3UIPC

Complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/isomerase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
total genus 59
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2011-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 3uipC00
2IY0C 2GRRB 2GRPB 5D2MC 2GRQB 1KPSB 2IO3C 3UIOC 2GRNB 3UINC 2IO2C 2GROB 1Z5SC 3UIPC
chains in the Genus database with same CATH superfamily
2ETBA 2P9SG 4A3VA 1HH8A 4CGWA 3TXMA 4I17A 4NRHB 3FTWA 2QZAA 3FP3A 3UI2A 3UINC 4AY6A 4I2WA 4RG9A 4Z68A 4A63B 3E32A 3UT4A 2DIWA 3RU0A 3T5VA 3I4RB 5A7DB 2VSOE 2AW6A 2GRQB 2WXNA 4GTMA 3G2WA 3I3NA 2RD0A 2GROB 1DCEA 2OOEA 1BLXB 4F6RD 3PDNA 3CSTA 4O6FA 3CHOA 2Y1LE 2GRRB 2QC9A 1TNZA 3RO3A 1Z3YA 2XS1A 1ELRA 3DEOA 4K0RA 1E96B 2XGSA 3CHQA 3SO8A 3QK0A 2AXUA 1TNUA 2JEKA 4DX7D 4WAFA 3V79K 4FULA 3S7FA 2RFMA 3L08A 3ZYLA 4I6GA 2WMOA 4N2SA 3PREA 4KT6B 2KZTB 3W9FA 4HBDA 3MV2B 3HXBA 2WXHA 2WXKA 1TJFA 4N3BA 3ABKE 5KJLA 1K3ZD 4BETA 4TUUA 3UKUG 4DX6D 1ELWA 3UKRG 4NIKA 5JJTA 2LSUA 5M72A 1WG0A 2M63A 5AAOA 3BU8A 4HOSA 4GCOA 4MLPA 4U04A 3RAUA 2DZNA 3CR3A 1OUVA 2R03A 5CECB 2C0LA 3EIQC 2IQCA 2LSVA 4BESA 4KZ0A 4KZCA 5AARA 2BUGA 5D2MC 1Z5SC 3GZSA 3HVEA 1OCCE 4U8HA 5JA4D 2Y4TA 3G2VA 3PZ3A 4I43A 3ASDA 1MX4A 5ITZF 3ESLA 3QWPA 4QQIA 2VYIA 1H2UA 2UY1B 3FTXA 5E75A 2YNQA 2HR2A 3EHNA 3D9PA 2MYOA 1KZPA 4UUCA 1OWLA 3D9NA 3BG0B 2BKKB 3JQ0A 3FU5A 2FEZA 5DIZA 2LXLA 3RJVA 5KJNA 1B89A 2R2LA 4YDEA 3MKQA 4ME2A 3NZSA 2BTDA 4WNEA 5C2YA 1EYHA 2RG8A 3QOUA 3NOCD 4CT4A 4ANWA 2YQ8A 4Q69A 5LFAA 3S7DA 3OAWA 5AYWD 1N4PA 3G2SA 4B8AA 2IU1A 5CHEE 3R9AB 4MRUA 3ZNGA 3ASHA 3ESKA 5G04J 4XX5A 1OY3D 2AXZA 3AAAC 1FVHA 4Y6WA 2XEEA 3CKCA 3ASFA 5B1AE 3P1UA 4XKCA 4JHRA 4JHKA 3FWVA 3UT8A 5AJDA 1NI1A 3E4BA 3CLJA 4XKBA 2ETAA 4LEUA 2LAIA 2C2LA 4BSXA 2AJAA 3QNKA 4N5QA 4U8VD 3AG1E 3HXFA 1YA0A 3E34A 1PC2A 2WXQA 2R05A 4HNAD 3C5RA 3D9IA 3MJWA 1WDYA 1H6OA 2WXRA 1EDUA 3FUMA 1DCQA 1FT2A 1SA4A 1FVFA 2Y3AA 4BERA 2WMNA 4LERA 5AQ9A 3DPDA 1D8EA 3APCA 4XIFA 4U95D 5T4YA 4PS7A 3D9OA 3TAXA 4GA2A 4HVBA 3ZVVA 5G05C 3SFZA 3LY9A 2KC7A 3FTUA 4PH4B 4HI8A 3V2XA 4JB8P 4JEHA 1OCRE 4N3AA 3LS8A 3DSXA 3MGBA 4HB5A 4BT8A 3LCAA 4I1AA 2A5UA 3PZ2A 1N9AA 3PS6A 4AJWA 3I5PA 1HS6A 2P9PG 2ONDA 1N0RA 4FJZA 1QNFA 1KT0A 3TWXA 3DSSA 1UJKA 4GA0A 3U9WA 4ANUA 5EILA 4OAVB 4U63A 2WXMA 1FPPA 1E7VA 2X6IA 4YVOA 1X5BA 3FH7A 4XI9A 3RKVA 2R5SA 3W9GA 5AQBA 4A55A 4WWPA 1BU9A 3DXMG 5JJ7A 3OTNA 3ZXSA 3CKBA 1E8ZA 3HVEB 3PNTB 4GZ5A 2R59A 4ILIA 4Y6CA 3GZ1A 3ONKA 5EYLA 1S63A 1E8YA 1OCOE 3LPZA 5ENPD 1ZU2A 4RSYA 3ZYKA 4DX1A 4HRMB 4N3CA 3CQGB 4OYSA 4U7EB 3PE3A 1A17A 4JW1A 1K1BA 1UW4B 2VJ8A 4URKA 3LVRE 1XNFA 1K1AA 4HFGA 3L13A 3ZEFA 1SZAA 1FT1A 4G8LA 5EX3A 4GU5A 2IONA 1HZ4A 2XPZA 3ASGA 3ASOE 3FHEA 2VGXB 1N54A 4J0UA 2NXPA 2GGFA 3TWSA 5H7PA 3DPYA 1E8XA 3ZGQA 3QWWA 1EF1C 3ZYMA 3KSLA 5FINA 2FI7A 1H2VC 5ANRA 3Q9UC 2XZDG 4XZ4A 5JHBA 