3UL5A

Saccharum officinarum canecystatin-1 in space group c2221
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
HENDLEAIELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKVWENFKQLQSFQPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography and NMR studies of domain-swapped canecystatin-1.
pubmed doi rcsb
source organism Saccharum officinarum
molecule tags Hydrolase inhibitor
molecule keywords Canecystatin-1
total genus 14
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16845 SQAPI Aspartic acid proteinase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ul5A00
1N5PA 4N6MA 3GAXA 1MOLA 1TIJA 1CYUA 1N5HA 5EQLA 1IV7A 3LH4A 3KSED 3UL5A 1IV9A 1KWIA 3K9MC 1ROAA 5LC7A 3QRDA 3PS8A 1A90A 1CYVA 1RN7A 1YVBI 4N6LA 4N6OB 4N6UA 4TX4A 1CEWI 1DVDA 5ELUA 1WNHA 1NB3I 2OCTA 3PXMA 5ELJA 1R4CA 3L0RA 3SVAA 4N6TA 1FA3A 4EYCA 1M9GA 3PYJA 1LXEA 2CH9A 2W9QA 5A0OB 1NB5I 3Q2PA 4IT7A 3UL6A 1PFPA 3MWZA 2BO9B 1A67A 5LC6A 2W9PA 4CCVA 2O9UX 1G96A 2KXGA 3S67A 1MNLA 1FUWA 1DVCA 4ZM8A 1EQKA 4N6V0 1GD4A 1STFI 4N6NB 3NX0A 1GD3A 4LZIA 1N9JA 3KFQC 3IMAB
chains in the Genus database with same CATH superfamily
2QIYA 3BLZA 1MOLA 3DMCA 4LYLB 1A2KA 1JKGA 1C54A 1K734 1L5GB 2OOVC 1OHPA 3V98A 4HM5B 2J8XB 1LOXA 5IENA 4N6OB 1MWUA 5IERA 1O7MB 3MPHA 2CX0A 1FGRA 1Q9EA 1GS3A 1VQN3 3EN1B 1KSIA 3LMLA 1FZUA 3LTDA 1AY7A 5I97A 3FG3A 5AIGA 1BRGA 3EX9A 4MJDA 3CCL3 1GOVA 1LVNA 3A76A 3ALAA 1B2UA 1I3FA 3MKIA 4HZBB 1YVSA 1IT7A 4I4KA 3S67A 2JDIH 2OTJ3 2CX1A 3CNXA 4BTXA 2P38A 3KFQC 1UUVB 3GZBA 3IMAB 5AIFA 3HIIA 4BTWA 3NQYA 3AHWA 3E99A 1KWIA 3S27A 1IVWA 4PEJA 1RDSA 4MMZB 5DRVA 1BSAA 1EKMA 1SIIA 6GSPA 4KFDA 3VF1A 1C7HA 1RGKA 1K8A4 1RCLA 3KKGA 2ML5A 2GU3A 3HX8A 3PXMA 4XM4A 1B2MA 4J5KA 1UI7A 3FG1A 1VQM3 3FGYA 2PZVA 3EJVA 4XBXA 1RGFA 1YIJ3 1S723 2CHCA 2E2UA 3GZRA 5G1LA 5STDA 5IG4A 1YHQ3 1N8R4 2L1SA 2KXGA 3GWRA 1BOXA 1SJWA 1WMNA 3WMDA 1T2HA 2CFDA 1J2BA 5GSPA 4K61A 4CJNA 3FH1A 3NBBA 5AYSC 1YIT3 1LOWA 1Y4KA 1TTOA 1D6ZA 1O7NB 3BNDA 7RNTA 3PGBA 1RN1A 2Z6BA 1OGXA 7STDA 2HMJB 2Q07A 4BU4A 1BNRA 5IG3A 1BNIA 1I2GA 1W00A 1T2IA 3DZLA 1OH0A 1BSBA 2A15A 1NO3A 3CCU3 4IIAA 2CKFB 2F99A 2LQVA 4NPBA 3JUOA 3CPW2 2MC8A 4NREA 2H0IA 1O7GB 1SIHA 1STDA 2GBWB 1JN5A 3EF8A 2GU1A 2W0QA 3GZYB 3CCJ3 3CD63 1TU5A 1JBRA 1BSCA 5IG5A 4J9AA 4CDLA 1PU4A 3JUPA 1A2VA 1FW7A 3OV4A 