3UIPC

Complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
total genus 59
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uipC00
2GRRB 2GRPB 2IY0C 2IO3C 3UIPC 1Z5SC 1KPSB 2GRNB 5D2MC 3UINC 2GROB 3UIOC 2IO2C 2GRQB
chains in the Genus database with same CATH superfamily
1HZ4A 2XPIA 1TJFA 4G8KA 1IYGA 3MJWA 3UM3A 1UN9A 3JXJA 3S2AA 3Q5MA 3G2UA 2BKGA 5AJLA 4G25A 5CEDB 5CBNA 4KBQA 2J9QA 5LOZA 4JL0A 4XZ4A 5CCMA 2KATA 5KBAA 2V8SE 2I1KA 2X6JA 4LRZA 4PUCA 4X8QA 3D9MA 4N39A 2X38A 5AJDA 3V2OA 5E75A 4HRMB 3HRAA 4HOSA 1OWLA 2RKKA 3CKCA 2E2EA 3RO3A 3MGBA 4GAAA 3UXGA 3AG1E 1OT8A 4UQXA 2PQNA 5AN8A 4ME2A 4CDMA 3Q73A 2A5EA 4M7CA 3FTWA 4LEUA 2CG2A 4GZDA 3KEAA 4U0UA 3KEZA 3UKUG 3UI2A 3T5VA 2ONDA 3E37A 4TRQA 4MBGA 3UMVA 2LUHA 2QFCA 1HS6A 3UT4A 4ANUA 1H2TC 3FEXA 1H6KA 1S63A 4JA9A 4HRNA 1UJKA 1IKND 1ZU2A 2IFUA 4GB9A 4CRWA 4FHKA 3RJVA 4C48B 2ILRA 1KLXA 1NI1A 3PREA 2Y0BG 4EECA 3NZSA 3EU9A 3PNLB 3E4BA 1HH8A 2VJ8A 2WXGA 2WQ6A 1TNUA 2J49A 2WXLA 2V0PA 2Y1LE 2OVBA 3JXIA 2HE0A 1FPPA 5EX3A 2EIJE 4ACKA 4N5QA 5D0QD 5HQ8A 3DPYA 4NRHB 3ESKA 3PZ2A 1UJJA 3FTYA 4JC8A 1KZOA 4GZ5A 1NFIE 3D9JA 4JXTA 2J08A 3SO8A 2WVIA 2BKKB 4UUCA 3DBSA 3N71A 2XGMA 3BG1B 4GCNA 1PAQA 2WXNA 2XGSA 3FU0A 1IQUA 1JCRA 3TXMA 2KC7A 4Q69A 1E96B 4IN3B 1U3CA 3MV3B 3CVPA 4G23A 4XKCA 1HG2A 1X5BA 3FTSA 5KJLA 5C1DA 4FP7A 3S7BA 3T9KA 4J0UA 1Y8MA 3FH7A 3EU5A 2GRPB 3AJIA 2PM7A 3MKRA 3JCKC 2X6FA 3C72A 3CK9A 2CHXA 2R2LA 3FP3A 5KWDA 4KYOB 5AARA 3RIBA 4I9CA 3Q49B 3ZHEB 1MYOA 4M3OA 2LSUA 2RG8A 4BERA 3TGOA 4ANWA 3QKYA 2BEDA 4C0EA 3UT7A 4G1TA 2R05A 2KZTA 2VGXA 3L54A 4TXQA 1HF8A 1KT1A 5EN5D 2CG3A 3LYAA 4WUYA 1NZNA 3L22A 1D8DA 1O1TA 2OEVA 4LERA 2YQ8A 1TNZA 2NC9A 2VGXB 3I3NA 1IHGA 2BUGA 4JB8P 4YNDA 4G11A 2XS8A 2IO3C 4UWLA 4DI4A 3B7TA 1N9AA 3DSVA 3DXMG 1EPUA 3CHQA 2ZISA 5HRYA 2WM9A 3C5RA 3CIAA 3X2QE 5CRUA 3TWWA 3J5QB 1FT1A 3UQ3A 1IHBA 2UY1A 5CBOA 3IEGA 1N95A 1SQMA 3CR3A 3FTZA 3QARA 2P9PG 2B6CA 3FUIA 4URKA 2IF4A 4WNGA 4APFA 2J4DA 4GTOA 2XPZA 5BPPA 2WXJA 4NURA 4JA7A 4CEMA 4EBAA 3O48A 4IULA 1A17A 4ATZD 3HDXA 5H7PA 3ZGQA 4YDOA 3MKQA 1ELKA 2WMNA 3T8KA 4BX9A 2X6IA 1H6PA 4U0SA 2C2LA 2NSZA 3BUAA 4GPKA 3L6AA 3MKQB 3ZIMA 2GGFA 3D9LA 4PH4B 5BXOA 1DCQA 4I1AA 3EHRA 1MZCA 4APOA 3CVWA 3DSSA 5ENQD 4N5CA 4GMRA 3QWWA 5CECB 1UN8A 4L2LA 3W9FA 3E30A 4PS3A 4A1SA 4ABNA 4J8SA 5FINA 4GYOA 1BU9A 2PZIA 1MQSA 1S0PA 3FFLA 3CVLA 5EIDA 2Q7FA 3R9MA 5T8IA 2XRYA 4MKTA 2I1JA 1TN6A 5CEAA 3DRAA 4HXIA 2WMOA 4DLQA 4Q96A 3ONKA 4GTVA 2ZGDA 1H2VC 4FJZA 1TYQG 1FVHA 2P9IG 2EIME 4N3CA 4HOUA 4O60A 3U66A 4LSZE 2A5UA 4JW1A 3RRUA 2HR2A 5AENA 2C0LA 3NBNB 4HBDA 3RRMB 1YMPA 3B7BA 2HM8A 3PNTB 2KXPC 4DI3A 4GTTA 1FT2A 3ASNE 5A23A 3CVQA 3PEUB 5CCLA 1SZAA 2PM6A 5CMYA 3D9HA 3PDNA 4EZKA 1D9SA 1L5JA 1RW2A 5LCWJ 3ZFWA 5FQ7A 3G2WA 2FF4A 3D9IA 1EDUA 2WXMA 4BY6A 4O1OA 2P9LG 5ENNA 2FI7A 3C3QA 1N0QA 4TXPA 4PDXA 