3UKUG

Structure of arp2/3 complex with bound inhibitor ck-869
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
144
structure length
138
Chain Sequence
SARFRKVDVGEYDENKFVDEEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arp2/3 complex with bound inhibitor CK-869
rcsb
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
total genus 38
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3ukuG00
1K8KG 1U2VG 4XEIG 3UKUG 2P9LG 3DXKG 3RSEG 2P9IG 2P9SG 3UKRG 4JD2G 2P9UG 1TYQG 3DWLG 2P9PG 3DXMG 2P9NG 3ULEG 2P9KG
chains in the Genus database with same CATH superfamily
4C9BB 1E7VA 4UI9K 1V55E 1YA0A 1OWLA 4FLBA 4FJZA 5ITZF 2F8XK 3GZ1A 4U96D 5G04C 1X5BA 3ULYA 2P9KG 3DSWA 4GYYA 1VDYA 1P5QA 4DK5A 2V4HC 3ZW3A 3ULQA 3Q75A 3DEPA 3C5RA 3DEOA 3AG2E 4WNEA 2E2EA 2I9CA 2UY1A 2QFCA 1EF1C 3PDNA 2IU1A 3J5PA 3FTYA 3CSTA 3RRMB 4JPSA 3DSVA 2AXZA 3QK0A 3FWVA 1UJKA 3FU5A 4WNFA 3UM0A 1HG2A 1ZBPA 2PL2A 3PVLA 2KCLA 4O1PA 1E8WA 4ANXA 3APDA 3G2UA 1MX2A 1MX4A 4LNUD 5HQ8A 1S70B 3FTZA 4GZ6A 4A55A 1GW6A 4I17A 4UUCA 3HIZA 4OVVA 1OCCE 1TNBA 3CVQA 3DWLG 2R59A 5BV0A 5FQ6A 2WXHA 5C2YA 2YHEA 2L0TB 2FI7A 1G3NB 3ONLA 3AS5A 4G24A 5AARA 3JUEA 2H6HA 3CVYA 5CEDB 3BU8A 3T8MA 3DSXA 1HZ4A 2UY1B 5AQBA 3QDNA 1ZU2A 5D0QD 2LXMA 3MGBA 2GRRB 3FTXA 4ABNA 1KLXA 4HRNA 4OAVB 5CCMA 5LP0A 4GMJA 4BWRA 4IRUA 4MRUA 2XPIA 1RW2A 1SW6A 4NURA 4ANVA 4B89A 4B94A 3PRZA 2IOSA 1IHBA 3GYZA 1WG0A 5ENOD 3MYVA 1EYHA 3KEZA 4G2VA 4F1SA 2X6JA 3FUMA 3AJIA 4J0UA 3RIBA 4FHKA 4G11A 1BU9A 3CK7A 3FTWA 4XKCA 3SFZA 3R7QA 3G2WA 3IHVA 3AG1E 4I9EA 1FT1A 1OXJA 4ZFHA 4RVBA 4OAUC 3FUFA 3FUIA 1N95A 1YCSB 3CK8A 3JYSA 4C0EA 1LF8A 4KMOA 3KAEA 2GRLA 2XCBA 3AU4A 2IOLA 2ZXWE 1NA3A 1TNZA 5ENSD 1U3DA 2LSUA 4CGWA 1TN6A 5FWQA 2AVPA 4GTOA 1OY3D 2XCCA 3TWWA 5G2NA 5CRVA 1BLXB 3T5VA 1H6KA 3HHMA 4U0SA 5CHEE 2FEZA 5KCMA 4BT9A 3RJVA 3L22A 3ZFWA 5D2MC 2XRYA 2L0IA 2WXGA 4YVOA 2ZU6B 1WM5A 3TG4A 3ZPJA 2A5EA 5EDSA 4V3IA 4AV7A 4F7AA 3RK6A 5CECB 4RLYA 4GCNA 3CVVA 3P2BA 4N3BA 3PZ3A 2DVWA 3NZSA 4N5CA 4HOTA 4HB5A 5FT9A 2Y69E 5DBKA 1O1SA 2C0MA 2DBAA 1HF8A 3LDZA 2RD0A 1WAO1 4J8FA 3CIAA 2Y1LE 4AM9A 3HXBA 1H2VC 4WWOA 2XZDG 4URKA 3L17A 4CRWA 4J6IA 3Q15A 4I6JA 4N2QA 4NIKA 3IV0A 4TUMA 3ZYQA 2BF0X 3QWVA 2XGSA 4KYOB 3QKYA 1NL4A 3ZU7B 5LCWC 5HS0A 3E37A 3S7BA 4TUUA 1QNFA 3WXXA 1HS6A 3JXIA 3CHRA 4U0UA 4DX1A 2PQNA 4U8HA 4JVSA 5BXUA 3CHSA 2NXPA 3Q5MA 5CBNA 3JQ1A 1DVPA 3C98A 1ZB1A 5J08A 2VGEA 3UTMA 4HI9A 4FC8A 4PUCA 4BTBA 2VJ8A 3MKRA 5JJ6A 4CT4A 4JC8A 2PZIA 4I6GA 1K1BA 2ONDA 3J5QB 3ML8A 3UT4A 3CVXA 4AOFA 4UWGA 2CG2A 1IYGA 2EIJE 3SF4A 4N3CA 1S64A 4N5QA 3D9JA 1HFAA 4O60A 4CDNA 1ELRA 1FVFA 1MHQA 3ESLA 5B1BE 3HXEA 3CVWA 2VTBB 3U4TA 4WAFA 4GTRA 3LY8A 2R02A 2AWIA 4YDEA 3IXEA 4GU5A 3TWUA 4FU3A 4H7XA 1FVHA 3FTVA 3EU9A 3IHYA 4AXHA 1FPPA 3PUJA 1SA5A 3Q4AB 3FUNA 2WXFA 1KT1A 2CHXA 4XI0A 3EDTB 1INZA 3ZIMA 4R7LA 3RRNB 2RG8A 3D9OA 2KM4A 3CVUA 1E8YA 3TWSA 3ZXPA 