;  1J19 A;  2NPT A;  3NOB A;  3ZDM C;  3PGE A;  4EZL A;  4DHJ B;  2KJH B;  3H7P A;  3GOE A;  3L08 A;  4CYE A;  1E8Y A;  3NS8 A;  1V86 A;  4JGH B;  3V62 A;  4LJO B;  1YQB A;  1ZKH A;  2FID A;  3UIN B;  3APC A;  2GMI C;  3DPD A;  4FN2 A;  1WGD A;  2JXX A;  3CMM B;  3TCA A;  2FCM A;  2PEA A;  3N30 A;  4BBN C;  4FHK A;  3A4S C;  4KIK B;  2ASQ A;  2CHW A;  2MBH A;  2MW5 A;  4AWJ A;  4FBJ B;  5D2M B;  3M3J A;  3WIM A;  5J2R A;  5IAA C;  3EEC A;  4I6N B;  1UH6 A;  4W9K A;  1RLF A;  5AZG A;  3ECI A;  3QIJ A;  3ZNG C;  2GOW A;  2UWQ A;  3APF A;  2M8S A;  4IM0 A;  3QX1 A;  5JZE B;  1WGR A;  2KHW B;  2EMS A;  2M17 A;  3EC8 A;  1GUA B;  3VUW A;  2RSU A;  2JPH A;  4IG7 B;  1QZE A;  2O2V B;  3GZN I;  1WRD B;  3PLU A;  4IWO A;  2JZZ A;  3NZU A;  4W9H A;  2J0J A;  2BWF A;  1WX7 A;  3DVG X;  3JYU A;  3UQB A;  1AAR A;  1SE9 A;  2K8H A;  5LXH A;  2V1Y A;  1ISN A;  1KJT A;  2B3A A;  1E8Z A;  3RCZ A;  1UBI A;  2PE9 A;  4EKU A;  3H9D A;  2KXJ A;  3D32 A;  4II2 B;  5DPT A;  1E7V A;  2W9N A;  2JRI B;  2XK5 A;  1E7U A;  4E3C A;  1NI2 A;  1XQQ A;  3RUL A;  2GBM A;  2KWV B;  1WXA A;  3VVW B;  4DXA B;  2DZI A;  2L05 A;  4BFR A;  2IO2 B;  1GC6 A;  2KWU B;  2YVC A;  4MGY E;  4XZ4 A;  4MGK E;  2MWS B;  4ZDV A;  1KM7 A;  4NAW A;  3DQV A;  4GU2 A;  5JHB A;  4KZC A;  3UGB B;  3V61 A;  4PS3 A;  1WZ0 A;  1L7Y A;  4LJP B;  3ML8 A;  4KZ0 A;  1P3Q U;  4PYU A;  4W9G A;  4WQO B;  3NZS A;  3VUY A;  3ZIM A;  1JRU A;  2KX0 A;  2LAS A;  2ZCB A;  4IM2 A;  4GDL B;  2KDF B;  1NBF C;  2G4S A;  4KIK A;  3R7R A;  2J0K A;  1KLV A;  3A9J B;  2LRW A;  3N3K B;  2CKH B;  4XX5 A;  3QAQ A;  3PRP B;  2FIF A;  2Z59 B;  3DBR I;  4ANV A;  2RGF A;  2DAF A;  3K9O B;  3VXW A;  1WJ4 A;  4BBN F;  3T9L A;  2C60 A;  1P98 A;  4J6I A;  4EZJ A;  2IY0 B;  1ZW7 A;  2BYV E;  5DCN A;  2MBO A;  1V9J A;  2O2V A;  2KOX A;  3ZNH B;  3LDZ E;  2KKC A;  1EUV B;  2ZNV C;  4HJK A;  4XC2 A;  4K1R B;  2BPS A;  2KX3 A;  3PLV A;  2PE6 B;  4KVG B;  3WA0 A;  2DYB A;  3DVN V;  2XBB C;  3PRE A;  4GSW A;  3PVL A;  2KTF A;  2A4Z A;  1GNU A;  2QHO A;  4I6L B;  2K8B A;  1VCB A;  3AXC A;  2K8C A;  1WM2 A;  4GN1 A;  2MRP A;  2L8J A;  2DZJ A;  3VH3 B;  3V6E B;  4JLC A;  1WE7 A;  3CST A;  3RZW C;  4E74 A;  2NBW B;  3JW0 X;  2L0F A;  4K7U A;  3R3M A;  4LDT D;  4DDG D;  4IWQ A;  1WYW B;  1TBE A;  1Q1O A;  5D94 A;  2KTR B;  4I6P A;  3M95 A;  4YL8 A;  5AZF A;  3TMP B;  2KO3 A;  2HTH A;  4X57 B;  1YIW A;  2KFK B;  4AUQ C;  3L13 A;  2LXC A;  3BIN A;  2M4N A;  1WY8 A;  3PS6 A;  2J0M A;  2JF5 A;  2N7D A;  2N7E A;  1R4M I;  2V4L A;  2Z0D B;  1RAX A;  2RPQ A;  3DBH I;  5D6J B;  2LGY A;  1EO6 A;  2G45 B;  3KH0 A;  4HXD A;  4M8M A;  4MGI E;  2IBI B;  1LXD A;  3KUD B;  3NHE B;  4W9F A;  3PTF C;  2NS5 A;  1IYF A;  3K9P B;  2MLB A;  3QA8 A;  3WAO A;  1Q5W B;  4GB9 A;  5TR5 A;  4DDI D;  1EF5 A;  5KHQ A;  1GJZ A;  5J18 A;  4GDL A;  4ZRJ A;  2M0X A;  4KDI C;  1H8C A;  3A1Q B;  3HIZ A;  2FNJ B;  2KK8 A;  3A9J A;  5DPR A;  3AI5 A;  1YD8 U;  2KC1 A;  3APD A;  4N9F 4;  2C7M B;  4MM3 A;  4HPL B;  1P0R A;  2VRR B;  5KHO A;  2KQS A;  4ZRI A;  5G2N A;  3WAM A;  2N9P C;  4OVU A;  1ZGU B;  1WGG A;  3A33 B;  4ZYN A;  1FXT B;  1WMH A;  2NBU A;  5CTR C;  2MA9 B;  4GGQ A;  1OGW A;  4PS8 A;  3QAR A;  4RM9 A;  4OVV A;  4NNJ B;  2GBR A;  2ZJD A;  3WAP A;  1WM3 A;  3RZF A;  2CR5 A;  2AWT A;  2N9X A;  2LGD A;  4MH0 E;  3PRM B;  1XD3 B;  3PRZ A;  2AYO B;  4ANW A;  4KDL B;  4PS7 A;  2ZZP B;  1VD2 A;  4TKN A;  1TGZ B;  4DHJ D;  1S1Q B;  2DAJ A;  3OJ3 A;  3L10 B;  4HCP B;  1TTN A;  2L00 B;  1K8R B;  4NJ7 A;  4MDK E;  1WJU A;  3ZNI D;  3KUC B;  3ZNZ B;  3QJZ A;  4NJ6 A;  4P7I A;  2KTR A;  4WJP A;  1BT0 A;  2FCQ A;  3ZTD A;  4CO7 A;  4DHZ B;  3PHW B;  4JIO U;  5E6N A;  2KFK A;  4ZRK A;  1LM8 B;  2WWZ A;  3QHT A;  1H4R A;  3L17 A;  2MBE A;  3AU5 A;  2LRU A;  1C3T A;  3H6N A;  2A5U A;  3U7D A;  4BVU C;  2KDI A;  4B95 A;  1GG3 