2H6GA 2V4HC 5EDSA 4QQIA 4RLYA 3FTVA 4DUIA 5IY5E 2F8YA 3ZRHA 4FA6A 3DXKG 5ENTD 3Q15A 3ZU7B 1GW6A 1TNOA 3MZLB 4Z68A 3U3WA 2ZGGA 3PZ3A 2KCVA 3PZ4A 4MLPA 5BXUA 2DVWA 3LEWA 1PC2A 4CT4A 3LY9A 4GMJA 5JJ6A 4NQ0A 4BFRA 3FUFA 2A4ZA 4F1PA 4L9PA 2DYSE 2AW6A 4N3AA 4K5BA 3P1UA 1X81A 4GCOA 3UTMA 4U04A 1FCHA 2BF0X 4ILHB 2YHCA 5FIOA 2F8XK 2FEZA 3ABKE 1RZ4A 3EUVA 2VGYA 4UI9J 5B1AE 3ZPJA 4CCAA 2X3MA 1JWGA 3R7RA 3UT8A 4HFGA 3O4ZA 3GW4A 4HRLA 3EDTB 1OUVA 1BI8B 5ANLA 4I6JA 5CRVA 4UWKA 4XX5A 2LAIA 1NA3A 4TUMA 4B94A 3L16A 2J8SD 3PVLA 3KSLA 3CHMA 2AXVA 3RAUA 1BPOA 3TL5A 3QAQA 4BTAA 4Y6WA 2H6FA 2HO1A 5ARGA 1Z3XA 5KNGA 4D10C 2VSXE 2LXMA 4BSXA 5EYLA 1U3DA 3LPZA 3CV0A 2QYUA 1TN8A 2OEWA 2QC9A 2I9CA 3CK7A 3HHMA 5JJ7A 2NYJA 3C98A 1MHQA 4G2VA 3EHMA 5JHBA 2JEKA 1N52A 5G2NA 4OAVB 3ISMC 1E8YA 3W9GA 3KAEA 2QZAA 1LD8A 1OWMA 2J07A 3ZEFA 2P58C 3QDNA 5BV0A 2LNIA 3Q79A 1JCQA 1OWPA 2VSYA 4UWGA 4F3VA 3FHEA 4BTBA 3BU8A 3UX4A 1OY3D 4XI9A 4JVSA 4HOTA 2X6HA 4AY5A 5BUZA 3ZW3A 5BNWA 2CHWA 2XHEA 3NZUA 1ZB1A 3PE4A 4RQIA 5EKQD 2IQCA 2I6HA 2L6JA 2FBNA 3HXFA 4ZHBA 4GTQA 4EZLA 5EX0A 1ELWA 4E6HA 1IQRA 4E85A 4ANVA 4MRUA 4U8VD 3L17A 3ENEA 5KJNA 1YCSB 4LG6A 2OV8A 5KJMA 3LKUA 2MHKA 3MEKA 4K5AB 4OVVA 1Z6TA 4UWFA 2EQXA 3SNXA 1N94A 5BT1A 4B89A 2UWJG 3Q78A 2MRIA 4YDYA 2GRQB 3OTNA 2V4LA 2CFZA 3QOUA 3SFYA 4CGVA 3QWPA 3FUEA 3NB2A 4KZCA 3ASGA 4G24A 5KJKA 1UOHA 3CKBA 2Y69E 1XNFA 3WXXA 1LD7A 2V5QC 5G04J 3KS2A 3ZXPA 3PEVB 2GRLA 3K9IA 4TV3A 1B89A 3TWUA 2IONA 1HXIA 2X6KA 3I4RB 4I1OB 4K0RA 3ZHEA 2DZOA 5KNHD 2MOWA 1N4PA 1NP7A 3CLJA 3FULA 2R59A 5FZRA 3JYSA 1QYMA 2IU1A 1TJCA 4YDWA 1FVFA 5JHAA 1INZA 2YHEA 2GW1A 3B7UX 3Q7FA 4B8AA 3DPDA 3UPVA 1E7VA 2IY0C 4L2YA 3LJ3A 5FTPA 1H19A 4ILGA 3DWLG 1QQEA 5A6CA 4DX2A 3HYMB 3B13A 2R5SA 1UG3A 2M63A 4JPSA 1WDYA 3U4TA 3E32A 3ASOE 4F7AA 4I6EA 1LF8A 1N4SA 3PZDA 4YVOA 4GZ6A 3ULYA 4KVMA 3L08A 4U95D 3UIPC 2IOSA 2JABA 2H6HA 5JMND 5T4YA 4U8HA 2QYJA 1Z3YA 2WQ7A 4GTRA 3RKVA 3V2XA 4I1MA 5J08A 1K8KG 5AIJA 5CHEE 2CHZA 3SBTB 1DVPA 1LTXA 1SZ9A 1OCZE 1N54A 4LUNU 4I9EA 4LNUD 3RO2A 3VLDA 4KZ0A 5AQBA 5BV1A 1DC2A 4FU3A 3CHSA 3LVRE 5G05J 1QZ2A 1DCEA 3HG0D 5D2MC 3FH8A 3URZA 4R7LA 3VTXA 3V79K 2KBXA 2WXFA 3VLFA 4GA1A 3TAXA 3TWVA 3P2BA 2RFMA 2DWZA 2C0MA 3ZKJA 2VQ2A 1Z5SC 4J7WA 3RRNB 4LNBA 4QFVA 3DEPA 4HORA 5FZSA 3UIOC 1TR4A 2FO1E 4U7EB 3U9WA 3CQCB 4FC8A 3CVVA 1AWCB 4H7YA 4JHJA 4RVBA 4BETA 4EBAG 4U96D 3LJNA 3BG0B 1UW4B 4CZ2D 4F1SA 3CSTA 3NAWA 3AG2E 4LNGA 2P2CP 5B3SE 1MJ0A 1NA0A 2XCCA 1N4QA 3I4GA 3RU0A 3LY8A 3AS4A 5EILA 5LX8A 3FUKA 5ENSD 2Y4TA 4HI9A 2J09A 2XEEA 4WWOA 4A3VA 4DX5D 3HXCA 2WXQA 4Q94A 1JCSA 2YINA 3ASDA 4DX1A 4I2WA 1BLXB 2GRNB 3MYVA 3AU5A 2XCBA 3B7RL 3TWRA 4JEHA 3SFZA 5DBKA 3HXDA 1PY1A 3MA5A 4ILIA 3ASHA 5A7DB 1TNYA 1HX8A 4ANXA 5LCWC 3ZN3A 1SA5A 5FQ8A 1WY6A 4F6RD 2EILE 2KM4A 2IEJA 4B93B 3Q9UC 3EHQA 4AXHA 4Y6CA 4HOQA 4UQYA 4U8YD 