3EHRA 3FUHA 2H6IA 1FCHA 4JHKA 4IYPA 5G05J 4Z68A 4F1PA 4ATGA 3ULEG 2DIWA 3IBEA 4GZ5A 3WG7E 1E8ZA 2KC7A 1JPLA 2OEWA 1NZNA 4LRZA 2I6HA 3AG4E 2V4LA 3ASOE 3RU0A 4APOA 1Y8MA 4F53A 3C3OA 4A3VA 4BFRA 3O48A 3QC1A 5T3RA 2VSOE 3FH5A 2P2CP 2H6GA 4TXPA 1UG3A 5A7DB 4K5CA 4MKTA 2RKKA 3D9PA 5EN5D 3UPVA 1H19A 3PZ1A 1QZ2A 5AAOA 3U3WA 3CVLA 2R2LA 1WY6A 3ASHA 4U04A 4M3OA 5BUZA 5AENA 2AW6A 4GTTA 4ILGA 1AWCB 5ENRD 3EHMA 4GA2A 2FO1E 5KBAA 2KATA 4A3TA 4HS2A 5EYPF 3OTNA 1PY1A 1SVXA 2X6FA 5KJLA 5EILA 5AYWD 4CCAA 3L6AA 3PZ4A 1MYOA 1MZCA 4U8VD 4UQZA 2EILE 3ZGQA 4UWFA 3ZN3A 4DX2A 2VSXE 3Q79A 3Q78A 5EIBE 2ZGGA 4RSYA 4TXQA 4MBGA 4EZLA 3TL5A 2WXIA 3DSUA 4DX5D 3JQ0A 1E90A 3HDXA 4Y6CA 5E75A 4ANWA 4YDYA 1IQRA 4GTSA 4XKBA 5KNGA 2X6KA 4EBAA 1DC2A 2WXNA 3MA5A 3QARA 4K5BA 3SY2A 3MZLB 2JABA 3LEWA 2P9LG 2KZTB 4I2ZA 2FF4A 4BY6A 1Q2ZA 4BESA 3QWPA 2QY7A 3QWWA 4PDXA 1H2TC 4YDWA 2RFAA 4AIFA 3FTUA 3P1UA 4J8EA 4FULA 4P29A 1NFIE 3Q7FA 2I1JA 3S7FA 1X81A 5BV1A 3W9FA 3L16A 3ZYLA 4DX6D 4OYSA 5CCLA 1Z3XA 4EHMA 4G8LA 4UWLA 4GZ3A 2IEJA 3QJZA 3RO3A 3LXUX 4WUYA 5G55A 4LNBA 3G2SA 3MKQB 3ZNGA 2XHEA 1ELWA 2EQXA 5EX3A 1XNFA 5EX0A 3PS6A 2EIME 4HOQA 1YMPA 2NSZA 3S2AA 4BT8A 3VLFA 3C72A 1Z6TA 1EPUA 3NBNB 1E8XA 1EDUA 3D9MA 3CSFA 4J8SA 4UWKA 5FZRA 1DCQA 3CQCB 4PH4B 2BKGA 3KEAA 3FUKA 3Q9UC 3SI5A 2Y4TA 1HE8A 3CVNA 3FULA 2WB2A 3BEEA 5JJ7A 2WQ7A 2V5QC 4HOSA 3LVQE 2PM7A 4ANUA 5BPPA 2GRMA 4LCTA 3SFXA 4CDMA 5FINA 3FU6A 2LSVA 2R17C 4AY6A 4L7TA 4JXTA 3LY9A 2MOWA 3ABLE 4ACLA 3ABKE 3LYAA 3RKVA 2IF4A 3TGOA 4XIFA 4B8CB 3MEKA 4O1OA 1PAQA 4LNGA 1Z3YA 4O6FA 2AXVA 4A1SA 1HO8A 4W9RA 1NI1A 1N4RA 4FJYA 1H2UA 4XX5A 3BUAA 4KZCA 2Y4UA 4N3AA 4J8DA 4KT6B 3K9IA 4LERA 5H7PA 4DLQA 3AAAC 3JCKC 1SZAA 3ZUVB 3FFLA 4YDOA 2LUHA 2QC9A 1TNYA 3LS8A 1H6PA 2NYJA 1YYHA 4HVBA 5ENTD 4BETA 4K5AB 5B3SE 1TR4A 2NC9A 2VSYA 3S7JA 4G25A 3CHPA 3FDHA 3RSEG 2LAHA 1TNOA 3MV2B 3L9TA 5ARGA 3HXDA 3ASNE 5FZQA 3ISMC 3UMVA 3C3RA 2ZGDA 3UIOC 1H0AA 3PEUB 1OCOE 4N39A 3I5PA 5IY5E 2XEEA 1BD8A 5AQAA 5HRYA 3KSQA 4C0MA 5J90A 2JEKA 4GYWA 3TWQA 1N94A 2P58C 4B93B 5BXOA 4YNDA 3FHEA 3NOGD 1U2VG 4APFA 4JEUA 1SZ9A 2IQCA 1JWGA 4L2LA 4L2YA 3R9AB 3KD7A 2OEVA 3FY4A 2XEHA 1IQUA 4NQ0A 5LX8A 1D9SA 3FUEA 5EIDA 4RG9A 5KJNA 4HOUA 2R05A 4RG6A 4E85A 3ZHEB 3KS2A 3B13A 3CEQA 3AU5A 3JXJA 4U07A 4XI9A 5AJLA 3UM2A 3R9MA 4Q96A 4AJWA 1OWPA 3G2TA 3UIPC 2DYSE 1MX6A 5ENQD 1FT2A 3D3MA 4DRXE 2DZOA 3T9KA 4I43A 4KVMA 1LD7A 1AP7A 3TXMA 3BQOA 4EQFA 3I4RB 4JB8P 4ZHBA 3D9KA 1UJJA 2KZTA 2HE0A 1OCZE 2VGXB 4WNGA 2OV8A 1BI8B 3LJNA 1N4SA 2HO1A 3DBSA 4GTVA 1IHGA 1RZ4A 3ZVVA 2PNNA 1N54A 3FUJA 3FP3A 4CYMD 1IXVA 3TG5A 4GA0A 4GMRA 5FZSA 1UN9A 4WWNA 3URZA 3IEGA 2MYOA 2C0LA 1TNUA 4WWPA 4B8AA 2MHKA 5CBOA 3NB2A 4MS6A 2GRQB 4HLEA 2LAIA 4HLLA 4DI3A 2DCPA 1H6OA 1WDYA 1OWMA 3D9NA 4H7YA 2OVFA 2ETCA 4FP7A 4I1AA 4JA9A 2J4BA 3EIJA 3TWTA 1JCRA 3CHMA 4HQDA 1MJ0A 1SQMA 4BX9A 1L5JA 3DSTA 2YINA 3RAUA 1QBQA 2HYZA 