3UKTA

Structure of the c-linker/cnbhd of zelk channels in p1 21 1 space group
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
196
structure length
196
Chain Sequence
RSLYHTRTKDLKDFIRVHRLPKALAQRMLECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKELLQLPLFESASRGCLRSLSLIIKTSFCAPGEFLIRQGDALQAIYFVCSGSMEVLKDNTVLAILGKGDLIGSDSLTKEQVIKTNANVKALTYCDLQYISLKGLREVLRLYPEYAQKFVSEIQHDLTYNLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Novel protein similar to vertebrate potassium voltage-gated
publication title Structure of the carboxy-terminal region of a KCNH channel.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein, membrane protein
total genus 60
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3uktA02
4Q0SA 2IXCA 2XKPA 3FE5A 4KL1A 4BIFA 3O14A 4PIXA 1ZZ8A 3H1WA 5K8SA 1X8MA 1ZZCA 4Q29A 1H1IA 3LZZA 2UYAA 1OMIA 3GYDA 3G7DA 1DGRA 2CGPA 2IXHA 3SCHA 2V09A 4AQ2A 4GULA 4LA3A 5FPZA 5LEKA 1SFNA 2XL7A 5KHKA 1ZNPA 5FPXA 1CAWA 2GC2A 4KU7A 4D7TA 3RNSA 3I59B 5J7MA 5LRSA 3ETQA 5I8TA 2PFWA 3WW2A 4ONUA 2GC0A 2OZJA 5EZWA 4LA2A 4MGKE 3MZHA 4XEZA 3FX3A 1ZVFA 1IPJA 3ACLA 4KWLA 3S0MA 2Q0AA 4QGLA 4MH0E 4N9IA 3I54A 2MPFA 3HT2A 4AVAA 4MGIE 5D1IA 1ZRCA 3IIAA 1J1LA 1LR5A 3GBFA 2GU9A 3CL1A 5BXXA 5LRRA 2Z69A 1O3SA 1LRHA 1OI6A 2PAMA 3MYXA 1RL3A 2PA7A 1VJ2A 3EJKA 3NL1A 5FCCA 5BV6A 1TQ5A 3IDBB 4QMAA 3D0JA 3RDIA 3U0ZA 1YFWA 2QNKA 4ZU5A 3I59A 3E5QA 1YUDA 4HVQA 3M3IA 3MPBA 2IC1A 1UD1A 1XRUA 4L11A 4QGMA 2XL9A 5LEJA 4O9GA 2H0VA 3OF1A 4XFBA 3EBRA 2K9ZA 5KHHA 2QDRA 4Z82A 1NE4A 1CAVB 2FMYA 5C6CA 3E6BA 1VR3A 3RYRA 4YRDA 3R6SA 3NKTA 4XFIA 1RUOA 1DGWA 1EY2A 4XF0A 2CV6A 2FQPA 2DCTA 4E2GA 3CLPA 1UIKA 3MDPA 4CYDA 5J3UA 4TLFA 4JV4A 2D93A 2WFPA 3KMHA 4HLTA 4HVRA 3RYKA 3NSTA 3I7DA 2XGXA 2XLFA 2IXIA 1XE8A 4XF3A 3E6CC 1CAXA 4H7LA 4WVZA 2ZKLA 3DKWA 1PMIA 3LA7A 2ET1A 1IPKA 4EROA 1GQGA 3LWCA 3IDCB 1Q5OA 5I0TA 4E2QA 1UCXA 2GZWA 3KGLA 3RPQA 1ZZ7A 3IBMA 3OCPA 1SQ4A 1J3QA 1DZTA 4FAHA 3QACA 3E97A 5EFUA 3E6DA 2EAAA 4KWJA 2PQQA 3NW4A 4AVBA 1H1MA 4META 3WW4A 2QCSB 4XFFA 5J48A 2HKXA 4IEWA 3ST7A 4MX3A 4F8AA 5JR7B 4HSLA 2IXJA 3SCFA 3FHIB 5CADA 5CVRA 4UBGA 4UBHA 3EO6A 2CAUA 2Y0OA 2BNMA 2UYBA 4F7ZA 2PTMA 4YSFA 4QM8A 3U11A 3OGJA 4RD7A 3KGZA 1CX4A 1ZZBA 1QY4A 3FFQA 1Q3EA 1O3TA 4B29A 5C8WA 4HMZA 4EV0A 1QXRA 5JCTA 3CO2A 2QVSB 4HBNA 1X82A 2OA2A 4ZU4A 3ELNA 3L2HA 3EQEA 3CF6E 3SCGA 3HT1A 1YLLA 1O3RA 4KU8A 1UW8A 3PNAA 4XF9A 4MV2A 1ZZ6A 3BPZA 1YFXA 3SMHA 1DZRA 5FLIA 2PYTA 4P9GA 3SHRA 2D40A 3KSCA 1I6XA 2OYZA 1Y9QA 4LULA 4R8HA 3H9AA 4MGZE 3OTFA 3BB6A 4Q0QA 1YWKA 4XFHA 1CAXB 3S7EA 1G6NA 4PIYA 5FQ0A 1XE7A 5JSOA 1Q43A 3HIFA 2B9UA 1O3QA 4JTNA 3LA2A 1LKNA 1X8EA 4N9HA 5KHIA 3UKTA 2BNNA 5I0SA 2VECA 3M70A 4L2NA 4QXKA 3WW3A 4I02A 1J58A 1I5ZA 2UY9A 1EPZA 4XF4A 3ES4A 4QGNA 4J1XA 4BYYA 4PJYA 3D0SA 3N4MA 1Y3TA 2ET7A 3H1MA 2H6CA 1ZX5A 2PHLA 1JUHA 4IESA 4BHPA 2MHFA 4YYOA 4D7SA 4ZU7A 3H50A 3HQXA 1FT9A 4HN1A 2WC2A 4HVOA 5KHGA 3E5UA 1YFYA 5JSPA 3U10A 2Z2SB 4QM9A 4FT8A 4LEJA 3NJZA 5KBFA 4IEQA 2ATFA 4Q0PA 2Q30A 5BPXA 3RZZA 2QJVA 2ETEA 2N7GA 3KCCA 3LOIA 2OPKA 4EWDA 3CJXA 3FJSA 2E9QA 4WBBA 4KWKA 1ZZ9A 2ZCWA 1NYWA 4LTAA 4I09A 3H8UA 2BYVE 2P17A 4X6QB 2F4PA 3WW1A 3H3UA 4FBFA 2XLAA 1L3JA 2BNOA 2I45A 4WZCA 2KXLA 3DN7A 5JAXA 3USSA 3H3ZA 1NZCA 1J3PA 4J1WA 1O4TA 5I0RA 4AVCA 4AQ6A 3BU7A 1X7NA 1SEFA 4E2SA 2K0GA 3C3VA 2MNGA 1J3RA 3NVCA 3EHKA 5FQ0B 3H7YA 3DL3A 4Q0UA 1LB2A 3B02A 3ES1A 5BUVA 4OFGA 5BY5A 2H6BA 4I2OA 4ORFA 3JZVA 3ZDSA 2D5FA 4IEZA 4QX5A 4XF1A 5T3NA 5AVPA 1ZRRA 2Q1ZB 4IETA 3TNPB 4R52A 1CAUA 3D82A 1FI2A 2IXKA 2XHKA 4EWEA 5F1RA 3CEWA 1U12A 2CAVA 2GH2A 4IEUA 1UPIA 1QXJA 1NE6A 1O5LA 5CU1A 3S7IA 4YNIA 1EP0A 4XFCA 2B8MA 2UY8A 3ROUA 4EWAA 5FLJA 4PIZA 1YHFA 5I8YA 2O8QA 4LUMA 2VQAA 2OZ6A 2D5HA 2VPVA 2IXLA 1RUNA 1ZRDA 4HZFA 5FDBA 4I01A 4I0BA 5I8SA 3UKVA 3E5XA 3UKNA 3RYPA 4FAGA 4MZUA 4YARA 1YFUA 3PVBB 4LLOA 3FZ3A 4I3PA 4JTOA 3SXWA 1OD5A 3FWEA 1ZRFA 1V70A 4XFAA 4OLLA 5HI0A 2C0ZA 3H7JA 1HW5A 4X6RB 5JSRA 3BCWA 4Z07A 1O5UA 1ZREA 1UIJA 4IERA 4XETA 5I91A 4HN0A 2GC1A 2PHDA 5FLHA 2HJIA 1FXZA 2Q4SA 3PLQA 1WLTA 1O7FA 4LUKA 4UXAA 2GC3A 4XFGA 2EVXA 2B5HA 2XLGA 1QWRA 4IEVA 5E1RA 4NVPA 2XKOA 3DV8A 4O9EA 4AXOA 3H1YA 3LAGA 5KHJA 1NXMA 4MUVA 4BH9A 5I93A 1PM7A 1RTVA 1OFNA 2O1QA 5I0UA 4JVAA 1CAWB 4A2UA 1WA4A 4IEXA 2PAKA 2GAUA 3BALA 1CAUB 4MGYE 2BEOA 3QOPA 3OD0A 1VP6A 3VHRA 5E16A 1CAVA 1RC6A 3LA3A 2BGCA 2PAEA 4IEYA 3TNQA 1CGPA 4IEOA 1WGPA 4IEPA 2EA7A 1GQHA 1RGSA 1J59A 4I0AA 4Q0VA 4DINB 3IWZA 4K8FA 1EYBA 4HSJA
chains in the Genus database with same CATH superfamily
