3UL5A

Saccharum officinarum canecystatin-1 in space group c2221
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'HENDLEAIELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKVWENFKQLQSFQPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Canecystatin-1
publication title X-ray crystallography and NMR studies of domain-swapped canecystatin-1.
pubmed doi rcsb
source organism Saccharum officinarum
molecule tags Hydrolase inhibitor
total genus 14
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16845 SQAPI Aspartic acid proteinase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ul5A00
1WNHA 1STFI 3UL6A 3UL5A 1IV7A 4ZM8A 1CYVA 3K9MC 2KXGA 5A0OB 1LXEA 3NX0A 1A90A 1N5HA 1TIJA 1M9GA 4N6OB 3Q2PA 3QRDA 1A67A 5LC6A 4N6V0 3MWZA 1N9JA 1EQKA 3PS8A 4CCVA 1KWIA 1DVDA 4N6LA 1FUWA 1ROAA 3PYJA 3LH4A 1RN7A 5ELJA 2W9PA 1R4CA 1GD4A 2W9QA 4LZIA 1IV9A 5EQLA 4EYCA 1NB5I 4N6NB 1GD3A 3KSED 1CEWI 2OCTA 1PFPA 4N6MA 1G96A 1MOLA 4N6UA 2CH9A 5ELUA 1YVBI 2BO9B 1FA3A 5LC7A 4N6TA 3SVAA 1NB3I 3S67A 1DVCA 3L0RA 1MNLA 4IT7A 3PXMA 3KFQC 3GAXA 3IMAB 4TX4A 2O9UX 1N5PA 1CYUA
chains in the Genus database with same CATH superfamily
1I8VA 3E99A 2B1XB 1YGWA 1YJ93 5BXQA 1STFI 5G2GA 1ULIB 1TP6A 1W6CA 4XDVA 1DYUA 2F5MA 1RKYA 4EXRA 1TFKA 1YNVX 3G8ZA 4FMCA 1BSAA 3D9RA 3GZYB 3UL5A 1K9M4 3NQYA 3D5IA 1TUHA 5IF6A 1IVUA 3B7CA 4R4KA 3NBBA 3AGOA 3X40A 3K9MC 2KXGA 3GRDA 2E2UA 3ECFA 4KZ1A 3T8UA 1WMPA 1JBRA 3ZFZA 1ZO2A 1YJN3 2ZA4A 3NX0A 5AIIA 1RTUA 2ML6A 1N8QA 1I0XA 4WYKA 3CC23 3TDGA 4H3UA 4AEQA 3CCM3 1C7HA 1JBTA 2IYJA 1RGLA 1GMRA 3FKAA 3LMLA 4FMAA 1IVXA 3GSPA 1KD14 1UGIA 2R41A 3MYTA 1BANA 3BIRA 1V74A 1SIHA 1RGAA 1O7NB 1STDA 1ZX2A 1VQM3 3NQZA 1SQWA 2BU4A 4N6V0 3DXOA 1ASKA 5AIHA 1VQ63 1HKXA 3RGRA 3D79A 3S29A 3HX8A 3PS8A 4WP5A 4CCVA 5BVBA 1JB5A 1B3SA 2SBLA 1KWIA 1JZDA 3FG4A 1FGTA 4HM8B 1E97A 1BGSA 1FUWA 1IQYA 1EG9B 3S27A 1UI8A 1RN1A 2F4YA 4J5KA 2HMNB 1VQQA 3LH4A 1GY7A 2R4IA 1T3BA 2F5WA 3K0ZA 5D83A 1BUJA 1JB4A 3FGYA 3NM2A 1BSDA 5ELJA 1RN4A 3KIIA 3F40A 2O3OA 4R9KA 1MWTA 5IEPA 1M1XB 2HMLB 1ROVA 3WODG 1MGRA 2CX0A 5M18A 2HMOB 2JDIH 1JBSA 4BTWA 4I4KA 4GHOA 3G6E3 3LTAA 1LOWA 1I0VA 3GZXB 4K1UA 5AI1A 1U5OA 4FCZA 5DRVA 1E3RA 1BNEA 1T5YA 1IYYA 1BNGA 1NO3A 1E3VA 4U13A 3UJMA 1ULJB 3EB8A 1VQ53 4IPBA 1OGXA 1G96A 2KF6A 1ZS7A 3CCQ3 4N6UA 1KC84 1RGFA 3WMDA 1W02A 1I70A 2CH9A 3WR2A 5ELUA 4OVMA 1S723 1YVBI 3EHCA 3LZAA 5IENA 3EQQB 1RGCA 3FLJA 2XFSA 8CHOA 2P09A 2Y74A 4QWTA 5LC7A 3K63A 3D3LA 1DETA 5AIFA 3UNLA 2XF3A 1LVNA 1GYBA 1UCLA 2F99A 4K1VA 2RGQA 4ILFA 4J9AA 4NHFA 1W2B2 3BNCA 3PGBA 1LNHA 3PXMA 4R9LA 3MPHA 3N54B 4O8SA 3OWSA 4HBRA 3WOEB 3M8CA 1RNTA 2KF3A 1W00A 2SARA 1UCJA 3DGOA 3JVCA 1MWSA 2Y73A 1RCKA 4HM3B 1WQLB 1C54A 1LQGC 2ZHXB 5CF1A 1CYUA 3NUVA 2W04A 2CC3A 2W56B 5FW5A 1YHQ3 2K3DA 3KKGA 2ZDJA 3B4PA 1IVWA 4LGQA 2W03A 4BTXA 5IG4A 3D4AA 4FCMA 3MG1A 3GWRA 1MWRA 1B2ZA 4MMZB 4WHAA 1IV7A 2WO0A 3IPTA 3X3ZA 3CD63 5BIRA 6GSPA 1V57A 2BMRB 5RNTA 4CJNA 1WTHA 3Q1CA 1CYVA 3VGNA 1LOXA 4LYLB 3J7Yd 2CWUA 5A0OB 1X1UA 5AEUB 1GY6A 2BNGA 3MSOA 1IU7A 3V92A 1FGOA 1TRPA 2OOVC 3G0KA 3FZWA 1GMQA 1OGZA 2XH9A 1TU5A 1A90A 1D6UA 2H0GA 3FG1A 1VQ93 1N5HA 5IW9A 1M9GA 1YGEA 5KP4A 3Q2PA 1N8R4 1QALA 2CFDA 1UDII 2H0IA 2Z77A 4L8OA 4LEHA 5JPUA 4N3VA 1LOVA 3B4OA 1A2VA 1A67A 2PNCA 5G1KA 2IUKA 1YJW3 3CCJ3 3FF2A 4KFDA 1RMSA 1VQO3 3CPOA 1N9JA 1AR0A 1R4YA 3AGNA 1NWWA 1Z1SA 3FSDA 3SX1A 1O7GB 5EVHA 2MF7A 2YFLB 2HMJB 3KSPA 3NM7A 1OACA 1FZUA 1MGWA 1RRLA 2HMKB 3JUOA 2Q07A 1OF5A 6RNTA 1ROAA 3PYJA 5M19A 1AV4A 1UW1A 2RBIA 2CK3H 3WHOA 4I5QA 1K734 4KFEA 5IG0A 2YX9A 1B20A 1WMOA 1HU9A 1V58A 2CG0A 1Q7HA 1RCLA 3ALAA 3DGLA 1MWUA 2E2TA 3CPW2 1VQ73 1BVIA 4BIRA 2L4VA 4GB5A 3HZPA 3X42A 4DKIA 1GOYA 3DUKA 3RDEA 1BIRA 2PZVA 3GZBA 1IV9A 3WDGB 5EQLA 4XBXA 5CK6A 1VQP3 2FXTA 2GEXA 