A;  1Q0W B;  4AJY B;  2KDE B;  3H1U A;  4FLH A;  2C5L C;  2KAN A;  2LVQ A;  5E6P A;  3ZVV A;  3U8Z A;  3ZDT A;  2CU1 A;  3A1Q A;  2BKR B;  2DZK A;  2WYQ A;  3QWZ B;  4B6W A;  2K6Q A;  1Z2M A;  3W1S A;  4GXB A;  2MCN B;  1M94 A;  3X0W A;  4BKS D;  1OTR B;  4URK A;  2IYD B;  2IY1 B;  4EEW A;  3BY4 B;  1XT9 B;  4WWN A;  1WR6 E;  3R7Q A;  2L76 A;  1YX6 B;  3X23 A;  2RD0 A;  3O65 B;  3L54 A;  3V6C B;  3M63 B;  2O6V B;  1I42 A;  1WMH B;  2G4D B;  1TZ1 A;  4HDQ A;  4MSQ B;  4W9I A;  4F1S A;  1E90 A;  4DHZ E;  4NQK E;  5DPS A;  4IM3 A;  2ZPY A;  5CHF A;  2N1V A;  2WDT B;  1WIA A;  5AZH A;  4AJW A;  4BOS C;  3DOW A;  1IPG A;  2L7R A;  3IFW B;  3TIX A;  3UF8 A;  3WAL A;  1WXS A;  4HLE A;  3PHX B;  2I1J A;  4NY0 A;  2D10 A;  3A9K B;  1GC7 A;  2AL3 A;  2JZ3 B;  5EDS A;  5GMV A;  2CS4 A;  3UQA A;  3VTW A;  3QK0 A;  3U30 A;  1V80 A;  2N9E B;  4EZK A;  4K81 A;  1WX8 A;  2NR2 A;  2ZEQ A;  4WAA A;  2DYO A;  4W9D A;  3EFU A;  2BGF A;  4FAD A;  2GBK A;  3KUZ A;  4FJZ A;  2KC2 A;  2CHX A;  4FUL A;  5LLI A;  3TL5 A;  4EFO A;  4GOC A;  1NDD A;  2ZVO A;  4BKT A;  2D3G A;  3S2A A;  2UYZ B;  3ZRC A;  3T8M A;  2D07 B;  2ZCC A;  3H7S A;  3MTN B;  3KYC D;  3ML9 A;  4A3P A;  4NQL B;  2KJ6 A;  4DBG A;  1LFD A;  1V5O A;  2ZNV B;  1PQS A;  1UEL A;  2GBN A;  1YJ1 A;  2NVU I;  2IO1 B;  2MX2 A;  2KMA A;  4IC7 B;  5L83 A;  3UIP B;  2LGX A;  3QQ8 B;  4WJN A;  1UZX B;  2IO0 B;  1WGH A;  1OEY J;  4GDK A;  2JT4 B;  1WR1 A;  4TQ0 A;  2NCN A;  3EHV A;  2PPH A;  2AEH A;  5E6O A;  4M8N A;  3RYT A;  4LCD E;  2LJ5 A;  3P2B A;  4KSK C;  4ASW C;  1V6E A;  2Z0E B;  5C1Z A;  1C1Y B;  2LD9 A;  3ZLZ A;  2LI5 A;  3HM3 A;  3L0W B;  5AEK B;  3UIO B;  3ENE A;  1V2Y A;  2BKF A;  2KWC A;  4G0N B;  2JVC A;  4K7W A;  3JSV B;  1P1A A;  4NPN A;  3RT3 B;  3VFK A;  3NY5 A;  2DHZ A;  4F7Z A;  1YX5 B;  3ONS A;  4JL9 A;  4TV3 A;  2L3Z A;  3AU4 A;  2ZVN A;  3IBE A;  3VDZ A;  2JWZ A;  1WGY A;  2K39 A;  2O6V A;  2R2O A;  2PJH A;  3IVF A;  4WJQ A;  2REX A;  4F8C B;  2HE7 A;  3RD2 A;  2MP2 B;  3ZUN A;  2J7Q B;  2KNB A;  2K25 A;  2V3S A;  2JUO A;  4EUT A;  5JHA A;  4G11 A;  4HCN B;  2YLM A;  2LVO A;  1X1M A;  4IWP A;  3SU8 X;  2DX5 B;  5L95 C;  1EF1 A; 
#chains in the Genus database with same CATH topology
 3B2G A;  3A9K A;  3BWU D;  5D7G A;  4Q2J A;  1RFK A;  4WH4 A;  3QCA A;  4P16 A;  4L23 A;  1HE8 A;  1E5W A;  2HD5 B;  4JX1 C;  2IPK D;  2G3Q B;  2JYE A;  1UD7 A;  3R2T A;  2R2Q A;  3KYD D;  5J17 A;  3HVZ A;  3Q69 A;  3L16 A;  1WJN A;  2LWP A;  3VUX A;  4W9E A;  4GLS C;  3NRZ A;  3ZKJ C;  4HK2 A;  1CMX B;  1WXV A;  3URY A;  2Y5B B;  3EA6 A;  3IG3 A;  1XCQ L;  5HKH A;  1KOT A;  2R61 A;  4W9C A;  3MFG A;  1FIQ A;  3V60 A;  3IHP C;  3C0R B;  4EOY A;  2BWE S;  2FCN A;  2FAZ A;  2NPT B;  2MP2 A;  4BKG A;  4IUM B;  4RGT A;  1ET6 A;  2QC8 A;  4LDT B;  4ARC A;  4FJY A;  3RNE C;  4RGN A;  1ENF A;  1FO4 A;  2D5G A;  3DVN U;  5G55 A;  5JH5 C;  3ZW3 A;  3PSE B;  1KH0 A;  1WJ6 A;  2KMC A;  1B9R A;  3WAN A;  3B08 A;  3RUI B;  3U4E G;  3OAW A;  4FHJ A;  4K7S A;  2XEW A;  1N5W A;  2LVP A;  3ALB A;  1E6E B;  3MC0 B;  2KN5 A;  4MEM A;  4RGO S;  3QC8 B;  1C4P A;  4HDO A;  3N1X C;  4RMA A;  3HM6 X;  3MJW A;  3PT2 B;  1ZE3 D;  1V81 A;  2AQ2 B;  2GLS A;  3ZRF A;  1J7C A;  2GI9 A;  3LB8 C;  2MBQ A;  4NAW B;  1J19 A;  3NOB A;  3PGE A;  4EZL A;  1YJJ A;  2KJH B;  2QDF A;  3H7P A;  3HVD A;  3GOE A;  1E8Y A;  1FPY A;  4JGH B;  4JWU C;  1HTO A;  3UIN B;  4M0W A;  3APC A;  2GMI C;  2BQQ A;  1FRD A;  2JXX A;  3CMM B;  3SFD B;  2LEK A;  2PEA A;  4FBJ B;  2MBH A;  2FE8 A;  2MW5 A;  3WIM A;  2QJL A;  3Q8E A;  1UH6 A;  1RLF A;  2OED A;  2W82 A;  2KHW B;  1VLB A;  3EC8 A;  4IG7 B;  4JPS A;  3H8H A;  3PLU A;  2JZZ A;  4W9H A;  2BWF A;  1SSN A;  1XLP A;  1WX7 A;  3DVG X;  5FR3 A;  2K8H A;  1KJT A;  2K0P A;  4II2 B;  4ZHO A;  1E7V A;  4UDU C;  2XK5 A;  1E7U A;  1NI2 A;  1I4X A;  1XQQ A;  