3ZYQA 1HE8A 4FADA 2BTDA 2DYRE 3HVEB 3B95A 3CVYA 2LSVA 3FUNA 3CHPA 4JHRA 3SQVA 2WPVA 4J8YA 5FQ4A 3PUJA 3FU3A 3APDA 1HFAA 3ESLA 1V55E 2XZDG 3FUJA 3HIZA 4I43A 4KVOA 3LY7A 3OXGA 2R02A 3B7SA 4XIFA 4GMLA 4DJAA 3AS5A 5ARFA 4UI9C 2WQHA 5AAOA 4GZCA 5B1BE 1ZBPA 1WM5A 3CK8A 2L0IA 3FY4A 4L1BA 4XKBA 4AV7A 3MX3A 4I6GA 3UM1A 5M72A 3R9AB 2Y4UA 4K03A 2RFAA 5J90A 3CHRA 4MS6A 3UINC 3CVXA 4RG6A 2XZTG 3CHOA 5LFAA 2FO7A 3SZ7A 5HI7A 1DNPA 3L9TA 4P29A 1MX2A 5E76A 2WXIA 3U64A 2GRMA 4AP2A 4AEZC 4V3IA 2OVFA 3FDHA 1O5MA 2RD0A 1U2VG 3Q47B 3ZUVB 3ZNGA 5EIBE 3HXBA 1V54E 5KCMA 1O1SA 2ZXWE 3MCXA 4EPZA 1MX6A 4BWRA 4CGWA 3VLEA 1S70B 3T5XA 3PS6A 4G8LA 3L13A 3JUEA 2OCCE 2P9NG 1HU3A 3UM2A 3WG7E 3ML8A 3PRZA 3Q7AA 1H6OA 3JQ0A 1WAO1 4L23A 5ENOD 4DRXE 5AQ7A 1SA4A 3TWXA 1N4RA 2LXLA 5HS0A 4B8CB 2WXPA 4BESA 3ZVVA 3Q9NC 1NL4A 1D8EA 3ML9A 5DIZA 1BI7B 1E90A 3PH0C 3SFXA 3QB2A 3R7QA 4CDRA 4U0ZA 1YYHA 3E33A 3AAAC 3TG5A 4UQZA 3CVUA 1K1BA 3SBSA 3D9KA 3AG3E 4EZJA 3CEQA 4JHKA 3TXNA 4WWNA 3RK6A 5JA4D 3LCAA 4NIKA 3DEOA 1K1AA 5CERB 3I5PA 2OOEA 5D66A 2YNQA 3Q4AB 2P9SG 3FTXA 4GYWA 2AVPA 3ZYKA 3DSUA 3EIJA 3FU6A 3GYZA 3F6QA 1P5QA 3IBEA 4AOFA 5BW8C 2DIWA 3EHNA 4YVQC 2XGOA 4UWHA 3BQOA 2B0OE 2WXKA 3CQGB 2I2OA 4FLBA 3E34A 3IKOB 3D3MA 3IHVA 4OAUC 2R17C 3FEYA 4HB5A 5FQ6A 2PQRA 2VGEA 1KT0A 3AS8A 2XEVA 1KZPA 3SD5A 4BT8A 1HG5A 4HLEA 5LP0A 2LO6A 1XGWA 2XEHA 3KD7A 4HQDA 3J5PA 5G04C 2NXPA 1EYHA 5ENRD 1E8WA 2CFUA 2IJGX 4J8EA 3HXEA 3NOGD 3ASFA 4N3BA 2VSOE 1QNFA 1H2UA 3TJPA 1OCCE 2KCLA 2VYIA 5AYWD 2XS1A 3TG4A 4HVBA 2P9UG 3IHYA 3D9OA 3ABLE 2AXUA 3EIQC 3AG4E 1W3BA 1JWFA 3FUDA 5C2YA 2L6BA 1A5EA 3QK0A 3SF4A 2XRZA 2ETBA 3LVQE 1N0RA 4ATGA 4KMOA 5ANRA 1BD8A 2F0YA 3GZSA 4K5CA 5G55A 2ZIRA 2F37A 1IXVA 4FULA 1OXJA 2GRRB 4GPMA 3C3RA 3OXFA 4A55A 4FLHA 1E8XA 3G2SA 2J4BA 3S7FA 1O1RA 2DCPA 3DSTA 5JJTA 1QBQA 3ABME 3EJNA 4HLLA 4BT9A 4AJWA 4JEUA 3G2TA 3LXUX 4AIFA 2WXRA 4HNAD 4LCTA 4NACA 2WB2A 4A1GA 4DX7D 4BEPA 3UUXA 4WAFA 4GYYA 1N11A 5D0OD 3ZXSA 1WG0A 4CT0A 2QY7A 2GROB 4L7TA 2H6IA 3CSFA 2KZTB 4WNDA 3ZYMA 4H7XA 4XI0A 1E8ZA 3SHFA 3GZ1A 1KPSB 1MX4A 1OWOA 2L9BA 4AY6A 4I17A 3ULQA 3FTUA 3VTYA 2AWIA 2PL2A 4C9BB 4G26A 2DBAA 2AJAA 4N2SA 4BSZB 3FH5A 4GU5A 3APCA 4EHMA 4DK5A 3ONLA 4C0MA 5G05C 3NQPA 4GA2A 3T8MA 1JUQA 3CGHA 3ZYLA 1HO8A 1TNBA 3FUHA 1YA0A 2KCKA 1OWNA 5ITZF 3NF1A 4U07A 3FWVA 5FWQA 4GTPA 4OVUA 2JLBA 3TWTA 3V31A 4GA0A 4U63A 2LAHA 1Y6IA 2EIKE 4FHJA 2UY1B 3AU4A 5AQAA 3NOCD 4GTSA 4ACLA 4GTMA 3D9PA 4WWPA 5EYPF 1OCRE 4DLOA 4IRUA 3Q75A 3FUMA 2L0TB 4PS8A 2FULA 3APFA 4BX8A 3PE3A 2ZU6B 4WNEA 4HS2A 4XEIG 3QWVA 2IO2C 4J8DA 3QJZA 4DX6D 4N2QA 1S64A 3G2VA 3TWQA 4O1PA 2XENA 1H0AA 3SGHA 1G3NB 3D9NA 4IYPA 4I2ZA 4A63B 4EQFA 4XE0A 1K3ZD 3PUKA 3RSEG 4B0ZA 5T3RA 4GZ3A 5HKPA 3FU5A 1JPLA 2WXOA 5FZQA 4ZFHA 4RG9A 2V5FA 3JUIA 3DSWA 1AP7A 2ETCA 1Q2ZA 2VTBA 2XPYA 4JZYA 4YDEA 4WNFA 1TN7A 