4Q0SA 4XBQA 2RR12 1UX6A 2XKPA 3RS6A 4BIFA 1GSLA 4CP9B 5K7PA 3O1UA 1IKQA 1MZ5A 3LZZA 5FY1A 1W0NA 2I74A 1EUUA 3GCXA 3ZFFB 3M3EA 1C28A 1NLQA 2CGPA 4XJUA 3V64A 4NWWA 2HEWF 4GULA 3VKNA 1JYCA 3OD4A 3ACGA 2DFCA 1SFNA 3SNMA 4YFZA 5LEKA 2VZVA 4TZDA 1TEIA 5FZ1A 2B42B 3H8RA 4GWNA 5A7NA 1RUJ3 3Q8BA 4QKDA 3VKOA 2GC2A 3KV5A 1W6MB 4CCJA 3KV6A 1N47A 3I59B 3Q9OA 1Q8OA 5LRSA 5D8AA 1N3OA 3ETQA 4RQPC 3I3QA 2VZUA 4AEMA 1QJU3 1FX5A 5FR3A 4BLJA 4QX0A 1MVEA 3WW2A 2VO5A 2EIBA 1KFXL 1CIYA 4Q4X2 2OZJA 5EZWA 4MGKE 3I2GA 4A45A 5B2GB 1JUIA 3VL9A 4AE2A 4EN0A 2WS93 3LQCA 2Q0AA 4QGLA 1PIV3 1TMF2 1PO11 1RUF3 2WNVC 1DYOA 2QKDA 4JGZB 2RDNA 2QQPA 3MLJA 3HT2A 4MGIE 5D1IA 4IV3B 4LBNA 5T5LA 5FZIA 1H8VA 2WNUB 3VBFA 2GU9A 2VBBA 5T54A 2VZSA 2Z69A 2YYOA 4FPEA 1NX9A 1LRHA 1AR82 4HL0A 1KEXA 1ASJ1 1AXKA 1RUG3 3MYXA 3DPRB 1NQJA 1VJ2A 3NL1A 1Z0HA 3GGLA 2F17A 4QPWA 1AYM1 5T52A 3LOBA 5FCCA 4CDUA 5BV6A 2JDAA 1O8PA 3IDBB 1XNCA 1H6XA 2JB4A 3RDIA 1KXGA 1ONAA 4XHBA 1YFWA 4HPKA 5C7GA 1JYWA 3U0ZA 5FZKA 4ZU5A 5F2SA 1GP4A 2J1RA 5GZEA 4LXLA 4Q1PA 3E5QA 4BIOA 4HVQA 2RS12 5DUXA 4QPIC 3AFKA 3B9IA 3AX4A 4JGZC 3DYPA 2H0VA 1NCRA 1D0HA 5C5TA 1DHKB 4M01A 4OMCA 2K9ZA 3ZXEA 1OOPB 2BU9A 1IHMA 4CCOA 5KHHA 2YGLA 4NPMA 4FPLA 4YVSC 1UOGA 2R16A 3J8F3 4XUQA 5FO9B 2C9AA 1CAVB 3CJIA 5F5IA 5M0TA 2A6ZA 3DPRC 2MEV2 4UFIA 2UURA 4XXAA 1VR3A 3RYRA 4ARYA 1IG3A 5DAPA 1EY2A 3T4VA 2HWF3 5KWRA 2G9ZA 3KVAA 4YG3A 2E26A 4M3CA 4E2GA 1W39A 1BBT3 1ND2B 2CDPA 3DGTA 2WO3A 1UIKA 3CLPA 3OGVA 1BVP1 3MF9A 5EWSA 1W6QA 4JV4A 1S1AA 3KMHA 1AHSA 4BWOA 2ZX0A 4HLTA 5A3LA 3B9CA 1LGNA 2BUKA 2D6OX 3AMQA 3NSTA 4HVRA 4JZRA 2A3YA 1W8ZA 2IXIA 4W6YA 4NIIA 1IZ3A 4CP2A 1V6KA 4U2AA 1REEA 1OOPC 5A32B 2AR6A 2HBUA 4UWDA 1AR92 1NQDA 2ET1A 2WWUA 1Q8VA 1IPKA 2NZ9A 2JG8B 3BIWE 2VOVA 5IVCA 2PHTA 5I0TA 4AFCA 2J1SA 2ERFA 3OUIA 4PQQA 3LFIA 5A70A 2QBXA 3MLLA 4UOJA 5T5OA 4B8EA 1SFPA 3T2OA 5LA2A 1I1EA 5IAVA 4HONA 2VNRA 4UT5A 4GJYA 1RHI1 1S2EA 5F6KA 4Q8KA 2X53S 3E97A 3USUA 1W2TA 1OBNA 4QKFA 2OPWA 3WQ1A 2NPIA 3AP9A 1JYTA 1ENRA 2JKXA 5T5PA 3VB9A 2R043 3ZSEA 1JYIA 4IV1A 3JD72 4AVBA 2ZZJA 5H9SA 2XVLA 5LY1A 2UWAA 4FOQA 4XFFA 3VKMA 5IK4A 4IEWA 3LEKA 4MX3A 4DS0A 3LSDA 5JR7B 5A1FA 4GH4C 4TXWA 1U5XA 2IXJA 3AP5A 4K21A 4H2AA 4PDWA 4YGCA 5CADA 2RS52 2Y6GA 1B35A 3O1PA 3H0OA 2FDIA 3WUCA 4MGSA 1I3HA 4IE7A 3WLUA 1W8FA 2LRPA 1SCRA 5FUPA 3ZR6A 3EO6A 3AXEA 2HWC3 2WAAA 4ZXEA 2FDFA 1CR7A 4LK6A 3RZMA 4EZHA 5EXOA 2AEYA 5CB7A 4YPJA 4JKKA 4BB3A 4GB32 5L7OA 4Y1XA 5FYSA 1G9AA 1GWMA 2HBTA 3AZYA 4I30A 5FZEA 1ZZBA 5CG8A 1QY4A 5F5AA 3HNYM 4OHZA 4B29A 4Q4Y2 2ZGQA 3K4ZA 1QXRA 5GZCA 1R091 1CJDA 3CO2A 1REFA 4HBNA 4ET7A 5FPBA 1NCQB 2AEZA 2D6KA 4CCEA 4Y1VA 3EQEA 3O12A 4FFIA 2Y26A 2JWPA 4XABA 3HT1A 1X36A 4RA0A 2ILMA 1YLLA 4FPFA 3RZKA 3VLBB 3WNXA 3POFA 3POGA 4ES8A 4ASLA 1VBD1 1ULCA 4RFRB 4XF9A 3V0BB 4NAOA 4XYXA 5FJHA 5CFDB 1BMV1 4LBJA 1AXYA 3B94A 5KR7A 1YFXA 2B7YA 1NA1C 5L9RA 3M3CA 1RINA 4LHLA 3SHRA 4NIHA 5CFCC 2DBIA 3UT0A 1EUTA 1SBFA 4UW3A 3MIFA 2UWBA 4LULA 3LSEA 3BTZA 2DCZA 4K1ZA 2VCAA 4MGZE 1UY4A 3ZKYA 1U0AA 3M8LA 1QU0A 1WMXA 1COV3 2HWB1 3ASIA 4N43A 3MPPG 5SV8A 1NCQC 5FXVA 3BB6A 2BGOA 1YWKA 4Q0QA 4XILA 3OB8A 2W9XA 1D4M1 1G6NA 1POV0 5FXZA 3WNLA 4TTGA 1MZ6A 1US3A 1XOYA 2ORZA 4PIYA 4QQLA 5FQ0A 1XE7A 4IW3A 3BODA 1Q43A 2E7TA 3HIFA 4TLGA 4N7UA 2NQYA 2P6HA 4Q27A 2V5DA 4NOTA 4OUSA 1WZXA 4DUVA 5K9YA 5ANNA 4N9HA 4AVTA 1K12A 3APBA 3ATGA 4QAWA 1TNFA 2WL1A 4XCBA 3SKVA 1IGOA 2R32A 2X10A 3P3NA 1WMEA 4N53A 3M70A 4L2NA 4P9LA 3ZXKA 5I0SA 1RMU1 3WT3A 4QXKA 3WW3A 4A4AA 1KITA 4DMIA 4CCLA 1KS5A 1S0DA 4QGNA 3WP4A 2QQNA 3DXUA 1ENXA 3ZIXA 1WD4A 1KJLA 1QDOA 4PJYA 3D0SA 5EP9A 3N4MA 1HRV2 2LALA 4S2GA 3CKHA 4EN6B 3ZFGB 4FQZA 3RWKX 2P3KA 1CZVA 1WA6X 4UYBA 4COWA 2BWAA 3T09A 2VQUA 5L9VA 1DQ6A 1VAMA 4IESA 2A5ZA 4V1PA 1JS9A 1JTZX 1WCKA 2X29A 4MVTA 3ENRA 4C1WA 3OBRA 3POWA 1KJRA 2JG9C 1DBNA 3OGGA 3R0RA 4BK5A 3H50A 4ZU7A 1HXS3 4D6QA 3ON7A 1PO12 5JSPA 2X09A 2Z2SB 2PLV3 4FT8A 1IS4A 5FMCA 1YO8A 4NRQA 3UJQA 2PHXA 3GHMA 5JOYA 3O1SA 1RUI1 5FZBA 3T30A 3HBZA 1VPHA 4FP2A 1GANA 2AREA 4J6GA 2AC1A 1ASJ2 1W8UA 5LBFA 4AL9A 1XYNA 3ZSKA 5IK5A 3ZFGC 3PIJA 1DYKA 1UZWA 2D3PA 2K2SA 3FJSA 2E9QA 3TRSB 4BXFA 1HDKA 4AEDB 5A33B 2BTVC 2ZCWA 2DUQA 1LOBA 1NYWA 3IDEA 1QDCA 3U75A 3GDBA 5EYXA 3H8UA 2OKXA 3T2QA 2BYVE 3CIHA 4YFWA 4Q26A 3WUDA 5ACA3 1RUC1 3B01A 3PTRB 4Q4W1 5C33A 4YM3A 5IFPA 5F3EA 2ARXA 3PUQA 3SH5A 5J09A 4FBFA 2XLAA 1UY1A 1L3JA 3LD8A 5DXDA 3VBHA 4CA9A 2HYXA 2J1AA 3N35A 3NJXA 2GDFA 2XQRA 4QPGC 1A8DA 1GP5A 3AM2A 4N7IA 1UYPA 2B9VA 4JDMA 3USSA 3ME2A 1NZCA 1J3PA 3B93A 2ADEA 2Q1MA 3K4AA 3PUIA 3PTYA 1OXCA 4UW4A 4CEYB 3OBTA 2XVKA 1VBA2 1EAH3 2AYHA 3NV1A 4LOTA 1SEFA 4CXXA 1FAYA 3R05A 4P5YA 5CBLA 3KB5A 4CU9A 1C8M1 1ND3A 3O0XA 1J3RA 1AVBA 5A1AA 2YB7A 3NVCA 4GMP3 2XBO3 2X5IA 4DO0A 3DEMA 2D6PA 3BYWA 3H7YA 4P9YA 3ZYGA 4ZHNA 3BTXA 1D7PM 4DB5A 3UV9A 5C3SA 2XG3A 5FJKA 4XJAA 4Z2WA 2R0FA 1LNSA 1J84A 1LHOA 2ZGUA 4JAAA 4M0NA 2VQ0A 4ZXKA 4OFGA 3WDXA 1OLQA 2WRAA 4Q4V3 3AZXA 4YZ3A 1HB3A 2JICA 5JMOA 2H6BA 2P3JA 4BMBA 2WNOA 3FHAA 3WF2A 5J96B 4I2OA 1LJ7A 4KGGA 1W99A 2YBKA 3ZDSA 3LDRA 3LCPA 4XF1A 3W20A 2EAKA 3MHZA 1ZRRA 5AVPA 3ZMNA 4CDUC 1BKZA 2G1MA 5DDJ3 2XHNA 3GBWA 5JXGA 1FI2A 4A44A 4AGRA 4RHV2 5A1LA 4OQ9A 1VMHA 3GXUA 1U12A 5ERLA 5FBJA 4A7YA 1AJKA 2F6BA 2A3XA 1RHI2 2VVEA 4IEUA 3HQUA 3I8TA 3N7JA 1I9RA 1NE6A 1QXJA 1SLAA 3MEPA 3A7QA 2J1UA 5CU1A 3S7IA 1FV3A 4XFCA 1FOD3 3OPZA 4YW6A 5FLJA 1FMD3 5FZ7A 4EWAA 2W2IA 4COUA 1AR73 1NCRC 1CWPA 1JMUB 2RJLA 1YJLA 2E7QA 4SBVA 1HRI3 3JBG1 4AFBA 4GMP0 4QHZA 1F15A 1R1ZA 1O59A 2IXLA 3ZR5A 5C9AB 1IG0A 4CP9A 4XXPA 3IAPA 2QQMA 2PQSA 4JC1A 3ZN5A 1MVQA 3HNMA 3PVNA 4YGEA 1HX6A 3ZFFA 4MG2A 2Y0IA 4I01A 4R4ZA 