1KM7 A;  1NYQ A;  3N1Y C;  4YSZ B;  2Y5C A;  5JHB A;  4DQO C;  4HEA 1;  1WZ0 A;  4LJP B;  4W9G A;  4RNA A;  3AEA B;  1NBF C;  2G4S A;  3Q3N C;  3R7R A;  1NVI D;  1TKY A;  3N3K B;  5G5G A;  4OVZ A;  2FIF A;  1YQ4 B;  2RGF A;  2KYW A;  1MG4 A;  2C60 A;  1ZW7 A;  2O2V A;  3ZNH B;  4MAC A;  1C79 A;  2V4I B;  2DYB A;  3DVN V;  4C56 C;  3I63 C;  2XBB C;  4YWG G;  2KAJ A;  3PVL A;  1GNU A;  4I6L B;  1ZDX A;  4GN1 A;  2L8J A;  2DZJ A;  2N9K A;  1MPE A;  2NBW B;  3JW0 X;  1ACC A;  2PTL A;  4DDG D;  1WYW B;  3C8Y A;  1SJH D;  5D94 A;  4I6P A;  4YL8 A;  2KO3 A;  3AE1 B;  3AED B;  3GE8 C;  3L13 A;  1VZ7 A;  1WY8 A;  1GOZ A;  2JF5 A;  2N7D A;  3DHI C;  1R4M I;  2G45 B;  4WAF A;  1FNU A;  2K3U A;  1LXD A;  2BB5 A;  4ZRJ A;  1KRH A;  1SJE D;  2LHE A;  2FNJ B;  2KK8 A;  2PVO D;  1JQ4 A;  4MM3 A;  4ZRI A;  2V3N A;  1WGG A;  5HI1 A;  4ZYN A;  1WMH A;  4L2Y A;  2K9X A;  4RM9 A;  4NNJ B;  2GBR A;  2ZJD A;  3AE9 B;  2N9X A;  2LGD A;  3IT6 B;  1UWM A;  3PRZ A;  1T5X D;  2VZK B;  4ANW A;  4KDL B;  4B0M A;  3AEC B;  4PS7 A;  3N1Z C;  1EWY C;  1E0Z A;  1TGZ B;  3DHG C;  1LGR A;  4C80 A;  4HCP B;  1TTN A;  1K8R B;  1TS4 A;  4NJ7 A;  4MDK E;  2JU6 X;  1I4P A;  4WJP A;  1IGD A;  1TJE A;  3RPF C;  4C4V B;  4DHZ B;  4JIO U;  4RF1 A;  4YSX B;  1C3T A;  3H6N A;  2KDI A;  1PGB A;  1XCT L;  2I38 A;  5E6P A;  1ZPS A;  4S17 A;  2CU1 A;  3A1Q A;  3AE4 B;  2BKR B;  2K6Q A;  1Z2M A;  3X0W A;  1OFF A;  4WWN A;  1HXY D;  3X23 A;  3M63 B;  1KLG D;  1F2R C;  1TZ1 A;  1XLN A;  2WDV B;  4F1S A;  4H2A A;  2WDT B;  3IFW B;  3T3N A;  1FXA A;  2M19 A;  3A9K B;  3UQA A;  1GB4 A;  3AEF B;  4K81 A;  1WX8 A;  4A9A A;  1I4G A;  2DYO A;  3EFU A;  4LNK A;  4ZRP A;  3W2D A;  2CHX A;  3KWV A;  4FUL A;  3TL5 A;  4EFO A;  4GOC A;  4DXF A;  4MT5 A;  2UYZ B;  2N0S B;  2JXT A;  3MTN B;  4RH6 A;  2M0A A;  4K3C A;  1V1O A;  4A6Q A;  2I2Y A;  1XEE A;  2LGX A;  2SAK A;  2IO0 B;  1L6V A;  4GDK A;  3RYT A;  1R4N B;  2LJ5 A;  1V6E A;  1FNW A;  2LD9 A;  4LNO A;  4HKZ E;  3HM3 A;  2E6X A;  2RDG A;  3UIO B;  1P1A A;  1V1P A;  3VDZ A;  4CQN A;  2WXP A;  4KGR A;  4XWW A;  2K39 A;  2O6V A;  4WJQ A;  2PJH A;  1FRR A;  2MP2 B;  2KNB A;  4EUT A;  3ZGZ A;  2WP9 B;  3AEE B;  4GMV A;  1E8W A;  3NZ3 A;  4JE3 B;  4WUR A;  2L0T A;  5CHW A;  1P9D U;  1PUT A;  2AQ3 B;  3B1L X;  3VQI A;  1TY0 A;  3KW5 B;  3TUO A;  3ABV B;  3P4Q B;  2ON8 A;  3PPA A;  3B9J A;  4HPM B;  5IO9 A;  3DWM A;  1T6B X;  4DXG A;  3KQ4 A;  2MBB B;  5IA7 A;  1IBX A;  4WWP A;  5C2T B;  4AOF A;  3VAW A;  3VH4 B;  3JSV A;  1V49 A;  3HHM A;  1UGJ A;  2C7H A;  2KZR A;  2D2Q A;  2IO3 B;  2KQ7 A;  4C7Y A;  3Q8B A;  1SXT A;  1U4A A;  2CJN A;  2OJR A;  4HVB A;  2WXG A;  3DBL B;  3H7P B;  3DBS A;  4W9L A;  5FR6 A;  1T3Q A;  2KLG A;  2MSE D;  4RGM A;  4M0W B;  3B0A A;  1L0X B;  3DBL I;  1WXM A;  2QMT A;  4N58 A;  2GB1 A;  2DLB A;  2GBJ A;  1IP9 A;  2N1W A;  4XWT A;  5BO4 B;  3U2S C;  4ANU A;  5BYS A;  1E8X A;  4BKS A;  4MEL A;  2CU3 A;  1JAL A;  3R66 C;  4MGZ E;  1DYQ A;  3MP9 A;  2PW9 A;  1WH3 A;  2C7N B;  3SHQ A;  1WZ3 A;  1RFA A;  1XXG A;  4E71 A;  4HWI B;  4N59 A;  1HZ5 A;  1P7F A;  4G3X B;  1YOV B;  4KV2 A;  1QLB B;  5EE9 A;  2FUH B;  3V3X A;  2O6V D;  2XK5 B;  3W1Y A;  2WXN A;  5DPW A;  1YN3 A;  4MJS A;  5D3D A;  3NVV A;  2WX1 A;  4GIV A;  1CK1 A;  2N7J A;  1WX9 A;  4A3O A;  1UBQ A;  1WE6 A;  3N32 A;  2IGG A;  4US9 A;  3ZDM C;  5IN7 A;  2HDE A;  4CYE A;  3NS8 A;  3V62 A;  1YQB A;  2FID A;  5HHD G;  2PLP A;  1WYG A;  3DPD A;  2IND C;  4FHK A;  3A4S C;  2ASQ A;  4XGA B;  5J2R A;  1SEB D;  4I6N B;  5BYQ A;  3ZJV A;  2IGD A;  2GOW A;  3EUB 2;  2UWQ A;  3QX1 A;  1V97 A;  2M17 A;  4R3D A;  1GUA B;  1R7S A;  3VUW A;  1ZXI A;  1QZE A;  4US8 A;  2O2V B;  1WRD B;  3NZU A;  4ZYS A;  2H88 B;  4OZC A;  3AB5 A;  1SE9 A;  2J53 A;  1ISN A;  2B3A A;  3BVM A;  2W3S A;  3W5V B;  4EKU A;  3H9D A;  5DPT A;  2W9N A;  4YTM B;  