2PNNA 3IXEA 2XQ0A 3QNKA 1ELRA 4A3TA 3JQ1A 3LS8A 5AQ9A 3QC1A 4J6IA 4TUUA 2VTBB 4JD2G 3ULEG 3SI5A 1SW6A 2EINE 3MV2B 3HVEA 3S7JA 4KXKB 3L82A 2Y3AA 1OCOE 4F53A 3KSQA 2P9KG 5FJYA 3OXLA 3PZ1A 2HYZA 4PS7A 3BEEA 1EF1C 2WXHA 4TXRA 1VDYA 1SVXA 4KT6B 1TEZA 3V30A 4J8FA 2ETAA 3IV0A 3SY2A 4FJYA 4OYSA 4CDNA 1E7UA 4RSYA 4AM9A 3GZ2A 3TWSA 4DPRA 4AVXA 3OAWA 2E0IA 5ENPD 2MYOA 4CYMD 3UKRG 3CVNA 5FT9A 4UI9K 3DSXA 4HI8A 4O6FA 4W9RA 3C3OA 2IOLA 2R03A 5CMWA 3S7DA 2AXZA 2DZNA 3LDZA 2VSNA 3UM0A
chains in the Genus database with same CATH topology
2GRRB 2GRPB 2IY0C 2IO3C 3UIPC 1Z5SC 1KPSB 2GRNB 5D2MC 3UINC 2GROB 3UIOC 2IO2C 2GRQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRR B;  2GRP B;  2IY0 C;  2IO3 C;  3UIP C;  1Z5S C;  1KPS B;  2GRN B;  5D2M C;  3UIN C;  2GRO B;  3UIO C;  2IO2 C;  2GRQ B; 
#chains in the Genus database with same CATH topology
 1HZ4 A;  2XPI A;  1TJF A;  4G8K A;  1IYG A;  3MJW A;  3UM3 A;  1UN9 A;  3JXJ A;  3S2A A;  3Q5M A;  3G2U A;  2BKG A;  5AJL A;  4G25 A;  5CED B;  5CBN A;  4KBQ A;  2J9Q A;  5LOZ A;  4JL0 A;  4XZ4 A;  5CCM A;  2KAT A;  5KBA A;  2V8S E;  2I1K A;  2X6J A;  4LRZ A;  4PUC A;  4X8Q A;  3D9M A;  4N39 A;  2X38 A;  5AJD A;  3V2O A;  5E75 A;  4HRM B;  3HRA A;  4HOS A;  1OWL A;  2RKK A;  3CKC A;  2E2E A;  3RO3 A;  3MGB A;  4GAA A;  3UXG A;  3AG1 E;  1OT8 A;  4UQX A;  2PQN A;  5AN8 A;  4ME2 A;  4CDM A;  3Q73 A;  2A5E A;  4M7C A;  3FTW A;  4LEU A;  2CG2 A;  4GZD A;  3KEA A;  4U0U A;  3KEZ A;  3UKU G;  3UI2 A;  3T5V A;  2OND A;  3E37 A;  4TRQ A;  4MBG A;  3UMV A;  2LUH A;  2QFC A;  1HS6 A;  3UT4 A;  4ANU A;  1H2T C;  3FEX A;  1H6K A;  1S63 A;  4JA9 A;  4HRN A;  1UJK A;  1IKN D;  1ZU2 A;  2IFU A;  4GB9 A;  4CRW A;  4FHK A;  3RJV A;  4C48 B;  2ILR A;  1KLX A;  1NI1 A;  3PRE A;  2Y0B G;  4EEC A;  3NZS A;  3EU9 A;  3PNL B;  3E4B A;  1HH8 A;  2VJ8 A;  2WXG A;  2WQ6 A;  1TNU A;  2J49 A;  2WXL A;  2V0P A;  2Y1L E;  2OVB A;  3JXI A;  2HE0 A;  1FPP A;  5EX3 A;  2EIJ E;  4ACK A;  4N5Q A;  5D0Q D;  5HQ8 A;  3DPY A;  4NRH B;  3ESK A;  3PZ2 A;  1UJJ A;  3FTY A;  4JC8 A;  1KZO A;  4GZ5 A;  1NFI E;  3D9J A;  4JXT A;  2J08 A;  3SO8 A;  2WVI A;  2BKK B;  4UUC A;  3DBS A;  3N71 A;  2XGM A;  3BG1 B;  4GCN A;  1PAQ A;  2WXN A;  2XGS A;  3FU0 A;  1IQU A;  1JCR A;  3TXM A;  2KC7 A;  4Q69 A;  1E96 B;  4IN3 B;  1U3C A;  3MV3 B;  3CVP A;  4G23 A;  4XKC A;  1HG2 A;  1X5B A;  3FTS A;  5KJL A;  5C1D A;  4FP7 A;  3S7B A;  3T9K A;  4J0U A;  1Y8M A;  3FH7 A;  3EU5 A;  2GRP B;  3AJI A;  2PM7 A;  3MKR A;  3JCK C;  2X6F A;  3C72 A;  3CK9 A;  2CHX A;  2R2L A;  3FP3 A;  5KWD A;  4KYO B;  5AAR A;  3RIB A;  4I9C A;  3Q49 B;  3ZHE B;  1MYO A;  4M3O A;  2LSU A;  2RG8 A;  4BER A;  3TGO A;  4ANW A;  3QKY A;  2BED A;  4C0E A;  3UT7 A;  4G1T A;  2R05 A;  2KZT A;  2VGX A;  3L54 A;  4TXQ A;  1HF8 A;  1KT1 