2I9CA 4L9PA 5AN8A 4UI9K 4I6JA 3VTXA 4E6HA 3FH5A 1HO8A 5G55A 3FUNA 3ONLA 2HM8A 4B0ZA 4HOTA 3HHMA 3TWRA 1O1TA 5HQ8A 1NA0A 3CSFA 2IO3C 4KYOB 1SVXA 3RSEG 1GW6A 4ILGA 4AY5A 1TR4A 1HX8A 1Q2ZA 3ZXPA 5J08A 4C48B 5KCMA 5EDSA 3HDXA 1AWCB 4ANXA 4TV3A 1UOHA 4FA6A 3CK8A 2X6KA 4JL0A 2H6GA 5FJYA 3FTZA 4CDRA 2ZGDA 3L22A 1OWNA 2P9UG 3JUIA 1BPOA 4U0ZA 3FU0A 4DUIA 1IHBA 4K5BA 4NQ0A 1TN7A 2AWIA 5CCMA 4MKTA 3LDZA 1DC2A 1QYMA 4KVMA 4UWKA 1KT1A 3S7JA 5AQ7A 4GTQA 4G25A 2YINA 5ENQD 1DVPA 4KBQA 3EUVA 4H7XA 4FC8A 1UN8A 5EIBE 2ZIRA 4GTRA 3LKUA 1O5MA 1XGWA 5CEAA 2XGOA 5ENRD 3T8KA 4FU3A 4J8FA 1LF8A 3BG1B 1N4RA 2X38A 4IN3B 4GTVA 4AOFA 3MKQB 1S70B 4DLOA 3IV0A 2FF4A 2LNIA 4ABNA 3PZDA 4CEMA 3FUHA 4APFA 1P5QA 5KJMA 3EIJA 4JXTA 1UG3A 4F3VA 1MQSA 4U8YD 2WXPA 3U3WA 3SHFA 4TXQA 4RQIA 3TG4A 5G05J 3F6QA 3S2AA 4F1SA 4P29A 3AG4E 1E8WA 4GTPA 2FULA 3ZN3A 3EJNA 4B89A 1OWOA 1JCSA 3FUEA 4DX2A 2EILE 3IHYA 3EDTB 3D9MA 4EZKA 3CVPA 3ENEA 3HG0D 3DRAA 1S0PA 2CFUA 4JA9A 1TN8A 4I9CA 4GYYA 3ABLE 4GYWA 4PS8A 3L16A 3U4TA 3OXGA 5EX0A 3EHQA 4AP2A 1JWFA 3FTVA 3LY7A 5CMYA 3ASNE 4N39A 3SBTB 4B94A 3JCKC 4XEIG 2F8YA 1H2TC 2V4HC 4G8KA 2XS8A 4HI9A 4JEUA 2KZTA 2X6FA 4GB9A 2P9LG 3ZPJA 3RRMB 2L0TB 3TGOA 2PL2A 3ZHEA 3KS2A 1JUQA 2F8XK 3UM3A 4TXPA 2WQ6A 5G04C 4GMJA 1BI7B 3SNXA 5ARFA 2C0MA 2NC9A 2WPVA 2J08A 4UQZA 4EPZA 3D3MA 4V3IA 2DZOA 1FCHA 3PEVB 1YCSB 2EINE 2BEDA 3UPVA 5KNHD 1BI8B 1HF8A 3CHPA 4HLEA 3DBSA 4I1MA 1V54E 3MZLB 4BEPA 4AV7A 4I2ZA 4FLBA 2P2CP 4O1PA 3UM0A 2L6BA 4WWNA 3UX4A 2I1JA 3UT7A 3BEEA 1WM5A 2WXJA 2VTBA 3TJPA 3UM2A 3P2BA 4F7AA 3OXLA 5FQ7A 3CK9A 2IOSA 4OVVA 3TL5A 4GTSA 3CVVA 3UQ3A 2UWJG 4YDWA 3B7RL 4A3TA 4FADA 3T8MA 2MRIA 1IQRA 3R7QA 4ATGA 4G23A 2LO6A 4K5CA 5EN5D 2XEHA 4YVQC 4IYPA 3FULA 3UTMA 3PNLB 4BTBA 1NA3A 3Q9NC 3FEYA 3B95A 5HKPA 3DSTA 2V5QC 3JQ1A 2ZU6B 4BFRA 1ELKA 3BUAA 4JC8A 5CRVA 3Q49B 4GPMA 4X8QA 3G2TA 2B0OE 4IRUA 4FLHA 3ULYA 2VGXA 3DXKG 4HS2A 3ML8A 2E0IA 4F53A 4RVBA 3FH8A 3S7BA 3QB2A 3VLFA 3FUDA 3Q15A 5JHAA 5T3RA 4E85A 3D9HA 3UUXA 3VLEA 4OAUC 4B8CB 3PE4A 4EZJA 3O48A 1JCQA 5JJ6A 2YHCA 4AEZC 3PVLA 5FZQA 5BXUA 1E7UA 3C98A 1Y8MA 3TWTA 4UWGA 2EIKE 2A4ZA 2GRNB 2ILRA 3SFXA 3L82A 2WVIA 3AS8A 1TN6A 3SF4A 2IJGX 4HOQA 3TWVA 4GTOA 4AM9A 3FU3A 3JXIA 1ZBPA 4K5AB 4DK5A 4J6IA 4WUYA 1HU3A 3UMVA 2CG2A 2NYJA 4I6EA 3D9JA 4DRXE 1MJ0A 2J9QA 4LG6A 3Q5MA 4G2VA 3JXJA 4LRZA 3BQOA 4GYOA 3LEWA 3HXCA 3B7UX 4UQXA 3AU4A 1IQUA 4G1TA 3ZYQA 2LUHA 3CIAA 4BT9A 4GZ6A 1RZ4A 2VSXE 4NURA 4HRNA 1WY6A 3NQPA 4KVOA 1NFIE 3IEGA 2L0IA 2IY0C 4CDMA 3N71A 1O1RA 1X81A 2EIJE 4L23A 4HRLA 3CEQA 4K03A 4LNBA 3U64A 3MKRA 3ZUVB 3QARA 3MEKA 3LXUX 4NACA 5ENNA 2X6JA 3L9TA 4JPSA 3B7BA 4LNUD 5FZSA 4J8DA 4DPRA 2XRZA 2WXFA 3CVQA 5ARGA 2DBAA 3WXXA 4C0EA 4DI3A 4PUCA 1HXIA 3IHVA 2V0PA 3J5QB 2HYZA 4HORA 5BV0A 2GW1A 5BXOA 3HXDA 5LCWC 3UIPC 2J4DA 3APDA 3EU9A 4JVSA 4CCAA 3GZ2A 2P9IG 2RKKA 5AQAA 1TNYA 