2KWV B;  2WQY B;  1N60 A;  2JSV X;  1F1H A;  2KWU B;  4XZ4 A;  1HA5 A;  3BYY B;  4KZC A;  1HTQ A;  2VZK D;  3UGB B;  3BVZ A;  3ML8 A;  4KZ0 A;  4PYU A;  1MHX A;  4WQO B;  3VUY A;  4ZHP A;  3ZIM A;  4ARI A;  2ZCB A;  3AE2 B;  4RFB A;  4YSY B;  2KDF B;  3EFC A;  2J0K A;  3RFZ B;  4MM3 B;  2CKH B;  4KGS A;  4BBN F;  2ICI A;  2W55 A;  3T3O A;  2MBO A;  2WXK A;  2KOX A;  4O1N A;  1PGA A;  4K1R B;  2KX3 A;  2PE6 B;  3WA0 A;  2KN4 A;  3RN9 C;  4OHJ A;  2WU2 B;  1YN4 A;  1F2R I;  3PZ8 A;  3VH3 B;  1CZP A;  3V6E B;  4JLC A;  2L0F A;  3R3M A;  3P4R B;  4IWQ A;  5EE1 A;  3DBH B;  5AZF A;  2M4N A;  5BMI A;  4A90 A;  3DBH I;  2RPQ A;  2LGY A;  1E7P B;  3KH0 A;  4HXD A;  2LJI A;  2KQ4 X;  4KKJ A;  4W9F A;  2MLB A;  5KHQ A;  4GDL A;  3Q6B A;  2M0X A;  4KDI C;  1H8C A;  3A1Q B;  2J52 A;  1C4A A;  1P0R A;  1OQR A;  2VRR B;  4NAM A;  3WAM A;  2N9P C;  1OQQ A;  4XDD A;  3A33 B;  2FBW B;  3E56 A;  2WXR A;  2NBU A;  3AMZ A;  2WNM A;  3R8B A;  2ZW0 A;  1JRO A;  4BAX A;  4OVV A;  1KF6 B;  2OJW A;  1UNS A;  2AWT A;  4MH0 E;  1XD3 B;  2D3A A;  3VR8 B;  2WU5 B;  5H92 C;  2B76 B;  4M02 A;  3SR6 A;  2AQ1 B;  4AQ7 A;  2DAJ A;  3L10 B;  2L00 B;  2CJO A;  5D3I B;  1YN5 A;  3KUC B;  4NJ6 A;  2KTR A;  1BT0 A;  3ZTD A;  1TYG B;  1T0R C;  3PHW B;  2KFK A;  4ZRK A;  1F0Z A;  3QHT A;  1H4R A;  1I4H A;  4TMA B;  2MBE A;  3AU5 A;  3ZXR A;  2A5U A;  4USA A;  5IOI A;  1JWM D;  3VRB B;  3H1U A;  4FLH A;  1L5P A;  3QWZ B;  4B6W A;  3W1S A;  1E9M A;  4NZL B;  2MCN B;  1OTR B;  4EEW A;  3BY4 B;  1XT9 B;  5EE3 A;  1WR6 E;  3R7Q A;  2L76 A;  1YX6 B;  2V0G A;  1V1P B;  1UWX A;  4OZB A;  2O6V B;  3W5U B;  3MC8 A;  1E90 A;  4NQK E;  5DPS A;  2ZPY A;  1VR9 A;  5AZH A;  4AJW A;  3DOW A;  3WAL A;  2L7R A;  3TIX A;  1WXS A;  3PHX B;  2I1J A;  3SFE B;  2D10 A;  3OG5 A;  1K52 A;  5GMV A;  1DOY A;  3QK0 A;  1V80 A;  4C00 A;  2N9E B;  2ZEQ A;  4WAA A;  4W9D A;  3KUZ A;  5LLI A;  1CJE A;  2GRI A;  4HRS A;  4BKT A;  1SIJ A;  2E3T A;  2ZCC A;  3KYC D;  3MC9 A;  3ML9 A;  3RNB C;  1L0V B;  2KJ6 A;  4A3P A;  1V5O A;  1YJ1 A;  3Q8F A;  2IO1 B;  3NJT A;  2MX2 A;  2KMA A;  1TS3 A;  4J3O D;  3QQ8 B;  1FM0 D;  1WGH A;  3FKY A;  2JT4 B;  4LNN A;  2NCN A;  5E6O A;  2AEH A;  2RDH A;  3P2B A;  4KSK C;  2JYT A;  2LGI A;  2Z0E B;  3ZLZ A;  3L0W B;  1HEZ E;  2BKF A;  2KWC A;  3VFK A;  3JSV B;  2DHZ A;  4OW0 A;  4JL9 A;  1ROE A;  1HZ6 A;  2M56 B;  1SB3 C;  3Q8A A;  3LYY A;  3IVF A;  2R2O A;  3ZUN A;  1BXT A;  2J7Q B;  2JUO A;  3RNF C;  1XLQ A;  2KMM A;  4P6V F;  5TSS A;  2LVO A;  1EF1 A;  3CSF A;  1S3S G;  3AE6 B;  3PZD A;  3R2I A;  1JRP A;  3OWE B;  3J9C A;  2D11 A;  2KAC A;  2W54 A;  1SGH A;  3LJ3 A;  2I1K A;  2TSS A;  1WI0 A;  2BYE A;  4BOZ B;  3BZD B;  1WXQ A;  1LQB A;  3DCG A;  1I7H A;  3AUL A;  4W9J A;  4ANX A;  1SIF A;  4TUU A;  5JXV A;  3VRA B;  3VHT C;  3RNG C;  2JQR B;  1NYR A;  4HKQ A;  1GB1 A;  1QOG A;  3BII D;  3TSS A;  2MQJ A;  1EWC A;  2N4F A;  1KFY B;  2IGH A;  3Q14 C;  2BYF A;  2IZV B;  1SE3 A;  2RPV A;  2NMQ A;  4MJS B;  4PYZ A;  5T8I A;  1DOI A;  2AX5 A;  4AP4 C;  3Q3O C;  4TQ1 A;  3CWI A;  5LXI B;  2EMT A;  1MG8 A;  1PFD A;  2KJR A;  4K3B A;  2HJ8 A;  2BF8 B;  1Y8R C;  1V5T A;  1ZOY B;  1OQY A;  2KFJ A;  4G50 A;  2DZM A;  2KVR A;  2JZP A;  5CX3 A;  2K6D B;  4RM8 A;  4B0E A;  2QSD A;  2FCS A;  2QIL A;  2KWD A;  3UI3 A;  2BYT A;  1I35 A;  2X8X X;  4JQW C;  3NG0 A;  2DYM A;  3VTU A;  2OOB B;  3VTV A;  1E10 A;  4B9K A;  1PYW D;  1N63 A;  2V9H A;  2INN E;  4II3 B;  1L2N A;  3ZTC A;  1Z5S B;  4PT5 A;  2PMV A;  3DDC B;  3P4P B;  2NBV B;  1RRB A;  2MJD A;  3Q3J A;  2KDB A;  4ZOH C;  2YEP F;  3PV1 A;  1WFY A;  1MJD A;  1WSP A;  2KD0 A;  2WHI A;  4WWO A;  1FMA D;  2WXO A;  3MHS D;  2JRH A;  3SDL C;  4CHK A;  1N61 A;  3I5J C;  2X38 A;  1R4N I;  2ACZ B;  2KLC A;  2H89 B;  4XDC A;  1YQ3 B;  4P1B C;  3HRD D;  2PKO A;  1V86 A;  4LJO B;  2HJ1 A;  1L6U