1EUIC 1GD3A 1O7HB 4NREA 1BRSA 1I2EA 1I2FA 1JN5A 2ZL8A 4FCJA 1BNIA 7STDA 1VZZA 2BMOB 2YFJB 1BRKA 3OW22 1SJWA 3V98A 3I553 1JKGA 2CFWA 1TTOA 3CNMA 2C10A 1B21A 1BAOA 2XGLA 1ZGXA 1Q40B 3NHXA 2HOHA 1PYLA 1FUTA 1F8NA 1JB2A 5DREA 1BNFA 3U1WA 5IG5A 1X1WA 3VSYA 2GU1A 2UX0A 4PEJA 2WOHA 2IA7A 3CME3 2A15A 5IEOA 1QJGA 3HK4A 1GMPA 3K5TA 4WWUC 1JV2B 3CU3A 3HOHA 3KFQC 1QVG2 3BNEA 3PZWA 5IG3A 3G713 2GXFA 3EJVA 3DGYA 4TX4A 3JUQA 1BOXA 1OUNA 3BLZA 1IVVA 4K61A 2OQEA 3PCRA 5CF2A 2K0MA 3BNDA 1N5PA 2OTJ3 2F98A 3NV0B 1NJI4 1NDOB 3SLUA 4HZ9B 1X1YA 1UGHI 3LTBA 2GSPA 1IDPA 1O7PB 5JBSA 2CHCA 3WOFB 4EW5A 3EE1A 3UL6A 1RGKA 2GBXB 3WA2X 4G1MB 1BRNL 1WMNA 1DE3A 3U97A 3KZTA 2Z6BA 1VQ83 1UCIA 2XR8B 4ZM8A 1QVF2 4KVHA 1EA2A 8RNTA 1RNBA 3DGMA 1W6YA 4EV5A 2CIUA 4HYZA 2CX1A 1VQ43 4HM7B 1DMQA 2RNTA 4L7KA 4MMXB 4O02B 4EV2A 2KRTA 3CXC2 1PY3A 3FCSB 1VQN3 1Q7Y4 4BL3A 2RFRA 3MKIA 4WYKB 1RJOA 4HJLB 3STDA 1K28A 1S5AA 2IY2A 1JNQA 3QRDA 4RNZA 1Q814 2MC8A 1BU4A 1FUSA 1K41A 2BT3A 3EC9A 3EN1B 2XRXB 3NBJA 5AYRB 2Z76A 3X3YA 1OCVA 4BTYA 2CW9A 4HM4B 4HAAA 3G16A 1OH0A 1AY7A 1OHOA 1RSNA 4MEIA 1EQKA 3A76A 1TFOA 3PCSA 1GS3A 4L8PA 5CXOA 3T0UA 3OWYA 1EEJA 3AMOA 2UUGC 3KCHA 1DVDA 4J5GA 4HOHA 1US1A 4MJDA 4N6LA 1IT8A 3SYUA 1RHLA 3DH2A 1JN5B 3DM8A 5GSPA 3K7CA 3LT8A 1T2IA 1J2BA 1O7WB 1RN7A 4RNYA 1QAFA 3FG3A 4BU4A 4HM0B 2INXA 3LYGA 3ER7A 1BRHA 1BSCA 2C11A 3N9HA 4KT3B 3URPA 6STDA 2STDA 4HM5B 2KAAA 1GOUA 2B24B 1R4CA 1GD4A 4LSOA 1TJDA 2GU3A 2KF5A 4HM1B 2F56A 5AEWB 1QMAA 1RRHA 5AIGA 3BU4A 1U8CB 3EX9A 4EYCA 4N6NB 2AAEA 3MG3A 4X2OA 4IIAA 4ORLA 1UCKA 4HKVB 3F8HA 3CMA3 4BL2A 3EBYA 3CCL3 3HIGA 1EKMA 3KSED 2OCTA 4RNTA 1N9EA 3EF8A 5I97A 4R1KA 2AADA 3SOYA 1B2UA 1BRGA 3FH1A 7RNTA 2CWVA 1UUVB 1IQXA 3OXAA 1VQK3 2QIYA 4MMYB 5FGOA 5G1LA 2HMMB 2QEX3 5KP1A 3LT9A 3F9SA 1FA3A 3DMCA 2XEPA 3JUNA 2P38A 1B2SA 2RSXA 2D42A 1BUQA 2CFGA 1QAKA 1SIIA 3RGAA 3EN8A 3L0RA 2JQ5A 3HI7A 4HM2B 1BNSA 5HOHA 3UB1A 1FGQA 1YVSA 3CCS3 2P0MA 3GAXA 1I2GA 1NU3A 1BNRA 1PU4A 3H3HA 3CCE3 4RBNA 9RNTA 4O3VA 2W56A 4X2HA 2O9UX 1M904 5KP3A 1CH0A 4Q53A 1WNHA 1LNIA 1CQSA 3SOAA 1D6ZA 1LOYA 2Z7AA 1AVLA 3OWUA 1B2XA 4NPBA 1O7MB 3HIIA 3S28A 2W0QA 3SEDA 2IMJA 2K54A 2E2VA 5D82A 4FMDA 3OV4A 1BSBA 2XSHB 3N8BA 5EEOA 4CPKA 3LOYA 4EBGA 1YIJ3 3WA3A 1LXEA 2I9WA 3AMOB 2V1LA 2M7OA 1HZ1A 3JUPA 3DZLA 1W7CA 2FNQA 3A5EA 3JUMA 2XFTA 2XGNA 4XM4A 3CCU3 3AHSA 2CFLA 2OTL3 1L5GB 1SPUA 1DMNA 2OOVA 2CKFB 1TIJA 2C4BA 4N6OB 3LTDA 3BNBA 4H61A 1W01A 3CC43 1OPYA 4FR9A 3V99A 1K8A4 3DY5A 4HZBB 1W5ZA 1RLSA 5IERA 1KQS2 3KE7A 1NNVA 3I0YA 1FW7A 5LC6A 3Q90A 1BRJA 2BMQB 3AHWA 4XDWA 1FYSA 1KSIA 2LYXA 1SARA 3I563 3MWZA 2W2CA 4AKZA 2WGQA 4FMBA 3VF1A 4GSPA 1JZOA 4OUQA 2CG1A 2IUJA 1M1K4 1VQL3 2OWPA 3S5CA 3H51A 4CDLA 1LQMB 1Q824 4J8TA 2CWTA 5M1AA 1D6YA 5BU4A 3X41A 3LXUX 4HM6B 4RZMA 1JJ22 1OF5B 3F7XA 4JRFA 2YFIB 3CNXA 1RGGA 1RGHA 4O2HA 3LTCA 4GL6A 3FF0A 5TGNA 2W9PA 3T8NA 1BNJA 2P05A 1IT7A 1HYFA 3ROBA 3CCV3 1A2PA 4R80A 1DMMA 2XSOB 2J8XB 2QGUA 2W9QA 3OX9A 4LZIA 1UI7A 1GY5A 5D81A 3RNTA 1W4NA 2P0XA 5STDA 3X3XA 4STDA 3ZG5A 3B8LA 2GEYA 4AKYA 3F7SA 1NB5I 2KCDA 1IQ8A 2D1WA 3QK9A 1Q864 3F14A 1FGRA 1BRIA 1OHSA 4OK0A 2QA43 1UUWB 1Q42A 2GBWB 3BB9A 3MG2A 1CEWI 3MHEA 1I3IA 1YI23 1LRAA 4N6MA 5JPPA 1MOLA 3ZG0A 1T2HA 2UGIA 1B27A 2BHMA 4LMIA 1FGMA 3F8XA 1X1XA 1Q40A 1Y4KA 2CFKA 3SXXA 3D5GA 1RGEA 2RCDA 5HGRA 5AYSC 1JKGB 7GSPA 3CCR3 2WOFA 2FGTA 3GZRA 2KF4A 3KN4A 4HVNA 1GOVA 1TRQA 2BO9B 1JRQA 1IK3A 1B2MA 2WGOA 4N6TA 3SVAA 1NB3I 1GSPA 3S67A 1DVCA 1YIT3 1A2KA 4JF8A 3NXJA 3Q3FA 4XBYA 2BIRA 3EBTA 4WFOA 4EC6A 2LQVA 1Q9EA 1UUGB 1W6GA 2ML5A 3O8YA 2W6JH 1RDSA 1AQZA 1MNLA 4IT7A 5CLKA 2F86B 2L1SA 1BSEA 4K90B 2OQEC 4XB5A 3CC73 1I3FA 3IMAB 1W2ZA 3NBRA 1AVKA 3DGNA 4XBTA 3NV0A 3G4S3 1OHPA 2H0HA 4KFFA 3IJEB 1PFPA 1G02A 1ISKA 1G0TA