3X3XA 2D1WA 1N8QA 1RRHA 2F56A 1UGIA 4R9LA 4AKYA 3BNBA 3N54B 4WYKA 1DMMA 4Q53A 2QEX3 3I563 1FUSA 3OX9A 4HM2B 3RGAA 2OQEA 3CPOA 3K5TA 3CC43 1CEWI 1ROVA 5ELUA 1B2XA 1UGHI 2BMRB 2HOHA 3WDGB 5IF6A 4EXRA 3S5CA 1YJW3 3KZTA 5KP1A 1K9M4 1LOYA 1U8CB 1NB5I 3KCHA 4DKIA 5AIIA 3RGRA 3CME3 1NU3A 4FR9A 5AEWB 3WOEB 2F4YA 1T5YA 1N9EA 1QJGA 2CK3H 3CU3A 3O8YA 2H0GA 2WO0A 3ZG0A 2CFLA 1GD4A 3U97A 1JZDA 1IQ8A 2SARA 1I0VA 1FYSA 1DYUA 3OWUA 3MYTA 1IV7A 3NV0B 3UL5A 4O8SA 2P05A 5HOHA 1RGLA 4CPKA 3OXAA 1IVVA 1EUIC 3LT9A 3SEDA 3EB8A 1RN7A 2GBXB 1W01A 4N6UA 5CLKA 1VQ83 4FCMA 1NB3I 4U13A 3T8NA 2CG1A 4OVMA 1WTHA 4EYCA 2CW9A 1CH0A 1DMQA 4IT7A 1B3SA 1BRHA 2KF3A 2OWPA 2WGOA 1IVXA 1ZGXA 2BU4A 2M7OA 4HJLB 4J5GA 2W9PA 3V92A 1G96A 4MMYB 3FF0A 4ILFA 1IU7A 3NUVA 4N6V0 1BU4A 2RCDA 4X2OA 3KE7A 3AHSA 3FCSB 2ZA4A 4RZMA 3I553 2WGQA 5IEOA 5JPPA 3LYGA 3K9MC 2IY2A 4L8OA 5CF1A 3H3HA 3LOYA 1BRKA 2FXTA 2Z77A 1BNJA 1BSEA 4IPBA 2MF7A 4L8PA 1O7WB 2GEXA 3MG2A 1BNFA 2BMOB 3L0RA 4NHFA 1RJOA 4WHAA 1I0XA 2Z76A 1GY5A 1UUGB 3B7CA 2UGIA 1QALA 5KP3A 3PZWA 1PY3A 4HKVB 1KQS2 2K3DA 4MMXB 4AEQA 5BXQA 2E2VA 1GMPA 1UW1A 1I2EA 4GL6A 4N6NB 1RNTA 3LTAA 1X1WA 3DY5A 1YJN3 1N9JA 3F7XA 2BNGA 1FGQA 1ZX2A 3F8HA 1G02A 3LH4A 1RMSA 3EE1A 3BB9A 1HYFA 4GSPA 1M1K4 1Q7Y4 3IPTA 3MHEA 1NNVA 5FW5A 1UCKA 1DETA 3HIGA 5G1KA 1A2PA 3WOFB 2KF5A 5EVHA 4KFEA 1YNVX 2XSHB 1GY7A 3G713 4WFOA 3SVAA 4HVNA 4LMIA 1B20A 1IDPA 5AEUB 1B2SA 1JB4A 1V74A 2GEYA 4I5QA 3V99A 2BO9B 3HZPA 5LC6A 5AI1A 8RNTA 1KC84 4BL3A 2CWTA 1W6GA 4STDA 5M19A 1GSPA 1TRPA 2ZDJA 3Q90A 4HOHA 2HMOB 4O2HA 1LNHA 2YFJB 5CK6A 3X42A 3FKAA 3RNTA 1CYUA 2O3OA 3KSED 3K0ZA 3KIIA 1BNGA 2XGNA 3JVCA 3CCR3 1X1UA 1LNIA 3A5EA 4EBGA 4J8TA 4XDWA 1JKGB 5CF2A 2CFKA 1SARA 3FSDA 2W6JH 4KVHA 1K28A 4KT3B 1UUWB 3X41A 4GHOA 1RTUA 4HAAA 3SXXA 4FCZA 1AR0A 3CC23 3LZAA 4LGQA 2KAAA 1Q824 2XSOB 3AMOA 1S5AA 4L7KA 4JF8A 1MNLA 1B21A 3NM7A 3QK9A 1OPYA 2IUKA 1JJ22 1JRQA 1OF5B 3ECFA 4RNZA 3GZXB 5DREA 2P0MA 2R41A 1BRJA 2INXA 3M8CA 3SX1A 2AAEA 2V1LA 3CXC2 1R4YA 4N6LA 2CFWA 3SOAA 1HKXA 1LRAA 1RHLA 3MSOA 3PCRA 3STDA 3NBRA 3G8ZA 2BMQB 1PYLA 3JUNA 1NDOB 1TUHA 2I9WA 1UDII 3F7SA 1QVF2 2RSXA 3FZWA 3X3ZA 9RNTA 1VQQA 3T0UA 3CNMA 1A67A 1JB2A 2C10A 4FCJA 2O9UX 3JUQA 2LYXA 3D9RA 3K63A 1BNEA 1IK3A 1W4NA 4KFFA 1BANA 3VGNA 2UUGC 5BVBA 1EQKA 1B27A 1ISKA 1W2ZA 2C4BA 1G0TA 1DMNA 1VQ93 