A;  1IGC A;  3AE5 B;  4FN2 A;  1WGD A;  3LXF A;  1C9F A;  3M3J A;  4W9K A;  3GZN B;  3ECI A;  3QIJ A;  1ZDV A;  2L1A A;  1WGR A;  2DBY A;  1N6Z A;  3BK1 A;  2RSU A;  2JPH A;  1YMH E;  1SF0 A;  2BS2 B;  3GZN I;  4IWO A;  3JYU A;  4FXC A;  5LXH A;  2V1Y A;  1TS2 A;  2L83 A;  3RCZ A;  1TIF A;  1UBI A;  2WDQ B;  2KXJ A;  3D32 A;  4C7Z A;  2WGS A;  2JRI B;  4M01 A;  1WXA A;  2DZI A;  2HTM E;  1WWT A;  1GC6 A;  2IO2 B;  2JX5 A;  2YVC A;  3DHH C;  2MJ3 A;  4MGY E;  2MWS B;  4ZDV A;  4LTU A;  2LMC A;  4GU2 A;  1L0Y B;  3TEW A;  1TT5 B;  3V61 A;  1L7Y A;  2RMM A;  1YJI A;  1P3Q U;  3GP7 A;  1Y56 A;  3NZS A;  3DBR B;  3NUH B;  4GDL B;  2L52 A;  4KIK A;  1B1Z A;  2K22 A;  4XX5 A;  5AUI A;  5C3J B;  2WXQ A;  1FCC C;  3DBR I;  4ANV A;  3AEG B;  2DAF A;  3VXW A;  2IDY A;  4J6I A;  2IY0 B;  2BYV E;  5DCN A;  3FIL A;  1RM6 C;  2KKC A;  1EUV B;  5FK9 C;  4XC2 A;  4HJK A;  2BPS A;  3P42 A;  3PLV A;  4WWM A;  4A55 A;  3PRE A;  4GSW A;  2EEL A;  1QOB A;  2KTF A;  2WDR B;  1N5X A;  1KTK A;  2A4Z A;  2QHO A;  2K8B A;  1VCB A;  1WM2 A;  4ITK A;  3RZW C;  4E74 A;  1IUE A;  4K7U A;  1RWS A;  3DWG C;  1TBE A;  2KTR B;  3M95 A;  4S0R A;  2HTH A;  4X57 B;  1YIW A;  2KFK B;  3BIN A;  2BBC A;  3PS6 A;  2J0M A;  2Z0D B;  5D6J B;  1EO6 A;  4MGI E;  3PTF C;  2NS5 A;  3WAO A;  3QA8 A;  1Q5W B;  4GB9 A;  5TR5 A;  1GJZ A;  2WXF A;  5J18 A;  3A9J A;  4N6E B;  3AI5 A;  5E6J A;  1YD8 U;  4N9F 4;  1M4V A;  2KQS A;  4RCO A;  1STE A;  4OVU A;  1ZGU B;  1FXT B;  1UF0 A;  3Q8C A;  1FFV A;  2MA9 B;  4GGQ A;  5IKC M;  2WXM A;  4PK1 A;  1P7E A;  2NTT A;  1WM3 A;  3RZF A;  2CR5 A;  2QCZ A;  3RI7 C;  2AYO B;  2G9H D;  2ZZP B;  3I57 A;  2BVC A;  2KDM A;  1VD2 A;  2MJE A;  3FC4 A;  4MH8 A;  4DHJ D;  3OJ3 A;  3W9C B;  4BZA A;  3ZNZ B;  1AWD A;  4ZRQ A;  2DNF A;  3IAM 1;  2FCQ A;  4CO7 A;  2SEB D;  5E6N A;  1QT9 A;  2PVG C;  3O13 A;  1LM8 B;  3L17 A;  2OHF A;  1VZ8 A;  1SE4 A;  4BVU C;  1C77 A;  3U7D A;  4B95 A;  2ONQ A;  1GG3 A;  4AJY B;  2KDE B;  2KAN A;  2LVQ A;  3ZVV A;  3NS1 A;  2DZK A;  2WYQ A;  3U7Z A;  4GXB A;  3P4S B;  4BKS D;  2IY1 B;  1MI0 A;  3ZXV A;  3BK2 A;  3L54 A;  3V6C B;  4XYC A;  2BW2 A;  1I42 A;  4HRO A;  1WMH B;  2G4D B;  4HDQ A;  4KKI A;  4IM3 A;  2N1V A;  1WIA A;  4BOS C;  1IPG A;  4HLE A;  4NY0 A;  1GC7 A;  2AL3 A;  3U30 A;  1I4Q A;  3Q2A C;  2NR2 A;  4FAD A;  1RYJ A;  1QKZ A;  2GBK A;  2KC2 A;  5BMG A;  3GB1 A;  1NDD A;  3ZRC A;  3H7S A;  4DBG A;  1LFD A;  2ZNV B;  1PQS A;  1JML A;  1UEL A;  3PZ7 A;  4WJN A;  1UZX B;  1WR1 A;  4TQ0 A;  3EHV A;  2PPH A;  4ASW C;  3BVG A;  1JWB D;  3AE8 B;  1F52 A;  2LI5 A;  1JCK B;  4K7W A;  3KWL A;  2J42 A;  2MH7 A;  2JVC A;  4G0N B;  4NPN A;  1YX5 B;  2L32 A;  5GXG B;  3RNA C;  4QAY A;  1J7B A;  1SE2 A;  2ZVN A;  3AE7 B;  3GS2 A;  4ACF A;  2JWZ A;  3IT4 B;  4F8C B;  2HE7 A;  3RD2 A;  3IAS 1;  3MHZ A;  2V3S A;  3EGR A;  4G11 A;  2EKI A;  1ZXH A;  4IWP A;  3SU8 X;  2LGS A;  2D3B A;  4DK5 A;  1MHH E;  3CIR B;  1VDV A;  2MEK A;  2RR9 A;  3NVZ A;  1C76 A;  4YT0 B;  2LZ6 A;  3M62 B;  2FUG 1;  1TS5 A;  2LXA A;  2XN9 C;  4LK0 M;  3ZYY X;  4FA6 A;  4WIP A;  4A20 A;  1LO5 D;  3NVW A;  4MSM B;  4KSL C;  3C19 A;  2D3C A;  1BUI C;  2M1M A;  1GPX A;  3OJ4 B;  1C4C A;  3AN1 A;  4WJO A;  3N9Y C;  4DWF A;  4GDK B;  3AEB B;  3VR9 B;  4IDI A;  4P1C C;  2LUE A;  4ICV A;  2K5P A;  4LNF A;  2WX0 A;  4JWS C;  1PGX A;  5I4D A;  1UGM A;  2AL6 A;  3I3T B;  5C23 A;  1C78 A;  1K53 A;  1JWS D;  1FCL A;  1J0G A;  1DOX A;  1FXI A;  1XO3 A;  5AUK A;  3JVZ X;  3DVG Y;  4IOI E;  1OEY A;  4FJV B;  4IW0 A;  3ZO5 B;  1FFU A;  2CHZ A;  4D2K A;  3CF6 E;  5MPO A;  3RNC C;  1XLO A;  1A5R A;  2IJ0 A;  2DEN B;  2Q5W D;  5BMH A;  1D4B A;  3HUI A;  5CHV C;  1J8C A;  2BS3 B;  1F9J A;  3HK0 A;  2C9W B;  4ICU A;  1L4D B;  1VZ6 A;  3WCQ A;  1XF5 L;  2EKE C;  2WS3 B;  4RF0 A;  1DGJ A;  2K1F A;  1JWU D;  1D3Z A;  3Q3F A;  3TJP