chains in the Genus database with same CATH topology
3E99A 2B1XB 1YJ93 5BXQA 1STFI 5G2GA 1ULIB 1TP6A 1W6CA 4XDVA 1DYUA 1RKYA 4EXRA 1TFKA 3G8ZA 4FMCA 1K9M4 3D9RA 3GZYB 3UL5A 3NQYA 1TUHA 5IF6A 1IVUA 3B7CA 4R4KA 3NBBA 3X40A 3K9MC 2KXGA 3GRDA 2E2UA 3ECFA 4KZ1A 3T8UA 1WMPA 1ZO2A 1YJN3 3NX0A 5AIIA 2ML6A 1N8QA 4WYKA 3CC23 3TDGA 4H3UA 4AEQA 3CCM3 1C7HA 3FKAA 3LMLA 4FMAA 1IVXA 1KD14 3MYTA 1V74A 1SIHA 1O7NB 1STDA 1ZX2A 1VQM3 3NQZA 1SQWA 4N6V0 3DXOA 1ASKA 5AIHA 1VQ63 1HKXA 3RGRA 3S29A 3HX8A 3PS8A 4WP5A 4CCVA 5BVBA 1JB5A 2SBLA 1KWIA 3FG4A 1FGTA 4HM8B 1E97A 1FUWA 1IQYA 1EG9B 3S27A 1UI8A 2HMNB 3LH4A 1GY7A 2R4IA 3K0ZA 5D83A 1JB4A 3FGYA 3NM2A 5ELJA 3KIIA 3F40A 2O3OA 4R9KA 5IEPA 1M1XB 2HMLB 1ROVA 3WODG 2HMOB 2JDIH 4BTWA 4I4KA 3G6E3 3LTAA 3GZXB 4K1UA 5AI1A 1U5OA 4FCZA 5DRVA 1E3RA 1T5YA 1NO3A 1E3VA 4U13A 3UJMA 1ULJB 3EB8A 1VQ53 4IPBA 1OGXA 1G96A 1KC84 3CCQ3 4N6UA 3WMDA 1W02A 2CH9A 5ELUA 4OVMA 1S723 1YVBI 3EHCA 3LZAA 5IENA 3EQQB 3FLJA 8CHOA 2XFSA 2P09A 2Y74A 4QWTA 5LC7A 3K63A 3D3LA 5AIFA 3UNLA 2XF3A 1LVNA 1GYBA 2F99A 4K1VA 2RGQA 4J9AA 4NHFA 1W2B2 3BNCA 3PGBA 1LNHA 3PXMA 4R9LA 3MPHA 3N54B 4O8SA 3OWSA 4HBRA 3WOEB 3M8CA 1W00A 3DGOA 3JVCA 2Y73A 4HM3B 1WQLB 1CYUA 5CF1A 3NUVA 2W04A 2CC3A 2W56B 5FW5A 1YHQ3 3KKGA 2ZDJA 3B4PA 1IVWA 4LGQA 2W03A 4BTXA 5IG4A 4FCMA 3MG1A 3GWRA 4MMZB 4WHAA 1IV7A 2WO0A 3IPTA 3X3ZA 3CD63 2BMRB 1WTHA 3Q1CA 1CYVA 3VGNA 1LOXA 3J7Yd 2CWUA 5A0OB 5AEUB 1GY6A 2BNGA 3MSOA 1IU7A 3V92A 1FGOA 2OOVC 3G0KA 3FZWA 1OGZA 2XH9A 1TU5A 1A90A 1D6UA 3FG1A 1VQ93 1N5HA 5IW9A 1M9GA 1YGEA 5KP4A 3Q2PA 1N8R4 1QALA 2CFDA 2Z77A 4L8OA 4LEHA 5JPUA 4N3VA 3B4OA 1A2VA 1A67A 2PNCA 2IUKA 1YJW3 3CCJ3 3FF2A 4KFDA 1VQO3 3CPOA 1N9JA 1AR0A 1NWWA 1Z1SA 3FSDA 3SX1A 1O7GB 5EVHA 2MF7A 2YFLB 2HMJB 3KSPA 3NM7A 1OACA 1RRLA 3JUOA 2HMKB 2Q07A 1OF5A 1ROAA 3PYJA 1AV4A 1UW1A 2CK3H 1K734 4KFEA 5IG0A 2YX9A 1WMOA 1HU9A 3ALAA 2CG0A 3DGLA 1VQ73 2E2TA 3CPW2 2L4VA 4GB5A 3HZPA 3X42A 3DUKA 3RDEA 2PZVA 3GZBA 1IV9A 3WDGB 5EQLA 4XBXA 5CK6A 1VQP3 2FXTA 2GEXA 1GD3A 1O7HB 4NREA 1JN5A 2ZL8A 4FCJA 7STDA 1VZZA 2BMOB 2YFJB 3OW22 1SJWA 3V98A 3I553 1JKGA 2CFWA 3CNMA 2C10A 2XGLA 1Q40B 3NHXA 1F8NA 1JB2A 5DREA 3U1WA 5IG5A 3VSYA 2GU1A 2UX0A 4PEJA 2WOHA 2IA7A 3CME3 2A15A 5IEOA 1QJGA 3HK4A 3K5TA 4WWUC 1JV2B 3CU3A 3KFQC 1QVG2 3BNEA 3PZWA 5IG3A 3G713 2GXFA 3EJVA 4TX4A 3JUQA 1OUNA 3BLZA 1IVVA 4K61A 2OQEA 3PCRA 5CF2A 2K0MA 3BNDA 1N5PA 2OTJ3 2F98A 3NV0B 1NJI4 1NDOB 3SLUA 4HZ9B 3LTBA 1IDPA 1O7PB 5JBSA 2CHCA 3WOFB 3EE1A 3UL6A 2GBXB 3WA2X 4G1MB 1WMNA 3U97A 3KZTA 2Z6BA 1VQ83 2XR8B 4ZM8A 1QVF2 4KVHA 1EA2A 3DGMA 1W6YA 4EV5A 2CIUA 4HYZA 1VQ43 4HM7B 1DMQA 4L7KA 4MMXB 4O02B 4EV2A 3CXC2 2KRTA 1VQN3 3FCSB 1Q7Y4 2RFRA 3MKIA 4WYKB 1RJOA 4HJLB 3STDA 1K28A 1S5AA 3QRDA 1JNQA 4RNZA 1Q814 2MC8A 3X3YA 1K41A 2BT3A 3EC9A 3EN1B 2XRXB 3NBJA 5AYRB 2Z76A 4BTYA 1OCVA 4HM4B 3G16A 1OH0A 1OHOA 4MEIA 1EQKA 3A76A 1TFOA 3PCSA 1GS3A 4L8PA 5CXOA 3T0UA 3OWYA 3AMOA 1DVDA 1US1A 4MJDA 4N6LA 1IT8A 1JN5B 3DM8A 3K7CA 3LT8A 1J2BA 1O7WB 1RN7A 4RNYA 1QAFA 3FG3A 4HM0B 2INXA 3LYGA 3ER7A 2C11A 3N9HA 6STDA 2STDA 4HM5B 2B24B 1R4CA 1GD4A 4LSOA 2GU3A 4HM1B 5AEWB 1QMAA 1RRHA 5AIGA 1U8CB 3EX9A 4EYCA 4N6NB 4X2OA 3MG3A 4IIAA 4ORLA 4HKVB 3F8HA 3CMA3 3CCL3 3EBYA 3HIGA 1EKMA 3KSED 2OCTA 1N9EA 1PFPA 3EF8A 5I97A 4R1KA 3SOYA 3FH1A 2CWVA 1UUVB 1IQXA 3OXAA 1VQK3 2QIYA 4MMYB 5FGOA 2QEX3 2HMMB 5KP1A 3LT9A 3F9SA 1FA3A 3DMCA 2XEPA 3JUNA 2P38A 2RSXA 2D42A 1BUQA 2CFGA 1QAKA 1SIIA 3RGAA 3EN8A 3L0RA 2JQ5A 3HI7A 4HM2B 3UB1A 1FGQA 3CCS3 2P0MA 3GAXA 1NU3A 1PU4A 3H3HA 3CCE3 4RBNA 4O3VA 2W56A 4X2HA 2O9UX 1M904 5KP3A 4Q53A 1WNHA 1CQSA 3SOAA 1D6ZA 2Z7AA 1AVLA 3OWUA 1O7MB 3HIIA 3S28A 2W0QA 3SEDA 2IMJA 2K54A 2E2VA 5D82A 4FMDA 3OV4A 2XSHB 3N8BA 5EEOA 3LOYA 4EBGA 1YIJ3 3WA3A 1LXEA 2I9WA 3AMOB 2V1LA 2M7OA 3JUPA 3DZLA 1W7CA 2FNQA 3JUMA 