1TP6A 2AADA 7GSPA 1IQYA 4BIRA 2WOFA 1VQO3 3CCS3 3FG4A 1OGZA 5EQLA 1SPUA 4H3UA 4K90B 4RNYA 1VQ53 2L4VA 2E2TA 3ZFZA 3U1WA 1RGEA 2RBIA 3DXOA 4R4KA 3OWYA 4WP5A 1Q7HA 8CHOA 1I2FA 2OQEC 3ER7A 4MEIA 3S29A 4O02B 5JBSA 2YX9A 3LTCA 2HMMB 1Q40A 1BIRA 5CXOA 2B1XB 3G6E3 1FA3A 1BRSA 3DUKA 2GXFA 3EQQB 4LEHA 1QAKA 3UL6A 3KSPA 4HBRA 2XFSA 4XBYA 6RNTA 2C11A 4HM4B 2K54A 2F5MA 1RN4A 3EBYA 1OCVA 3MG1A 3WR2A 1D6YA 3UJMA 4ZM8A 1I8VA 1STFI 2KCDA 3VSYA 1FGTA 4QWTA 1JN5B 2W04A 5JPUA 4LZIA 1TFKA 3MG3A 3NXJA 5D83A 1FUWA 1JB5A 2IUJA 2H0HA 3H51A 3B4OA 1TFOA 5RNTA 1IV9A 1JBSA 4KZ1A 1BSDA 2KF4A 3CCE3 1KD14 4ORLA 3LTBA 1FGMA 3PCSA 4WWUC 2XRXB 5BIRA 1GOUA 4EW5A 2K0MA 1Q814 1RCKA 1R4CA 3F40A 4BTYA 5A0OB 1VZZA 1ZO2A 3HOHA 3GRDA 2P09A 2XH9A 1IQXA 3EBTA 2CWUA 4XDVA 1OUNA 1Q42A 1US1A 2JQ5A 3G16A 4HM7B 3WA2X 1VQ73 5FGOA 1W6YA 1T3BA 2XGLA 1EEJA 1HU9A 1I70A 5HGRA 3NBJA 2D42A 1AV4A 2GSPA 2BIRA 2R4IA 4HM6B 1JBTA 2B24B 2ML6A 2W03A 1NJI4 1FGOA 1BUQA 1VQP3 1O7PB 4BL2A 3NV0A 5ELJA 4N6TA 1AVKA 1M904 3BU4A 4XBTA 2F86B 1IT8A 3F8XA 4OUQA 3F9SA 4RNTA 3BIRA 1PFPA 2YFIB 3WA3A 1RNBA 3IJEB 2W56A 1E3RA 3DGOA 4CCVA 1EA2A 1QAFA 1VQ63 2HMLB 1DE3A 1OHSA 2FGTA 1RGGA 1GY6A 3HI7A 2CC3A 3CCM3 4O3VA 1BRNL 2P0XA 3DGNA 3EHCA 4FMAA 1V57A 1B2ZA 2F5WA 3F14A 5LC7A 5KP4A 1RKYA 4HYZA 3AGNA 1MGRA 2KRTA 3EC9A 4K1UA 1AVLA 4R1KA 4RBNA 1BAOA 2XR8B 3K7CA 4TX4A 3JUMA 2OCTA 3DGMA 1TRQA 3UNLA 4N3VA 1QMAA 1BNSA 3D5IA 3PYJA 4G1MB 1BUJA 4FMBA 2CH9A 2YFLB 1ULIB 4K1VA 4R9KA 3EN8A 4JRFA 1YJ93 1YI23 2IMJA 1JV2B 1UCLA 2SBLA 1IYYA 4EV5A 3RDEA 1DVCA 1MGWA 3OWSA 1GMQA 3NM2A 3N9HA 3NX0A 1BRIA 1WMPA 5TGNA 1GMRA 1LOVA 5D82A 1BGSA 2CWVA 1GOYA 4HM8B 4XB5A 3NQZA 1GYBA 2ZHXB 2UX0A 3HK4A 3PS8A 2RFRA 1YVBI 3LXUX 1JNQA 5IEPA 4HM0B 4WYKB 3BNEA 1JZOA 4HM1B 3ROBA 4EV2A 5IG0A 1YGWA 1W2B2 1W7CA 3WHOA 1UI8A 1ASKA 1K41A 1X1YA 3NHXA 5AYRB 3Q3FA 2OTL3 4GB5A 1RGHA 1OF5A 2XF3A 3D5GA 4FMDA 3X3YA 3CCV3 4FMCA 1VQL3 2XEPA 2Y74A 3TDGA 1GD3A 2KF6A 3B8LA 3AMOB 1OHOA 1Q864 1BVIA 1RGCA 1ULJB 3I0YA 3GAXA 1EG9B 3GSPA 3G0KA 1N5HA 3N8BA 3WODG 1I3IA 2OOVA 3SOYA 3QRDA 2FNQA 2XFTA 3J7Yd 1IVUA 1A90A 2Y73A 3Q1CA 2HMKB 3URPA 1MWTA 5M18A 1WNHA 3DH2A 2QA43 2W2CA 1VQ43 2RNTA 1M9GA 2BHMA 2RGQA 1LXEA 2W9QA 4EC6A 4AKZA 3Q2PA 5BU4A 1NWWA 3MWZA 4HZ9B 1AQZA 3CC73 2IYJA 1MWRA 3X40A 3CCQ3 3D3LA 1RLSA 2F98A 3D4AA 2HMNB 2CFGA 1X1XA 5M1AA 