1SMVA 5FP3A 3UKVA 3UKNA 2WNVA 1VBB1 1YRZA 3KCYA 4KBBA 4YVWB 1AYN3 1NXD1 3T1LA 4YARA 5DMYA 3IN9A 3V0AB 2VW0A 3SXWA 3FLTA 4FOVA 4CXYA 2HH9A 2XJPA 4RS5B 3FBYA 1URXA 1DIWA 3FWEA 1KDKA 3JQXA 4OI4A 5DQ0A 1W6MA 1ZRFA 3UGHA 3R4SA 4UFKA 2DTYA 5B4XA 3H7JA 3P6BA 3OGSA 1U5ZA 3G6JB 1OSGA 3FLPA 2X05A 3VD4A 3NWKA 1E5RA 1R092 3LDBA 4K40A 4CU6A 3WVJA 2PHRA 5FAXA 1VALA 1ULOA 3H42B 1UIJA 1UY3A 2Z42A 3ILFA 1W3XA 5I91A 5DG2A 3DYOA 2WZR1 4XDQA 4QXBA 4CPBA 4R9DA 5FYZA 3BGAA 2VW2A 5FLHA 4WVWA 2HJIA 1FXZA 3PLQA 3VBSC 3BPSA 1E5SA 4ITCA 1WLTA 4JGZA 2Y8KA 3OY8A 1BMV2 2L9LA 5CZKA 2G9FA 2EALA 2Y60A 4UXAA 4DRRA 1JZ4A 4XFGA 2EVXA 3NNMA 4LKSA 5FZGA 2NMNA 3PUSA 3QLQA 2UU8A 3OPTA 2BV4A 2IZWA 5DABA 4CDQB 3AFGA 4YVSA 4IV1C 1TE1B 4EE2A 4QX8A 3DPRA 4NVPA 3V65A 1V6LA 2R063 5FIXA 2RR13 1RVF3 2VZ1A 4XOGA 5L19A 2ZAHA 2HWB2 5FPVA 4BQ1A 1D4M2 5CIRA 4WM8C 4XCAA 2A7AA 4W4ZA 4QX3A 4BH9A 1RTVA 2BOJA 1QJY1 2VD7A 4JKLA 4Y5SA 5A6QA 1OPMA 1OURA 1CESA 1WA4A 4IEXA 4AVVA 5A6XA 1OKOA 2PAKA 5ABJB 1Y4WA 2VCBA 3BALA 1CAUB 4MGYE 4W6WA 1OOPA 4AI3A 3LEGA 4CDQC 2WQ8A 1NKGA 1LU2A 4NHKA 5E16A 4DUWA 1CAVA 5KXBA 1S0IA 3HAGA 1C1LA 1OF3A 5A3WA 4IEYA 3TNQA 4PBOA 3WY6A 1ACCA 4IEOA 1RGSA 4XAAA 1UZVA 5EV7A 1IS5A 3WNOA 4LPLA 4E9KA 2EXIA 1S0EA 1EYBA 1RIRA 2IXCA 5FYVA 2IFRA 3TEWA 3FE5A 3KVBA 3O14A 3OG2A 4PIXA 4AFMA 1BLZA 1X8MA 1ZZCA 4Q29A 4BK4A 2DFBA 1OMIA 3GYDA 3THDA 1DGRA 1X33A 2AZ5A 2XWJB 5A7WB 3SCHA 1IQDC 4KWUA 3IZOA 2VTXA 2WO1A 5A32A 2E32A 3WNNA 3WF4A 1O6UA 4NAMA 4IE4A 4LLFA 1RUI2 1ZNPA 2PXJA 4CUGA 5FY8A 1BEV3 1CAWA 5FPXA 5IVJA 5JR2A 3H8OA 2CDOA 1HIXA 4N43C 3RNSA 2KM2A 1JYVA 2A6YA 1XE0A 1P8JA 2YFUA 2VNVA 3WQ0A 4QU1A 5HV4A 1QMJA 5IK8A 3MO4A 3RJRA 4BQXA 1S0BA 5IATA 3ECQA 1XB9A 2CY6A 3PU3A 1W2UA 1RITA 2DCYA 2GC0A 4ONUA 4BQ5A 5FOBB 3MZHA 1U5IA 3FX3A 4XEZA 1JXNA 2FBEA 1RUC2 2P2KA 4D6RA 4LBQB 3ACLA 4L92A 4FPHA 1IPSA 4KWLA 4Q4W2 4MH0E 4CEWB 1MS1A 4TYSA 2JDZA 3I54A 2E7AA 2ZMLA 5FP4A 5A7SA 5FZOB 2MPFA 4Y5Z0 3TB0A 4AVAA 5I0DA 4JGYB 4QX2A 1N1TA 1FPN1 4O7XA 1R083 1LR5A 2YHJA 4C0HA 1QQP3 3CL1A 4I0WB 2XJVA 4KG0A 1J83A 2ZX4A 3VD3A 1Q56A 3EJKA 5ANQA 2CGNA 4Y33A 1W9YA 1QJX1 1XC6A 1TQ5A 3D4KA 4IGPA 4QMAA 3WG1A 2YV8A 3VKFC 1C8M2 1NA1A 1DYPA 1BK0A 2VOXA 1AL22 2QNKA 1AR63 3D8CA 1V0AA 3FN9A 3A22A 4RR3B 5CFCA 4BLIA 2J1EA 5HBAA 3DKQA 1H30A 2PHFA 4CEWC 3GNEA 2WLPA 4W50A 2D97A 4YGDA 1UD1A 4NMIA 3LF7A 4L11A 4WVMA 3M1HA 2VMHA 5FK7A 4CCNA 3VDBA 1ULPA 1GOHA 4ZZ5A 4JGYC 1NCQA 3ZN4A 2R071 4Y22A 3EBRA 1V9U1 5LA1A 2TEPA 4XC9A 2XUEA 4QB6A 1QNYA 1AJOA 4AI0A 4AHWA 1S0FA 5F5QA 1F8VA 4WZFA 1MZEA 4GXLA 4A41A 4YRDA 3R6SA 1W6OB 3NKTA 2JDNA 3VHNA 3V0BA 5CFDA 3ZX7A 3L2YA 2P4EA 3QH7A 3TYJA 2W92A 5DAWA 3ZO0B 4BQ2A 2I2SA 3BU0A 1C3HA 3MDPA 2DUPA 3M3QA 5J3UA 1VBC3 2XJRA 3K3OA 4TLFA 4XAEA 4COZA 4KQ7A 5DPNA 1ODNA 1YEWA 2DVGA 4MADA 3VZMA 1K42A 3WD5A 2C5DA 1H2MA 2XGXA 3ALQA 1XE8A 3P1IA 2JE7A 3DCQA 3VBOB 3VBHC 3E6CC 2Q8DA 2CWSA 2DDUA 2IVJA 3JUUA 3LPGA 5F3CA 3AYCA 4MXWB 2W52A 4H7LA 3ABZA 3JBG2 4INDA 3ITQA 2ZS6B 3P3PA 1ZBE3 3TN93 4WVVA 4HETA 1D4VB 1GQGA 4YW1A 4CDWB 2V5YA 1Q5OA 2JG9A 1GU3A 4AI1A 1QNWA 1VRH1 1GFF2 3J7MA 4GQ7A 4AQTA 1VBB2 5K0UC 1BZWA 2W1WA 2ZGLA 1K5MB 3HR9A 2SLIA 3PL0A 1J3QA 4OULA 4FAHA 3J4UH 1VBE3 4B4QA 2DBNA 1RUD3 1E57A 1OC1A 1EV13 3E6DA 2EF6A 4XMAA 1WW6A 2PQQA 2VCMA 1AF9A 4PI0A 1ZBA3 2DYCA 4YW3A 3VBOC 3ZFGA 4E4SA 4PT6A 4QD2A 4G4FA 1KQRA 4F8AA 2WFF2 5CNAA 4XUOA 3ZFEC 1G9DA 4OMDA 4CDWC 4CCKA 5HXMA 4K8RB 4UBGA 4S2FA 4XQDA 5IVYA 2JXAA 2WZR2 3AJZA 3ZM8A 2FZ2A 3T2TA 1OA3A 2Z5WA 1H2KA 3S30A 4UBHA 3ZPYA 1DQ2A 1K5MC 2Y0OA 1LENA 2VTFA 3ILNA 2R7EB 1RUJ1 1WCSA 4LO5B 4QPGA 3VHPA 5JPNB 2D3SA 2XR4A 2XXZA 3U11A 2ZA9A 4PBPA 3OGJA 4QDQA 4RD7A 5APAA 5F8PA 2GN7A 3M7AA 4H3WA 1QJU1 3FFQA 2WZ8A 5KXCA 1O3TA 5C8WA 3FC0A 3K51A 4HMZA 3M2MA 2RVAA 2RJ2A 1XBFA 1UWWA 4AEDA 2OA2A 4OCTA 5BNNB 1Z7S3 3L2HA 3RZJA 4NUBA 4H14A 2VBDA 4NPLA 2W68A 1YI9A 2J1TA 2WS91 3ZFFC 4AW7A 1JU4A 1PIV1 3I2HA 5FZFA 2JE8A 1O3RA 1MEC3 1QJY2 1WW5A 2DU0A 2FDGA 2RS32 4NN0A 4LNVA 1UW8A 2QFEA 1GZ9A 3ZN6A 1S2BA 2FCTA 2IUWA 2B39A 3OSDA 3ZLIA 3HEIA 1V00A 3MV11 4LO4B 2BFUL 3LGRA 2ZGRA 1HRV3 4FPKA 1RUG1 2WUHA 5FLIA 5L73A 1LOCA 2GMMA 2ZHMA 2OYZA 5FZ9A 5FY0A 1AXZA 3QH6A 4R8HA 3H9AA 1W6NA 1QXPA 2VTXJ 4C1XA 2WSVA 1RJ8A 3LE0A 4QKBA 4UAPA 4OVEA 4D94A 4XFHA 4AYUA 1CAXB 3R4DB 4M4PA 3HJRA 1PO13 4DXRA 1XSQA 4LHSA 4JDOA 3MW2A 5JSOA 3AKPA 5A3PA 4A7KA 2WABA 1KS4A 1WW4A 1MQTB 2KA3A 5IUQA 5AC92 4IV3C 4JRLA 1YXWA 1SPPB 2WNUC 2BNNA 2VECA 1LOGA 3MFAA 5LATA 1J58A 1I5ZA 2UY9A 5CKQA 1CD3G 3VN4A 3QD6A 1JODA 3WG3A 4BYYA 4KI5M 2HWF1 2HEVF 2RMU3 3FLRA 4BQ3A 4DFSA 5FXWA 1AX0A 1SG3A 2NP0A 1BBT1 3H1MA 1UN1A 4JCKA 2QTWB 1XNDA 1J1TA 1ZX5A 2ES3A 2ZGKA 5LBEA 5DZFA 1JUHA 4L9BA 4Y4RA 2W47A 4A42A 1JYXA 1SBEA 2MHFA 4AHXA 4YYOA 1SACA 4D7SA 1IOAA 1RUE3 2WWSA 4YZ4A 1MQTC 1N1SA 4HVOA 2WC2A 4Y1ZA 4E27A 3VDAA 5C3RA 3E5UA 4NO4A 3BI3A 4GAZA 4IL7A 4IDZA 2C1FA 4BZ4A 3QBQA 3DUIA 1HQNA 2W3JA 1TME3 1GV9A 2VOTA 2WQZC 2YZ4A 3BN6A 3NJZA 5GZFA 4D6SA 1VBA3 3I4IA 4PI2A 1FPN2 4Q0PA 4DXTA 5C9AA 1R1A3 2QJVA 2VUJA 2ORXA 5GLZA 4S2DA 2ZABA 3FHQA 1YNAA 1OA2A 1PK6B 2N7GA 3AP7A 3IMNA 3I3MA 4MHUA 1G8WA 4EWDA 