2I2OA 4RQIA 3UXGA 4N2SA 3UT8A 2RFMA 5C1DA 4GPMA 2XS8A 4K03A 3W9GA 3ZKJA 4LG6A 4FHJA 3V31A 3O4ZA 1BPOA 2B6CA 4Q69A 4KZ0A 5JJTA 4I1OB 4M7CA 3QB2A 3Q47B 1Y6IA 5CMYA 4GZCA 3ZXSA 2IJGX 2F37A 5FJYA 4ATZD 2F8YA 3HXFA 2XGMA 3UUXA 5KWDA 4CEMA 3SO8A 2BTDA 4UI9C 4EPZA 3BG0B 4DJAA 3B95A 3LPZA 3HYMB 4A1GA 5A6CA 4EECA 2OCCE 1N4PA 4U63A 4MLPA 1HX8A 5ENPD 3R7RA 2WQHA 2ZIRA 2LNIA 2P9PG 4ME2A 4DPRA 1TN8A 3OXFA 3LY7A 3UI2A 4KBQA 3CLJA 2GGFA 3E4BA 2FBNA 2P9SG 2AXUA 2J9QA 4LSZE 5FQ7A 2XS1A 1K1AA 4GTPA 5JMND 3LVRE 2DWZA 3QOUA 2WMNA 4J7WA 3LKUA 2WXKA 3KSLA 3U64A 3FEYA 4UQYA 5B1AE 1UOHA 2IFUA 1N4QA 2Y0BG 4JHRA 3FUDA 3OXGA 2IY0C 2CG3A 2BEDA 4ILHB 4CGVA 4F3VA 2C2LA 3MCXA 3CK9A 3E30A 3FU0A 4I9CA 1DNPA 4XZ4A 4BERA 1PC2A 4HNAD 1TEZA 2X38A 4EZKA 2VGXA 4U0ZA 2V5FA 4HORA 2AJAA 2L6JA 2WMOA 4G23A 2XEVA 4U95D 1JCQA 1OUVA 4HXIA 5E76A 4BX8A 3FH7A 4UI9J 4DLOA 5EKQD 1IKND 3TWVA 3PZ2A 1OT8A 4I1MA 2J49A 5G04J 1O1TA 2WXQA 3NOCD 1E96B 4JW1A 2WM9A 4UWHA 3D9HA 3PZDA 3VLEA 4D10C 2M63A 2CFZA 3Q73A 3EHQA 4HBDA 1UN8A 3ABME 4TV3A 1TJFA 3UT7A 4NACA 2OVBA 1OWOA 5ANLA 4Y6WA 5AIJA 3VLDA 3Q9NC 3ZHEA 1HXIA 2R5SA 4EBAG 5FQ8A 3CGHA 3UKRG 3SNXA 2XENA 3PNTB 3NAWA 4AY5A 3AS8A 4J8YA 4E6HA 3S7DA 3QAQA 3EIQC 4AP2A 2XRZA 2XQ0A 1N9AA 3PEVB 1KZOA 2L9BA 2F0YA 2YQ8A 1HG5A 2X6IA 5CRUA 3VTXA 2V0PA 4C48B 3ESKA 1LTXA 2BUGA 4CDRA 3PNLB 2GRPB 4G8KA 4CZ2D 5BNWA 3N71A 2WQ6A 2KCVA 3UM1A 5T4YA 4F6RD 3D9IA 1S0PA 4KXKB 3CHQA 2VQ2A 3DSSA 4ILIA 3PE4A 3V79K 1K8KG 5KJMA 3SZ7A 2I1KA 3ENEA 4GPKA 3CV0A 2LO6A 2ETBA 5CERB 3GW4A 4QFVA 3MJWA 3GZSA 4GZDA 3HXCA 3FTSA 3TAXA 1TYQG 3OAWA 3HG0D 4GTMA 1ELKA 2XGOA 3Q49B 4AEZC 3B7TA 2FULA 4JD2G 3B7UX 3NQPA 1BI7B 4I2WA 2Q7FA 4JEHA 5D0OD 3B7BA 2J4DA 1LD8A 4A63B 3B7RL 5FQ4A 3I3NA 1K3ZD 3E32A 2WXJA 3EUVA 4DUIA 2XPZA 4B0ZA 4TRQA 2R03A 2P9NG 4X8QA 3SFYA 4BEPA 5T8IA 3T8KA 3FH8A 4ACKA 4LUNU 4L9PA 4PS7A 4GTQA 1QQEA 3DPYA 4NRHB 3DXKG 1N0RA 4GB9A 4U8YD 2PM6A 4JA7A 2IO3C 4TXRA 3PUKA 3L08A 3L54A 4PS8A 2EINE 3PE3A 3OXLA 2WXMA 4KVOA 3SBSA 5KJKA 3SD5A 3V2OA 4DI4A 5AN8A 5AQ7A 2QZAA 2EIKE 2ILRA 3DPDA 1KZPA 3LCAA 1KT0A 2HM8A 3CQGB 1QYMA 2WPVA 2P9UG 3HRAA 4GCOA 1HH8A 3C3QA 3F6QA 1OCRE 1Z5SC 4L1BA 4EZJA 2HR2A 3NZUA 1D8DA 3HVEB 5JHBA 1JUQA 5HI7A 2QYUA 2GROB 2ZISA 3CKCA 5AQ9A 1W3BA 2J8SD 1NP7A 2QYJA 3I4GA 4QQIA 2X3MA 2A5UA 5FIOA 2VGYA 2KCKA 3TJPA 2E0IA 3APCA 2YHCA 3D9LA 2J08A 5G05C 5DIZA 5LOZA 3X2QE 3TXNA 3ONKA 3UINC 2UWJG 1MQSA 1N52A 3NF1A 5ANRA 4WNDA 3TWXA 2WXOA 5EYLA 3QNKA 4JZYA 1NA0A 5HKPA 3UKUG 1A17A 4Q94A 3B7SA 5D66A 1N0QA 2WVIA 5ENNA 3APFA 3SHFA 2BKKB 3EU5A 3UQ3A 2XPYA 3E34A 4FADA 3HVEA 1UW4B 3U66A 2GRNB 3ML9A 5A23A 4U7EB 3E33A 5BW8C 3SGHA 2YNQA 2MRIA 1E7UA 4BSZB 2IONA 3RO2A 1V54E 3TWRA 2L6BA 2V8SE 3VTYA 3V30A 3SBTB 4GYOA 3RRUA 3CKBA 3SQVA 3FU3A 2B0OE 3PREA 4HFGA 3EHNA 3AS4A 3MX3A 3UM3A 4OVUA 4HI8A 5BT1A 3JUIA 2CHWA 2Y3AA 2VSNA 3DRAA 5ARFA 5CEAA 1U3CA 4GMLA 3G2VA 3BG1B 4FA6A 4L23A 2P9IG 