2XFTA 2XGNA 4XM4A 3CCU3 2OTL3 2CFLA 1L5GB 1SPUA 1DMNA 2OOVA 2CKFB 1TIJA 3CC43 4N6OB 3LTDA 3BNBA 4H61A 1W01A 1OPYA 4FR9A 3V99A 1K8A4 3DY5A 4HZBB 1W5ZA 5IERA 1KQS2 3KE7A 3I0YA 5LC6A 3Q90A 2BMQB 4XDWA 1KSIA 2LYXA 3I563 3MWZA 2W2CA 4AKZA 2WGQA 4FMBA 3VF1A 1VQL3 2CG1A 4OUQA 2IUJA 1M1K4 2OWPA 3S5CA 3H51A 4CDLA 1Q824 4J8TA 2CWTA 1D6YA 3X41A 3LXUX 4HM6B 4RZMA 1JJ22 1OF5B 3F7XA 4JRFA 2YFIB 3CNXA 4O2HA 3LTCA 4GL6A 3FF0A 5TGNA 2W9PA 3T8NA 2P05A 1IT7A 3CCV3 3ROBA 4R80A 1DMMA 2XSOB 2W9QA 2QGUA 3OX9A 4LZIA 1UI7A 1GY5A 5D81A 1W4NA 2P0XA 5STDA 3X3XA 4STDA 3B8LA 2GEYA 4AKYA 3F7SA 1NB5I 2KCDA 1IQ8A 2D1WA 3QK9A 1Q864 3F14A 1FGRA 1OHSA 4OK0A 2QA43 1UUWB 1Q42A 2GBWB 3BB9A 3MG2A 1CEWI 3MHEA 1YI23 4N6MA 5JPPA 1MOLA 2BHMA 4LMIA 1FGMA 3F8XA 1Q40A 1Y4KA 2CFKA 3SXXA 2RCDA 5HGRA 5AYSC 1JKGB 3CCR3 2WOFA 2FGTA 3GZRA 3KN4A 4HVNA 2BO9B 1JRQA 1IK3A 2WGOA 4N6TA 3SVAA 1NB3I 3S67A 1DVCA 1YIT3 1A2KA 4JF8A 3NXJA 4XBYA 3EBTA 4WFOA 4EC6A 2LQVA 1W6GA 3O8YA 2ML5A 5CLKA 2W6JH 1MNLA 4IT7A 2F86B 4K90B 2OQEC 4XB5A 3CC73 3IMAB 1W2ZA 3NBRA 1AVKA 3DGNA 4XBTA 3NV0A 3G4S3 1OHPA 4KFFA 3IJEB 2CW9A 1ISKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNH A;  1STF I;  3UL6 A;  3UL5 A;  1IV7 A;  4ZM8 A;  1CYV A;  3K9M C;  2KXG A;  5A0O B;  1LXE A;  3NX0 A;  1A90 A;  1N5H A;  1TIJ A;  1M9G A;  4N6O B;  3Q2P A;  3QRD A;  1A67 A;  5LC6 A;  4N6V 0;  3MWZ A;  1N9J A;  1EQK A;  3PS8 A;  4CCV A;  1KWI A;  1DVD A;  4N6L A;  1FUW A;  1ROA A;  3PYJ A;  3LH4 A;  1RN7 A;  5ELJ A;  2W9P A;  1R4C A;  1GD4 A;  2W9Q A;  4LZI A;  1IV9 A;  5EQL A;  4EYC A;  1NB5 I;  4N6N B;  1GD3 A;  3KSE D;  1CEW I;  2OCT A;  1PFP A;  4N6M A;  1G96 A;  1MOL A;  4N6U A;  2CH9 A;  5ELU A;  1YVB I;  2BO9 B;  1FA3 A;  5LC7 A;  4N6T A;  3SVA A;  1NB3 I;  3S67 A;  1DVC A;  3L0R A;  1MNL A;  4IT7 A;  3PXM A;  3KFQ C;  3GAX A;  3IMA B;  4TX4 A;  2O9U X;  1N5P A;  1CYU A; 
#chains in the Genus database with same CATH topology
 1I8V A;  3E99 A;  2B1X B;  1YGW A;  1YJ9 3;  5BXQ A;  1STF I;  5G2G A;  1ULI B;  1TP6 A;  1W6C A;  4XDV A;  1DYU A;  2F5M A;  1RKY A;  4EXR A;  1TFK A;  1YNV X;  3G8Z A;  4FMC A;  1BSA A;  3D9R A;  3GZY B;  3UL5 A;  1K9M 4;  3NQY A;  3D5I A;  1TUH A;  5IF6 A;  1IVU A;  3B7C A;  4R4K A;  3NBB A;  3AGO A;  3X40 A;  3K9M C;  2KXG A;  3GRD A;  2E2U A;  3ECF A;  4KZ1 A;  3T8U A;  1WMP A;  1JBR A;  3ZFZ A;  1ZO2 A;  1YJN 3;  2ZA4 A;  3NX0 A;  5AII A;  1RTU A;  2ML6 A;  1N8Q A;  1I0X A;  4WYK A;  3CC2 3;  3TDG A;  4H3U A;  4AEQ A;  3CCM 3;  1C7H A;  1JBT A;  2IYJ A;  1RGL A;  1GMR A;  3FKA A;  3LML A;  4FMA A;  1IVX A;  3GSP A;  1KD1 4;  1UGI A;  2R41 A;  3MYT A;  1BAN A;  3BIR A;  1V74 A;  1SIH A;  1RGA A;  1O7N B;  1STD A;  1ZX2 A;  1VQM 3;  3NQZ A;  1SQW A;  2BU4 A;  4N6V 0;  3DXO A;  1ASK A;  5AIH A;  1VQ6 3;  1HKX A;  3RGR A;  3D79 A;  3S29 A;  3HX8 A;  3PS8 A;  4WP5 A;  4CCV A;  5BVB A;  1JB5 A;  1B3S A;  2SBL A;  1KWI A;  1JZD A;  3FG4 A;  1FGT A;  4HM8 B;  1E97 A;  1BGS A;  1FUW A;  1IQY A;  1EG9 B;  3S27 A;  1UI8 A;  1RN1 A;  2F4Y A;  4J5K A;  2HMN B;  1VQQ A;  3LH4 A;  1GY7 A;  2R4I A;  1T3B A;  2F5W A;  3K0Z A;  5D83 A;  1BUJ A;  1JB4 A;  3FGY A;  3NM2 A;  1BSD A;  5ELJ A;  1RN4 A;  3KII A;  3F40 A;  2O3O A;  4R9K A;  1MWT A;  5IEP A;  1M1X B;  2HML B;  1ROV A;  3WOD G;  1MGR A;  2CX0 A;  5M18 A;  2HMO B;  2JDI H;  1JBS A;  4BTW A;  4I4K A;  4GHO A;  3G6E 3;  3LTA A;  1LOW A;  1I0V A;  3GZX B;  4K1U A;  5AI1 A;  1U5O A;  4FCZ A;  5DRV A;  1E3R A;  1BNE A;  1T5Y A;  1IYY A;  1BNG A;  1NO3 A;  1E3V A;  4U13 A;  3UJM A;  1ULJ B;  3EB8 A;  1VQ5 3;  4IPB A;  1OGX A;  1G96 A;  2KF6 A;  1ZS7 A;  3CCQ 3;  4N6U A;  1KC8 4;  1RGF A;  3WMD A;  1W02 A;  1I70 A;  2CH9 A;  3WR2 A;  5ELU A;  4OVM A;  1S72 3;  1YVB I;  3EHC A;  