3S28A 2W56B 3CMA3 1VQK3 2CIUA 3DM8A 1D6UA 1E97A 1N5PA 1TJDA 1TIJA 1W02A 4N6MA 3T8UA 3DGLA 2ZL8A 2CG0A 3G4S3 1WQLB 2WOHA 5EEOA 1ZS7A 1CQSA 1OACA 1ROAA 1HZ1A 5D81A 2STDA 3FLJA 3ZG5A 1E3VA 1F8NA 1CYVA 1LQMB 1M1XB 2Z7AA 1RSNA 2PNCA 1DVDA 3OW22 3UB1A 1QVG2 1O7HB 3LT8A 1SQWA 5IW9A 3D79A 1LQGC 5AIHA 3SLUA 1FUTA 4LSOA 1Z1SA 1RRLA 5G2GA 6STDA 1RGAA 3DGYA 3BNCA 1WMOA 1Q40B 1W6CA 1U5OA 2BT3A 2QGUA 3AGOA 3FF2A 3B4PA 4HM3B 4OK0A 4R80A 4H61A 1YGEA 1MWSA 4X2HA 1W5ZA 3SYUA 2IA7A 3KN4A 1UCIA 1V58A 1UCJA
chains in the Genus database with same CATH topology
2QIYA 3BLZA 1MOLA 3DMCA 1A2KA 1JKGA 1K734 1L5GB 2OOVC 1OHPA 3V98A 4HM5B 1LOXA 5IENA 4N6OB 5IERA 1O7MB 3MPHA 1FGRA 1GS3A 1VQN3 3EN1B 1KSIA 3LMLA 3LTDA 5I97A 3FG3A 5AIGA 3EX9A 4MJDA 3CCL3 1LVNA 3A76A 3ALAA 3MKIA 4HZBB 4I4KA 3S67A 1IT7A 2JDIH 2OTJ3 3CNXA 4BTXA 2P38A 3KFQC 1UUVB 3GZBA 3IMAB 5AIFA 3HIIA 4BTWA 3NQYA 3E99A 1KWIA 3S27A 1IVWA 4PEJA 4MMZB 1EKMA 1SIIA 4KFDA 3VF1A 1C7HA 1K8A4 3KKGA 3PXMA 2ML5A 2GU3A 3HX8A 4XM4A 1UI7A 3FG1A 1VQM3 3FGYA 2PZVA 3EJVA 4XBXA 1YIJ3 1S723 2CHCA 2E2UA 3GZRA 5STDA 5IG4A 1YHQ3 1N8R4 2KXGA 3GWRA 1SJWA 3WMDA 1WMNA 2CFDA 1J2BA 4K61A 3FH1A 3NBBA 5AYSC 1YIT3 1Y4KA 1D6ZA 1O7NB 3BNDA 3PGBA 2Z6BA 1OGXA 7STDA 2HMJB 2Q07A 5IG3A 1W00A 3DZLA 1OH0A 2A15A 1NO3A 3CCU3 4IIAA 2CKFB 2F99A 2LQVA 3JUOA 3CPW2 2MC8A 4NREA 1O7GB 1SIHA 1STDA 2GBWB 1JN5A 3EF8A 2GU1A 2W0QA 3GZYB 3CCJ3 3CD63 1TU5A 5IG5A 4J9AA 4CDLA 1PU4A 3JUPA 1A2VA 3OV4A 3X3XA 2D1WA 1N8QA 1RRHA 4R9LA 4AKYA 3BNBA 3N54B 4WYKA 1DMMA 4Q53A 2QEX3 3I563 4HM2B 3OX9A 3RGAA 2OQEA 3CPOA 3K5TA 3CC43 1CEWI 1ROVA 5ELUA 3WDGB 2BMRB 5IF6A 4EXRA 3S5CA 1YJW3 3KZTA 5KP1A 1K9M4 1U8CB 1NB5I 3CME3 5AIIA 3RGRA 1NU3A 4FR9A 5AEWB 3WOEB 1T5YA 1N9EA 1QJGA 2CK3H 3CU3A 3O8YA 2WO0A 2CFLA 1GD4A 3U97A 1IQ8A 1DYUA 3OWUA 3MYTA 1IV7A 3NV0B 3UL5A 4O8SA 2P05A 3OXAA 1IVVA 3LT9A 3SEDA 3EB8A 1RN7A 2GBXB 1W01A 4N6UA 5CLKA 1VQ83 4FCMA 1NB3I 4U13A 3T8NA 2CG1A 4OVMA 1WTHA 4EYCA 2CW9A 1DMQA 4IT7A 2OWPA 2WGOA 1IVXA 2M7OA 4HJLB 2W9PA 3V92A 1G96A 4MMYB 3FF0A 1IU7A 3NUVA 4N6V0 2RCDA 4X2OA 3KE7A 3FCSB 4RZMA 3I553 2WGQA 5IEOA 5JPPA 3LYGA 3K9MC 4L8OA 5CF1A 3H3HA 3LOYA 2FXTA 2Z77A 4IPBA 4L8PA 5DRVA 2MF7A 4NHFA 1O7WB 2GEXA 3MG2A 2BMOB 3L0RA 1RJOA 4WHAA 2Z76A 1GY5A 3B7CA 1QALA 5KP3A 3PZWA 4HKVB 1KQS2 4MMXB 4AEQA 5BXQA 2E2VA 1UW1A 4GL6A 4N6NB 3LTAA 