A;  2BB6 A;  3BYT B;  1WF9 A;  2WLB A;  1G6J A;  1QIL A;  2JY6 A;  3KVF B;  3ZQ4 A;  3SEB A;  3TBL D;  3A4R A;  1IBX B;  1NEN B;  2ZPN A;  3W1S C;  3SD5 A;  1ZUD 2;  1AN8 A;  1R4M B;  1V8C A;  1ET9 A;  3AV8 A;  4XE0 A;  1T0Y A;  3OLM D;  2W3R A;  2NPT A;  4DHJ B;  1MFW A;  3L08 A;  1ZKH A;  3ETR A;  5EE0 A;  3AE3 B;  3TCA A;  2FCM A;  3N30 A;  2Z8L A;  4BBN C;  3TEY A;  1QQR A;  4KIK B;  2CHW A;  4AWJ A;  2BTE A;  5D2M B;  1L4Z B;  1JWA D;  5IAA C;  3EEC A;  5AZG A;  3ZNG C;  4YXD B;  3APF A;  2M8S A;  4IM0 A;  5JZE B;  4WQM A;  2EMS A;  3FIL B;  1EU4 A;  2WXJ A;  4KGT A;  2J0J A;  2NTS A;  1VJK A;  4AS1 A;  1A70 A;  3UQB A;  1AAR A;  2G1E A;  1TZO A;  5LNK 1;  1E8Z A;  2VH1 A;  4OZA A;  2PE9 A;  1ZP0 B;  3NVY A;  1VRA B;  3AH7 A;  4E3C A;  1HQR D;  3RUL A;  2GBM A;  3VVW B;  4DXA B;  4BFR A;  2L05 A;  4IKG A;  4MGK E;  4NAW A;  3DQV A;  5H8Y E;  1Q10 A;  3ZJT A;  2YEP B;  1KLU D;  4PS3 A;  3FAH A;  3KLS X;  3P1M A;  2BT6 A;  1JRU A;  2KX0 A;  1GAQ B;  2LAS A;  4IM2 A;  1KLV A;  2KT7 A;  3A9J B;  2LRW A;  3QAQ A;  3PRP B;  2Z59 B;  3K9O B;  3PO0 A;  5HG2 A;  1WJ4 A;  3T9L A;  1NEK B;  1UUP A;  3I9V 1;  1P98 A;  4EZJ A;  1V9J A;  3LDZ E;  2ZNV C;  5IP4 D;  4KVG B;  3V05 A;  2INC C;  1WGK A;  5HFY A;  4YTP B;  1SBB B;  4KX6 B;  3AXC A;  2K8C A;  2N9L A;  2MRP A;  5BYR A;  2Y5P A;  2QEJ C;  1WE7 A;  3CST A;  1AYF A;  4YTN B;  4LDT D;  1Q1O A;  3TMP B;  4AUQ C;  1TKG A;  2LXC A;  1PDX A;  2N7E A;  2V4L A;  1RAX A;  4M8M A;  3Q3M C;  2IBI B;  3ZJU A;  3KUD B;  3NHE B;  1IYF A;  3K9P B;  4DDI D;  1EF5 A;  2QIE B;  4TSS A;  3U52 E;  1D6E C;  3HIZ A;  5DPR A;  2KC1 A;  3APD A;  3GE3 C;  2C7M B;  2PIA A;  4HPL B;  5G5H A;  5KHO A;  1CQV A;  3IXS A;  5G2N A;  1NI3 A;  1AW7 A;  2LFI A;  5CTR C;  5FKA C;  1OGW A;  4PS8 A;  3QAR A;  2Y3A A;  1FNV A;  3WAP A;  2LUM A;  4LNI A;  1QOF A;  2KVZ A;  3PRM B;  1QOA A;  2V3P A;  2LHD A;  4TKN A;  3AM9 A;  1S1Q B;  4LLG M;  2UU7 A;  3E9S A;  1T0S C;  1WJU A;  3ZNI D;  3QJZ A;  4P7I A;  4REZ A;  2WWZ A;  3TEZ A;  1J7A A;  2LRU A;  1K51 A;  1Q0W B;  2BS4 B;  2C5L C;  3U8Z A;  3ZDT A;  1QF6 A;  1F77 A;  3TEX A;  3B2F A;  1M94 A;  1FD6 A;  4URK A;  1JW9 D;  1FEH A;  2IYD B;  2MHJ A;  4NJC A;  2RD0 A;  3O65 B;  2XNA C;  1T0Q C;  4MSQ B;  4W9I A;  1MVK A;  4DHZ E;  1N62 A;  2J4X A;  5CHF A;  4EE2 A;  3UF8 A;  3MJ5 A;  1EM7 A;  2JZ3 B;  5EDS A;  2CS4 A;  3VTW A;  4EZK A;  3L4P A;  2BGF A;  4FJZ A;  2INP E;  1WRI A;  2ZVO A;  1TY2 A;  2D3G A;  3S2A A;  2VH2 A;  1D5X C;  3T8M A;  2D07 B;  4M00 A;  4NQL B;  4C4V A;  2GBN A;  1YNT E;  4A8X C;  2NVU I;  2WXH A;  4HJG E;  5L83 A;  4IC7 B;  3UIP B;  2RDB C;  1D5Z C;  1OEY J;  2JWU A;  1TKE A;  2ZW1 A;  4M8N A;  4LCD E;  1D5M C;  5C1Z A;  1C1Y B;  4L1B A;  3P63 A;  5AEK B;  3ENE A;  1V2Y A;  1I4R A;  4F7Z A;  3RT3 B;  4HPP A;  2WXI A;  3NY5 A;  3ONS A;  4TV3 A;  2L3Z A;  3AU4 A;  3IBE A;  1EU3 A;  1K50 A;  1ESF A;  1WGY A;  3RMK C;  2REX A;  1BML C;  2K25 A;  3N20 C;  2WXL A;  5JHA A;  2DWQ A;  4HCN B;  2YLM A;  1X1M A;  2DX5 B;  5L95 C; 
#chains in the Genus database with same CATH homology
 3CSF A;  3A9K A;  4DK5 A;  1S3S G;  4GMV A;  5D7G A;  1E8W A;  2RR9 A;  3QCA A;  3PZD A;  1HE8 A;  1E5W A;  2D11 A;  2HD5 B;  2LZ6 A;  3M62 B;  1SGH A;  3LJ3 A;  2G3Q B;  2I1K A;  1UD7 A;  1WI0 A;  2LXA A;  2L0T A;  2BYE A;  4BOZ B;  2R2Q A;  3KYD D;  5CHW A;  1P9D U;  5J17 A;  1LQB A;  3DCG A;  4FA6 A;  4W9J A;  3AUL A;  3L16 A;  3B1L X;  3VQI A;  4A20 A;  1SIF A;  3KW5 B;  4ANX A;  4TUU A;  1WJN A;  3PPA A;  2LWP A;  3VHT C;  4HPM B;  4KSL C;  4MSM B;  3VUX A;  2M1M A;  3OJ4 B;  4W9E A;  2MBB B;  4WJO A;  3ZKJ C;  4DWF A;  4HK2 A;  1CMX B;  4GDK B;  1WXV A;  5IA7 A;  2MQJ A;  2N4F A;  2Y5B B;  3IG3 A;  2BYF A;  4WWP A;  2IZV B;  2LUE A;  4ICV A;  4AOF A;  3VAW A;  3VH4 B;  4PYZ A;  4MJS B;  2WX0 A;  1V49 A;  3HHM A;  3JSV A;  