3LZA A;  5IEN A;  3EQQ B;  1RGC A;  3FLJ A;  2XFS A;  8CHO A;  2P09 A;  2Y74 A;  4QWT A;  5LC7 A;  3K63 A;  3D3L A;  1DET A;  5AIF A;  3UNL A;  2XF3 A;  1LVN A;  1GYB A;  1UCL A;  2F99 A;  4K1V A;  2RGQ A;  4ILF A;  4J9A A;  4NHF A;  1W2B 2;  3BNC A;  3PGB A;  1LNH A;  3PXM A;  4R9L A;  3MPH A;  3N54 B;  4O8S A;  3OWS A;  4HBR A;  3WOE B;  3M8C A;  1RNT A;  2KF3 A;  1W00 A;  2SAR A;  1UCJ A;  3DGO A;  3JVC A;  1MWS A;  2Y73 A;  1RCK A;  4HM3 B;  1WQL B;  1C54 A;  1LQG C;  2ZHX B;  5CF1 A;  1CYU A;  3NUV A;  2W04 A;  2CC3 A;  2W56 B;  5FW5 A;  1YHQ 3;  2K3D A;  3KKG A;  2ZDJ A;  3B4P A;  1IVW A;  4LGQ A;  2W03 A;  4BTX A;  5IG4 A;  3D4A A;  4FCM A;  3MG1 A;  3GWR A;  1MWR A;  1B2Z A;  4MMZ B;  4WHA A;  1IV7 A;  2WO0 A;  3IPT A;  3X3Z A;  3CD6 3;  5BIR A;  6GSP A;  1V57 A;  2BMR B;  5RNT A;  4CJN A;  1WTH A;  3Q1C A;  1CYV A;  3VGN A;  1LOX A;  4LYL B;  3J7Y d;  2CWU A;  5A0O B;  1X1U A;  5AEU B;  1GY6 A;  2BNG A;  3MSO A;  1IU7 A;  3V92 A;  1FGO A;  1TRP A;  2OOV C;  3G0K A;  3FZW A;  1GMQ A;  1OGZ A;  2XH9 A;  1TU5 A;  1A90 A;  1D6U A;  2H0G A;  3FG1 A;  1VQ9 3;  1N5H A;  5IW9 A;  1M9G A;  1YGE A;  5KP4 A;  3Q2P A;  1N8R 4;  1QAL A;  2CFD A;  1UDI I;  2H0I A;  2Z77 A;  4L8O A;  4LEH A;  5JPU A;  4N3V A;  1LOV A;  3B4O A;  1A2V A;  1A67 A;  2PNC A;  5G1K A;  2IUK A;  1YJW 3;  3CCJ 3;  3FF2 A;  4KFD A;  1RMS A;  1VQO 3;  3CPO A;  1N9J A;  1AR0 A;  1R4Y A;  3AGN A;  1NWW A;  1Z1S A;  3FSD A;  3SX1 A;  1O7G B;  5EVH A;  2MF7 A;  2YFL B;  2HMJ B;  3KSP A;  3NM7 A;  1OAC A;  1FZU A;  1MGW A;  1RRL A;  2HMK B;  3JUO A;  2Q07 A;  1OF5 A;  6RNT A;  1ROA A;  3PYJ A;  5M19 A;  1AV4 A;  1UW1 A;  2RBI A;  2CK3 H;  3WHO A;  4I5Q A;  1K73 4;  4KFE A;  5IG0 A;  2YX9 A;  1B20 A;  1WMO A;  1HU9 A;  1V58 A;  2CG0 A;  1Q7H A;  1RCL A;  3ALA A;  3DGL A;  1MWU A;  2E2T A;  3CPW 2;  1VQ7 3;  1BVI A;  4BIR A;  2L4V A;  4GB5 A;  3HZP A;  3X42 A;  4DKI A;  1GOY A;  3DUK A;  3RDE A;  1BIR A;  2PZV A;  3GZB A;  1IV9 A;  3WDG B;  5EQL A;  4XBX A;  5CK6 A;  1VQP 3;  2FXT A;  2GEX A;  1EUI C;  1GD3 A;  1O7H B;  4NRE A;  1BRS A;  1I2E A;  1I2F A;  1JN5 A;  2ZL8 A;  4FCJ A;  1BNI A;  7STD A;  1VZZ A;  2BMO B;  2YFJ B;  1BRK A;  3OW2 2;  1SJW A;  3V98 A;  3I55 3;  1JKG A;  2CFW A;  1TTO A;  3CNM A;  2C10 A;  1B21 A;  1BAO A;  2XGL A;  1ZGX A;  1Q40 B;  3NHX A;  2HOH A;  1PYL A;  1FUT A;  1F8N A;  1JB2 A;  5DRE A;  1BNF A;  3U1W A;  5IG5 A;  1X1W A;  3VSY A;  2GU1 A;  2UX0 A;  4PEJ A;  2WOH A;  2IA7 A;  3CME 3;  2A15 A;  5IEO A;  1QJG A;  3HK4 A;  1GMP A;  3K5T A;  4WWU C;  1JV2 B;  3CU3 A;  3HOH A;  3KFQ C;  1QVG 2;  3BNE A;  3PZW A;  5IG3 A;  3G71 3;  2GXF A;  3EJV A;  3DGY A;  4TX4 A;  3JUQ A;  1BOX A;  1OUN A;  3BLZ A;  1IVV A;  4K61 A;  2OQE A;  3PCR A;  5CF2 A;  2K0M A;  3BND A;  1N5P A;  2OTJ 3;  2F98 A;  3NV0 B;  1NJI 4;  1NDO B;  3SLU A;  4HZ9 B;  1X1Y A;  1UGH I;  3LTB A;  2GSP A;  1IDP A;  1O7P B;  5JBS A;  2CHC A;  3WOF B;  4EW5 A;  3EE1 A;  3UL6 A;  1RGK A;  2GBX B;  3WA2 X;  4G1M B;  1BRN L;  1WMN A;  1DE3 A;  3U97 A;  3KZT A;  2Z6B A;  1VQ8 3;  1UCI A;  2XR8 B;  4ZM8 A;  1QVF 2;  4KVH A;  1EA2 A;  8RNT A;  1RNB A;  3DGM A;  1W6Y A;  4EV5 A;  2CIU A;  4HYZ A;  2CX1 A;  1VQ4 3;  4HM7 B;  1DMQ A;  2RNT A;  4L7K A;  4MMX B;  4O02 B;  4EV2 A;  2KRT A;  3CXC 2;  1PY3 A;  3FCS B;  1VQN 3;  1Q7Y 4;  4BL3 A;  2RFR A;  3MKI A;  4WYK B;  1RJO A;  4HJL B;  3STD A;  1K28 A;  1S5A A;  2IY2 A;  1JNQ A;  3QRD A;  4RNZ A;  1Q81 4;  2MC8 A;  1BU4 A;  1FUS A;  1K41 A;  2BT3 A;  3EC9 A;  3EN1 B;  2XRX B;  3NBJ A;  5AYR B;  2Z76 A;  3X3Y A;  1OCV A;  4BTY A;  2CW9 A;  4HM4 B;  4HAA A;  3G16 A;  1OH0 A;  1AY7 A;  1OHO A;  1RSN A;  4MEI A;  1EQK A;  3A76 A;  1TFO A;  3PCS A;  1GS3 A;  4L8P