3GYZA 3QWVA 2VGYA 3MX3A 2WXGA 2Q7FA 3C3OA 3DWLG 1TYQG 5EIDA 3L17A 3KAEA 4A1GA 3UM1A 2J8SD 3CV0A 1MX2A 3CHMA 3NAWA 4GMRA 3HXEA 4GMLA 1RW2A 3AG3E 4WNDA 5ENOD 1Y6IA 1HG5A 1Z6TA 2DCPA 5E76A 3AJIA 3FUIA 3UIOC 4EBAG 4UI9J 4U0SA 3IXEA 5CRUA 2Y69E 1LD7A 3NBNB 2J09A 2JABA 5C1DA 3CGHA 2EQXA 5HS0A 2E2EA 2JLBA 3QAQA 3CVXA 1D8DA 2RFAA 3IBEA 5FWQA 4UWLA 2H6HA 2OCCE 4CYMD 4OVUA 5B1BE 4L2YA 1KLXA 2XRYA 2XHEA 1JCRA 2XCBA 5BW8C 3Q47B 3Q7FA 4IULA 2VGEA 5ENTD 4J8SA 3ISMC 5BNWA 5AENA 3E33A 4YDYA 1QBQA 3I4GA 3L6AA 4ATZD 2XCCA 4FJYA 2QYJA 4J8EA 1IKND 1HFAA 5LP0A 1H19A 5DBKA 1N94A 3EHMA 1LD8A 3U66A 3KEZA 3SD5A 3ABME 4AXHA 4BX9A 5KBAA 3QC1A 4UWFA 2V4LA 1Z3XA 2LXMA 4CRWA 5FQ8A 2PQRA 2XZTG 5BUZA 3CVWA 2VTBB 1TJCA 2AXVA 4I9EA 4GTTA 1IYGA 2PM6A 4GZCA 1BD8A 4KMOA 3GW4A 1SZ9A 2XENA 1W3BA 4XE0A 4R7LA 1H6PA 2WXLA 1E90A 1OWPA 5T8IA 5CBOA 3SBSA 5FQ6A 1INZA 3FTSA 2OVFA 2R17C 4HOUA 3LVQE 4D10C 2DVWA 2PM7A 3DSVA 5D0QD 2IO2C 3LJ3A 2P9KG 3Q7AA 1ZB1A 3SGHA 4H7YA 2HE0A 1N11A 4N2QA 4BTAA 2QFCA 3B7TA 5IY5E 2Y4UA 1H6KA 2IOLA 3QJZA 1PAQA 1MZCA 1NL4A 1TNOA 2KBXA 2Y0BG 5B3SE 4Q94A 4GAAA 2XQ0A 3QDNA 3E30A 2WXIA 3JUEA 1N52A 3C3QA 2MOWA 2I6HA 4LCTA 2PQNA 1MYOA 1YYHA 1O1SA 3TWQA 2KCVA 4EQFA 4FHKA 1QQEA 3LY8A 3SZ7A 3QKYA 1DNPA 4HXIA 3R9MA 1KZOA 3PH0C 4J7WA 1NP7A 4RLYA 5LOZA 3FUKA 4G26A 4QFVA 3FY4A 4EHMA 4AIFA 1JWGA 1U3DA 5HI7A 4MBGA 3SFYA 3HIZA 1AP7A 1SW6A 5A6CA 1JPLA 3ULQA 2IFUA 1UN9A 3O4ZA 2GRPB 1SQMA 3SQVA 3RK6A 4L7TA 2WB2A 5JMND 4YNDA 5J90A 3V31A 3B13A 1YMPA 5CERB 5BPPA 3PEUB 4L2LA 4XI0A 3NOGD 3MCXA 4C9BB 1UJJA 4TRQA 4PS3A 5KWDA 3B7SA 3AU5A 3RO2A 3ZW3A 3J5PA 4GZDA 1SA5A 3NB2A 2J49A 3DEPA 2IF4A 2ETCA 4J8YA 3AS5A 4N5CA 2V8SE 3DSWA 3FEXA 4O1OA 4CT0A 4JZYA 4ZFHA 4LNGA 2KCLA 2J07A 3FTYA 2DYSE 5D66A 2EIME 3MV3B 4LSZE 2I1KA 3CVUA 4DLQA 1OT8A 2WQ7A 3TG5A 3KSQA 4WWOA 1TNBA 2H6IA 3TWUA 4W9RA 3ZU7B 4LUNU 1D9SA 3Q75A 4TUMA 3AS4A 2HO1A 5BV1A 2A5EA 4G24A 2ZGGA 3AG2E 2BF0X 1PY1A 4U07A 4BX8A 2AVPA 4YDOA 3UXGA 3TWWA 3HRAA 4ACKA 4JA7A 5A23A 1S64A 1TEZA 2XEVA 3L54A 3FDHA 4HLLA 2KXPC 1OXJA 2F0YA 4M7CA 2CFZA 1G3NB 2WM9A 5BT1A 5ENSD 3X2QE 2DWZA 2WXOA 4U0UA 2OVBA 3Q78A 2X6HA 2OV8A 1HG2A 5FTPA 3PZ4A 5CEDB 1WAO1 2VQ2A 2R02A 2FO7A 4AVXA 3PUKA 3IKOB 5CBNA 3MA5A 2XPIA 5KJKA 1H0AA 2WQHA 3FU6A 2XPYA 3CQCB 4ACLA 2V5FA 4CGVA 2CHWA 5KNGA 1EPUA 2ZISA 3G2UA 3PUJA 2IEJA 3TXNA 3R7RA 2GRMA 3DSUA 4CDNA 2CHXA 5AJLA 1V55E 2CHZA 3V30A 4I1OB 3KD7A 3RRNB 3RRUA 2P9NG 1K8KG 4L1BA 3FUJA 3ZKJA 3Q79A 4PDXA 3CVLA 3ZIMA 3URZA 3C3RA 3EU5A 4GCNA 3VTYA 1N0QA 4C0MA 4EECA 3RIBA 4F1PA 4U96D 3ZHEB 2QY7A 4UI9C 5G2NA 3T9KA 4JHJA 2BKGA 4A1SA 3SY2A 5CCLA 2OEVA 4G11A 1HE8A 3D9LA 1QZ2A 2J4BA 4APOA 1N4QA 4UQYA 3LYAA 4M3OA 5FIOA 4B93B 1KPSB 1IHGA 2KATA 3ULEG 3PRZA 4TXRA 2YHEA 4ZHBA 2VSYA 2KM4A 4BWRA 2PNNA 2VSNA 5CMWA 4EZLA 5HRYA 3FFLA 4EBAA 1VDYA 4KXKB 2MHKA 3V2OA 1N4SA 2CG3A 3OXFA 2L6JA 5LCWJ 