4BSXA 3T5XA 1JCSA 4UQXA 4YVQC 2OOEA 3DXMG 3ASDA 3ZYKA 4XEIG 3ZEFA 1XGWA 5M72A 3ASGA 3ASFA 4XE0A 2LXLA 1TJCA 3ZRHA 3FEXA 3L13A 4K0RA 5FTPA 4IULA 2A4ZA 4JL0A 4G1TA 2CHZA 1HU3A 2WXPA 5CMWA 4IN3B 4DX7D 3LJ3A 4FLHA 1SA4A 4GAAA 3V2XA 5LCWJ 4JHJA 4LEUA 3ZYMA 1OWNA 3UX4A 4I6EA 3MV3B 3MKQA 2ETAA 3U9WA 2XZTG 3CR3A 4BTAA 1A5EA 5LFAA 2IO2C 3CHOA 2KXPC 1TN7A 2J07A 2J09A 2X6HA 5AJDA 3IKOB 1B89A 2VYIA 5JA4D 2VTBA 1JWFA 3Q7AA 4GA1A 3CVPA 2WXRA 2DYRE 3EJNA 2CFUA 3L82A 3AG3E 5KNHD 3GZ2A 2FO7A 1D8EA 2WXLA 4HRLA 1O5MA 2PQRA 2H6FA 1S63A 2KBXA 1N11A 2GW1A 4HRMB 1DCEA 3PH0C 2DZNA 1KPSB 4CT0A 2JLBA 4PS3A 1O1RA 4G26A 4AVXA 5JHAA
chains in the Genus database with same CATH topology
1K8KG 1U2VG 4XEIG 3UKUG 2P9LG 3DXKG 3RSEG 2P9IG 2P9SG 3UKRG 4JD2G 2P9UG 1TYQG 3DWLG 2P9PG 3DXMG 2P9NG 3ULEG 2P9KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8K G;  1U2V G;  4XEI G;  3UKU G;  2P9L G;  3DXK G;  3RSE G;  2P9I G;  2P9S G;  3UKR G;  4JD2 G;  2P9U G;  1TYQ G;  3DWL G;  2P9P G;  3DXM G;  2P9N G;  3ULE G;  2P9K G; 
#chains in the Genus database with same CATH topology
 4C9B B;  1E7V A;  4UI9 K;  1V55 E;  1YA0 A;  1OWL A;  4FLB A;  4FJZ A;  5ITZ F;  2F8X K;  3GZ1 A;  4U96 D;  5G04 C;  1X5B A;  3ULY A;  2P9K G;  3DSW A;  4GYY A;  1VDY A;  1P5Q A;  4DK5 A;  2V4H C;  3ZW3 A;  3ULQ A;  3Q75 A;  3DEP A;  3C5R A;  3DEO A;  3AG2 E;  4WNE A;  2E2E A;  2I9C A;  2UY1 A;  2QFC A;  1EF1 C;  3PDN A;  2IU1 A;  3J5P A;  3FTY A;  3CST A;  3RRM B;  4JPS A;  3DSV A;  2AXZ A;  3QK0 A;  3FWV A;  1UJK A;  3FU5 A;  4WNF A;  3UM0 A;  1HG2 A;  1ZBP A;  2PL2 A;  3PVL A;  2KCL A;  4O1P A;  1E8W A;  4ANX A;  3APD A;  3G2U A;  1MX2 A;  1MX4 A;  4LNU D;  5HQ8 A;  1S70 B;  3FTZ A;  4GZ6 A;  4A55 A;  1GW6 A;  4I17 A;  4UUC A;  3HIZ A;  4OVV A;  1OCC E;  1TNB A;  3CVQ A;  3DWL G;  2R59 A;  5BV0 A;  5FQ6 A;  2WXH A;  5C2Y A;  2YHE A;  2L0T B;  2FI7 A;  1G3N B;  3ONL A;  3AS5 A;  4G24 A;  5AAR A;  3JUE A;  2H6H A;  3CVY A;  5CED B;  3BU8 A;  3T8M A;  3DSX A;  1HZ4 A;  2UY1 B;  5AQB A;  3QDN A;  1ZU2 A;  5D0Q D;  2LXM A;  3MGB A;  2GRR B;  3FTX A;  4ABN A;  1KLX A;  4HRN A;  4OAV B;  5CCM A;  5LP0 A;  4GMJ A;  4BWR A;  4IRU A;  4MRU A;  2XPI A;  1RW2 A;  1SW6 A;  4NUR A;  4ANV A;  4B89 A;  4B94 A;  3PRZ A;  2IOS A;  1IHB A;  3GYZ A;  1WG0 A;  5ENO D;  3MYV A;  1EYH A;  3KEZ A;  4G2V A;  4F1S A;  2X6J A;  3FUM A;  3AJI A;  4J0U A;  3RIB A;  4FHK A;  4G11 A;  1BU9 A;  3CK7 A;  3FTW A;  4XKC A;  3SFZ A;  3R7Q A;  3G2W A;  3IHV A;  3AG1 E;  4I9E A;  1FT1 A;  1OXJ A;  4ZFH A;  4RVB A;  4OAU C;  3FUF A;  3FUI A;  1N95 A;  1YCS B;  3CK8 A;  3JYS A;  4C0E A;  1LF8 A;  4KMO A;  3KAE A;  2GRL A;  2XCB A;  3AU4 A;  2IOL A;  2ZXW E;  1NA3 A;  1TNZ A;  5ENS D;  1U3D A;  2LSU A;  4CGW A;  1TN6 A;  5FWQ A;  2AVP A;  4GTO A;  1OY3 D;  2XCC A;  3TWW A;  5G2N A;  5CRV A;  1BLX B;  3T5V A;  1H6K A;  3HHM