4HT1T 5JOXA 1A8MA 1G9FA 2ID4A 4XVHA 3N9QA 3CJXA 4YVWA 1ND2C 3RFRA 3VBSA 4MXVA 1HB2A 2Y34A 1V6MA 4E4DX 1QJX2 4RFT0 2Q1FA 2O0OA 1GNZA 3U14A 1AX1A 2R041 3A0KA 3CBNA 1JZ3A 4QXCA 4OHYA 2CNAA 1KFUL 2ZPXA 3WW1A 3TBDA 1GP6A 2E53A 3MIGA 1BHGA 1NLRA 5C4WB 2JG8C 3NO8A 1BVVA 2R072 3RJ2X 1V9U2 2DUOA 4A7ZA 3TWIA 5KXEA 4WM8A 4DEVA 1M4WA 5JAXA 1PGL1 5CYYA 3R4UA 5K4LA 4RHV3 5FK8A 3FL7A 1VB2A 3ACIA 2HWC1 4B3NA 2VZPA 4E4HA 3AKSA 1OLMA 4B7KA 1MS3A 5AVAA 3KQRA 4UFJA 2DV9A 1MS0A 3LPFA 3AL5A 3KV4A 4BE3A 5EQUA 1POV3 4LITA 4CDQA 1RUH3 1QJZA 1V6OA 2GNMA 5DUWA 3U78A 2GMEA 3EHKA 1XPWA 1YI7A 2GNBA 3I97A 3VBUB 3PDQA 2J7MA 2E51A 5HCHA 3B02A 3RMXA 4YW4A 5LK5A 1GMMA 2WA3A 3LIHA 2CSGA 1DF0A 3O7OA 5BUVA 1POQA 3HNBM 4BU2A 4YG0A 4BISA 2ZHKA 2YGMA 3DYMA 2XH6A 3FUOA 3PMSA 3WZ1A 2VU9A 4OHXA 2LUWA 3IM0A 4HXCA 2HWE3 2VZ3A 4IEZA 5IJRA 2FDJA 3Q8CA 4M3CE 5T3NA 4ASMB 5LWBA 4P08A 1SZBA 2Q1ZB 2QZ2A 1VRH2 4IETA 3TNPB 5A6YA 1UY0A 3FBMA 1CAUA 3MI8A 2XHKA 5F1RA 4NJ4A 5GLWA 3KF3A 1WMDA 1R093 1DLCA 3MIEA 2QQJA 1F5JA 1PMJX 3EXUA 3HOBA 1O5LA 4LE4A 5LBBA 1COV1 4CZSA 4YNIA 2VG9A 2B8MA 3ROUA 2Y6HA 2VZTA 1Q8SA 2ADDA 4M00A 1B09A 1PVC3 4Y4YA 3URFA 1H2NA 4LIUA 1H0BA 1OPOA 3WHTA 2O8OA 2OZ6A 2D5HA 4AEJA 1RUNA 1HKDA 3GF6A 4OUMA 5LA0A 2QQUA 4QX1A 1NY71 1UU6A 2BGPA 2DCKA 3S6PA 1OVPA 4I0BA 5I8SA 5A7WA 5IVFA 5C8CB 2VJXA 3WDYA 2VR4A 3D5OA 4YWAA 4MZUA 2JIGA 1DZQA 1ULFA 3FZ3A 5FMOS 3MUY1 4JTOA 4LO8A 4DZGA 1RUJ2 2AENA 3UJOA 3EMRA 1OD5A 4NROA 3X29B 1CPNA 1RJ7A 3WINE 1HB1A 5F6LB 3FUQA 3GZTB 4YZ1A 2AH2A 3O5SA 4XFAA 1QJU2 1DG6A 3KLSA 1WLCA 2E31A 1DGRN 4QHOA 4PLMA 1KGYA 2TBVA 2VMCA 3EYPA 5C5UA 4Z07A 4LMFA 5BNOB 3PVOA 4XETA 3WDVA 1GZWB 1HXS1 2WS92 1PIV2 3GALA 1O91A 1AL0G 2WINB 4CEWA 2PLV1 2Q4SA 3ZXGA 1GZTA 3W5NA 3WX5A 3JXSA 4BOWA 4JGYA 1IKPA 4ISRA 1OH3A 1O7FA 1ENQA 2VL4A 2P37A 1RUG2 1L7QA 2WZPP 3ZYRA 2BVBA 3MF6A 2VVDA 1IS6A 3O1OA 3NNLA 5DAXA 3MIHA 1W8HA 4BQYA 5FYUA 3DV8A 1AYM2 1LHNA 4PF1A 1C57A 1QH7A 1GQPA 2JE9A 1G86A 4XMIA 3C8XA 4AXOA 5ACA1 5FYMA 2YU1A 3POJA 4HFSA 4MUVA 1WBLA 5JWPA 3ZYJB 1SCSA 2FMDA 1PZ8A 1HV0A 1TVGA 1PM7A 2ZHLA 1OFNA 5I0UA 5FZLA 2QDNA 4A2UA 4WV8A 1I5PA 3B7MA 4XZUG 4E8CA 2Q5TA 1W2NA 3AZWA 5D8AB 1F2NA 5JXJA 1SDDB 5SV5A 1KD7A 3QOPA 1YIFA 3OD0A 3OEAA 1W6PB 1GBGA 4DIQA 1ODMA 2FCUA 4MOAA 1V6IA 2IFWA 4LHKA 3O0WA 4FPGA 1NZIA 1WW7A 2WBKA 3RWNA 1W6OA 4J25A 5LCWL 4LBMA 1TNRA 1Q8QA 1PX3A 4I0AA 4XHXA 4AEDC 4AQSA 1JOBA 5CKMA 1BBT2 3SEPA 2ENRA 4GKXA 1A78A 1RUC3 3WSOA 4LHNA 3I2IA 4GMP1 1O4YA 3IWZA 3AXDA 2XBO1 4K8FA 4TSVA 4YW5A 1OUXA 5FMBA 3WP3A 3KT7A 1FV2A 1A34A 1F9KA 2NLRA 3ETPA 1IS3A 4Q2FA 3N9OA 4EN8B 3IMMA 4KL1A 3H1WA 3V56A 3C7OA 1ULGA 3VBFB 3OBZA 3ZYHA 2UYAA 1UL9A 5C71A 4AG4A 1VLNA 3G7DA 3VBOA 4Q4V1 3UESA 1MS9A 1UMZA 2IXHA 1JZ7A 5LASA 4K6BA 1CN1A 1GKBA 4MXWA 4LA3A 5FPZA 4LE3A 5FO7B 4XJ9A 5EJ1B 3U37A 3ZFEA 1W9FA 2WN2A 3FMGA 3I2KA 4SLIA 4CDWA 4C0BA 4CEYC 4P5HA 5KHKA 4OZXA 2P1BA 4KU7A 5DDJ1 2VXJA 5FKCA 4AR2A 1F4AA 2JD9A 3M4FA 2ZGNA 5CAZA 1AL23 3CDZB 1GZCA 2VOKA 1K5MA 5GLTA 4QB2A 5I8TA 1BXHA 3I3EA 4RSUA 3O1MA 2OUHA 3H8XA 3NMBA 1VMFA 4FI9A 5G04L 5D2AA 4GWMA 4LA2A 2R042 1FOD1 1FMD1 3OYWA 2JECA 1AR71 3DECA 5BYNA 2C24A 1IPJA 1UXZA 4YLZA 4RN5A 4Y3OA 5FPLA 3S0MA 5A7OA 1HRI1 4N9IA 3VUOA 1DDLA 1DQ0A 2XJUA 2BFUS 1PO23 2A1XA 3SQOA 3NQHA 2YC4A 1GOGA 1SHWB 1GICA 1UU5A 3VZNA 5BXXA 1OQ1A 3UGGA 5LRRA 1H8TB 1PGL2 1JI6A 4GJZA 4XE9A 1W6QB 4URTA 2VZQA 4E4ZA 1RL3A 2HWC2 1AYN1 1T2XA 4EN7B 5FWJA 2W91A 2GN3A 5E89A 3MLKA 3PJQA 2HWD3 3VDDB 3D0JA 3MV01 2WO7A 1H9WA 2Q8OA 3I59A 3K4DA 3W9AA 3ZYBA 5F32A 4DUXA 4LQRA 1T6BX 4CCDA 5LK7B 1EPWA 2IC1A 3WNMA 3TEYA 2GALA 3B5LB 4QGMA 2E33A 5LEJA 4O9GA 1XQNA 1W28A 1YQ6A 2A6WA 3U4XA 4Y1YA 5C9AC 3WXPA 1WUVA 1H8TC 1H1AA 2W39A 3BTAA 5IT6A 2QDRA 4Z82A 2YXSA 1NE4A 3ZSJA 2EIEA 2FMYA 1UKGA 2FDHA 3MUZ1 3E6BA 4YVWC 4UF0B 5GZDA 4BDVB 1VBD2 5IFTA 2ZACA 2RM23 2XPJA 1D0GA 2Y6LA 4IV3A 4FTSA 1C5HA 2Z79A 4LOSA 2WNUA 2CV6A 3IIIA 2VGDA 1F35A 3N9NA 4RS5C 3VDDC 2D6MA 4QU2A 5A3TA 4QB1A 4RGGA 2R061 4CYDA 2V73A 2D93A 2RR11 1RVF1 2WFPA 1BCXA 1D2QA 4PDWB 2WFF3 3I7DA 2OVUA 1B35B 4XF3A 3WG4A 2ZEYA 1XNTA 4FPJA 3PU8A 5J98B 1CAXA 3POSA 2VAUA 1ULDA 2WWJA 2ZKLA 1FYUA 1W05A 3LA7A 4OZOA 4L97A 4EROA 3ZPOA 3LWCA 3IDCB 2G9GA 2W46A 1UCXA 3IDAA 1MQTA 5L7OB 2ARAA 2P34A 3KGLA 4GWJA 1XXNA 4HG6B 1ZZ7A 1SPPA 3IBMA 4W65A 2TNFA 2YPJA 3C7HA 1RMU2 1UOBA 1DZTA 1YC61 3QACA 2J42A 5F39A 1VAVA 3CZUA 2DVDA 4XIOA 4QT6A 2Z4FA 5FXXA 2OX0A 5EFUA 1W90A 4Q4X3 2EAAA 4Y5TA 3VD5A 4XQ4A 4FTBA 3ZVXA 3CQOA 4M4RA 4LBQD 1ND2A 4QQOA 5J48A 3VD9A 1OVSA 1TMF3 2E6VA 3ST7A 2ZGOA 4KH9A 2VUCA 2RS33 3SC7X 4C8DA 2VY0A 1QJFA 4FXGB 1LCLA 1PZ7A 1ST8A 3FHIB 3POBA 3SCFA 2VW1A 1SLLA 5CVRA 5JMCA 2WT2A 1R64A 3TOJA 5FYBA 5ABJC 5FYHA 4AAXA 1JW6A 4EQVA 1AR83 3L9JT 2PLV2 1US2A 2DCJA 5LBCA 2VMEA 1UYZA 2CAUA 5F3IA 1UMIA 2JENA 2ZJCA 5DUUA 4GIQA 5F2WA 5J1XA 2JG8A 3KD4A 3WF3A 1BEV1 2PTMA 4YSFA 5LY2A 4YGBA 4QM8A 1JZ2A 5FZ8A 3VKLA 5FTTC 3T2PA 2J1VA 4AAPA 1PK6A 4IUGA 4OUEA 4CDXB 1YYNA 2WO2A 3KGZA 2VULA 1NG0A 4FFHA 4NIAA 4YW2A 1Q3EA 1DU3D 2PN5A 4AI8A 4DY3A 4EV0A 2D6LX 5FP8A 3AYEA 4UFHA 5JCTA 4N8MA 2RS13 3UL2A 4ZONA 1PM4A 2QVSB 