A;  5CXO A;  3T0U A;  3OWY A;  1EEJ A;  3AMO A;  2UUG C;  3KCH A;  1DVD A;  4J5G A;  4HOH A;  1US1 A;  4MJD A;  4N6L A;  1IT8 A;  3SYU A;  1RHL A;  3DH2 A;  1JN5 B;  3DM8 A;  5GSP A;  3K7C A;  3LT8 A;  1T2I A;  1J2B A;  1O7W B;  1RN7 A;  4RNY A;  1QAF A;  3FG3 A;  4BU4 A;  4HM0 B;  2INX A;  3LYG A;  3ER7 A;  1BRH A;  1BSC A;  2C11 A;  3N9H A;  4KT3 B;  3URP A;  6STD A;  2STD A;  4HM5 B;  2KAA A;  1GOU A;  2B24 B;  1R4C A;  1GD4 A;  4LSO A;  1TJD A;  2GU3 A;  2KF5 A;  4HM1 B;  2F56 A;  5AEW B;  1QMA A;  1RRH A;  5AIG A;  3BU4 A;  1U8C B;  3EX9 A;  4EYC A;  4N6N B;  2AAE A;  3MG3 A;  4X2O A;  4IIA A;  4ORL A;  1UCK A;  4HKV B;  3F8H A;  3CMA 3;  4BL2 A;  3EBY A;  3CCL 3;  3HIG A;  1EKM A;  3KSE D;  2OCT A;  4RNT A;  1N9E A;  3EF8 A;  5I97 A;  4R1K A;  2AAD A;  3SOY A;  1B2U A;  1BRG A;  3FH1 A;  7RNT A;  2CWV A;  1UUV B;  1IQX A;  3OXA A;  1VQK 3;  2QIY A;  4MMY B;  5FGO A;  5G1L A;  2HMM B;  2QEX 3;  5KP1 A;  3LT9 A;  3F9S A;  1FA3 A;  3DMC A;  2XEP A;  3JUN A;  2P38 A;  1B2S A;  2RSX A;  2D42 A;  1BUQ A;  2CFG A;  1QAK A;  1SII A;  3RGA A;  3EN8 A;  3L0R A;  2JQ5 A;  3HI7 A;  4HM2 B;  1BNS A;  5HOH A;  3UB1 A;  1FGQ A;  1YVS A;  3CCS 3;  2P0M A;  3GAX A;  1I2G A;  1NU3 A;  1BNR A;  1PU4 A;  3H3H A;  3CCE 3;  4RBN A;  9RNT A;  4O3V A;  2W56 A;  4X2H A;  2O9U X;  1M90 4;  5KP3 A;  1CH0 A;  4Q53 A;  1WNH A;  1LNI A;  1CQS A;  3SOA A;  1D6Z A;  1LOY A;  2Z7A A;  1AVL A;  3OWU A;  1B2X A;  4NPB A;  1O7M B;  3HII A;  3S28 A;  2W0Q A;  3SED A;  2IMJ A;  2K54 A;  2E2V A;  5D82 A;  4FMD A;  3OV4 A;  1BSB A;  2XSH B;  3N8B A;  5EEO A;  4CPK A;  3LOY A;  4EBG A;  1YIJ 3;  3WA3 A;  1LXE A;  2I9W A;  3AMO B;  2V1L A;  2M7O A;  1HZ1 A;  3JUP A;  3DZL A;  1W7C A;  2FNQ A;  3A5E A;  3JUM A;  2XFT A;  2XGN A;  4XM4 A;  3CCU 3;  3AHS A;  2CFL A;  2OTL 3;  1L5G B;  1SPU A;  1DMN A;  2OOV A;  2CKF B;  1TIJ A;  2C4B A;  4N6O B;  3LTD A;  3BNB A;  4H61 A;  1W01 A;  3CC4 3;  1OPY A;  4FR9 A;  3V99 A;  1K8A 4;  3DY5 A;  4HZB B;  1W5Z A;  1RLS A;  5IER A;  1KQS 2;  3KE7 A;  1NNV A;  3I0Y A;  1FW7 A;  5LC6 A;  3Q90 A;  1BRJ A;  2BMQ B;  3AHW A;  4XDW A;  1FYS A;  1KSI A;  2LYX A;  1SAR A;  3I56 3;  3MWZ A;  2W2C A;  4AKZ A;  2WGQ A;  4FMB A;  3VF1 A;  4GSP A;  1JZO A;  4OUQ A;  2CG1 A;  2IUJ A;  1M1K 4;  1VQL 3;  2OWP A;  3S5C A;  3H51 A;  4CDL A;  1LQM B;  1Q82 4;  4J8T A;  2CWT A;  5M1A A;  1D6Y A;  5BU4 A;  3X41 A;  3LXU X;  4HM6 B;  4RZM A;  1JJ2 2;  1OF5 B;  3F7X A;  4JRF A;  2YFI B;  3CNX A;  1RGG A;  1RGH A;  4O2H A;  3LTC A;  4GL6 A;  3FF0 A;  5TGN A;  2W9P A;  3T8N A;  1BNJ A;  2P05 A;  1IT7 A;  1HYF A;  3ROB A;  3CCV 3;  1A2P A;  4R80 A;  1DMM A;  2XSO B;  2J8X B;  2QGU A;  2W9Q A;  3OX9 A;  4LZI A;  1UI7 A;  1GY5 A;  5D81 A;  3RNT A;  1W4N A;  2P0X A;  5STD A;  3X3X A;  4STD A;  3ZG5 A;  3B8L A;  2GEY A;  4AKY A;  3F7S A;  1NB5 I;  2KCD A;  1IQ8 A;  2D1W A;  3QK9 A;  1Q86 4;  3F14 A;  1FGR A;  1BRI A;  1OHS A;  4OK0 A;  2QA4 3;  1UUW B;  1Q42 A;  2GBW B;  3BB9 A;  3MG2 A;  1CEW I;  3MHE A;  1I3I A;  1YI2 3;  1LRA A;  4N6M A;  5JPP A;  1MOL A;  3ZG0 A;  1T2H A;  2UGI A;  1B27 A;  2BHM A;  4LMI A;  1FGM A;  3F8X A;  1X1X A;  1Q40 A;  1Y4K A;  2CFK A;  3SXX A;  3D5G A;  1RGE A;  2RCD A;  5HGR A;  5AYS C;  1JKG B;  7GSP A;  3CCR 3;  2WOF A;  2FGT A;  3GZR A;  2KF4 A;  3KN4 A;  4HVN A;  1GOV A;  1TRQ A;  2BO9 B;  1JRQ A;  1IK3 A;  1B2M A;  2WGO A;  4N6T A;  3SVA A;  1NB3 I;  1GSP A;  3S67 A;  1DVC A;  1YIT 3;  1A2K A;  4JF8 A;  3NXJ A;  3Q3F A;  4XBY A;  2BIR A;  3EBT A;  4WFO A;  4EC6 A;  2LQV A;  1Q9E A;  1UUG B;  1W6G A;  2ML5 A;  3O8Y A;  2W6J H;  1RDS A;  1AQZ A;  1MNL A;  4IT7 A;  5CLK A;  2F86 B;  2L1S A;  1BSE A;  4K90 B;  2OQE C;  4XB5 A;  3CC7 3;  1I3F A;  3IMA B;  1W2Z A;  3NBR A;  1AVK A;  3DGN A;  4XBT A;  3NV0 A;  3G4S 3;  1OHP A;  2H0H A;  4KFF A;  3IJE B;  1PFP A;  1G02 A;  1ISK A;  1G0T A; 