5HKH A;  1KOT A;  4W9C A;  1UGM A;  2AL6 A;  3I3T B;  4AP4 C;  4TQ1 A;  5C23 A;  3V60 A;  3IHP C;  3C0R B;  4EOY A;  2BWE S;  2FCN A;  2FAZ A;  2EMT A;  1MG8 A;  5LXI B;  1J0G A;  2C7H A;  2KZR A;  2D2Q A;  2IO3 B;  2NPT B;  2KJR A;  2KQ7 A;  2HJ8 A;  2BF8 B;  2MP2 A;  3JVZ X;  1Y8R C;  1U4A A;  3DVG Y;  2OJR A;  4IUM B;  4BKG A;  3H7P B;  4HVB A;  1OEY A;  1V5T A;  3DBS A;  4FJV B;  4IW0 A;  4LDT B;  4W9L A;  5FR6 A;  3ZO5 B;  1OQY A;  2KFJ A;  4FJY A;  4G50 A;  2CHZ A;  2DZM A;  2KLG A;  2MSE D;  2KVR A;  5CX3 A;  4M0W B;  2K6D B;  3B0A A;  3CF6 E;  3DBL I;  4RM8 A;  1A5R A;  2DEN B;  1WXM A;  3DVN U;  5CHV C;  5G55 A;  3ZW3 A;  5JH5 C;  1J8C A;  1F9J A;  3HK0 A;  2FCS A;  2C9W B;  2GBJ A;  3PSE B;  4ICU A;  1I35 A;  1IP9 A;  2N1W A;  5BO4 B;  4JQW C;  1WJ6 A;  2EKE C;  2KMC A;  3WAN A;  4ANU A;  2DYM A;  3VTU A;  1E8X A;  2OOB B;  3B08 A;  3RUI B;  3OAW A;  3VTV A;  4BKS A;  4B9K A;  4FHJ A;  4MEL A;  2K1F A;  4K7S A;  3R66 C;  4MGZ E;  2XEW A;  1D3Z A;  1WH3 A;  2LVP A;  3Q3F A;  3TJP A;  2C7N B;  3SHQ A;  4II3 B;  1WZ3 A;  1RFA A;  3ALB A;  1L2N A;  3ZTC A;  1Z5S B;  4E71 A;  1WF9 A;  4HWI B;  1G6J A;  2JY6 A;  3DDC B;  2KN5 A;  3KVF B;  4MEM A;  4G3X B;  2NBV B;  1RRB A;  4KV2 A;  3TBL D;  3Q3J A;  2KDB A;  3QC8 B;  4HDO A;  2FUH B;  3A4R A;  2O6V D;  2XK5 B;  3PV1 A;  4RMA A;  3HM6 X;  3MJW A;  3W1Y A;  1WFY A;  5DPW A;  2KD0 A;  2ZPN A;  4MJS A;  3W1S C;  2WX1 A;  4GIV A;  4WWO A;  3MHS D;  3PT2 B;  3SD5 A;  4A3O A;  1WX9 A;  2JRH A;  3SDL C;  4CHK A;  1V81 A;  1UBQ A;  1R4N I;  3ZRF A;  1WE6 A;  2KLC A;  3N32 A;  1T0Y A;  3OLM D;  2MBQ A;  4NAW B;  1J19 A;  2NPT A;  3NOB A;  3ZDM C;  3PGE A;  4EZL A;  4DHJ B;  2KJH B;  3H7P A;  3GOE A;  3L08 A;  4CYE A;  1E8Y A;  3NS8 A;  1V86 A;  4JGH B;  3V62 A;  4LJO B;  1YQB A;  1ZKH A;  2FID A;  3UIN B;  3APC A;  2GMI C;  3DPD A;  4FN2 A;  1WGD A;  2JXX A;  3CMM B;  3TCA A;  2FCM A;  2PEA A;  3N30 A;  4BBN C;  4FHK A;  3A4S C;  4KIK B;  2ASQ A;  2CHW A;  2MBH A;  2MW5 A;  4AWJ A;  4FBJ B;  5D2M B;  3M3J A;  3WIM A;  5J2R A;  5IAA C;  3EEC A;  4I6N B;  1UH6 A;  4W9K A;  1RLF A;  5AZG A;  3ECI A;  3QIJ A;  3ZNG C;  2GOW A;  2UWQ A;  3APF A;  2M8S A;  4IM0 A;  3QX1 A;  5JZE B;  1WGR A;  2KHW B;  2EMS A;  2M17 A;  3EC8 A;  1GUA B;  3VUW A;  2RSU A;  2JPH A;  4IG7 B;  1QZE A;  2O2V B;  3GZN I;  1WRD B;  3PLU A;  4IWO A;  2JZZ A;  3NZU A;  4W9H A;  2J0J A;  2BWF A;  1WX7 A;  3DVG X;  3JYU A;  3UQB A;  1AAR A;  1SE9 A;  2K8H A;  5LXH A;  2V1Y A;  1ISN A;  1KJT A;  2B3A A;  1E8Z A;  3RCZ A;  1UBI A;  2PE9 A;  4EKU A;  3H9D A;  2KXJ A;  3D32 A;  4II2 B;  5DPT A;  1E7V A;  2W9N A;  2JRI B;  2XK5 A;  1E7U A;  4E3C A;  1NI2 A;  1XQQ A;  3RUL A;  2GBM A;  2KWV B;  1WXA A;  3VVW B;  4DXA B;  2DZI A;  2L05 A;  4BFR A;  2IO2 B;  1GC6 A;  2KWU B;  2YVC A;  4MGY E;  4XZ4 A;  4MGK E;  2MWS B;  4ZDV A;  1KM7 A;  4NAW A;  3DQV A;  4GU2 A;  5JHB A;  4KZC A;  3UGB B;  3V61 A;  4PS3 A;  1WZ0 A;  1L7Y A;  4LJP B;  3ML8 A;  4KZ0 A;  1P3Q U;  4PYU A;  4W9G A;  4WQO B;  3NZS A;  3VUY A;  3ZIM A;  1JRU A;  2KX0 A;  2LAS A;  2ZCB A;  4IM2 A;  4GDL B;  2KDF B;  1NBF C;  2G4S A;  4KIK A;  3R7R A;  2J0K A;  1KLV A;  3A9J B;  2LRW A;  3N3K B;  2CKH B;  4XX5 A;  3QAQ A;  3PRP B;  2FIF A;  2Z59 B;  3DBR I;  4ANV A;  2RGF A;  2DAF A;  3K9O B;  3VXW A;  1WJ4 A;  4BBN F;  3T9L A;  2C60 A;  1P98 A;  4J6I A;  4EZJ A;  2IY0 B;  1ZW7 A;  2BYV E;  5DCN A;  2MBO A;  1V9J A;  2O2V A;  2KOX A;  3ZNH B;  3LDZ E;  2KKC A;  1EUV B;  2ZNV C;  4HJK A;  4XC2 A;  4K1R B;  2BPS A;  2KX3 A;  3PLV A;  2PE6 B;  4KVG B;  3WA0 A;  2DYB A;  3DVN V;  2XBB C;  3PRE A;  4GSW A;  3PVL A;  2KTF A;  2A4Z A;  1GNU A;  2QHO A;  4I6L B;  2K8B A;  1VCB A;  3AXC A;  2K8C A;  1WM2 A;  4GN1 A;  2MRP A;  2L8J A;  2DZJ A;  3VH3 B;  3V6E B;  4JLC A;  1WE7 A;  3CST A;  3RZW C;  4E74 A;  2NBW B;  3JW0 X;  2L0F A;  