A;  5EN5 D;  2CG3 A;  3LYA A;  4WUY A;  1NZN A;  3L22 A;  1D8D A;  1O1T A;  2OEV A;  4LER A;  2YQ8 A;  1TNZ A;  2NC9 A;  2VGX B;  3I3N A;  1IHG A;  2BUG A;  4JB8 P;  4YND A;  4G11 A;  2XS8 A;  2IO3 C;  4UWL A;  4DI4 A;  3B7T A;  1N9A A;  3DSV A;  3DXM G;  1EPU A;  3CHQ A;  2ZIS A;  5HRY A;  2WM9 A;  3C5R A;  3CIA A;  3X2Q E;  5CRU A;  3TWW A;  3J5Q B;  1FT1 A;  3UQ3 A;  1IHB A;  2UY1 A;  5CBO A;  3IEG A;  1N95 A;  1SQM A;  3CR3 A;  3FTZ A;  3QAR A;  2P9P G;  2B6C A;  3FUI A;  4URK A;  2IF4 A;  4WNG A;  4APF A;  2J4D A;  4GTO A;  2XPZ A;  5BPP A;  2WXJ A;  4NUR A;  4JA7 A;  4CEM A;  4EBA A;  3O48 A;  4IUL A;  1A17 A;  4ATZ D;  3HDX A;  5H7P A;  3ZGQ A;  4YDO A;  3MKQ A;  1ELK A;  2WMN A;  3T8K A;  4BX9 A;  2X6I A;  1H6P A;  4U0S A;  2C2L A;  2NSZ A;  3BUA A;  4GPK A;  3L6A A;  3MKQ B;  3ZIM A;  2GGF A;  3D9L A;  4PH4 B;  5BXO A;  1DCQ A;  4I1A A;  3EHR A;  1MZC A;  4APO A;  3CVW A;  3DSS A;  5ENQ D;  4N5C A;  4GMR A;  3QWW A;  5CEC B;  1UN8 A;  4L2L A;  3W9F A;  3E30 A;  4PS3 A;  4A1S A;  4ABN A;  4J8S A;  5FIN A;  4GYO A;  1BU9 A;  2PZI A;  1MQS A;  1S0P A;  3FFL A;  3CVL A;  5EID A;  2Q7F A;  3R9M A;  5T8I A;  2XRY A;  4MKT A;  2I1J A;  1TN6 A;  5CEA A;  3DRA A;  4HXI A;  2WMO A;  4DLQ A;  4Q96 A;  3ONK A;  4GTV A;  2ZGD A;  1H2V C;  4FJZ A;  1TYQ G;  1FVH A;  2P9I G;  2EIM E;  4N3C A;  4HOU A;  4O60 A;  3U66 A;  4LSZ E;  2A5U A;  4JW1 A;  3RRU A;  2HR2 A;  5AEN A;  2C0L A;  3NBN B;  4HBD A;  3RRM B;  1YMP A;  3B7B A;  2HM8 A;  3PNT B;  2KXP C;  4DI3 A;  4GTT A;  1FT2 A;  3ASN E;  5A23 A;  3CVQ A;  3PEU B;  5CCL A;  1SZA A;  2PM6 A;  5CMY A;  3D9H A;  3PDN A;  4EZK A;  1D9S A;  1L5J A;  1RW2 A;  5LCW J;  3ZFW A;  5FQ7 A;  3G2W A;  2FF4 A;  3D9I A;  1EDU A;  2WXM A;  4BY6 A;  4O1O A;  2P9L G;  5ENN A;  2FI7 A;  3C3Q A;  1N0Q A;  4TXP A;  4PDX A;  2H6G A;  2V4H C;  5EDS A;  4QQI A;  4RLY A;  3FTV A;  4DUI A;  5IY5 E;  2F8Y A;  3ZRH A;  4FA6 A;  3DXK G;  5ENT D;  3Q15 A;  3ZU7 B;  1GW6 A;  1TNO A;  3MZL B;  4Z68 A;  3U3W A;  2ZGG A;  3PZ3 A;  2KCV A;  3PZ4 A;  4MLP A;  5BXU A;  2DVW A;  3LEW A;  1PC2 A;  4CT4 A;  3LY9 A;  4GMJ A;  5JJ6 A;  4NQ0 A;  4BFR A;  3FUF A;  2A4Z A;  4F1P A;  4L9P A;  2DYS E;  2AW6 A;  4N3A A;  4K5B A;  3P1U A;  1X81 A;  4GCO A;  3UTM A;  4U04 A;  1FCH A;  2BF0 X;  4ILH B;  2YHC A;  5FIO A;  2F8X K;  2FEZ A;  3ABK E;  1RZ4 A;  3EUV A;  2VGY A;  4UI9 J;  5B1A E;  3ZPJ A;  4CCA A;  2X3M A;  1JWG A;  3R7R A;  3UT8 A;  4HFG A;  3O4Z A;  3GW4 A;  4HRL A;  3EDT B;  1OUV A;  1BI8 B;  5ANL A;  4I6J A;  5CRV A;  4UWK A;  4XX5 A;  2LAI A;  1NA3 A;  4TUM A;  4B94 A;  3L16 A;  2J8S D;  3PVL A;  3KSL A;  3CHM A;  2AXV A;  3RAU A;  1BPO A;  3TL5 A;  3QAQ A;  4BTA A;  4Y6W A;  2H6F A;  2HO1 A;  5ARG A;  1Z3X A;  5KNG A;  4D10 C;  2VSX E;  2LXM A;  4BSX A;  5EYL