1ALYA 1S0JA 1SLIA 2ZZQA 5CEHA 5ACA2 4ZU4A 3ELNA 5AC93 3CF6E 3SCGA 4MLOA 2YPDA 4N53B 3WCRA 3S5AA 2QQOA 4PLOA 2A6XA 2WT1A 2VOWA 4K1YA 4DOUA 4RL7A 1L7RA 3C7FA 2PELA 2MEV3 2IVIB 1W2OA 3JB8A 3PUHA 1R081 2AGSA 4AHYA 4CSWA 4LR4A 1QQP1 3BPZA 3JU9A 4UW5A 4YM1A 5BNQA 3LEIA 4TWTA 3SMHA 1DZRA 2PYTA 4P9GA 4RYDA 1LOFC 2D40A 3KSCA 3WP5A 1I6XA 3AVSA 4CDXC 4A6SA 1Y9QA 4FOYA 1ZA7A 2JDKA 2NYYA 5KC5A 2X8KA 2BJSA 2R1DA 5JOZA 2GH8A 1LAJA 2LS6A 2J22A 4QHBA 5FMOL 4MGQA 3S7EA 1JZ5A 1AR61 2XBO2 3J26N 4R9CA 4LT5A 1PGSA 1SLCA 4URAA 4CCCA 1AR93 3VBUA 4QQPA 4YW7A 3VDCA 3A4UA 1O3QA 3Q8FA 4JTNA 1H4HA 1LKNA 4YZ5A 1REDA 4KNCA 3ZXJA 1X8EA 3AMHA 4LBKA 4Q4V2 5JIAA 5KHIA 4KBZA 5JIUA 1QF3A 4NPRA 2VC9A 3KZ4C 2YBSA 4KGQA 2ZEXA 1DQ5A 2ZHNA 5F5CA 1WKYA 5D21A 3ES4A 4YZ2A 1ENSA 4J1XA 1BJQA 1H2LA 5DDJ2 4FO9A 1STMA 1S0GA 1Y3TA 3NAPB 3JD73 2H6CA 4AFAA 4ASKA 1VBC1 1UYXA 2PHLA 2W0XA 4RR3C 1K5JA 3JCIA 4BHPA 3SH3A 1KDMA 5HCBA 3NV4A 5HV0A 1O8SA 4Q8LA 1FMD2 4G9SB 4FTEA 1AR72 2W1QA 2A71A 1FT9A 3WHUA 4CCMA 2RS53 1PGW1 3RI8A 5KHGA 1HRI2 2BERA 2JB8A 4XTPA 5JI9A 1JHJA 1YFYA 4P9JA 3I2JA 4QM9A 1QIQA 5FUNA 1ZBE1 4LEJA 3TN91 1QKQA 3VZLA 5KBFA 4IEQA 2ATFA 1DQ4A 3VZKA 1F4HA 2R49A 2Q30A 4FPCA 5BPXA 3RZZA 3VD7A 2C26A 2C9KA 3I2DA 1SLBA 4IQPA 2R1BA 3KS7A 4LORA 1LU1A 2X5IB 4FPYA 4P9IA 4GB33 1AYN2 4Y26A 2OPKA 4CU8A 1H4GA 2Y38A 4IGOA 1NLSA 1W9TA 3K2OA 4XQWA 1VBE1 4Y1UA 2VVFA 4GA9A 4CUAA 1IQAA 1QOOA 2P3IA 2VZOA 4KWKA 4Q4Y3 1RUD1 5FO8B 5L36A 2CTVA 1QEXA 1EV11 1RYYA 4IE6A 4KG8A 1JOPA 4I09A 4Z92B 2OT7A 1C8NA 1ZBA1 1ZYBA 2EXJA 3IKWA 2D98A 2RJKA 5FKBA 2C4XA 4XUTA 3RQ0A 1GNYA 3CMGA 1G9CA 2QQLA 1WLDA 2R30A 3POYA 4X6QB 3H3UA 3IPVB 1A3KA 1AUYA 2BNOA 1CONA 4N90A 4XUPA 1DGWX 4ZKTB 3WDWA 4WM7B 2BP6A 4UFLA 2YU2A 4NIGA 1UZ0A 2WYFA 3DN7A 4P9XA 2H0BA 1Y9MA 4P02B 4J1WA 3KF5A 4C91A 1LECA 5JOWA 1W03A 4AVCA 3HD8B 4AQ6A 1DFQA 3BU7A 3KM5A 4F83A 5C3QA 3HN1A 4OI0A 2K0GA 4Y20B 4D0QA 4RQPB 3C3VA 1XJAA 2A75A 2O14A 4PF5A 4BM8A 1BQPA 1HV1A 2R062 5B4NA 2YC0A 1RVF2 4D7YA 4IXLA 3NNGA 3PURA 2RDSA 4Q0UA 5FY5A 1OA4A 4D8MA 1OLRA 1PNFA 2YY1A 1CJPA 5A33A 3ZYIB 1Z7S1 5HXVA 4MHRA 2WA4A 4WM7C 5BY5A 1G9BA 2WZEA 2WNVB 4Q5OA 1PVXA 3DF0A 4GZ9A 3GZAA 1MEC1 4COYA 1MS8A 1RUF1 2YG0A 1SBDA 1V6JA 2VNOA 1UXXX 1UQXA 5GJ6A 4QX5A 3KHCA 5DZGA 3RG0A 1GOFA 2B45X 3GHNA 4R52A 1HRV1 4KMQA 1H9PA 2Y64A 3HBKA 5FZMA 1MS4A 1VIWB 1LOAA 3PHMA 5KC6A 1W6PA 5FUIA 2DURA 3IB3A 2CAVA 5FZ3A 4OHWA 2ZX3A 2VH9A 2VCCA 4CEYA 5E8AA 4Q1RA 4R4XA 2UY8A 2GP3A 2D43A 4CRQA 1OH4A 5BNNC 2W1UA 3ZYFA 5I8YA 2KR2A 1XU2A 2ZGTA 3GJAA 4QPIB 4V2VA 5EJ3A 2O8QA 2XVGA 4LUMA 4M3CF 1LODA 4XJWA 3ZXFA 1JZ6A 3OY8B 2VZRA 3OOXA 2JD4A 3VL8A 1UOJA 4R9BA 3T1MA 4YVSB 3THCA 4UFMA 2CGOA 4B4RA 3E5XA 2EXKA 3O1TA 4BXSV 1ASJ3 1YQCA 3LFMA 3RYPA 4FAGA 3KQ4B 5GALA 1YFUA 3J8F1 3PVBB 4IGQA 3VZOA 2XJTA 4I3GA 2P6CA 1BEV2 1C5IA 3I3DA 1AYM3 3AMNA 2RDRA 2RMU1 5JZGB 4XTMA 3SLIA 2VQTA 1GYKA 1V6NA 4OLLA 3C7EA 2R0HA 1HN0A 4NHXA 3M3OA 1HW5A 1UF2C 5FP7A 1UY2A 3K48A 1JU3A 1AZDA 2D44A 1HJGA 1ZREA 5BNPB 2OUJA 3ZMOA 1RUE1 4EYUA 3WF0A 1NAEA 4MSVA 4QDRA 2BZDA 5IWFA 1LHVA 4HN0A 3AB0A 2GC1A 2PHDA 1XNBA 4QQHA 1TME1 2WT0A 2FDKA 1VBA1 4BMEA 3CZJA 2WLQA 1R082 1G7YA 4O61A 1R1A1 1QQP2 2QE3A 2QUOA 2RV9A 4L0PA 5JI7A 3WNKA 4AVSA 5JZGC 3E1F1 2B5HA 2XLGA 3F2ZA 4CP0A 1QWRA 1H8TA 2JJ6A 2ZGSA 5C3PA 3GJBA 1JOJA 1WLWA 5A80A 4BQWA 2XKOA 3MFCA 2VMIA 1CX1A 3N36A 3V0AA 4JX0A 2HLEA 4O9EA 4W6XA 2VMGA 3MICA 4QX7A 4RS5A 2B4KA 3VDDA 5BNPC 1HN1A 5KHJA 1AR62 5CG9A 1NXMA 3RSJA 5JVVA 4AI9A 4TN7A 5FZAA 4GH4B 4JQRA 4XDOA 2O1QA 1YCIA 4LJHA 1CAWB 5C70A 4CUBA 1FATA 3AMMA 1OFSA 2GAUA 4GWIA 3VGIA 4B7EA 5F9TA 3I2OA 5A3NA 4OI1A 2P3YA 1PX4A 2BEOA 4RHV1 3WDUA 5E88A 2RDQA 2WSUA 4CU7A 1PK6C 3VHRA 3RVHA 1UPSA 3WNPA 3LA3A 2PAEA 4UF0A 1RHI3 1CGPA 4QPYA 4XW3A 1WGPA 2EA7A 4LKEA 4XPVA 3ZXDA 1POV1 2GNTA 1W0OA 5FV3A 4K20A 5JDBA 1RUH1 1E5IA 5FPUA 1VBC2 4F7ZA 4HSJA 3MGUA 4AK3A 1S55A 2SBAA 5EIYB 5LA9A 5GZGA 2ZMNA 1UO9A 1ZZ8A 1D2SA 4LKFA 5K8SA 2ZBJA 1H1IA 2BPA2 5C4WC 3S5QA 3DXTA 1PGW2 2QQIA 1JYNA 4OI2A 2V09A 2WJSA 3UGFA 4AQ2A 3POEA 3UK9A 1ZBE2 3TN92 4K7JA 4MO3M 2HWE1 2CL2A 2XL7A 3UETA 3GZEA 2UWCA 4XBLA 1Y7BA 1OHFA 1NA1B 4D7TA 5JLVA 3U07A 5FYCA 3OGRA 5ABJA 5CFCB 1MS5A 5IAXA 5J7MA 1VBE2 3BKZA 2AUYA 4WVMB 2JDHA 3KT1A 2PFWA 1NUKA 1RUD2 3VBRB 1EV12 5DAVA 3VBUC 3WP6A 4Y22B 3MW3A 4BJ0A 2XOMA 1C1FA 1ZBA2 2W94A 2JDPA 1ZVFA 1W8OA 2EIGA 1PVC1 2VE1A 2VXRA 3NJVA 3Q8EA 5FYIA 4DPNA 5J37A 1YQ5A 2ZEWA 5FRAA 2XJQA 5A7PA 2OS2A 2XWBB 3W58A 5A3MA 3ACHA 2XUMA 4BQ4A 2BBVA 2JKBA 1VBD3 1DLLA 2QQKA 3I2FA 4QXHA 4FP3A 1ZRCA 3IIAA 1J1LA 3GBFA 1O3SA 5IVEA 1OI6A 1VE0A 2PAMA 4ZS2A 2JX9A 2PA7A 1YJKA 3BTYA 4FFGA 3AYAA 3NNJA 2GNDA 3LB9A 3OUHA 3VBRC 2D6NA 2HWB3 2W5FA 5FWEA 2QZ3A 3KT4A 2TUNA 4K3UA 5IK7A 5DG1A 4CDXA 1LOFA 1D4M3 4NE9A 1GNHA 5HPOA 1YUDA 3THPA 5L9BA 5DZEA 1A6CA 3M3IA 3MPBA 2VBPA 4NHYA 3I49A 2JIJA 4JHTA 1XRUA 2JG9B 2W87A 2XL9A 5DAQA 3JB4C 1Z7S2 3OF1A 2RE9A 1LTEA 4XFBA 5IVBA 1Q8PA 4NHLA 2ZX2A 4GKYA 3U1XA 1OLME 4YG6A 1MEC2 4LBQA 1RUF2 3RGBA 5TSWA 1RMU3 1C4RA 2GMPA 3OPWA 3ZYPA 5C6CA 5C8CC 4E8DA 5FZOA 4DQAA 3WQBA 3U4SA 4X8NA 4XFIA 1DGWA 1RUOA 4A3XA 5A3UA 