4GZ3A 1OCZE 3Q4AB 2FBNA 4WNFA 3ZFWA 5EKQD 2XGMA 4GA1A 4BSZB 4DX5D 2F37A 1LTXA 4FP7A 2LAHA 4CZ2D 4DI4A 2GRLA 2I2OA 2NSZA 1IXVA 1L5JA 3SI5A 1U3CA 5FQ4A 4UWHA 3E37A 5FZRA 2OEWA 3WG7E 3T5XA 3CHSA 2H6FA 2UY1A 4WNGA 5EYPF 3ZRHA 3CHRA 5ANLA 5AIJA 1OWMA 2X3MA 4O60A 3Q73A 3JYSA 3NF1A 2FO1E 2DYRE 3VLDA 3EHRA 4MS6A 2ZXWE 3ML9A 3HYMB 3NZUA 2P58C 4Q96A 2KCKA 3C72A 4JD2G 4ANVA 1A5EA 3MYVA 4DJAA 1NZNA 3D9KA 4RG6A 3PZ1A 3LJNA 2L9BA 3CK7A 5FT9A 1MX6A 1N95A 5LX8A 2QYUA 3APFA 2B6CA 4ILHB 1MHQA 4BY6A 3CVYA 4GPKA 3K9IA 2PZIA 5D0OD 4FHJA 4HQDA 3FUFA 3KEAA 3CVNA 1U2VG
chains in the Genus database with same CATH topology
2IY0C 2GRRB 2GRPB 5D2MC 2GRQB 1KPSB 2IO3C 3UIOC 2GRNB 3UINC 2IO2C 2GROB 1Z5SC 3UIPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY0 C;  2GRR B;  2GRP B;  5D2M C;  2GRQ B;  1KPS B;  2IO3 C;  3UIO C;  2GRN B;  3UIN C;  2IO2 C;  2GRO B;  1Z5S C;  3UIP C; 
#chains in the Genus database with same CATH topology
 2ETB A;  2P9S G;  4A3V A;  1HH8 A;  4CGW A;  3TXM A;  4I17 A;  4NRH B;  3FTW A;  2QZA A;  3FP3 A;  3UI2 A;  3UIN C;  4AY6 A;  4I2W A;  4RG9 A;  4Z68 A;  4A63 B;  3E32 A;  3UT4 A;  2DIW A;  3RU0 A;  3T5V A;  3I4R B;  5A7D B;  2VSO E;  2AW6 A;  2GRQ B;  2WXN A;  4GTM A;  3G2W A;  3I3N A;  2RD0 A;  2GRO B;  1DCE A;  2OOE A;  1BLX B;  4F6R D;  3PDN A;  3CST A;  4O6F A;  3CHO A;  2Y1L E;  2GRR B;  2QC9 A;  1TNZ A;  3RO3 A;  1Z3Y A;  2XS1 A;  1ELR A;  3DEO A;  4K0R A;  1E96 B;  2XGS A;  3CHQ A;  3SO8 A;  3QK0 A;  2AXU A;  1TNU A;  2JEK A;  4DX7 D;  4WAF A;  3V79 K;  4FUL A;  3S7F A;  2RFM A;  3L08 A;  3ZYL A;  4I6G A;  2WMO A;  4N2S A;  3PRE A;  4KT6 B;  2KZT B;  3W9F A;  4HBD A;  3MV2 B;  3HXB A;  2WXH A;  2WXK A;  1TJF A;  4N3B A;  3ABK E;  5KJL A;  1K3Z D;  4BET A;  4TUU A;  3UKU G;  4DX6 D;  1ELW A;  3UKR G;  4NIK A;  5JJT A;  2LSU A;  5M72 A;  1WG0 A;  2M63 A;  5AAO A;  3BU8 A;  4HOS A;  4GCO A;  4MLP A;  4U04 A;  3RAU A;  2DZN A;  3CR3 A;  1OUV A;  2R03 A;  5CEC B;  2C0L A;  3EIQ C;  2IQC A;  2LSV A;  4BES A;  4KZ0 A;  4KZC A;  5AAR A;  2BUG A;  5D2M C;  1Z5S C;  3GZS A;  3HVE A;  1OCC E;  4U8H A;  5JA4 D;  2Y4T A;  3G2V A;  3PZ3 A;  4I43 A;  3ASD A;  1MX4 A;  5ITZ F;  3ESL A;  3QWP A;  4QQI A;  2VYI A;  1H2U A;  2UY1 B;  3FTX A;  5E75 A;  2YNQ A;  2HR2 A;  3EHN A;  3D9P A;  2MYO A;  1KZP A;  4UUC A;  1OWL A;  3D9N A;  3BG0 B;  2BKK B;  3JQ0 A;  3FU5 A;  2FEZ A;  5DIZ A;  2LXL A;  3RJV A;  5KJN A;  1B89 A;  2R2L A;  4YDE A;  3MKQ A;  4ME2 A;  3NZS A;  2BTD A;  4WNE A;  5C2Y A;  1EYH A;  2RG8 A;  3QOU A;  3NOC D;  4CT4 A;  4ANW A;  2YQ8 A;  4Q69 A;  5LFA A;  3S7D A;  3OAW A;  5AYW D;  1N4P A;  3G2S A;  4B8A A;  2IU1 A;  5CHE E;  3R9A B;  4MRU A;  3ZNG A;  3ASH A;  3ESK A;  5G04 J;  4XX5 A;  1OY3 D;  2AXZ A;  3AAA C;  1FVH A;  4Y6W A;  2XEE A;  3CKC A;  3ASF A;  5B1A E;  3P1U A;  4XKC