A;  1U3D A;  3LPZ A;  3CV0 A;  2QYU A;  1TN8 A;  2OEW A;  2QC9 A;  2I9C A;  3CK7 A;  3HHM A;  5JJ7 A;  2NYJ A;  3C98 A;  1MHQ A;  4G2V A;  3EHM A;  5JHB A;  2JEK A;  1N52 A;  5G2N A;  4OAV B;  3ISM C;  1E8Y A;  3W9G A;  3KAE A;  2QZA A;  1LD8 A;  1OWM A;  2J07 A;  3ZEF A;  2P58 C;  3QDN A;  5BV0 A;  2LNI A;  3Q79 A;  1JCQ A;  1OWP A;  2VSY A;  4UWG A;  4F3V A;  3FHE A;  4BTB A;  3BU8 A;  3UX4 A;  1OY3 D;  4XI9 A;  4JVS A;  4HOT A;  2X6H A;  4AY5 A;  5BUZ A;  3ZW3 A;  5BNW A;  2CHW A;  2XHE A;  3NZU A;  1ZB1 A;  3PE4 A;  4RQI A;  5EKQ D;  2IQC A;  2I6H A;  2L6J A;  2FBN A;  3HXF A;  4ZHB A;  4GTQ A;  4EZL A;  5EX0 A;  1ELW A;  4E6H A;  1IQR A;  4E85 A;  4ANV A;  4MRU A;  4U8V D;  3L17 A;  3ENE A;  5KJN A;  1YCS B;  4LG6 A;  2OV8 A;  5KJM A;  3LKU A;  2MHK A;  3MEK A;  4K5A B;  4OVV A;  1Z6T A;  4UWF A;  2EQX A;  3SNX A;  1N94 A;  5BT1 A;  4B89 A;  2UWJ G;  3Q78 A;  2MRI A;  4YDY A;  2GRQ B;  3OTN A;  2V4L A;  2CFZ A;  3QOU A;  3SFY A;  4CGV A;  3QWP A;  3FUE A;  3NB2 A;  4KZC A;  3ASG A;  4G24 A;  5KJK A;  1UOH A;  3CKB A;  2Y69 E;  1XNF A;  3WXX A;  1LD7 A;  2V5Q C;  5G04 J;  3KS2 A;  3ZXP A;  3PEV B;  2GRL A;  3K9I A;  4TV3 A;  1B89 A;  3TWU A;  2ION A;  1HXI A;  2X6K A;  3I4R B;  4I1O B;  4K0R A;  3ZHE A;  2DZO A;  5KNH D;  2MOW A;  1N4P A;  1NP7 A;  3CLJ A;  3FUL A;  2R59 A;  5FZR A;  3JYS A;  1QYM A;  2IU1 A;  1TJC A;  4YDW A;  1FVF A;  5JHA A;  1INZ A;  2YHE A;  2GW1 A;  3B7U X;  3Q7F A;  4B8A A;  3DPD A;  3UPV A;  1E7V A;  2IY0 C;  4L2Y A;  3LJ3 A;  5FTP A;  1H19 A;  4ILG A;  3DWL G;  1QQE A;  5A6C A;  4DX2 A;  3HYM B;  3B13 A;  2R5S A;  1UG3 A;  2M63 A;  4JPS A;  1WDY A;  3U4T A;  3E32 A;  3ASO E;  4F7A A;  4I6E A;  1LF8 A;  1N4S A;  3PZD A;  4YVO A;  4GZ6 A;  3ULY A;  4KVM A;  3L08 A;  4U95 D;  3UIP C;  2IOS A;  2JAB A;  2H6H A;  5JMN D;  5T4Y A;  4U8H A;  2QYJ A;  1Z3Y A;  2WQ7 A;  4GTR A;  3RKV A;  3V2X A;  4I1M A;  5J08 A;  1K8K G;  5AIJ A;  5CHE E;  2CHZ A;  3SBT B;  1DVP A;  1LTX A;  1SZ9 A;  1OCZ E;  1N54 A;  4LUN U;  4I9E A;  4LNU D;  3RO2 A;  3VLD A;  4KZ0 A;  5AQB A;  5BV1 A;  1DC2 A;  4FU3 A;  3CHS A;  3LVR E;  5G05 J;  1QZ2 A;  1DCE A;  3HG0 D;  5D2M C;  3FH8 A;  3URZ A;  4R7L A;  3VTX A;  3V79 K;  2KBX A;  2WXF A;  3VLF A;  4GA1 A;  3TAX A;  3TWV A;  3P2B A;  2RFM A;  2DWZ A;  2C0M A;  3ZKJ A;  2VQ2 A;  1Z5S C;  4J7W A;  3RRN B;  4LNB A;  4QFV A;  3DEP A;  4HOR A;  5FZS A;  3UIO C;  1TR4 A;  2FO1 E;  4U7E B;  3U9W A;  3CQC B;  4FC8 A;  3CVV A;  1AWC B;  4H7Y A;  4JHJ A;  4RVB A;  4BET A;  4EBA G;  4U96 D;  3LJN A;  3BG0 B;  1UW4 B;  4CZ2 D;  4F1S A;  3CST A;  3NAW A;  3AG2 E;  4LNG A;  2P2C P;  5B3S E;  1MJ0 A;  1NA0 A;  2XCC A;  1N4Q A;  3I4G A;  3RU0 A;  3LY8 A;  3AS4 A;  5EIL A;  5LX8 A;  3FUK A;  5ENS D;  2Y4T A;  4HI9 A;  2J09 A;  2XEE A;  