#chains in the Genus database with same CATH homology
 3E99 A;  2B1X B;  1YJ9 3;  5BXQ A;  1STF I;  5G2G A;  1ULI B;  1TP6 A;  1W6C A;  4XDV A;  1DYU A;  1RKY A;  4EXR A;  1TFK A;  3G8Z A;  4FMC A;  1K9M 4;  3D9R A;  3GZY B;  3UL5 A;  3NQY A;  1TUH A;  5IF6 A;  1IVU A;  3B7C A;  4R4K A;  3NBB A;  3X40 A;  3K9M C;  2KXG A;  3GRD A;  2E2U A;  3ECF A;  4KZ1 A;  3T8U A;  1WMP A;  1ZO2 A;  1YJN 3;  3NX0 A;  5AII A;  2ML6 A;  1N8Q A;  4WYK A;  3CC2 3;  3TDG A;  4H3U A;  4AEQ A;  3CCM 3;  1C7H A;  3FKA A;  3LML A;  4FMA A;  1IVX A;  1KD1 4;  3MYT A;  1V74 A;  1SIH A;  1O7N B;  1STD A;  1ZX2 A;  1VQM 3;  3NQZ A;  1SQW A;  4N6V 0;  3DXO A;  1ASK A;  5AIH A;  1VQ6 3;  1HKX A;  3RGR A;  3S29 A;  3HX8 A;  3PS8 A;  4WP5 A;  4CCV A;  5BVB A;  1JB5 A;  2SBL A;  1KWI A;  3FG4 A;  1FGT A;  4HM8 B;  1E97 A;  1FUW A;  1IQY A;  1EG9 B;  3S27 A;  1UI8 A;  2HMN B;  3LH4 A;  1GY7 A;  2R4I A;  3K0Z A;  5D83 A;  1JB4 A;  3FGY A;  3NM2 A;  5ELJ A;  3KII A;  3F40 A;  2O3O A;  4R9K A;  5IEP A;  1M1X B;  2HML B;  1ROV A;  3WOD G;  2HMO B;  2JDI H;  4BTW A;  4I4K A;  3G6E 3;  3LTA A;  3GZX B;  4K1U A;  5AI1 A;  1U5O A;  4FCZ A;  5DRV A;  1E3R A;  1T5Y A;  1NO3 A;  1E3V A;  4U13 A;  3UJM A;  1ULJ B;  3EB8 A;  1VQ5 3;  4IPB A;  1OGX A;  1G96 A;  1KC8 4;  3CCQ 3;  4N6U A;  3WMD A;  1W02 A;  2CH9 A;  5ELU A;  4OVM A;  1S72 3;  1YVB I;  3EHC A;  3LZA A;  5IEN A;  3EQQ B;  3FLJ A;  8CHO A;  2XFS A;  2P09 A;  2Y74 A;  4QWT A;  5LC7 A;  3K63 A;  3D3L A;  5AIF A;  3UNL A;  2XF3 A;  1LVN A;  1GYB A;  2F99 A;  4K1V A;  2RGQ A;  4J9A A;  4NHF A;  1W2B 2;  3BNC A;  3PGB A;  1LNH A;  3PXM A;  4R9L A;  3MPH A;  3N54 B;  4O8S A;  3OWS A;  4HBR A;  3WOE B;  3M8C A;  1W00 A;  3DGO A;  3JVC A;  2Y73 A;  4HM3 B;  1WQL B;  1CYU A;  5CF1 A;  3NUV A;  2W04 A;  2CC3 A;  2W56 B;  5FW5 A;  1YHQ 3;  3KKG A;  2ZDJ A;  3B4P A;  1IVW A;  4LGQ A;  2W03 A;  4BTX A;  5IG4 A;  4FCM A;  3MG1 A;  3GWR A;  4MMZ B;  4WHA A;  1IV7 A;  2WO0 A;  3IPT A;  3X3Z A;  3CD6 3;  2BMR B;  1WTH A;  3Q1C A;  1CYV A;  3VGN A;  1LOX A;  3J7Y d;  2CWU A;  5A0O B;  5AEU B;  1GY6 A;  2BNG A;  3MSO A;  1IU7 A;  3V92 A;  1FGO A;  2OOV C;  3G0K A;  3FZW A;  1OGZ A;  2XH9 A;  1TU5 A;  1A90 A;  1D6U A;  3FG1 A;  1VQ9 3;  1N5H A;  5IW9 A;  1M9G A;  1YGE A;  5KP4 A;  3Q2P A;  1N8R 4;  1QAL A;  2CFD A;  2Z77 A;  4L8O A;  4LEH A;  5JPU A;  4N3V A;  3B4O A;  1A2V A;  1A67 A;  2PNC A;  2IUK A;  1YJW 3;  3CCJ 3;  3FF2 A;  4KFD A;  1VQO 3;  3CPO A;  1N9J A;  1AR0 A;  1NWW A;  1Z1S A;  3FSD A;  3SX1 A;  1O7G B;  5EVH A;  2MF7 A;  2YFL B;  2HMJ B;  3KSP A;  3NM7 A;  1OAC A;  1RRL A;  3JUO A;  2HMK B;  2Q07 A;  1OF5 A;  1ROA A;  3PYJ A;  1AV4 A;  1UW1 A;  2CK3 H;  1K73 4;  4KFE A;  5IG0 A;  2YX9 A;  1WMO A;  1HU9 A;  3ALA A;  2CG0 A;  3DGL A;  1VQ7 3;  2E2T A;  3CPW 2;  2L4V A;  4GB5 A;  3HZP A;  3X42 A;  3DUK A;  3RDE A;  2PZV A;  3GZB A;  1IV9 A;  3WDG B;  5EQL A;  4XBX A;  5CK6 A;  1VQP 3;  2FXT A;  2GEX A;  1GD3 A;  1O7H B;  4NRE A;  1JN5 A;  2ZL8 A;  4FCJ A;  7STD A;  1VZZ A;  2BMO B;  2YFJ B;  3OW2 2;  1SJW A;  3V98 A;  3I55 3;  1JKG A;  2CFW A;  3CNM A;  2C10 A;  2XGL A;  1Q40 B;  3NHX A;  1F8N A;  1JB2 A;  5DRE A;  3U1W A;  5IG5 A;  3VSY A;  2GU1 A;  2UX0 A;  4PEJ A;  2WOH A;  2IA7 A;  3CME 3;  2A15 A;  5IEO A;  1QJG A;  3HK4 A;  3K5T A;  4WWU C;  1JV2 B;  3CU3 A;  3KFQ C;  1QVG 2;  3BNE A;  3PZW A;  5IG3 A;  3G71 3;  2GXF A;  3EJV A;  4TX4 A;  3JUQ A;  1OUN A;  3BLZ A;  1IVV A;  4K61 A;  2OQE A;  3PCR A;  5CF2 A;  2K0M A;  3BND A;  1N5P A;  2OTJ 3;  2F98 A;  3NV0 B;  1NJI 4;  1NDO B;  3SLU A;  