A;  4U0S A;  5CHE E;  2FEZ A;  5KCM A;  4BT9 A;  3RJV A;  3L22 A;  3ZFW A;  5D2M C;  2XRY A;  2L0I A;  2WXG A;  4YVO A;  2ZU6 B;  1WM5 A;  3TG4 A;  3ZPJ A;  2A5E A;  5EDS A;  4V3I A;  4AV7 A;  4F7A A;  3RK6 A;  5CEC B;  4RLY A;  4GCN A;  3CVV A;  3P2B A;  4N3B A;  3PZ3 A;  2DVW A;  3NZS A;  4N5C A;  4HOT A;  4HB5 A;  5FT9 A;  2Y69 E;  5DBK A;  1O1S A;  2C0M A;  2DBA A;  1HF8 A;  3LDZ A;  2RD0 A;  1WAO 1;  4J8F A;  3CIA A;  2Y1L E;  4AM9 A;  3HXB A;  1H2V C;  4WWO A;  2XZD G;  4URK A;  3L17 A;  4CRW A;  4J6I A;  3Q15 A;  4I6J A;  4N2Q A;  4NIK A;  3IV0 A;  4TUM A;  3ZYQ A;  2BF0 X;  3QWV A;  2XGS A;  4KYO B;  3QKY A;  1NL4 A;  3ZU7 B;  5LCW C;  5HS0 A;  3E37 A;  3S7B A;  4TUU A;  1QNF A;  3WXX A;  1HS6 A;  3JXI A;  3CHR A;  4U0U A;  4DX1 A;  2PQN A;  4U8H A;  4JVS A;  5BXU A;  3CHS A;  2NXP A;  3Q5M A;  5CBN A;  3JQ1 A;  1DVP A;  3C98 A;  1ZB1 A;  5J08 A;  2VGE A;  3UTM A;  4HI9 A;  4FC8 A;  4PUC A;  4BTB A;  2VJ8 A;  3MKR A;  5JJ6 A;  4CT4 A;  4JC8 A;  2PZI A;  4I6G A;  1K1B A;  2OND A;  3J5Q B;  3ML8 A;  3UT4 A;  3CVX A;  4AOF A;  4UWG A;  2CG2 A;  1IYG A;  2EIJ E;  3SF4 A;  4N3C A;  1S64 A;  4N5Q A;  3D9J A;  1HFA A;  4O60 A;  4CDN A;  1ELR A;  1FVF A;  1MHQ A;  3ESL A;  5B1B E;  3HXE A;  3CVW A;  2VTB B;  3U4T A;  4WAF A;  4GTR A;  3LY8 A;  2R02 A;  2AWI A;  4YDE A;  3IXE A;  4GU5 A;  3TWU A;  4FU3 A;  4H7X A;  1FVH A;  3FTV A;  3EU9 A;  3IHY A;  4AXH A;  1FPP A;  3PUJ A;  1SA5 A;  3Q4A B;  3FUN A;  2WXF A;  1KT1 A;  2CHX A;  4XI0 A;  3EDT B;  1INZ A;  3ZIM A;  4R7L A;  3RRN B;  2RG8 A;  3D9O A;  2KM4 A;  3CVU A;  1E8Y A;  3TWS A;  3ZXP A;  3EHR A;  3FUH A;  2H6I A;  1FCH A;  4JHK A;  4IYP A;  5G05 J;  4Z68 A;  4F1P A;  4ATG A;  3ULE G;  2DIW A;  3IBE A;  4GZ5 A;  3WG7 E;  1E8Z A;  2KC7 A;  1JPL A;  2OEW A;  1NZN A;  4LRZ A;  2I6H A;  3AG4 E;  2V4L A;  3ASO E;  3RU0 A;  4APO A;  1Y8M A;  4F53 A;  3C3O A;  4A3V A;  4BFR A;  3O48 A;  3QC1 A;  5T3R A;  2VSO E;  3FH5 A;  2P2C P;  2H6G A;  4TXP A;  1UG3 A;  5A7D B;  4K5C A;  4MKT A;  2RKK A;  3D9P A;  5EN5 D;  3UPV A;  1H19 A;  3PZ1 A;  1QZ2 A;  5AAO A;  3U3W A;  3CVL A;  2R2L A;  1WY6 A;  3ASH A;  4U04 A;  4M3O A;  5BUZ A;  5AEN A;  2AW6 A;  4GTT A;  4ILG A;  1AWC B;  5ENR D;  3EHM A;  4GA2 A;  2FO1 E;  5KBA A;  2KAT A;  4A3T A;  4HS2 A;  5EYP F;  3OTN A;  1PY1 A;  1SVX A;  2X6F A;  5KJL A;  5EIL A;  5AYW D;  4CCA A;  3L6A A;  3PZ4 A;  1MYO A;  1MZC A;  4U8V D;  4UQZ A;  2EIL E;  3ZGQ A;  4UWF A;  3ZN3 A;  4DX2 A;  2VSX E;  3Q79 A;  3Q78 A;  5EIB E;  2ZGG A;  4RSY A;  4TXQ A;  4MBG A;  4EZL A;  3TL5 A;  2WXI A;  3DSU A;  4DX5 D;  3JQ0 A;  1E90 A;  3HDX A;  4Y6C A;  5E75 A;  4ANW A;  4YDY A;  1IQR A;  4GTS A;  4XKB A;  5KNG A;  2X6K A;  4EBA A;  1DC2 A;  2WXN A;  3MA5 A;  3QAR A;  4K5B A;  3SY2 A;  3MZL B;  2JAB A;  3LEW A;  2P9L G;  2KZT B;  4I2Z A;  2FF4 A;  4BY6 A;  