4WWO A;  4A3V A;  4DX5 D;  3HXC A;  2WXQ A;  4Q94 A;  1JCS A;  2YIN A;  3ASD A;  4DX1 A;  4I2W A;  1BLX B;  2GRN B;  3MYV A;  3AU5 A;  2XCB A;  3B7R L;  3TWR A;  4JEH A;  3SFZ A;  5DBK A;  3HXD A;  1PY1 A;  3MA5 A;  4ILI A;  3ASH A;  5A7D B;  1TNY A;  1HX8 A;  4ANX A;  5LCW C;  3ZN3 A;  1SA5 A;  5FQ8 A;  1WY6 A;  4F6R D;  2EIL E;  2KM4 A;  2IEJ A;  4B93 B;  3Q9U C;  3EHQ A;  4AXH A;  4Y6C A;  4HOQ A;  4UQY A;  4U8Y D;  3ZYQ A;  1HE8 A;  4FAD A;  2BTD A;  2DYR E;  3HVE B;  3B95 A;  3CVY A;  2LSV A;  3FUN A;  3CHP A;  4JHR A;  3SQV A;  2WPV A;  4J8Y A;  5FQ4 A;  3PUJ A;  3FU3 A;  3APD A;  1HFA A;  3ESL A;  1V55 E;  2XZD G;  3FUJ A;  3HIZ A;  4I43 A;  4KVO A;  3LY7 A;  3OXG A;  2R02 A;  3B7S A;  4XIF A;  4GML A;  4DJA A;  3AS5 A;  5ARF A;  4UI9 C;  2WQH A;  5AAO A;  4GZC A;  5B1B E;  1ZBP A;  1WM5 A;  3CK8 A;  2L0I A;  3FY4 A;  4L1B A;  4XKB A;  4AV7 A;  3MX3 A;  4I6G A;  3UM1 A;  5M72 A;  3R9A B;  2Y4U A;  4K03 A;  2RFA A;  5J90 A;  3CHR A;  4MS6 A;  3UIN C;  3CVX A;  4RG6 A;  2XZT G;  3CHO A;  5LFA A;  2FO7 A;  3SZ7 A;  5HI7 A;  1DNP A;  3L9T A;  4P29 A;  1MX2 A;  5E76 A;  2WXI A;  3U64 A;  2GRM A;  4AP2 A;  4AEZ C;  4V3I A;  2OVF A;  3FDH A;  1O5M A;  2RD0 A;  1U2V G;  3Q47 B;  3ZUV B;  3ZNG A;  5EIB E;  3HXB A;  1V54 E;  5KCM A;  1O1S A;  2ZXW E;  3MCX A;  4EPZ A;  1MX6 A;  4BWR A;  4CGW A;  3VLE A;  1S70 B;  3T5X A;  3PS6 A;  4G8L A;  3L13 A;  3JUE A;  2OCC E;  2P9N G;  1HU3 A;  3UM2 A;  3WG7 E;  3ML8 A;  3PRZ A;  3Q7A A;  1H6O A;  3JQ0 A;  1WAO 1;  4L23 A;  5ENO D;  4DRX E;  5AQ7 A;  1SA4 A;  3TWX A;  1N4R A;  2LXL A;  5HS0 A;  4B8C B;  2WXP A;  4BES A;  3ZVV A;  3Q9N C;  1NL4 A;  1D8E A;  3ML9 A;  5DIZ A;  1BI7 B;  1E90 A;  3PH0 C;  3SFX A;  3QB2 A;  3R7Q A;  4CDR A;  4U0Z A;  1YYH A;  3E33 A;  3AAA C;  3TG5 A;  4UQZ A;  3CVU A;  1K1B A;  3SBS A;  3D9K A;  3AG3 E;  4EZJ A;  3CEQ A;  4JHK A;  3TXN A;  4WWN A;  3RK6 A;  5JA4 D;  3LCA A;  4NIK A;  3DEO A;  1K1A A;  5CER B;  3I5P A;  2OOE A;  5D66 A;  2YNQ A;  3Q4A B;  2P9S G;  3FTX A;  4GYW A;  2AVP A;  3ZYK A;  3DSU A;  3EIJ A;  3FU6 A;  3GYZ A;  3F6Q A;  1P5Q A;  3IBE A;  4AOF A;  5BW8 C;  2DIW A;  3EHN A;  4YVQ C;  2XGO A;  4UWH A;  3BQO A;  2B0O E;  2WXK A;  3CQG B;  2I2O A;  4FLB A;  3E34 A;  3IKO B;  3D3M A;  3IHV A;  4OAU C;  2R17 C;  3FEY A;  4HB5 A;  5FQ6 A;  2PQR A;  2VGE A;  1KT0 A;  3AS8 A;  2XEV A;  1KZP A;  3SD5 A;  4BT8 A;  1HG5 A;  4HLE A;  5LP0 A;  2LO6 A;  1XGW A;  2XEH A;  3KD7 A;  4HQD A;  3J5P A;  5G04 C;  2NXP A;  1EYH A;  5ENR D;  1E8W A;  2CFU A;  2IJG X;  4J8E A;  3HXE A;  3NOG D;  3ASF A;  4N3B A;  2VSO E;  1QNF A;  1H2U A;  3TJP A;  1OCC E;  2KCL A;  2VYI A;  5AYW D;  2XS1 A;  3TG4 A;  4HVB A;  2P9U G;  3IHY A;  3D9O A;  3ABL E;  2AXU A;  3EIQ C;  3AG4 E;  1W3B A;  1JWF A;  3FUD A;  5C2Y A;  