A;  4JHR A;  4JHK A;  3FWV A;  3UT8 A;  5AJD A;  1NI1 A;  3E4B A;  3CLJ A;  4XKB A;  2ETA A;  4LEU A;  2LAI A;  2C2L A;  4BSX A;  2AJA A;  3QNK A;  4N5Q A;  4U8V D;  3AG1 E;  3HXF A;  1YA0 A;  3E34 A;  1PC2 A;  2WXQ A;  2R05 A;  4HNA D;  3C5R A;  3D9I A;  3MJW A;  1WDY A;  1H6O A;  2WXR A;  1EDU A;  3FUM A;  1DCQ A;  1FT2 A;  1SA4 A;  1FVF A;  2Y3A A;  4BER A;  2WMN A;  4LER A;  5AQ9 A;  3DPD A;  1D8E A;  3APC A;  4XIF A;  4U95 D;  5T4Y A;  4PS7 A;  3D9O A;  3TAX A;  4GA2 A;  4HVB A;  3ZVV A;  5G05 C;  3SFZ A;  3LY9 A;  2KC7 A;  3FTU A;  4PH4 B;  4HI8 A;  3V2X A;  4JB8 P;  4JEH A;  1OCR E;  4N3A A;  3LS8 A;  3DSX A;  3MGB A;  4HB5 A;  4BT8 A;  3LCA A;  4I1A A;  2A5U A;  3PZ2 A;  1N9A A;  3PS6 A;  4AJW A;  3I5P A;  1HS6 A;  2P9P G;  2OND A;  1N0R A;  4FJZ A;  1QNF A;  1KT0 A;  3TWX A;  3DSS A;  1UJK A;  4GA0 A;  3U9W A;  4ANU A;  5EIL A;  4OAV B;  4U63 A;  2WXM A;  1FPP A;  1E7V A;  2X6I A;  4YVO A;  1X5B A;  3FH7 A;  4XI9 A;  3RKV A;  2R5S A;  3W9G A;  5AQB A;  4A55 A;  4WWP A;  1BU9 A;  3DXM G;  5JJ7 A;  3OTN A;  3ZXS A;  3CKB A;  1E8Z A;  3HVE B;  3PNT B;  4GZ5 A;  2R59 A;  4ILI A;  4Y6C A;  3GZ1 A;  3ONK A;  5EYL A;  1S63 A;  1E8Y A;  1OCO E;  3LPZ A;  5ENP D;  1ZU2 A;  4RSY A;  3ZYK A;  4DX1 A;  4HRM B;  4N3C A;  3CQG B;  4OYS A;  4U7E B;  3PE3 A;  1A17 A;  4JW1 A;  1K1B A;  1UW4 B;  2VJ8 A;  4URK A;  3LVR E;  1XNF A;  1K1A A;  4HFG A;  3L13 A;  3ZEF A;  1SZA A;  1FT1 A;  4G8L A;  5EX3 A;  4GU5 A;  2ION A;  1HZ4 A;  2XPZ A;  3ASG A;  3ASO E;  3FHE A;  2VGX B;  1N54 A;  4J0U A;  2NXP A;  2GGF A;  3TWS A;  5H7P A;  3DPY A;  1E8X A;  3ZGQ A;  3QWW A;  1EF1 C;  3ZYM A;  3KSL A;  5FIN A;  2FI7 A;  1H2V C;  5ANR A;  3Q9U C;  2XZD G;  4XZ4 A;  5JHB A;  2I9C A;  4L9P A;  5AN8 A;  4UI9 K;  4I6J A;  3VTX A;  4E6H A;  3FH5 A;  1HO8 A;  5G55 A;  3FUN A;  3ONL A;  2HM8 A;  4B0Z A;  4HOT A;  3HHM A;  3TWR A;  1O1T A;  5HQ8 A;  1NA0 A;  3CSF A;  2IO3 C;  4KYO B;  1SVX A;  3RSE G;  1GW6 A;  4ILG A;  4AY5 A;  1TR4 A;  1HX8 A;  1Q2Z A;  3ZXP A;  5J08 A;  4C48 B;  5KCM A;  5EDS A;  3HDX A;  1AWC B;  4ANX A;  4TV3 A;  1UOH A;  4FA6 A;  3CK8 A;  2X6K A;  4JL0 A;  2H6G A;  5FJY A;  3FTZ A;  4CDR A;  2ZGD A;  3L22 A;  1OWN A;  2P9U G;  3JUI A;  1BPO A;  4U0Z A;  3FU0 A;  4DUI A;  1IHB A;  4K5B A;  4NQ0 A;  1TN7 A;  2AWI A;  5CCM A;  4MKT A;  3LDZ A;  1DC2 A;  1QYM A;  4KVM A;  4UWK A;  1KT1 A;  3S7J A;  5AQ7 A;  4GTQ A;  4G25 A;  2YIN A;  5ENQ D;  1DVP A;  4KBQ A;  3EUV A;  4H7X A;  4FC8 A;  1UN8 A;  5EIB E;  2ZIR A;  4GTR A;  3LKU A;  1O5M A;  1XGW A;  5CEA A;  2XGO A;  5ENR D;  3T8K A;  4FU3 A;  4J8F A;  1LF8 A;  3BG1 B;  1N4R A;  2X38 A;  4IN3 B;  4GTV A;  4AOF A;  3MKQ B;  1S70 B;  4DLO A;  3IV0 A;  2FF4 A;  2LNI A;  4ABN A;  3PZD A;  4CEM A;  3FUH A;  4APF A;  1P5Q A;  5KJM A;  3EIJ A;  4JXT A;  