1Q2Z A;  4BES A;  3QWP A;  2QY7 A;  3QWW A;  4PDX A;  1H2T C;  4YDW A;  2RFA A;  4AIF A;  3FTU A;  3P1U A;  4J8E A;  4FUL A;  4P29 A;  1NFI E;  3Q7F A;  2I1J A;  3S7F A;  1X81 A;  5BV1 A;  3W9F A;  3L16 A;  3ZYL A;  4DX6 D;  4OYS A;  5CCL A;  1Z3X A;  4EHM A;  4G8L A;  4UWL A;  4GZ3 A;  2IEJ A;  3QJZ A;  3RO3 A;  3LXU X;  4WUY A;  5G55 A;  4LNB A;  3G2S A;  3MKQ B;  3ZNG A;  2XHE A;  1ELW A;  2EQX A;  5EX3 A;  1XNF A;  5EX0 A;  3PS6 A;  2EIM E;  4HOQ A;  1YMP A;  2NSZ A;  3S2A A;  4BT8 A;  3VLF A;  3C72 A;  1Z6T A;  1EPU A;  3NBN B;  1E8X A;  1EDU A;  3D9M A;  3CSF A;  4J8S A;  4UWK A;  5FZR A;  1DCQ A;  3CQC B;  4PH4 B;  2BKG A;  3KEA A;  3FUK A;  3Q9U C;  3SI5 A;  2Y4T A;  1HE8 A;  3CVN A;  3FUL A;  2WB2 A;  3BEE A;  5JJ7 A;  2WQ7 A;  2V5Q C;  4HOS A;  3LVQ E;  2PM7 A;  4ANU A;  5BPP A;  2GRM A;  4LCT A;  3SFX A;  4CDM A;  5FIN A;  3FU6 A;  2LSV A;  2R17 C;  4AY6 A;  4L7T A;  4JXT A;  3LY9 A;  2MOW A;  3ABL E;  4ACL A;  3ABK E;  3LYA A;  3RKV A;  2IF4 A;  3TGO A;  4XIF A;  4B8C B;  3MEK A;  4O1O A;  1PAQ A;  4LNG A;  1Z3Y A;  4O6F A;  2AXV A;  4A1S A;  1HO8 A;  4W9R A;  1NI1 A;  1N4R A;  4FJY A;  1H2U A;  4XX5 A;  3BUA A;  4KZC A;  2Y4U A;  4N3A A;  4J8D A;  4KT6 B;  3K9I A;  4LER A;  5H7P A;  4DLQ A;  3AAA C;  3JCK C;  1SZA A;  3ZUV B;  3FFL A;  4YDO A;  2LUH A;  2QC9 A;  1TNY A;  3LS8 A;  1H6P A;  2NYJ A;  1YYH A;  4HVB A;  5ENT D;  4BET A;  4K5A B;  5B3S E;  1TR4 A;  2NC9 A;  2VSY A;  3S7J A;  4G25 A;  3CHP A;  3FDH A;  3RSE G;  2LAH A;  1TNO A;  3MV2 B;  3L9T A;  5ARG A;  3HXD A;  3ASN E;  5FZQ A;  3ISM C;  3UMV A;  3C3R A;  2ZGD A;  3UIO C;  1H0A A;  3PEU B;  1OCO E;  4N39 A;  3I5P A;  5IY5 E;  2XEE A;  1BD8 A;  5AQA A;  5HRY A;  3KSQ A;  4C0M A;  5J90 A;  2JEK A;  4GYW A;  3TWQ A;  1N94 A;  2P58 C;  4B93 B;  5BXO A;  4YND A;  3FHE A;  3NOG D;  1U2V G;  4APF A;  4JEU A;  1SZ9 A;  2IQC A;  1JWG A;  4L2L A;  4L2Y A;  3R9A B;  3KD7 A;  2OEV A;  3FY4 A;  2XEH A;  1IQU A;  4NQ0 A;  5LX8 A;  1D9S A;  3FUE A;  5EID A;  4RG9 A;  5KJN A;  4HOU A;  2R05 A;  4RG6 A;  4E85 A;  3ZHE B;  3KS2 A;  3B13 A;  3CEQ A;  3AU5 A;  3JXJ A;  4U07 A;  4XI9 A;  5AJL A;  3UM2 A;  3R9M A;  4Q96 A;  4AJW A;  1OWP A;  3G2T A;  3UIP C;  2DYS E;  1MX6 A;  5ENQ D;  1FT2 A;  3D3M A;  4DRX E;  2DZO A;  3T9K A;  4I43 A;  4KVM A;  1LD7 A;  1AP7 A;  3TXM A;  3BQO A;  4EQF A;  3I4R B;  4JB8 P;  4ZHB A;  3D9K A;  1UJJ A;  2KZT A;  2HE0 A;  1OCZ E;  2VGX B;  4WNG A;  2OV8 A;  1BI8 B;  3LJN A;  1N4S A;  2HO1 A;  3DBS A;  4GTV A;  1IHG A;  1RZ4 A;  3ZVV A;  2PNN A;  1N54 A;  3FUJ A;  3FP3 A;  4CYM D;  1IXV A;  3TG5 A;  4GA0 A;  4GMR A;  5FZS A;  1UN9 A;  4WWN A;  3URZ A;  3IEG A;  2MYO A;  2C0L A;  1TNU A;  4WWP A;  4B8A A;  2MHK A;  5CBO A;  3NB2 A;  4MS6 A;  2GRQ B;  4HLE A;  2LAI A;  4HLL A;  4DI3 A;  2DCP A;  1H6O A;  1WDY A;  1OWM A;  3D9N A;  4H7Y