2L6B A;  1A5E A;  3QK0 A;  3SF4 A;  2XRZ A;  2ETB A;  3LVQ E;  1N0R A;  4ATG A;  4KMO A;  5ANR A;  1BD8 A;  2F0Y A;  3GZS A;  4K5C A;  5G55 A;  2ZIR A;  2F37 A;  1IXV A;  4FUL A;  1OXJ A;  2GRR B;  4GPM A;  3C3R A;  3OXF A;  4A55 A;  4FLH A;  1E8X A;  3G2S A;  2J4B A;  3S7F A;  1O1R A;  2DCP A;  3DST A;  5JJT A;  1QBQ A;  3ABM E;  3EJN A;  4HLL A;  4BT9 A;  4AJW A;  4JEU A;  3G2T A;  3LXU X;  4AIF A;  2WXR A;  4HNA D;  4LCT A;  4NAC A;  2WB2 A;  4A1G A;  4DX7 D;  4BEP A;  3UUX A;  4WAF A;  4GYY A;  1N11 A;  5D0O D;  3ZXS A;  1WG0 A;  4CT0 A;  2QY7 A;  2GRO B;  4L7T A;  2H6I A;  3CSF A;  2KZT B;  4WND A;  3ZYM A;  4H7X A;  4XI0 A;  1E8Z A;  3SHF A;  3GZ1 A;  1KPS B;  1MX4 A;  1OWO A;  2L9B A;  4AY6 A;  4I17 A;  3ULQ A;  3FTU A;  3VTY A;  2AWI A;  2PL2 A;  4C9B B;  4G26 A;  2DBA A;  2AJA A;  4N2S A;  4BSZ B;  3FH5 A;  4GU5 A;  3APC A;  4EHM A;  4DK5 A;  3ONL A;  4C0M A;  5G05 C;  3NQP A;  4GA2 A;  3T8M A;  1JUQ A;  3CGH A;  3ZYL A;  1HO8 A;  1TNB A;  3FUH A;  1YA0 A;  2KCK A;  1OWN A;  5ITZ F;  3NF1 A;  4U07 A;  3FWV A;  5FWQ A;  4GTP A;  4OVU A;  2JLB A;  3TWT A;  3V31 A;  4GA0 A;  4U63 A;  2LAH A;  1Y6I A;  2EIK E;  4FHJ A;  2UY1 B;  3AU4 A;  5AQA A;  3NOC D;  4GTS A;  4ACL A;  4GTM A;  3D9P A;  4WWP A;  5EYP F;  1OCR E;  4DLO A;  4IRU A;  3Q75 A;  3FUM A;  2L0T B;  4PS8 A;  2FUL A;  3APF A;  4BX8 A;  3PE3 A;  2ZU6 B;  4WNE A;  4HS2 A;  4XEI G;  3QWV A;  2IO2 C;  4J8D A;  3QJZ A;  4DX6 D;  4N2Q A;  1S64 A;  3G2V A;  3TWQ A;  4O1P A;  2XEN A;  1H0A A;  3SGH A;  1G3N B;  3D9N A;  4IYP A;  4I2Z A;  4A63 B;  4EQF A;  4XE0 A;  1K3Z D;  3PUK A;  3RSE G;  4B0Z A;  5T3R A;  4GZ3 A;  5HKP A;  3FU5 A;  1JPL A;  2WXO A;  5FZQ A;  4ZFH A;  4RG9 A;  2V5F A;  3JUI A;  3DSW A;  1AP7 A;  2ETC A;  1Q2Z A;  2VTB A;  2XPY A;  4JZY A;  4YDE A;  4WNF A;  1TN7 A;  2PNN A;  3IXE A;  2XQ0 A;  3QNK A;  1ELR A;  4A3T A;  3JQ1 A;  3LS8 A;  5AQ9 A;  3QC1 A;  4J6I A;  4TUU A;  2VTB B;  4JD2 G;  3ULE G;  3SI5 A;  1SW6 A;  2EIN E;  3MV2 B;  3HVE A;  3S7J A;  4KXK B;  3L82 A;  2Y3A A;  1OCO E;  4F53 A;  3KSQ A;  2P9K G;  5FJY A;  3OXL A;  3PZ1 A;  2HYZ A;  4PS7 A;  3BEE A;  1EF1 C;  2WXH A;  4TXR A;  1VDY A;  1SVX A;  4KT6 B;  1TEZ A;  3V30 A;  4J8F A;  2ETA A;  3IV0 A;  3SY2 A;  4FJY A;  4OYS A;  4CDN A;  1E7U A;  4RSY A;  4AM9 A;  3GZ2 A;  3TWS A;  4DPR A;  4AVX A;  3OAW A;  2E0I A;  5ENP D;  2MYO A;  4CYM D;  3UKR G;  3CVN A;  5FT9 A;  4UI9 K;  3DSX A;  4HI8 A;  4O6F A;  4W9R A;  3C3O A;  2IOL A;  2R03 A;  5CMW A;  3S7D A;  2AXZ A;  2DZN A;  3LDZ A;  2VSN A;  3UM0 A; 
#chains in the Genus database with same CATH homology
 2GRR B;  2GRP B;  2IY0 C;  2IO3 C;  3UIP C;  1Z5S C;  1KPS B;  2GRN B;  5D2M C;  3UIN C;  2GRO B;  3UIO C;  2IO2 C;  2GRQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...