2VUDA 4XF0A 3J7HA 1QH6A 2ZAAA 2FHRA 2DCTA 2FQPA 3ZDVA 1LHWA 1RXGA 1VRBA 2BOIA 2BVVA 2VUAA 2DF7A 2Y33A 4K9SA 5FMDA 4ATFA 2C6SA 3AJYA 3RMYA 4AOCA 1Y43B 1ZM1A 1OUSA 3RYKA 2FD8A 1CZSA 2NMOA 2XLFA 2DVAA 1APNA 2LW8A 3AP4A 5EPAA 5BNOC 4XIKA 1UU4A 1X50A 3WDTA 5DN2A 4WVZA 2JDUA 2PHUA 3A21A 1PMIA 3DKWA 4RR3A 3B00A 1QOTA 4JDNA 3RZHA 4LBOA 4QPGB 4AI2A 4U36A 3ZIWA 2ZX1A 2NM1A 4E2QA 1RUI3 5CKNA 5FBZA 2GP5A 2Q8CA 2GZWA 2QQWA 3RPQA 3TEZA 3OCPA 3BIEA 2D7FA 2WYSA 4LKDA 1SQ4A 4FCAA 3J8F2 3LDKA 2BBAA 5FYTA 2HYKA 3B69A 5G05L 2XB6C 3P5BA 2YMZA 2FZ1A 2OQ7A 1PHMA 2WN3A 1WCUA 2RMU2 1N1VA 3ILRA 1EAH1 1UOFA 3SITA 4DEQA 5FY4A 2HWF2 4KWJA 3NW4A 4UW6A 3NAPA 1F5FA 1H1MA 4META 3WW4A 4AGVA 2QCSB 3Q8AA 1YQ8A 4Q4W3 4ARXA 2HKXA 3ZN6B 2V4AA 3F95A 3TAYA 2W95A 1N3PA 4HSLA 3ORJA 5CFDC 2A70A 5T50A 1RUE2 1XNKA 3SH4A 2YC2A 2WKKA 5F7UA 3D6EA 1XU1A 4ZS3A 1LGBA 3GCWA 5FZCA 4Y24A 1XYOA 2F4LA 3AP6A 5H9RA 3SISA 4CE8A 2IWGB 3HQRA 1HJFA 3GM8A 5FREA 4UI9L 5D8AC 2P5BA 3AYDA 1VMJA 1TME2 3ZSLA 5FOJB 2BW8A 3SKJE 5FP9A 2WNEA 2BNMA 2UYBA 1W6NB 1R1A2 3T0AA 1OT5A 3OBAA 5H9PA 1H6YA 2EXHA 3TEXA 2Y6KA 2LTNA 1GLHA 4PQ9A 1QGLA 4DXSA 4BCUA 1GWKA 4HPKB 4XBNA 2ARBA 1AL21 1MPXA 1C8M3 1SDWA 3JQWA 1CX4A 1VB4A 5HCFA 2BRTA 1HLCA 2AACA 4QKNA 2Q8EA 1O4ZA 4PLNA 2KD7A 1X82A 3N7KA 1NCRB 2WR9A 1GWLA 1WCDJ 3AZVA 3VBFC 3BOWA 4ES9A 1FNYA 1UYYA 1N1YA 1X9TA 4FVVA 3HWJA 4XACA 1CIWA 3CJIB 1XYPA 3N3HA 5F3GA 1MR5A 4KU8A 1PO21 5E6HA 3IPVA 3NV3A 3PNAA 3N7LA 1W3VA 4IE0A 4MV2A 2A73B 3N9MA 1ZZ6A 4WM7A 5JPMB 1RXFA 2ZMKA 4AGGA 4M3CB 4B1MA 3IT8A 5J36A 2Y6JA 5KXDA 3AC0A 4A6OA 3B3QE 1LGCA 4Z8BA 1W06A 5IYYA 2B46X 3OTFA 2HWD1 1JZ8A 5EYYA 2W08A 4F3JA 4YM0A 4W8JA 2WIIB 4Y20A 1RUH2 4RQPA 1JHNA 5CA6A 2CHHA 3BVCA 4FQ4A 2BQPA 2NN8A 1SFYA 3VV1A 2CWMA 1W8NA 3JBG3 2G19A 1N3QA 3CJIC 5A6ZA 4AEKA 2B9UA 3NJYA 4A3ZA 4QWNA 4FXKB 3LA2A 2WQ4A 5LB6A 1Y9GA 5FYYA 3EB7A 1DP0A 3UKTA 3MBWA 5BNNA 3CHXA 3VBSB 2ZKNA 3AK0A 1VBB3 4I02A 1DQ1A 1EPZA 2BDRA 2HWE2 4XF4A 4QQ2A 4BPZA 3VZJA 2WAOA 5GLUA 4JRAA 2RM21 3QCWA 3NNFA 3PVEA 3SEEA 1U5YA 3USUB 3WR0A 5ISLA 1W9SA 5JXHA 1LHUA 4PCRA 1CZTA 4IV1B 4LK7A 4M0HA 2ET7A 3KWVA 1UX7A 4LIVA 3W59A 4MYEA 3S57A 3AKRA 2XJSA 1XSRA 1UKRA 3A23A 4X8PA 2WFF1 2ZXQA 5HCAA 1COV2 2FCVA 5JUVA 1L7LA 5GKAC 4WM8B 1UZYA 5FY9A 4LO6B 3HQXA 1PVC2 4HN1A 4P9WA 2YROA 3NKGA 3T3YA 4B1LA 3AKQA 1K3IA 2WZR3 3CNAA 2W1SA 1HQWA 1HB4A 3U10A 4ISQA 4QPIA 4MGTA 5DUVA 4CXWA 1LESA 1W8WA 2PHWA 3LEMA 1HQLA 4JKMA 4PHZA 1S4CA 1NY72 4LO7A 5A3OA 1TG7A 3NRUA 2YBPA 1QOSA 3IAQA 3K46A 2ETEA 3OEBA 4XJZA 4D3WA 2RG4A 3KCCA 2YDEA 4OHVA 3MIBA 3LOIA 1QJEA 5FZHA 1T6GC 2DVFA 4WBBA 2ZEZA 1ZZ9A 2ZOEB 1ZRIA 2VM9A 4Q4X1 5JZGA 2EIDA 3MIDA 1ZA4A 4L8QA 4LTAA 4PDWC 2CYFA 4AF9A 2P17A 1B35C 1CVNA 1DCSA 3WEZA 4AFDA 2V4VA 1LEMA 3GZUC 4HANA 1YIPA 4R9AA 3PUAA 1TMF1 2F4PA 3I3BA 2RS31 1QJY3 4L99A 3MW4A 2I45A 4WZCA 5BNPA 2KXLA 5EJZB 5A7QA 1HXS2 2JDYA 3ZOIA 1AR81 5L7OC 1LOEA 3T08A 3AZZA 3K3NA 3H3ZA 5FZ6A 2A6VA 4NHMA 1GR3A 1W2AX 1O4TA 3BUCA 5I0RA 1JBCA 2OQ6A 5FZDA 3O1RA 5FFOC 3AMPA 4S2HA 4NRPA 5IW0A 1Z78A 1AX2A 1X7NA 4N43B 4AHZA 1GUIA 4E2SA 2YFZA 5FZ0A 2RHPA 4V2WA 1OF4A 2ZGPA 2MNGA 4NR1A 3ACFA 2I07B 2XONA 1NOVA 5FQ0B 2CU5A 4XUNA 3DL3A 3O0VA 2VMFA 1S0CA 2RS11 2A3WA 1LB2A 1OD3A 3AVRA 2R6QA 1XNAA 3ES1A 2E63A 3T0BA 4GALA 1ULEA 1W8TA 4HKWA 1RB8G 5AC91 2K46A 4FPOB 4FSJA 1WMFA 1BYHA 2DU1A 1W9WA 4P14A 2EICA 5T5JA 4ORFA 3JZVA 3W21A 3POIA 4GH4A 2D5FA 3OUJA 2LROA 5F37A 2MEV1 3PIGA 4LBLA 1W04A 4ATEA 3T0DA 3PMEA 5C4WA 1MACA 4RGKA 3HPNA 1F31A 3D82A 5T55A 2IXKA 3J7NA 4GD4A 4O65A 4G3YC 4YM2A 3CEWA 3ZXLA 4EWEA 4OQ8A 3O1VA 1QHDA 1SLTA 4EJRA 4QDSA 1WWYA 2GH2A 1PMHX 4NWVA 4B4PA 1UPIA 1UNBA 1EAH2 3WCSA 2OW4A 4IE5A 1PNGA 1EP0A 4EZ4A 4Z2AA 5LW9A 4H7MA 2LM3A 2JDMA 3RRDA 5IVVA 4PIZA 1DGLA 1YHFA 4HKLA 3ZXAC 2JEMA 3KCXA 2HEYF 4N53C 1W0PA 4XURA 4BA6A 1AR91 4CUCA 1PZ9A 2VQAA 1BK1A 3H3LA 2VPVA 5FY7A 3UNPA 4DXZA 4CTEA 4COVA 2ARCA 3T4HB 3KV9A 3WQ7A 3WV6A 1WBFA 1KRIA 1WD3A 4HZFA 4JHZA 4H55A 1ZRDA 1FPN3 4HK8A 1OKQA 5FDBA 4DNYA 4DY5A 1FNZA 1UAIA 3J9SA 3D3AA 3A0NA 1X9PA 3AKTA 1WCQA 4XDPA 3WG2A 1S2KA 3RI9A 4CP1A 4LLOA 4I3PA 2PMWB 3C7GA 4EN9B 1JH5A 3RZGA 1QJX3 4Z1VA 3FFZA 1V70A 5AFEA 5EHDA 3W5MA 3BOPA 4FFFA 3JD71 5HI0A 2C0ZA 2G4IA 2V72A 4HOOA 4NIDA 1LULA 5LZ6A 3K75B 3N7MA 4X6RB 2XDVA 5JSRA 3BCWA 3THTA 1O5UA 3HVDA 5FPAA 4ZY9A 3VBHB 3VBRA 4IERA 1UMHA 1FOD2 1M06G 4OYUA 2R073 2RS51 1V9U3 5AFBA 3CU7A 5CISA 4CVUA 3HMYA 3INAA 1PO22 1YQ2A 4AWDA 3C2UA 2DVBA 3LKJA 4HK9A 1CPMA 5GM0A 1K45A 4LUKA 2GC3A 2YUEA 4ZPIA 5K0UB 5K0UA 1ND3B 2ZTNA 3VHOA 1NT0A 3OJBA 4GB31 4XZPA 4IEVA 2ZGMA 4ZZ8A 3NAPC 5E1RA 5C8CA 3N9PA 1JN2P 3K77A 4Q4Y1 3WOGA 4HKOA 2DTWA 1E5HA 1MZFA 2HWD2 4DRVA 2GSYA 2D3RA 4P00B 4NRMA 3LIGA 1TZOA 3J7LA 5C3OA 1VAKA 3H1YA 3LAGA 2XMLA 3AL6A 2VMDA 2VNGA 3UYJA 4FOWA 5JXIA 3ZFEB 5I93A 1OQDA 4D69A 4JVAA 3ZKUA 4AZZA 4C90A 2Y6FA 5BNOA 2DWRA 1UZZA 2OIIA 1VRH3 1GZWA 2XQXA 4RGAA 5IHRA 5FZ4A 1ND3C 1VP6A 4XJ8A 1CQ9A 2X5IC 3WF1A 3KHBA 5H9QA 1RC6A 1OQEA 2BGCA 2RM22 2QQVA 2WDBA 3GBGA 3N9LA 4JQTA 2OXBA 3OYWB 4IEPA 1GQHA 5GLVA 1J59A 4Q0VA 4DINB 3HN3A 3PJYA 3ZSMA 3NV2A 4CPBD 1LEDA 4CDUB 3RZLA 2BWCA