1UG3 A;  4F3V A;  1MQS A;  4U8Y D;  2WXP A;  3U3W A;  3SHF A;  4TXQ A;  4RQI A;  3TG4 A;  5G05 J;  3F6Q A;  3S2A A;  4F1S A;  4P29 A;  3AG4 E;  1E8W A;  4GTP A;  2FUL A;  3ZN3 A;  3EJN A;  4B89 A;  1OWO A;  1JCS A;  3FUE A;  4DX2 A;  2EIL E;  3IHY A;  3EDT B;  3D9M A;  4EZK A;  3CVP A;  3ENE A;  3HG0 D;  3DRA A;  1S0P A;  2CFU A;  4JA9 A;  1TN8 A;  4I9C A;  4GYY A;  3ABL E;  4GYW A;  4PS8 A;  3L16 A;  3U4T A;  3OXG A;  5EX0 A;  3EHQ A;  4AP2 A;  1JWF A;  3FTV A;  3LY7 A;  5CMY A;  3ASN E;  4N39 A;  3SBT B;  4B94 A;  3JCK C;  4XEI G;  2F8Y A;  1H2T C;  2V4H C;  4G8K A;  2XS8 A;  4HI9 A;  4JEU A;  2KZT A;  2X6F A;  4GB9 A;  2P9L G;  3ZPJ A;  3RRM B;  2L0T B;  3TGO A;  2PL2 A;  3ZHE A;  3KS2 A;  1JUQ A;  2F8X K;  3UM3 A;  4TXP A;  2WQ6 A;  5G04 C;  4GMJ A;  1BI7 B;  3SNX A;  5ARF A;  2C0M A;  2NC9 A;  2WPV A;  2J08 A;  4UQZ A;  4EPZ A;  3D3M A;  4V3I A;  2DZO A;  1FCH A;  3PEV B;  1YCS B;  2EIN E;  2BED A;  3UPV A;  5KNH D;  1BI8 B;  1HF8 A;  3CHP A;  4HLE A;  3DBS A;  4I1M A;  1V54 E;  3MZL B;  4BEP A;  4AV7 A;  4I2Z A;  4FLB A;  2P2C P;  4O1P A;  3UM0 A;  2L6B A;  4WWN A;  3UX4 A;  2I1J A;  3UT7 A;  3BEE A;  1WM5 A;  2WXJ A;  2VTB A;  3TJP A;  3UM2 A;  3P2B A;  4F7A A;  3OXL A;  5FQ7 A;  3CK9 A;  2IOS A;  4OVV A;  3TL5 A;  4GTS A;  3CVV A;  3UQ3 A;  2UWJ G;  4YDW A;  3B7R L;  4A3T A;  4FAD A;  3T8M A;  2MRI A;  1IQR A;  3R7Q A;  4ATG A;  4G23 A;  2LO6 A;  4K5C A;  5EN5 D;  2XEH A;  4YVQ C;  4IYP A;  3FUL A;  3UTM A;  3PNL B;  4BTB A;  1NA3 A;  3Q9N C;  3FEY A;  3B95 A;  5HKP A;  3DST A;  2V5Q C;  3JQ1 A;  2ZU6 B;  4BFR A;  1ELK A;  3BUA A;  4JC8 A;  5CRV A;  3Q49 B;  4GPM A;  4X8Q A;  3G2T A;  2B0O E;  4IRU A;  4FLH A;  3ULY A;  2VGX A;  3DXK G;  4HS2 A;  3ML8 A;  2E0I A;  4F53 A;  4RVB A;  3FH8 A;  3S7B A;  3QB2 A;  3VLF A;  3FUD A;  3Q15 A;  5JHA A;  5T3R A;  4E85 A;  3D9H A;  3UUX A;  3VLE A;  4OAU C;  4B8C B;  3PE4 A;  4EZJ A;  3O48 A;  1JCQ A;  5JJ6 A;  2YHC A;  4AEZ C;  3PVL A;  5FZQ A;  5BXU A;  1E7U A;  3C98 A;  1Y8M A;  3TWT A;  4UWG A;  2EIK E;  2A4Z A;  2GRN B;  2ILR A;  3SFX A;  3L82 A;  2WVI A;  3AS8 A;  1TN6 A;  3SF4 A;  2IJG X;  4HOQ A;  3TWV A;  4GTO A;  4AM9 A;  3FU3 A;  3JXI A;  1ZBP A;  4K5A B;  4DK5 A;  4J6I A;  4WUY A;  1HU3 A;  3UMV A;  2CG2 A;  2NYJ A;  4I6E A;  3D9J A;  4DRX E;  1MJ0 A;  2J9Q A;  4LG6 A;  3Q5M A;  4G2V A;  3JXJ A;  4LRZ A;  3BQO A;  4GYO A;  3LEW A;  3HXC A;  3B7U X;  4UQX A;  3AU4 A;  1IQU A;  4G1T A;  3ZYQ A;  2LUH A;  3CIA A;  4BT9 A;  4GZ6 A;  1RZ4 A;  2VSX E;  4NUR A;  4HRN A;  1WY6 A;  3NQP A;  4KVO A;  1NFI E;  3IEG A;  2L0I A;  2IY0 C;  4CDM A;  3N71 A;  1O1R A;  1X81 A;  2EIJ E;  4L23 A;  4HRL A;  3CEQ A;  4K03 A;  4LNB A;  3U64 A;  3MKR A;  3ZUV B;  3QAR A;  3MEK A;  3LXU X;  4NAC A;  5ENN A;  2X6J A;  3L9T A;  4JPS A;  3B7B A;  4LNU