1YJN3 3DY5A 1N9JA 3F7XA 2BNGA 1FGQA 1ZX2A 3F8HA 3LH4A 3EE1A 3BB9A 1M1K4 1Q7Y4 3IPTA 3MHEA 5FW5A 3HIGA 3WOFB 5EVHA 4KFEA 2XSHB 1GY7A 3G713 4WFOA 3SVAA 4HVNA 4LMIA 1IDPA 5AEUB 1V74A 1JB4A 3V99A 2GEYA 2BO9B 3HZPA 5LC6A 5AI1A 1KC84 2CWTA 1W6GA 4STDA 3Q90A 2ZDJA 2HMOB 4O2HA 1LNHA 2YFJB 5CK6A 3X42A 3FKAA 1CYUA 2O3OA 3KSED 3K0ZA 3KIIA 2XGNA 3JVCA 3CCR3 4EBGA 4J8TA 4XDWA 1JKGB 5CF2A 2CFKA 3FSDA 2W6JH 4KVHA 1K28A 1UUWB 3X41A 3SXXA 4FCZA 1AR0A 3CC23 3LZAA 4LGQA 1Q824 2XSOB 3AMOA 1S5AA 4L7KA 4JF8A 1MNLA 3QK9A 3NM7A 1OPYA 2IUKA 1JJ22 1JRQA 1OF5B 3ECFA 4RNZA 3GZXB 5DREA 2P0MA 2INXA 3M8CA 3SX1A 2V1LA 3CXC2 4N6LA 2CFWA 3SOAA 1HKXA 3MSOA 3PCRA 3STDA 3NBRA 3G8ZA 2BMQB 3JUNA 1NDOB 1TUHA 2I9WA 3F7SA 1QVF2 2RSXA 3FZWA 3X3ZA 3T0UA 3CNMA 1A67A 1JB2A 2C10A 4FCJA 2O9UX 3JUQA 2LYXA 3D9RA 3K63A 1IK3A 1W4NA 4KFFA 3VGNA 5BVBA 1EQKA 1ISKA 1W2ZA 1DMNA 1VQ93 1TP6A 1IQYA 2WOFA 1VQO3 3CCS3 3FG4A 1OGZA 5EQLA 1SPUA 4H3UA 4K90B 4RNYA 1VQ53 2L4VA 2E2TA 3U1WA 3DXOA 4R4KA 3OWYA 4WP5A 8CHOA 2OQEC 3ER7A 4MEIA 3S29A 4O02B 5JBSA 2YX9A 3LTCA 2HMMB 1Q40A 5CXOA 2B1XB 3G6E3 1FA3A 3DUKA 2GXFA 3EQQB 4LEHA 1QAKA 3UL6A 3KSPA 4HBRA 2XFSA 4XBYA 2C11A 4HM4B 2K54A 3EBYA 1OCVA 3MG1A 1D6YA 3UJMA 4ZM8A 1STFI 2KCDA 3VSYA 1FGTA 4QWTA 1JN5B 2W04A 5JPUA 4LZIA 1TFKA 3MG3A 3NXJA 5D83A 1FUWA 1JB5A 2IUJA 3H51A 3B4OA 1TFOA 1IV9A 4KZ1A 3CCE3 1KD14 4ORLA 3LTBA 1FGMA 3PCSA 4WWUC 2XRXB 2K0MA 1Q814 1R4CA 3F40A 4BTYA 5A0OB 1VZZA 1ZO2A 3GRDA 2P09A 2XH9A 1IQXA 3EBTA 2CWUA 4XDVA 1OUNA 1Q42A 1US1A 2JQ5A 3G16A 4HM7B 3WA2X 1VQ73 5FGOA 1W6YA 2XGLA 1HU9A 5HGRA 3NBJA 1AV4A 2D42A 2R4IA 4HM6B 2B24B 2ML6A 2W03A 1NJI4 1FGOA 1BUQA 1VQP3 1O7PB 3NV0A 5ELJA 4N6TA 1AVKA 1M904 4XBTA 2F86B 1IT8A 3F8XA 4OUQA 3F9SA 1PFPA 2YFIB 3WA3A 3IJEB 2W56A 1E3RA 3DGOA 4CCVA 1EA2A 1QAFA 1VQ63 2HMLB 1OHSA 2FGTA 1GY6A 3HI7A 2CC3A 3CCM3 4O3VA 2P0XA 3EHCA 3DGNA 4FMAA 5LC7A 5KP4A 1RKYA 3F14A 4HYZA 2KRTA 3EC9A 4K1UA 1AVLA 4R1KA 4RBNA 2XR8B 3K7CA 4TX4A 3JUMA 2OCTA 3DGMA 3UNLA 4N3VA 1QMAA 3PYJA 4G1MB 4FMBA 2CH9A 2YFLB 1ULIB 4K1VA 4R9KA 3EN8A 4JRFA 1YJ93 1YI23 2IMJA 1JV2B 2SBLA 4EV5A 3RDEA 1DVCA 3OWSA 3NM2A 3N9HA 3NX0A 1WMPA 5TGNA 5D82A 2CWVA 4HM8B 4XB5A 3NQZA 1GYBA 3HK4A 2UX0A 3PS8A 2RFRA 1YVBI 3LXUX 1JNQA 5IEPA 4HM0B 4WYKB 3BNEA 4HM1B 3ROBA 4EV2A 5IG0A 1W2B2 1W7CA 1UI8A 1ASKA 1K41A 3NHXA 5AYRB 2OTL3 4GB5A 