chains in the Genus database with same CATH topology
4Q0SA 4XBQA 2RR12 1UX6A 2XKPA 3RS6A 4BIFA 1GSLA 5K7PA 1IKQA 1MZ5A 3LZZA 2I74A 3ZFFB 3M3EA 1C28A 2CGPA 4XJUA 3V64A 4NWWA 2HEWF 4GULA 3VKNA 1JYCA 3OD4A 2DFCA 1SFNA 3SNMA 4YFZA 5LEKA 4TZDA 1TEIA 2B42B 4GWNA 1RUJ3 3VKOA 2GC2A 1W6MB 1N47A 3I59B 3Q9OA 1Q8OA 5LRSA 5D8AA 1N3OA 3ETQA 4RQPC 4AEMA 1QJU3 1FX5A 4BLJA 1MVEA 3WW2A 1KFXL 4Q4X2 5EZWA 2OZJA 4MGKE 5B2GB 1JUIA 3VL9A 4AE2A 4EN0A 2WS93 2Q0AA 4QGLA 1PIV3 1TMF2 1PO11 1RUF3 2WNVC 2QKDA 4JGZB 2QQPA 3MLJA 3HT2A 4MGIE 5D1IA 4IV3B 4LBNA 5T5LA 1H8VA 2WNUB 3VBFA 2GU9A 5T54A 4FPEA 2Z69A 2YYOA 1LRHA 1AR82 4HL0A 1ASJ1 1AXKA 1RUG3 3MYXA 3DPRB 1NQJA 1VJ2A 3NL1A 1Z0HA 5T52A 1AYM1 3LOBA 5FCCA 4CDUA 5BV6A 3IDBB 1XNCA 3RDIA 1KXGA 1ONAA 4XHBA 1YFWA 4HPKA 3U0ZA 4ZU5A 5GZEA 4Q1PA 3E5QA 4BIOA 4HVQA 2RS12 5DUXA 4QPIC 3AFKA 3B9IA 3AX4A 4JGZC 2H0VA 1NCRA 1D0HA 1DHKB 4M01A 3ZXEA 2K9ZA 1OOPB 1IHMA 5KHHA 2YGLA 4FPLA 4YVSC 2R16A 3J8F3 5FO9B 2C9AA 1CAVB 3CJIA 2A6ZA 3DPRC 2MEV2 4XXAA 2UURA 1VR3A 3RYRA 1EY2A 2HWF3 5KWRA 4YG3A 4M3CA 4E2GA 1W39A 1BBT3 1ND2B 3DGTA 5EWSA 3CLPA 1UIKA 1BVP1 3MF9A 1W6QA 4JV4A 1S1AA 3KMHA 1AHSA 4BWOA 2ZX0A 4HLTA 5A3LA 3B9CA 1LGNA 2BUKA 2D6OX 3AMQA 3NSTA 4HVRA 2A3YA 2IXIA 4W6YA 1IZ3A 4CP2A 1V6KA 4U2AA 1REEA 1OOPC 5A32B 2AR6A 1AR92 1NQDA 2ET1A 1Q8VA 1IPKA 2NZ9A 2JG8B 3BIWE 2VOVA 2PHTA 5I0TA 4AFCA 2ERFA 3MLLA 5T5OA 4B8EA 1I1EA 2VNRA 1RHI1 5F6KA 4Q8KA 2X53S 3E97A 3USUA 3WQ1A 2NPIA 3AP9A 1ENRA 3ZSEA 5T5PA 1JYIA 2R043 4IV1A 3JD72 4AVBA 2ZZJA 5H9SA 2XVLA 2UWAA 4FOQA 4XFFA 3VKMA 5IK4A 4IEWA 4MX3A 4DS0A 3LSDA 5JR7B 4GH4C 1U5XA 2IXJA 3AP5A 4K21A 4PDWA 4YGCA 5CADA 2RS52 1B35A 3H0OA 3WUCA 1I3HA 3WLUA 1SCRA 3EO6A 3AXEA 2HWC3 1CR7A 5EXOA 5CB7A 4GB32 5L7OA 4Y1XA 1G9AA 3AZYA 4I30A 1ZZBA 5CG8A 1QY4A 4OHZA 4B29A 4Q4Y2 2ZGQA 5GZCA 1QXRA 1R091 1CJDA 3CO2A 1REFA 4HBNA 1NCQB 2D6KA 4Y1VA 3EQEA 3O12A 2Y26A 3HT1A 1X36A 4RA0A 2ILMA 1YLLA 4FPFA 3VLBB 3WNXA 4ES8A 4ASLA 1VBD1 1ULCA 4XF9A 3V0BB 4XYXA 5CFDB 1BMV1 4LBJA 1AXYA 3B94A 1YFXA 2B7YA 1NA1C 3M3CA 1RINA 4LHLA 3SHRA 5CFCC 4UW3A 1SBFA 3MIFA 2UWBA 4LULA 3LSEA 2DCZA 4K1ZA 4MGZE 1U0AA 3M8LA 1QU0A 5SV8A 1COV3 2HWB1 3ASIA 4N43A 3MPPG 1NCQC 3BB6A 4Q0QA 1YWKA 4XILA 1D4M1 1G6NA 1POV0 1MZ6A 4PIYA 4QQLA 5FQ0A 1XE7A 3BODA 1Q43A 2E7TA 3HIFA 4N7UA 2NQYA 4Q27A 4NOTA 4OUSA 5K9YA 4N9HA 4AVTA 5CFDC 3APBA 3ATGA 1TNFA 2WL1A 1IGOA 2R32A 3P3NA 1WMEA 4N53A 3M70A 4L2NA 4P9LA 3ZXKA 5I0SA 1RMU1 3WT3A 4QXKA 3WW3A 1KITA 4DMIA 1KS5A 1S0DA 4QGNA 3WP4A 1ENXA 3ZIXA 1WD4A 1KJLA 1QDOA 4PJYA 3D0SA 3N4MA 1HRV2 2LALA 4S2GA 4EN6B 3ZFGB 4FQZA 2P3KA 4COWA 2BWAA 1DQ6A 1VAMA 4IESA 2A5ZA 4V1PA 1JTZX 4MVTA 1WCKA 2X29A 3ENRA 4C1WA 3OBRA 3POWA 1KJRA 2JG9C 1DBNA 3OGGA 3R0RA 4ZU7A 3H50A 1HXS3 1PO12 5JSPA 2Z2SB 2PLV3 4FT8A 1IS4A 1YO8A 3UJQA 5JOYA 2PHXA 3GHMA 1RUI1 3HBZA 4FP2A 4J6GA 1GANA 2AREA 1ASJ2 1XYNA 3ZSKA 5IK5A 3ZFGC 1DYKA 2K2SA 2D3PA 3FJSA 2E9QA 3TRSB 1HDKA 4AEDB 5A33B 2BTVC 2ZCWA 2DUQA 1LOBA 1NYWA 3IDEA 1QDCA 5EYXA 3H8UA 3WUDA 2BYVE 4YFWA 5ACA3 4Q26A 1RUC1 3B01A 4Q4W1 5C33A 4YM3A 2ARXA 3SH5A 5J09A 4FBFA 2XLAA 1L3JA 5DXDA 3VBHA 3N35A 2GDFA 4QPGC 1A8DA 3AM2A 4N7IA 4JDMA 3USSA 3ME2A 1NZCA 1J3PA 3B93A 2Q1MA 4CEYB 3PTYA 4UW4A 3OBTA 2XVKA 1VBA2 1EAH3 2AYHA 3NV1A 1SEFA 1FAYA 3R05A 5CBLA 3KB5A 1C8M1 1ND3A 3O0XA 1J3RA 1AVBA 3NVCA 4GMP3 2XBO3 2X5IA 2D6PA 3H7YA 4P9YA 3ZYGA 4DB5A 3UV9A 2XG3A 4XJAA 4Z2WA 2R0FA 2ZGUA 1LHOA 4JAAA 4M0NA 4ZXKA 2VQ0A 3WDXA 4OFGA 1OLQA 4Q4V3 3AZXA 4YZ3A 2JICA 2H6BA 2P3JA 4BMBA 4I2OA 5J96B 1LJ7A 4KGGA 3ZDSA 3LCPA 4XF1A 2EAKA 5AVPA 1ZRRA 3ZMNA 4CDUC 1BKZA 5DDJ3 3GBWA 1FI2A 4AGRA 4RHV2 1U12A 4A7YA 1AJKA 2F6BA 2A3XA 1RHI2 2VVEA 4IEUA 3I8TA 3N7JA 1I9RA 1NE6A 1QXJA 1SLAA 3MEPA 5CU1A 3S7IA 1FV3A 4XFCA 1FOD3 3OPZA 4EWAA 5FLJA 1FMD3 4COUA 1AR73 1NCRC 2RJLA 1YJLA 2E7QA 4SBVA 1HRI3 3JBG1 4AFBA 4GMP0 2IXLA 1R1ZA 5C9AB 4XXPA 3ZN5A 4JC1A 1MVQA 3PVNA 4YGEA 1HX6A 3ZFFA 2Y0IA 4I01A 4R4ZA 1SMVA 3UKVA 3UKNA 2WNVA 1VBB1 1YRZA 3KCYA 4KBBA 4YVWB 1AYN3 1NXD1 3T1LA 4YARA 3IN9A 3V0AB 2VW0A 3SXWA 3FLTA 4FOVA 2XJPA 4RS5B 3FBYA 1URXA 1DIWA 3FWEA 1KDKA 3JQXA 4OI4A 1W6MA 1ZRFA 3R4SA 2DTYA 3H7JA 1U5ZA 3G6JB 1OSGA 3FLPA 3NWKA 1R092 4K40A 3WVJA 2PHRA 5FAXA 1VALA 1UIJA 3ILFA 2Z42A 5I91A 5DG2A 2WZR1 4XDQA 4R9DA 2VW2A 5FLHA 4WVWA 2HJIA 1FXZA 3PLQA 3VBSC 4ITCA 1WLTA 4JGZA 3OY8A 1BMV2 4DRRA 2G9FA 2EALA 4UXAA 4XFGA 2EVXA 2NMNA 3QLQA 2UU8A 4CDQB 2IZWA 3AFGA 4YVSA 4IV1C 1TE1B 3DPRA 4NVPA 3V65A 1V6LA 2R063 2RR13 1RVF3 5L19A 4XOGA 2ZAHA 2HWB2 4BQ1A 1D4M2 5CIRA 4WM8C 2A7AA 4BH9A 1RTVA 1QJY1 1OPMA 1CESA 1WA4A 4IEXA 4AVVA 5ABJB 2PAKA 3BALA 1CAUB 4MGYE 4W6WA 1OOPA 4AI3A 4CDQC 1LU2A 4NHKA 5E16A 1CAVA 5KXBA 1S0IA 3HAGA 1C1LA 3WY6A 4IEYA 3TNQA 4PBOA 4IEOA 1RGSA 5EV7A 1IS5A 4E9KA 2EXIA 1S0EA 1EYBA 1RIRA 2IXCA 2IFRA 3FE5A 4AFMA 3O14A 4PIXA 1X8MA 1ZZCA 4Q29A 2DFBA 1OMIA 3GYDA 1DGRA 1X33A 2AZ5A 2XWJB 3SCHA 5A32A 4LLFA 1RUI2 1ZNPA 5FPXA 1BEV3 1CAWA 1HIXA 4N43C 3RNSA 2KM2A 2A6YA 3WQ0A 5IK8A 1QMJA 3RJRA 1S0BA 3ECQA 2CY6A 1W2UA 1RITA 2DCYA 2GC0A 4ONUA 5FOBB 3MZHA 1U5IA 3FX3A 4XEZA 1JXNA 2FBEA 1RUC2 2P2KA 4LBQB 3ACLA 4L92A 4FPHA 