D;  5FZS A;  4J8D A;  4DPR A;  2XRZ A;  2WXF A;  3CVQ A;  5ARG A;  2DBA A;  3WXX A;  4C0E A;  4DI3 A;  4PUC A;  1HXI A;  3IHV A;  2V0P A;  3J5Q B;  2HYZ A;  4HOR A;  5BV0 A;  2GW1 A;  5BXO A;  3HXD A;  5LCW C;  3UIP C;  2J4D A;  3APD A;  3EU9 A;  4JVS A;  4CCA A;  3GZ2 A;  2P9I G;  2RKK A;  5AQA A;  1TNY A;  3GYZ A;  3QWV A;  2VGY A;  3MX3 A;  2WXG A;  2Q7F A;  3C3O A;  3DWL G;  1TYQ G;  5EID A;  3L17 A;  3KAE A;  4A1G A;  3UM1 A;  2J8S D;  3CV0 A;  1MX2 A;  3CHM A;  3NAW A;  4GMR A;  3HXE A;  4GML A;  1RW2 A;  3AG3 E;  4WND A;  5ENO D;  1Y6I A;  1HG5 A;  1Z6T A;  2DCP A;  5E76 A;  3AJI A;  3FUI A;  3UIO C;  4EBA G;  4UI9 J;  4U0S A;  3IXE A;  5CRU A;  2Y69 E;  1LD7 A;  3NBN B;  2J09 A;  2JAB A;  5C1D A;  3CGH A;  2EQX A;  5HS0 A;  2E2E A;  2JLB A;  3QAQ A;  3CVX A;  1D8D A;  2RFA A;  3IBE A;  5FWQ A;  4UWL A;  2H6H A;  2OCC E;  4CYM D;  4OVU A;  5B1B E;  4L2Y A;  1KLX A;  2XRY A;  2XHE A;  1JCR A;  2XCB A;  5BW8 C;  3Q47 B;  3Q7F A;  4IUL A;  2VGE A;  5ENT D;  4J8S A;  3ISM C;  5BNW A;  5AEN A;  3E33 A;  4YDY A;  1QBQ A;  3I4G A;  3L6A A;  4ATZ D;  2XCC A;  4FJY A;  2QYJ A;  4J8E A;  1IKN D;  1HFA A;  5LP0 A;  1H19 A;  5DBK A;  1N94 A;  3EHM A;  1LD8 A;  3U66 A;  3KEZ A;  3SD5 A;  3ABM E;  4AXH A;  4BX9 A;  5KBA A;  3QC1 A;  4UWF A;  2V4L A;  1Z3X A;  2LXM A;  4CRW A;  5FQ8 A;  2PQR A;  2XZT G;  5BUZ A;  3CVW A;  2VTB B;  1TJC A;  2AXV A;  4I9E A;  4GTT A;  1IYG A;  2PM6 A;  4GZC A;  1BD8 A;  4KMO A;  3GW4 A;  1SZ9 A;  2XEN A;  1W3B A;  4XE0 A;  4R7L A;  1H6P A;  2WXL A;  1E90 A;  1OWP A;  5T8I A;  5CBO A;  3SBS A;  5FQ6 A;  1INZ A;  3FTS A;  2OVF A;  2R17 C;  4HOU A;  3LVQ E;  4D10 C;  2DVW A;  2PM7 A;  3DSV A;  5D0Q D;  2IO2 C;  3LJ3 A;  2P9K G;  3Q7A A;  1ZB1 A;  3SGH A;  4H7Y A;  2HE0 A;  1N11 A;  4N2Q A;  4BTA A;  2QFC A;  3B7T A;  5IY5 E;  2Y4U A;  1H6K A;  2IOL A;  3QJZ A;  1PAQ A;  1MZC A;  1NL4 A;  1TNO A;  2KBX A;  2Y0B G;  5B3S E;  4Q94 A;  4GAA A;  2XQ0 A;  3QDN A;  3E30 A;  2WXI A;  3JUE A;  1N52 A;  3C3Q A;  2MOW A;  2I6H A;  4LCT A;  2PQN A;  1MYO A;  1YYH A;  1O1S A;  3TWQ A;  2KCV A;  4EQF A;  4FHK A;  1QQE A;  3LY8 A;  3SZ7 A;  3QKY A;  1DNP A;  4HXI A;  3R9M A;  1KZO A;  3PH0 C;  4J7W A;  1NP7 A;  4RLY A;  5LOZ A;  3FUK A;  4G26 A;  4QFV A;  3FY4 A;  4EHM A;  4AIF A;  1JWG A;  1U3D A;  5HI7 A;  4MBG A;  3SFY A;  3HIZ A;  1AP7 A;  1SW6 A;  5A6C A;  1JPL A;  3ULQ A;  2IFU A;  1UN9 A;  3O4Z A;  2GRP B;  1SQM A;  3SQV A;  3RK6 A;  4L7T A;  2WB2 A;  5JMN D;  4YND A;  5J90 A;  3V31 A;  3B13 A;  1YMP A;  5CER B;  5BPP A;  3PEU B;  4L2L A;  4XI0 A;  3NOG D;  3MCX A;  4C9B B;  1UJJ A;  4TRQ A;  4PS3 A;  5KWD A;  3B7S A;  3AU5 A;  3RO2 A;  3ZW3 A;  3J5P A;  4GZD A;  1SA5 A;  3NB2 A;  2J49 A;  3DEP A;  2IF4 A;  2ETC A;  4J8Y A;  3AS5 A;  4N5C A;  2V8S E;  3DSW A;  3FEX A;  