4HZ9 B;  3LTB A;  1IDP A;  1O7P B;  5JBS A;  2CHC A;  3WOF B;  3EE1 A;  3UL6 A;  2GBX B;  3WA2 X;  4G1M B;  1WMN A;  3U97 A;  3KZT A;  2Z6B A;  1VQ8 3;  2XR8 B;  4ZM8 A;  1QVF 2;  4KVH A;  1EA2 A;  3DGM A;  1W6Y A;  4EV5 A;  2CIU A;  4HYZ A;  1VQ4 3;  4HM7 B;  1DMQ A;  4L7K A;  4MMX B;  4O02 B;  4EV2 A;  3CXC 2;  2KRT A;  1VQN 3;  3FCS B;  1Q7Y 4;  2RFR A;  3MKI A;  4WYK B;  1RJO A;  4HJL B;  3STD A;  1K28 A;  1S5A A;  3QRD A;  1JNQ A;  4RNZ A;  1Q81 4;  2MC8 A;  3X3Y A;  1K41 A;  2BT3 A;  3EC9 A;  3EN1 B;  2XRX B;  3NBJ A;  5AYR B;  2Z76 A;  4BTY A;  1OCV A;  4HM4 B;  3G16 A;  1OH0 A;  1OHO A;  4MEI A;  1EQK A;  3A76 A;  1TFO A;  3PCS A;  1GS3 A;  4L8P A;  5CXO A;  3T0U A;  3OWY A;  3AMO A;  1DVD A;  1US1 A;  4MJD A;  4N6L A;  1IT8 A;  1JN5 B;  3DM8 A;  3K7C A;  3LT8 A;  1J2B A;  1O7W B;  1RN7 A;  4RNY A;  1QAF A;  3FG3 A;  4HM0 B;  2INX A;  3LYG A;  3ER7 A;  2C11 A;  3N9H A;  6STD A;  2STD A;  4HM5 B;  2B24 B;  1R4C A;  1GD4 A;  4LSO A;  2GU3 A;  4HM1 B;  5AEW B;  1QMA A;  1RRH A;  5AIG A;  1U8C B;  3EX9 A;  4EYC A;  4N6N B;  4X2O A;  3MG3 A;  4IIA A;  4ORL A;  4HKV B;  3F8H A;  3CMA 3;  3CCL 3;  3EBY A;  3HIG A;  1EKM A;  3KSE D;  2OCT A;  1N9E A;  1PFP A;  3EF8 A;  5I97 A;  4R1K A;  3SOY A;  3FH1 A;  2CWV A;  1UUV B;  1IQX A;  3OXA A;  1VQK 3;  2QIY A;  4MMY B;  5FGO A;  2QEX 3;  2HMM B;  5KP1 A;  3LT9 A;  3F9S A;  1FA3 A;  3DMC A;  2XEP A;  3JUN A;  2P38 A;  2RSX A;  2D42 A;  1BUQ A;  2CFG A;  1QAK A;  1SII A;  3RGA A;  3EN8 A;  3L0R A;  2JQ5 A;  3HI7 A;  4HM2 B;  3UB1 A;  1FGQ A;  3CCS 3;  2P0M A;  3GAX A;  1NU3 A;  1PU4 A;  3H3H A;  3CCE 3;  4RBN A;  4O3V A;  2W56 A;  4X2H A;  2O9U X;  1M90 4;  5KP3 A;  4Q53 A;  1WNH A;  1CQS A;  3SOA A;  1D6Z A;  2Z7A A;  1AVL A;  3OWU A;  1O7M B;  3HII A;  3S28 A;  2W0Q A;  3SED A;  2IMJ A;  2K54 A;  2E2V A;  5D82 A;  4FMD A;  3OV4 A;  2XSH B;  3N8B A;  5EEO A;  3LOY A;  4EBG A;  1YIJ 3;  3WA3 A;  1LXE A;  2I9W A;  3AMO B;  2V1L A;  2M7O A;  3JUP A;  3DZL A;  1W7C A;  2FNQ A;  3JUM A;  2XFT A;  2XGN A;  4XM4 A;  3CCU 3;  2OTL 3;  2CFL A;  1L5G B;  1SPU A;  1DMN A;  2OOV A;  2CKF B;  1TIJ A;  3CC4 3;  4N6O B;  3LTD A;  3BNB A;  4H61 A;  1W01 A;  1OPY A;  4FR9 A;  3V99 A;  1K8A 4;  3DY5 A;  4HZB B;  1W5Z A;  5IER A;  1KQS 2;  3KE7 A;  3I0Y A;  5LC6 A;  3Q90 A;  2BMQ B;  4XDW A;  1KSI A;  2LYX A;  3I56 3;  3MWZ A;  2W2C A;  4AKZ A;  2WGQ A;  4FMB A;  3VF1 A;  1VQL 3;  2CG1 A;  4OUQ A;  2IUJ A;  1M1K 4;  2OWP A;  3S5C A;  3H51 A;  4CDL A;  1Q82 4;  4J8T A;  2CWT A;  1D6Y A;  3X41 A;  3LXU X;  4HM6 B;  4RZM A;  1JJ2 2;  1OF5 B;  3F7X A;  4JRF A;  2YFI B;  3CNX A;  4O2H A;  3LTC A;  4GL6 A;  3FF0 A;  5TGN A;  2W9P A;  3T8N A;  2P05 A;  1IT7 A;  3CCV 3;  3ROB A;  4R80 A;  1DMM A;  2XSO B;  2W9Q A;  2QGU A;  3OX9 A;  4LZI A;  1UI7 A;  1GY5 A;  5D81 A;  1W4N A;  2P0X A;  5STD A;  3X3X A;  4STD A;  3B8L A;  2GEY A;  4AKY A;  3F7S A;  1NB5 I;  2KCD A;  1IQ8 A;  2D1W A;  3QK9 A;  1Q86 4;  3F14 A;  1FGR A;  1OHS A;  4OK0 A;  2QA4 3;  1UUW B;  1Q42 A;  2GBW B;  3BB9 A;  3MG2 A;  1CEW I;  3MHE A;  1YI2 3;  4N6M A;  5JPP A;  1MOL A;  2BHM A;  4LMI A;  1FGM A;  3F8X A;  1Q40 A;  1Y4K A;  2CFK A;  3SXX A;  2RCD A;  5HGR A;  5AYS C;  1JKG B;  3CCR 3;  2WOF A;  2FGT A;  3GZR A;  3KN4 A;  4HVN A;  2BO9 B;  1JRQ A;  1IK3 A;  2WGO A;  4N6T A;  3SVA A;  1NB3 I;  3S67 A;  1DVC A;  1YIT 3;  1A2K A;  4JF8 A;  3NXJ A;  4XBY A;  3EBT A;  4WFO A;  4EC6 A;  2LQV A;  1W6G A;  3O8Y A;  2ML5 A;  5CLK A;  2W6J H;  1MNL A;  4IT7 A;  2F86 B;  4K90 B;  2OQE C;  4XB5 A;  3CC7 3;  3IMA B;  1W2Z A;  3NBR A;  1AVK A;  3DGN A;  4XBT A;  3NV0 A;  3G4S 3;  1OHP A;  4KFF A;  3IJE B;  2CW9 A;  1ISK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...