4Q4W2 4KWLA 4MH0E 4CEWB 1MS1A 4TYSA 2JDZA 3I54A 2E7AA 2ZMLA 2MPFA 4Y5Z0 3TB0A 4AVAA 4JGYB 1N1TA 1FPN1 1R083 1LR5A 2YHJA 4C0HA 1QQP3 3CL1A 4I0WB 2XJVA 4KG0A 2ZX4A 1Q56A 3EJKA 2CGNA 1QJX1 1TQ5A 3D4KA 3WG1A 4QMAA 2YV8A 3VKFC 1C8M2 1NA1A 1DYPA 2VOXA 1AL22 2QNKA 1AR63 3D8CA 4RR3B 5CFCA 5HBAA 4BLIA 1H30A 2PHFA 4CEWC 3GNEA 2WLPA 4YGDA 2D97A 1UD1A 4WVMA 4L11A 3M1HA 2VMHA 4JGYC 1NCQA 3ZN4A 2R071 4Y22A 3EBRA 1V9U1 2TEPA 1QNYA 1AJOA 4AI0A 4AHWA 1S0FA 5F5QA 1F8VA 4WZFA 1MZEA 4GXLA 4YRDA 3R6SA 1W6OB 3NKTA 3VHNA 3V0BA 5CFDA 3ZX7A 3L2YA 3QH7A 3TYJA 3ZO0B 2I2SA 1C3HA 3MDPA 2DUPA 3M3QA 5J3UA 1VBC3 2XJRA 4TLFA 4COZA 4KQ7A 2DVGA 3VZMA 3WD5A 2C5DA 1H2MA 2XGXA 3ALQA 1XE8A 3VBOB 2JE7A 3VBHC 3E6CC 2CWSA 3JUUA 3AYCA 4MXWB 2W52A 4H7LA 3JBG2 4INDA 2ZS6B 3P3PA 1ZBE3 3TN93 4WVVA 4HETA 1D4VB 1GQGA 4YW1A 4CDWB 2V5YA 1Q5OA 2JG9A 4AI1A 1QNWA 1VRH1 1GFF2 4GQ7A 4AQTA 1VBB2 5K0UC 1BZWA 2ZGLA 1K5MB 3HR9A 2SLIA 1J3QA 4OULA 4FAHA 3J4UH 1VBE3 4B4QA 1RUD3 1E57A 1EV13 3E6DA 2EF6A 4XMAA 1WW6A 2PQQA 3VBOC 1AF9A 1ZBA3 2DYCA 4YW3A 3ZFGA 4E4SA 4QD2A 4G4FA 1KQRA 4F8AA 2WFF2 5CNAA 3ZFEC 1G9DA 4CDWC 4UBGA 4S2FA 4XQDA 2JXAA 2WZR2 3AJZA 2FZ2A 3T2TA 1OA3A 2Z5WA 1H2KA 3S30A 4UBHA 3ZPYA 1DQ2A 1K5MC 2Y0OA 1LENA 3ILNA 1RUJ1 1WCSA 4LO5B 4QPGA 3VHPA 5JPNB 2D3SA 3U11A 2ZA9A 4PBPA 3OGJA 4RD7A 2GN7A 3M7AA 4H3WA 1QJU1 3FFQA 5KXCA 1O3TA 5C8WA 3FC0A 3K51A 4HMZA 3M2MA 4AEDA 2OA2A 5BNNB 1Z7S3 3L2HA 4H14A 2W68A 1YI9A 2WS91 3ZFFC 4AW7A 1PIV1 1O3RA 1MEC3 1QJY2 1WW5A 2DU0A 2RS32 4NN0A 4LNVA 1UW8A 2QFEA 1GZ9A 3ZN6A 1S2BA 2B39A 1V00A 4LO4B 2BFUL 3LGRA 2ZGRA 1HRV3 4FPKA 1RUG1 5L73A 5FLIA 1LOCA 2GMMA 2ZHMA 2OYZA 1AXZA 3QH6A 4R8HA 3H9AA 1W6NA 1QXPA 4C1XA 2WSVA 1RJ8A 4OVEA 4D94A 4XFHA 4AYUA 1CAXB 3R4DB 1PO13 4JDOA 3MW2A 5JSOA 3AKPA 4A7KA 1KS4A 1WW4A 1MQTB 2KA3A 5IUQA 5AC92 4IV3C 4JRLA 1YXWA 2WNUC 2BNNA 2VECA 1LOGA 3MFAA 1J58A 1I5ZA 2UY9A 1CD3G 3VN4A 3QD6A 3WG3A 4BYYA 2HWF1 2HEVF 2RMU3 3FLRA 4DFSA 1AX0A 2NP0A 1BBT1 3H1MA 1UN1A 4JCKA 1XNDA 1J1TA 1ZX5A 2ES3A 2ZGKA 5DZFA 1JUHA 4L9BA 1SBEA 2MHFA 4AHXA 4YYOA 1SACA 4D7SA 1IOAA 1RUE3 2WWSA 4YZ4A 1MQTC 1N1SA 4HVOA 2WC2A 4Y1ZA 4E27A 3E5UA 4NO4A 4IL7A 2C1FA 4BZ4A 3QBQA 3DUIA 1HQNA 1TME3 1GV9A 2YZ4A 2WQZC 3NJZA 5GZFA 1VBA3 3I4IA 1FPN2 4Q0PA 5C9AA 1R1A3 2QJVA 2VUJA 5GLZA 4S2DA 2ZABA 1YNAA 1OA2A 1PK6B 2N7GA 3AP7A 3IMNA 1G8WA 4EWDA 4HT1T 5JOXA 1A8MA 1G9FA 3VBSA 4YVWA 3CJXA 1ND2C 4MXVA 1V6MA 4E4DX 1QJX2 4RFT0 2O0OA 1GNZA 1AX1A 2R041 3A0KA 4OHYA 2CNAA 1KFUL 2ZPXA 3WW1A 3TBDA 2E53A 3MIGA 1NLRA 5C4WB 2JG8C 3NO8A 1BVVA 2R072 3RJ2X 1V9U2 2DUOA 4A7ZA 3TWIA 5KXEA 4WM8A 5JAXA 1M4WA 1PGL1 3R4UA 4RHV3 1VB2A 4B3NA 2HWC1 3AKSA 4B7KA 1MS3A 5AVAA 3KQRA 2DV9A 1MS0A 4BE3A 1POV3 4CDQA 1RUH3 1QJZA 1V6OA 2GNMA 5DUWA 2GMEA 3EHKA 1YI7A 2GNBA 3VBUB 2E51A 3B02A 3RMXA 4YW4A 5LK5A 2WA3A 3O7OA 5BUVA 1DF0A 4YG0A 2ZHKA 2YGMA 3FUOA 2XH6A 3PMSA 3WZ1A 2VU9A 4OHXA 2LUWA 3IM0A 2HWE3 4IEZA 4ASMB 4M3CE 5T3NA 2Q1ZB 2QZ2A 4IETA 1VRH2 3TNPB 3FBMA 1CAUA 3MI8A 2XHKA 5F1RA 5GLWA 1WMDA 1R093 3MIEA 3EXUA 1F5JA 4CZSA 1O5LA 4LE4A 1COV1 4YNIA 2VG9A 2B8MA 3ROUA 1Q8SA 4M00A 1B09A 1PVC3 4Y4YA 3URFA 1H2NA 1H0BA 1OPOA 3WHTA 2O8OA 2OZ6A 2D5HA 4AEJA 1RUNA 1HKDA 3GF6A 4OUMA 1NY71 1UU6A 2DCKA 3S6PA 4I0BA 5I8SA 5C8CB 3WDYA 3D5OA 4MZUA 1DZQA 1ULFA 3FZ3A 5FMOS 4JTOA 4LO8A 4DZGA 1RUJ2 2AENA 3UJOA 1OD5A 3X29B 1CPNA 1RJ7A 3WINE 5F6LB 3FUQA 3GZTB 4YZ1A 2AH2A 3O5SA 4XFAA 1QJU2 1DG6A 3KLSA 1WLCA 1DGRN 4PLMA 2TBVA 4Z07A 5BNOB 3PVOA 4XETA 3WDVA 1GZWB 1HXS1 2WS92 1PIV2 3GALA 1O91A 1AL0G 2WINB 4CEWA 2PLV1 2Q4SA 3ZXGA 3WX5A 4BOWA 4JGYA 1IKPA 4ISRA 1O7FA 1ENQA 2P37A 1RUG2 3ZYRA 2WZPP 2BVBA 3MF6A 2VVDA 1IS6A 3MIHA 3DV8A 1AYM2 1LHNA 1C57A 1QH7A 2JE9A 1G86A 4XMIA 4AXOA 5ACA1 4HFSA 4MUVA 1WBLA 5JWPA 3ZYJB 1SCSA 2FMDA 1PZ8A 1HV0A 1PM7A 2ZHLA 1OFNA 5I0UA 2QDNA 4A2UA 4WV8A 3B7MA 2Q5TA 3AZWA 5D8AB 1F2NA 5SV5A 1KD7A 3QOPA 1YIFA 3OD0A 1W6PB 1GBGA 1V6IA 2IFWA 4LHKA 3O0WA 4FPGA 1WW7A 3RWNA 1W6OA 4LBMA 1TNRA 1Q8QA 4I0AA 4AEDC 4XHXA 4AQSA 1BBT2 2ENRA 4GKXA 1A78A 1RUC3 4LHNA 5K0UA 4GMP1 1O4YA 3IWZA 3AXDA 2XBO1 4K8FA 4TSVA 4YW5A 3WP3A 3KT7A 1FV2A 1F9KA 2NLRA 1IS3A 4Q2FA 4EN8B 4KL1A 3H1WA 3V56A 1ULGA 3VBFB 2UYAA 1UL9A 4AG4A 1VLNA 3G7DA 3VBOA 4Q4V1 1MS9A 1UMZA 2IXHA 4K6BA 1CN1A 1GKBA 4MXWA 4LA3A 5FPZA 4LE3A 5FO7B 4XJ9A 3ZFEA 3FMGA 4SLIA 5KHKA 4CDWA 4C0BA 4CEYC 4P5HA 4OZXA 4KU7A 5DDJ1 3M4FA 2ZGNA 5CAZA 1AL23 1GZCA 2VOKA 1K5MA 5GLTA 5I8TA 1BXHA 4RSUA 2OUHA 4GWMA 4LA2A 2R042 1FOD1 1FMD1 3OYWA 2JECA 1AR71 5BYNA 1IPJA 4YLZA 3S0MA 1HRI1 4N9IA 3VUOA 1DDLA 1DQ0A 2XJUA 2BFUS 1PO23 1GICA 1UU5A 3VZNA 5BXXA 1OQ1A 5LRRA 1H8TB 1PGL2 4XE9A 1W6QB 4URTA 4E4ZA 1RL3A 2HWC2 1AYN1 4EN7B 2GN3A 5E89A 3MLKA 3PJQA 2HWD3 3VDDB 3D0JA 1H9WA 2Q8OA 3I59A 3W9AA 5LK7B 1EPWA 2IC1A 2GALA 3B5LB 4QGMA 5LEJA 4O9GA 1XQNA 2A6WA 3U4XA 4Y1YA 5C9AC 3WXPA 1WUVA 1H8TC 1H1AA 2W39A 3BTAA 5IT6A 2QDRA 4Z82A 2YXSA 1NE4A 3ZSJA 2FMYA 1UKGA 3E6BA 4YVWC 5GZDA 1VBD2 2ZACA 2RM23 2XPJA 1D0GA 4IV3A 4FTSA 1C5HA 2Z79A 4RS5C 2WNUA 2CV6A 3VDDC 2VGDA 2D6MA 4QU2A 4RGGA 2R061 4CYDA 2V73A 2D93A 2RR11 1RVF1 2WFPA 1BCXA 1D2QA 4PDWB 2WFF3 3I7DA 2OVUA 1B35B 4XF3A