4K7U A;  3R3M A;  4LDT D;  4DDG D;  4IWQ A;  1WYW B;  1TBE A;  1Q1O A;  5D94 A;  2KTR B;  4I6P A;  3M95 A;  4YL8 A;  5AZF A;  3TMP B;  2KO3 A;  2HTH A;  4X57 B;  1YIW A;  2KFK B;  4AUQ C;  3L13 A;  2LXC A;  3BIN A;  2M4N A;  1WY8 A;  3PS6 A;  2J0M A;  2JF5 A;  2N7D A;  2N7E A;  1R4M I;  2V4L A;  2Z0D B;  1RAX A;  2RPQ A;  3DBH I;  5D6J B;  2LGY A;  1EO6 A;  2G45 B;  3KH0 A;  4HXD A;  4M8M A;  4MGI E;  2IBI B;  1LXD A;  3KUD B;  3NHE B;  4W9F A;  3PTF C;  2NS5 A;  1IYF A;  3K9P B;  2MLB A;  3QA8 A;  3WAO A;  1Q5W B;  4GB9 A;  5TR5 A;  4DDI D;  1EF5 A;  5KHQ A;  1GJZ A;  5J18 A;  4GDL A;  4ZRJ A;  2M0X A;  4KDI C;  1H8C A;  3A1Q B;  3HIZ A;  2FNJ B;  2KK8 A;  3A9J A;  5DPR A;  3AI5 A;  1YD8 U;  2KC1 A;  3APD A;  4N9F 4;  2C7M B;  4MM3 A;  4HPL B;  1P0R A;  2VRR B;  5KHO A;  2KQS A;  4ZRI A;  5G2N A;  3WAM A;  2N9P C;  4OVU A;  1ZGU B;  1WGG A;  3A33 B;  4ZYN A;  1FXT B;  1WMH A;  2NBU A;  5CTR C;  2MA9 B;  4GGQ A;  1OGW A;  4PS8 A;  3QAR A;  4RM9 A;  4OVV A;  4NNJ B;  2GBR A;  2ZJD A;  3WAP A;  1WM3 A;  3RZF A;  2CR5 A;  2AWT A;  2N9X A;  2LGD A;  4MH0 E;  3PRM B;  1XD3 B;  3PRZ A;  2AYO B;  4ANW A;  4KDL B;  4PS7 A;  2ZZP B;  1VD2 A;  4TKN A;  1TGZ B;  4DHJ D;  1S1Q B;  2DAJ A;  3OJ3 A;  3L10 B;  4HCP B;  1TTN A;  2L00 B;  1K8R B;  4NJ7 A;  4MDK E;  1WJU A;  3ZNI D;  3KUC B;  3ZNZ B;  3QJZ A;  4NJ6 A;  4P7I A;  2KTR A;  4WJP A;  1BT0 A;  2FCQ A;  3ZTD A;  4CO7 A;  4DHZ B;  3PHW B;  4JIO U;  5E6N A;  2KFK A;  4ZRK A;  1LM8 B;  2WWZ A;  3QHT A;  1H4R A;  3L17 A;  2MBE A;  3AU5 A;  2LRU A;  1C3T A;  3H6N A;  2A5U A;  3U7D A;  4BVU C;  2KDI A;  4B95 A;  1GG3 A;  1Q0W B;  4AJY B;  2KDE B;  3H1U A;  4FLH A;  2C5L C;  2KAN A;  2LVQ A;  5E6P A;  3ZVV A;  3U8Z A;  3ZDT A;  2CU1 A;  3A1Q A;  2BKR B;  2DZK A;  2WYQ A;  3QWZ B;  4B6W A;  2K6Q A;  1Z2M A;  3W1S A;  4GXB A;  2MCN B;  1M94 A;  3X0W A;  4BKS D;  1OTR B;  4URK A;  2IYD B;  2IY1 B;  4EEW A;  3BY4 B;  1XT9 B;  4WWN A;  1WR6 E;  3R7Q A;  2L76 A;  1YX6 B;  3X23 A;  2RD0 A;  3O65 B;  3L54 A;  3V6C B;  3M63 B;  2O6V B;  1I42 A;  1WMH B;  2G4D B;  1TZ1 A;  4HDQ A;  4MSQ B;  4W9I A;  4F1S A;  1E90 A;  4DHZ E;  4NQK E;  5DPS A;  4IM3 A;  2ZPY A;  5CHF A;  2N1V A;  2WDT B;  1WIA A;  5AZH A;  4AJW A;  4BOS C;  3DOW A;  1IPG A;  2L7R A;  3IFW B;  3TIX A;  3UF8 A;  3WAL A;  1WXS A;  4HLE A;  3PHX B;  2I1J A;  4NY0 A;  2D10 A;  3A9K B;  1GC7 A;  2AL3 A;  2JZ3 B;  5EDS A;  5GMV A;  2CS4 A;  3UQA A;  3VTW A;  3QK0 A;  3U30 A;  1V80 A;  2N9E B;  4EZK A;  4K81 A;  1WX8 A;  2NR2 A;  2ZEQ A;  4WAA A;  2DYO A;  4W9D A;  3EFU A;  2BGF A;  4FAD A;  2GBK A;  3KUZ A;  4FJZ A;  2KC2 A;  2CHX A;  4FUL A;  5LLI A;  3TL5 A;  4EFO A;  4GOC A;  1NDD A;  2ZVO A;  4BKT A;  2D3G A;  3S2A A;  2UYZ B;  3ZRC A;  3T8M A;  2D07 B;  2ZCC A;  3H7S A;  3MTN B;  3KYC D;  3ML9 A;  4A3P A;  4NQL B;  2KJ6 A;  4DBG A;  1LFD A;  1V5O A;  2ZNV B;  1PQS A;  1UEL A;  2GBN A;  1YJ1 A;  2NVU I;  2IO1 B;  2MX2 A;  2KMA A;  4IC7 B;  5L83 A;  3UIP B;  2LGX A;  3QQ8 B;  4WJN A;  1UZX B;  2IO0 B;  1WGH A;  1OEY J;  4GDK A;  2JT4 B;  1WR1 A;  4TQ0 A;  2NCN A;  3EHV A;  2PPH A;  2AEH A;  5E6O A;  4M8N A;  3RYT A;  4LCD E;  2LJ5 A;  3P2B A;  4KSK C;  4ASW C;  1V6E A;  2Z0E B;  5C1Z A;  1C1Y B;  2LD9 A;  3ZLZ A;  2LI5 A;  3HM3 A;  3L0W B;  5AEK B;  3UIO B;  3ENE A;  1V2Y A;  2BKF A;  2KWC A;  4G0N B;  2JVC A;  4K7W A;  3JSV B;  1P1A A;  4NPN A;  3RT3 B;  3VFK A;  3NY5 A;  2DHZ A;  4F7Z A;  1YX5 B;  3ONS A;  4JL9 A;  4TV3 A;  2L3Z A;  3AU4 A;  2ZVN A;  3IBE A;  3VDZ A;  2JWZ A;  1WGY A;  2K39 A;  2O6V A;  2R2O A;  2PJH A;  3IVF A;  4WJQ A;  2REX A;  4F8C B;  2HE7 A;  3RD2 A;  2MP2 B;  3ZUN A;  2J7Q B;  2KNB A;  2K25 A;  2V3S A;  2JUO A;  4EUT A;  5JHA A;  4G11 A;  4HCN B;  2YLM A;  2LVO A;  1X1M A;  4IWP A;  3SU8 X;  2DX5 B;  5L95 C;  1EF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...