1OF5A 2XF3A 4FMDA 3X3YA 3CCV3 4FMCA 1VQL3 2XEPA 2Y74A 3TDGA 1GD3A 3B8LA 1Q864 3AMOB 1OHOA 1ULJB 3I0YA 3GAXA 1EG9B 3G0KA 1N5HA 3N8BA 3WODG 2OOVA 3SOYA 3QRDA 2FNQA 2XFTA 3J7Yd 1IVUA 1A90A 2Y73A 3Q1CA 2HMKB 1WNHA 2QA43 1VQ43 2W2CA 1M9GA 2BHMA 2RGQA 1LXEA 2W9QA 4EC6A 4AKZA 3Q2PA 1NWWA 3MWZA 4HZ9B 3CC73 3X40A 3CCQ3 3D3LA 2F98A 2HMNB 2CFGA 3S28A 2W56B 3CMA3 1VQK3 2CIUA 3DM8A 1D6UA 1E97A 1N5PA 4N6MA 1TIJA 1W02A 3T8UA 3DGLA 2ZL8A 2CG0A 3G4S3 1WQLB 2WOHA 5EEOA 1CQSA 1OACA 1ROAA 5D81A 2STDA 3FLJA 1E3VA 1F8NA 1CYVA 1M1XB 2Z7AA 2PNCA 1DVDA 3OW22 3UB1A 1QVG2 1O7HB 3LT8A 1SQWA 5IW9A 5AIHA 3SLUA 4LSOA 1Z1SA 1RRLA 5G2GA 6STDA 3BNCA 1WMOA 1Q40B 1W6CA 1U5OA 2QGUA 2BT3A 3FF2A 4HM3B 3B4PA 4OK0A 4R80A 4H61A 1YGEA 4X2HA 1W5ZA 2IA7A 3KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5P A;  4N6M A;  3GAX A;  1MOL A;  1TIJ A;  1CYU A;  1N5H A;  5EQL A;  1IV7 A;  3LH4 A;  3KSE D;  3UL5 A;  1IV9 A;  1KWI A;  3K9M C;  1ROA A;  5LC7 A;  3QRD A;  3PS8 A;  1A90 A;  1CYV A;  1RN7 A;  1YVB I;  4N6L A;  4N6O B;  4N6U A;  4TX4 A;  1CEW I;  1DVD A;  5ELU A;  1WNH A;  1NB3 I;  2OCT A;  3PXM A;  5ELJ A;  1R4C A;  3L0R A;  3SVA A;  4N6T A;  1FA3 A;  4EYC A;  1M9G A;  3PYJ A;  1LXE A;  2CH9 A;  2W9Q A;  5A0O B;  1NB5 I;  3Q2P A;  4IT7 A;  3UL6 A;  1PFP A;  3MWZ A;  2BO9 B;  1A67 A;  5LC6 A;  2W9P A;  4CCV A;  2O9U X;  1G96 A;  2KXG A;  3S67 A;  1MNL A;  1FUW A;  1DVC A;  4ZM8 A;  1EQK A;  4N6V 0;  1GD4 A;  1STF I;  4N6N B;  3NX0 A;  1GD3 A;  4LZI A;  1N9J A;  3KFQ C;  3IMA B; 
#chains in the Genus database with same CATH topology
 2QIY A;  3BLZ A;  1MOL A;  3DMC A;  4LYL B;  1A2K A;  1JKG A;  1C54 A;  1K73 4;  1L5G B;  2OOV C;  1OHP A;  3V98 A;  4HM5 B;  2J8X B;  1LOX A;  5IEN A;  4N6O B;  1MWU A;  5IER A;  1O7M B;  3MPH A;  2CX0 A;  1FGR A;  1Q9E A;  1GS3 A;  1VQN 3;  3EN1 B;  1KSI A;  3LML A;  1FZU A;  3LTD A;  1AY7 A;  5I97 A;  3FG3 A;  5AIG A;  1BRG A;  3EX9 A;  4MJD A;  3CCL 3;  1GOV A;  1LVN A;  3A76 A;  3ALA A;  1B2U A;  1I3F A;  3MKI A;  4HZB B;  1YVS A;  1IT7 A;  4I4K A;  3S67 A;  2JDI H;  2OTJ 3;  2CX1 A;  3CNX A;  4BTX A;  2P38 A;  3KFQ C;  1UUV B;  3GZB A;  3IMA B;  5AIF A;  3HII A;  4BTW A;  3NQY A;  3AHW A;  3E99 A;  1KWI A;  3S27 A;  1IVW A;  4PEJ A;  1RDS A;  4MMZ B;  5DRV A;  1BSA A;  1EKM A;  1SII A;  6GSP A;  