A;  2OVF A;  2ETC A;  4FP7 A;  4I1A A;  4JA9 A;  2J4B A;  3EIJ A;  3TWT A;  1JCR A;  3CHM A;  4HQD A;  1MJ0 A;  1SQM A;  4BX9 A;  1L5J A;  3DST A;  2YIN A;  3RAU A;  1QBQ A;  2HYZ A;  2I2O A;  4RQI A;  3UXG A;  4N2S A;  3UT8 A;  2RFM A;  5C1D A;  4GPM A;  2XS8 A;  4K03 A;  3W9G A;  3ZKJ A;  4LG6 A;  4FHJ A;  3V31 A;  3O4Z A;  1BPO A;  2B6C A;  4Q69 A;  4KZ0 A;  5JJT A;  4I1O B;  4M7C A;  3QB2 A;  3Q47 B;  1Y6I A;  5CMY A;  4GZC A;  3ZXS A;  2IJG X;  2F37 A;  5FJY A;  4ATZ D;  2F8Y A;  3HXF A;  2XGM A;  3UUX A;  5KWD A;  4CEM A;  3SO8 A;  2BTD A;  4UI9 C;  4EPZ A;  3BG0 B;  4DJA A;  3B95 A;  3LPZ A;  3HYM B;  4A1G A;  5A6C A;  4EEC A;  2OCC E;  1N4P A;  4U63 A;  4MLP A;  1HX8 A;  5ENP D;  3R7R A;  2WQH A;  2ZIR A;  2LNI A;  2P9P G;  4ME2 A;  4DPR A;  1TN8 A;  3OXF A;  3LY7 A;  3UI2 A;  4KBQ A;  3CLJ A;  2GGF A;  3E4B A;  2FBN A;  2P9S G;  2AXU A;  2J9Q A;  4LSZ E;  5FQ7 A;  2XS1 A;  1K1A A;  4GTP A;  5JMN D;  3LVR E;  2DWZ A;  3QOU A;  2WMN A;  4J7W A;  3LKU A;  2WXK A;  3KSL A;  3U64 A;  3FEY A;  4UQY A;  5B1A E;  1UOH A;  2IFU A;  1N4Q A;  2Y0B G;  4JHR A;  3FUD A;  3OXG A;  2IY0 C;  2CG3 A;  2BED A;  4ILH B;  4CGV A;  4F3V A;  2C2L A;  3MCX A;  3CK9 A;  3E30 A;  3FU0 A;  4I9C A;  1DNP A;  4XZ4 A;  4BER A;  1PC2 A;  4HNA D;  1TEZ A;  2X38 A;  4EZK A;  2VGX A;  4U0Z A;  2V5F A;  4HOR A;  2AJA A;  2L6J A;  2WMO A;  4G23 A;  2XEV A;  4U95 D;  1JCQ A;  1OUV A;  4HXI A;  5E76 A;  4BX8 A;  3FH7 A;  4UI9 J;  4DLO A;  5EKQ D;  1IKN D;  3TWV A;  3PZ2 A;  1OT8 A;  4I1M A;  2J49 A;  5G04 J;  1O1T A;  2WXQ A;  3NOC D;  1E96 B;  4JW1 A;  2WM9 A;  4UWH A;  3D9H A;  3PZD A;  3VLE A;  4D10 C;  2M63 A;  2CFZ A;  3Q73 A;  3EHQ A;  4HBD A;  1UN8 A;  3ABM E;  4TV3 A;  1TJF A;  3UT7 A;  4NAC A;  2OVB A;  1OWO A;  5ANL A;  4Y6W A;  5AIJ A;  3VLD A;  3Q9N C;  3ZHE A;  1HXI A;  2R5S A;  4EBA G;  5FQ8 A;  3CGH A;  3UKR G;  3SNX A;  2XEN A;  3PNT B;  3NAW A;  4AY5 A;  3AS8 A;  4J8Y A;  4E6H A;  3S7D A;  3QAQ A;  3EIQ C;  4AP2 A;  2XRZ A;  2XQ0 A;  1N9A A;  3PEV B;  1KZO A;  2L9B A;  2F0Y A;  2YQ8 A;  1HG5 A;  2X6I A;  5CRU A;  3VTX A;  2V0P A;  4C48 B;  3ESK A;  1LTX A;  2BUG A;  4CDR A;  3PNL B;  2GRP B;  4G8K A;  4CZ2 D;  5BNW A;  3N71 A;  2WQ6 A;  2KCV A;  3UM1 A;  5T4Y A;  4F6R D;  3D9I A;  1S0P A;  4KXK B;  3CHQ A;  2VQ2 A;  3DSS A;  4ILI A;  3PE4 A;  3V79 K;  1K8K G;  5KJM A;  3SZ7 A;  2I1K A;  3ENE A;  4GPK A;  3CV0 A;  2LO6 A;  2ETB A;  5CER B;  3GW4 A;  4QFV A;  3MJW A;  3GZS A;  4GZD A;  3HXC A;  3FTS A;  3TAX A;  1TYQ G;  3OAW A;  3HG0 D;  4GTM A;  1ELK A;  2XGO A;  3Q49 B;  4AEZ C;  3B7T A;  2FUL A;  4JD2 G;  3B7U X;  3NQP A;  1BI7 B;  4I2W A;  2Q7F A;  4JEH A;  5D0O D;  3B7B A;  2J4D A;  1LD8 A;  4A63 B;  3B7R L;  5FQ4 A;  3I3N A;  1K3Z D;  3E32 A;  2WXJ A;  3EUV A;  4DUI A;  2XPZ A;  4B0Z A;  4TRQ A;  2R03 A;  2P9N G;  4X8Q A;  