4O1O A;  4CT0 A;  4JZY A;  4ZFH A;  4LNG A;  2KCL A;  2J07 A;  3FTY A;  2DYS E;  5D66 A;  2EIM E;  3MV3 B;  4LSZ E;  2I1K A;  3CVU A;  4DLQ A;  1OT8 A;  2WQ7 A;  3TG5 A;  3KSQ A;  4WWO A;  1TNB A;  2H6I A;  3TWU A;  4W9R A;  3ZU7 B;  4LUN U;  1D9S A;  3Q75 A;  4TUM A;  3AS4 A;  2HO1 A;  5BV1 A;  2A5E A;  4G24 A;  2ZGG A;  3AG2 E;  2BF0 X;  1PY1 A;  4U07 A;  4BX8 A;  2AVP A;  4YDO A;  3UXG A;  3TWW A;  3HRA A;  4ACK A;  4JA7 A;  5A23 A;  1S64 A;  1TEZ A;  2XEV A;  3L54 A;  3FDH A;  4HLL A;  2KXP C;  1OXJ A;  2F0Y A;  4M7C A;  2CFZ A;  1G3N B;  2WM9 A;  5BT1 A;  5ENS D;  3X2Q E;  2DWZ A;  2WXO A;  4U0U A;  2OVB A;  3Q78 A;  2X6H A;  2OV8 A;  1HG2 A;  5FTP A;  3PZ4 A;  5CED B;  1WAO 1;  2VQ2 A;  2R02 A;  2FO7 A;  4AVX A;  3PUK A;  3IKO B;  5CBN A;  3MA5 A;  2XPI A;  5KJK A;  1H0A A;  2WQH A;  3FU6 A;  2XPY A;  3CQC B;  4ACL A;  2V5F A;  4CGV A;  2CHW A;  5KNG A;  1EPU A;  2ZIS A;  3G2U A;  3PUJ A;  2IEJ A;  3TXN A;  3R7R A;  2GRM A;  3DSU A;  4CDN A;  2CHX A;  5AJL A;  1V55 E;  2CHZ A;  3V30 A;  4I1O B;  3KD7 A;  3RRN B;  3RRU A;  2P9N G;  1K8K G;  4L1B A;  3FUJ A;  3ZKJ A;  3Q79 A;  4PDX A;  3CVL A;  3ZIM A;  3URZ A;  3C3R A;  3EU5 A;  4GCN A;  3VTY A;  1N0Q A;  4C0M A;  4EEC A;  3RIB A;  4F1P A;  4U96 D;  3ZHE B;  2QY7 A;  4UI9 C;  5G2N A;  3T9K A;  4JHJ A;  2BKG A;  4A1S A;  3SY2 A;  5CCL A;  2OEV A;  4G11 A;  1HE8 A;  3D9L A;  1QZ2 A;  2J4B A;  4APO A;  1N4Q A;  4UQY A;  3LYA A;  4M3O A;  5FIO A;  4B93 B;  1KPS B;  1IHG A;  2KAT A;  3ULE G;  3PRZ A;  4TXR A;  2YHE A;  4ZHB A;  2VSY A;  2KM4 A;  4BWR A;  2PNN A;  2VSN A;  5CMW A;  4EZL A;  5HRY A;  3FFL A;  4EBA A;  1VDY A;  4KXK B;  2MHK A;  3V2O A;  1N4S A;  2CG3 A;  3OXF A;  2L6J A;  5LCW J;  4GZ3 A;  1OCZ E;  3Q4A B;  2FBN A;  4WNF A;  3ZFW A;  5EKQ D;  2XGM A;  4GA1 A;  4BSZ B;  4DX5 D;  2F37 A;  1LTX A;  4FP7 A;  2LAH A;  4CZ2 D;  4DI4 A;  2GRL A;  2I2O A;  2NSZ A;  1IXV A;  1L5J A;  3SI5 A;  1U3C A;  5FQ4 A;  4UWH A;  3E37 A;  5FZR A;  2OEW A;  3WG7 E;  3T5X A;  3CHS A;  2H6F A;  2UY1 A;  4WNG A;  5EYP F;  3ZRH A;  3CHR A;  5ANL A;  5AIJ A;  1OWM A;  2X3M A;  4O60 A;  3Q73 A;  3JYS A;  3NF1 A;  2FO1 E;  2DYR E;  3VLD A;  3EHR A;  4MS6 A;  2ZXW E;  3ML9 A;  3HYM B;  3NZU A;  2P58 C;  4Q96 A;  2KCK A;  3C72 A;  4JD2 G;  4ANV A;  1A5E A;  3MYV A;  4DJA A;  1NZN A;  3D9K A;  4RG6 A;  3PZ1 A;  3LJN A;  2L9B A;  3CK7 A;  5FT9 A;  1MX6 A;  1N95 A;  5LX8 A;  2QYU A;  3APF A;  2B6C A;  4ILH B;  1MHQ A;  4BY6 A;  3CVY A;  4GPK A;  3K9I A;  2PZI A;  5D0O D;  4FHJ A;  4HQD A;  3FUF A;  3KEA A;  3CVN A;  1U2V G; 
#chains in the Genus database with same CATH homology
 2IY0 C;  2GRR B;  2GRP B;  5D2M C;  2GRQ B;  1KPS B;  2IO3 C;  3UIO C;  2GRN B;  3UIN C;  2IO2 C;  2GRO B;  1Z5S C;  3UIP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...