4KFD A;  3VF1 A;  1C7H A;  1RGK A;  1K8A 4;  1RCL A;  3KKG A;  2ML5 A;  2GU3 A;  3HX8 A;  3PXM A;  4XM4 A;  1B2M A;  4J5K A;  1UI7 A;  3FG1 A;  1VQM 3;  3FGY A;  2PZV A;  3EJV A;  4XBX A;  1RGF A;  1YIJ 3;  1S72 3;  2CHC A;  2E2U A;  3GZR A;  5G1L A;  5STD A;  5IG4 A;  1YHQ 3;  1N8R 4;  2L1S A;  2KXG A;  3GWR A;  1BOX A;  1SJW A;  1WMN A;  3WMD A;  1T2H A;  2CFD A;  1J2B A;  5GSP A;  4K61 A;  4CJN A;  3FH1 A;  3NBB A;  5AYS C;  1YIT 3;  1LOW A;  1Y4K A;  1TTO A;  1D6Z A;  1O7N B;  3BND A;  7RNT A;  3PGB A;  1RN1 A;  2Z6B A;  1OGX A;  7STD A;  2HMJ B;  2Q07 A;  4BU4 A;  1BNR A;  5IG3 A;  1BNI A;  1I2G A;  1W00 A;  1T2I A;  3DZL A;  1OH0 A;  1BSB A;  2A15 A;  1NO3 A;  3CCU 3;  4IIA A;  2CKF B;  2F99 A;  2LQV A;  4NPB A;  3JUO A;  3CPW 2;  2MC8 A;  4NRE A;  2H0I A;  1O7G B;  1SIH A;  1STD A;  2GBW B;  1JN5 A;  3EF8 A;  2GU1 A;  2W0Q A;  3GZY B;  3CCJ 3;  3CD6 3;  1TU5 A;  1JBR A;  1BSC A;  5IG5 A;  4J9A A;  4CDL A;  1PU4 A;  3JUP A;  1A2V A;  1FW7 A;  3OV4 A;  3X3X A;  2D1W A;  1N8Q A;  1RRH A;  2F56 A;  1UGI A;  4R9L A;  4AKY A;  3BNB A;  3N54 B;  4WYK A;  1DMM A;  4Q53 A;  2QEX 3;  3I56 3;  1FUS A;  3OX9 A;  4HM2 B;  3RGA A;  2OQE A;  3CPO A;  3K5T A;  3CC4 3;  1CEW I;  1ROV A;  5ELU A;  1B2X A;  1UGH I;  2BMR B;  2HOH A;  3WDG B;  5IF6 A;  4EXR A;  3S5C A;  1YJW 3;  3KZT A;  5KP1 A;  1K9M 4;  1LOY A;  1U8C B;  1NB5 I;  3KCH A;  4DKI A;  5AII A;  3RGR A;  3CME 3;  1NU3 A;  4FR9 A;  5AEW B;  3WOE B;  2F4Y A;  1T5Y A;  1N9E A;  1QJG A;  2CK3 H;  3CU3 A;  3O8Y A;  2H0G A;  2WO0 A;  3ZG0 A;  2CFL A;  1GD4 A;  3U97 A;  1JZD A;  1IQ8 A;  2SAR A;  1I0V A;  1FYS A;  1DYU A;  3OWU A;  3MYT A;  1IV7 A;  3NV0 B;  3UL5 A;  4O8S A;  2P05 A;  5HOH A;  1RGL A;  4CPK A;  3OXA A;  1IVV A;  1EUI C;  3LT9 A;  3SED A;  3EB8 A;  1RN7 A;  2GBX B;  1W01 A;  4N6U A;  5CLK A;  1VQ8 3;  4FCM A;  1NB3 I;  4U13 A;  3T8N A;  2CG1 A;  4OVM A;  1WTH A;  4EYC A;  2CW9 A;  1CH0 A;  1DMQ A;  4IT7 A;  1B3S A;  1BRH A;  2KF3 A;  2OWP A;  2WGO A;  1IVX A;  1ZGX A;  2BU4 A;  2M7O A;  4HJL B;  4J5G A;  2W9P A;  3V92 A;  1G96 A;  4MMY B;  3FF0 A;  4ILF A;  1IU7 A;  3NUV A;  4N6V 0;  1BU4 A;  2RCD A;  4X2O A;  3KE7 A;  3AHS A;  3FCS B;  2ZA4 A;  4RZM A;  3I55 3;  2WGQ A;  5IEO A;  5JPP A;  3LYG A;  3K9M C;  2IY2 A;  4L8O A;  5CF1 A;  