3SFY A;  4BEP A;  5T8I A;  3T8K A;  3FH8 A;  4ACK A;  4LUN U;  4L9P A;  4PS7 A;  4GTQ A;  1QQE A;  3DPY A;  4NRH B;  3DXK G;  1N0R A;  4GB9 A;  4U8Y D;  2PM6 A;  4JA7 A;  2IO3 C;  4TXR A;  3PUK A;  3L08 A;  3L54 A;  4PS8 A;  2EIN E;  3PE3 A;  3OXL A;  2WXM A;  4KVO A;  3SBS A;  5KJK A;  3SD5 A;  3V2O A;  4DI4 A;  5AN8 A;  5AQ7 A;  2QZA A;  2EIK E;  2ILR A;  3DPD A;  1KZP A;  3LCA A;  1KT0 A;  2HM8 A;  3CQG B;  1QYM A;  2WPV A;  2P9U G;  3HRA A;  4GCO A;  1HH8 A;  3C3Q A;  3F6Q A;  1OCR E;  1Z5S C;  4L1B A;  4EZJ A;  2HR2 A;  3NZU A;  1D8D A;  3HVE B;  5JHB A;  1JUQ A;  5HI7 A;  2QYU A;  2GRO B;  2ZIS A;  3CKC A;  5AQ9 A;  1W3B A;  2J8S D;  1NP7 A;  2QYJ A;  3I4G A;  4QQI A;  2X3M A;  2A5U A;  5FIO A;  2VGY A;  2KCK A;  3TJP A;  2E0I A;  3APC A;  2YHC A;  3D9L A;  2J08 A;  5G05 C;  5DIZ A;  5LOZ A;  3X2Q E;  3TXN A;  3ONK A;  3UIN C;  2UWJ G;  1MQS A;  1N52 A;  3NF1 A;  5ANR A;  4WND A;  3TWX A;  2WXO A;  5EYL A;  3QNK A;  4JZY A;  1NA0 A;  5HKP A;  3UKU G;  1A17 A;  4Q94 A;  3B7S A;  5D66 A;  1N0Q A;  2WVI A;  5ENN A;  3APF A;  3SHF A;  2BKK B;  3EU5 A;  3UQ3 A;  2XPY A;  3E34 A;  4FAD A;  3HVE A;  1UW4 B;  3U66 A;  2GRN B;  3ML9 A;  5A23 A;  4U7E B;  3E33 A;  5BW8 C;  3SGH A;  2YNQ A;  2MRI A;  1E7U A;  4BSZ B;  2ION A;  3RO2 A;  1V54 E;  3TWR A;  2L6B A;  2V8S E;  3VTY A;  3V30 A;  3SBT B;  4GYO A;  3RRU A;  3CKB A;  3SQV A;  3FU3 A;  2B0O E;  3PRE A;  4HFG A;  3EHN A;  3AS4 A;  3MX3 A;  3UM3 A;  4OVU A;  4HI8 A;  5BT1 A;  3JUI A;  2CHW A;  2Y3A A;  2VSN A;  3DRA A;  5ARF A;  5CEA A;  1U3C A;  4GML A;  3G2V A;  3BG1 B;  4FA6 A;  4L23 A;  2P9I G;  4BSX A;  3T5X A;  1JCS A;  4UQX A;  4YVQ C;  2OOE A;  3DXM G;  3ASD A;  3ZYK A;  4XEI G;  3ZEF A;  1XGW A;  5M72 A;  3ASG A;  3ASF A;  4XE0 A;  2LXL A;  1TJC A;  3ZRH A;  3FEX A;  3L13 A;  4K0R A;  5FTP A;  4IUL A;  2A4Z A;  4JL0 A;  4G1T A;  2CHZ A;  1HU3 A;  2WXP A;  5CMW A;  4IN3 B;  4DX7 D;  3LJ3 A;  4FLH A;  1SA4 A;  4GAA A;  3V2X A;  5LCW J;  4JHJ A;  4LEU A;  3ZYM A;  1OWN A;  3UX4 A;  4I6E A;  3MV3 B;  3MKQ A;  2ETA A;  3U9W A;  2XZT G;  3CR3 A;  4BTA A;  1A5E A;  5LFA A;  2IO2 C;  3CHO A;  2KXP C;  1TN7 A;  2J07 A;  2J09 A;  2X6H A;  5AJD A;  3IKO B;  1B89 A;  2VYI A;  5JA4 D;  2VTB A;  1JWF A;  3Q7A A;  4GA1 A;  3CVP A;  2WXR A;  2DYR E;  3EJN A;  2CFU A;  3L82 A;  3AG3 E;  5KNH D;  3GZ2 A;  2FO7 A;  1D8E A;  2WXL A;  4HRL A;  1O5M A;  2PQR A;  2H6F A;  1S63 A;  2KBX A;  1N11 A;  2GW1 A;  4HRM B;  1DCE A;  3PH0 C;  2DZN A;  1KPS B;  4CT0 A;  2JLB A;  4PS3 A;  1O1R A;  4G26 A;  4AVX A;  5JHA A; 
#chains in the Genus database with same CATH homology
 1K8K G;  1U2V G;  4XEI G;  3UKU G;  2P9L G;  3DXK G;  3RSE G;  2P9I G;  2P9S G;  3UKR G;  4JD2 G;  2P9U G;  1TYQ G;  3DWL G;  2P9P G;  3DXM G;  2P9N G;  3ULE G;  2P9K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...