3H3H A;  3LOY A;  1BRK A;  2FXT A;  2Z77 A;  1BNJ A;  1BSE A;  4IPB A;  2MF7 A;  4L8P A;  1O7W B;  2GEX A;  3MG2 A;  1BNF A;  2BMO B;  3L0R A;  4NHF A;  1RJO A;  4WHA A;  1I0X A;  2Z76 A;  1GY5 A;  1UUG B;  3B7C A;  2UGI A;  1QAL A;  5KP3 A;  3PZW A;  1PY3 A;  4HKV B;  1KQS 2;  2K3D A;  4MMX B;  4AEQ A;  5BXQ A;  2E2V A;  1GMP A;  1UW1 A;  1I2E A;  4GL6 A;  4N6N B;  1RNT A;  3LTA A;  1X1W A;  3DY5 A;  1YJN 3;  1N9J A;  3F7X A;  2BNG A;  1FGQ A;  1ZX2 A;  3F8H A;  1G02 A;  3LH4 A;  1RMS A;  3EE1 A;  3BB9 A;  1HYF A;  4GSP A;  1M1K 4;  1Q7Y 4;  3IPT A;  3MHE A;  1NNV A;  5FW5 A;  1UCK A;  1DET A;  3HIG A;  5G1K A;  1A2P A;  3WOF B;  2KF5 A;  5EVH A;  4KFE A;  1YNV X;  2XSH B;  1GY7 A;  3G71 3;  4WFO A;  3SVA A;  4HVN A;  4LMI A;  1B20 A;  1IDP A;  5AEU B;  1B2S A;  1JB4 A;  1V74 A;  2GEY A;  4I5Q A;  3V99 A;  2BO9 B;  3HZP A;  5LC6 A;  5AI1 A;  8RNT A;  1KC8 4;  4BL3 A;  2CWT A;  1W6G A;  4STD A;  5M19 A;  1GSP A;  1TRP A;  2ZDJ A;  3Q90 A;  4HOH A;  2HMO B;  4O2H A;  1LNH A;  2YFJ B;  5CK6 A;  3X42 A;  3FKA A;  3RNT A;  1CYU A;  2O3O A;  3KSE D;  3K0Z A;  3KII A;  1BNG A;  2XGN A;  3JVC A;  3CCR 3;  1X1U A;  1LNI A;  3A5E A;  4EBG A;  4J8T A;  4XDW A;  1JKG B;  5CF2 A;  2CFK A;  1SAR A;  3FSD A;  2W6J H;  4KVH A;  1K28 A;  4KT3 B;  1UUW B;  3X41 A;  4GHO A;  1RTU A;  4HAA A;  3SXX A;  4FCZ A;  1AR0 A;  3CC2 3;  3LZA A;  4LGQ A;  2KAA A;  1Q82 4;  2XSO B;  3AMO A;  1S5A A;  4L7K A;  4JF8 A;  1MNL A;  1B21 A;  3NM7 A;  3QK9 A;  1OPY A;  2IUK A;  1JJ2 2;  1JRQ A;  1OF5 B;  3ECF A;  4RNZ A;  3GZX B;  5DRE A;  2P0M A;  2R41 A;  1BRJ A;  2INX A;  3M8C A;  3SX1 A;  2AAE A;  2V1L A;  3CXC 2;  1R4Y A;  4N6L A;  2CFW A;  3SOA A;  1HKX A;  1LRA A;  1RHL A;  3MSO A;  3PCR A;  3STD A;  3NBR A;  3G8Z A;  2BMQ B;  1PYL A;  3JUN A;  1NDO B;  1TUH A;  2I9W A;  1UDI I;  3F7S A;  1QVF 2;  2RSX A;  3FZW A;  3X3Z A;  9RNT A;  1VQQ A;  3T0U A;  3CNM A;  1A67 A;  1JB2 A;  2C10 A;  4FCJ A;  2O9U X;  3JUQ A;  2LYX A;  3D9R A;  3K63 A;  1BNE A;  1IK3 A;  1W4N A;  4KFF A;  1BAN A;  3VGN A;  2UUG C;  5BVB A;  1EQK A;  1B27 A;  1ISK A;  1W2Z A;  2C4B A;  1G0T A;  1DMN A;  1VQ9 3;  1TP6 A;  2AAD A;  7GSP A;  1IQY A;  4BIR A;  2WOF A;  1VQO 3;  3CCS 3;  3FG4 A;  1OGZ A;  5EQL A;  1SPU A;  4H3U A;  4K90 B;  4RNY A;  1VQ5 3;  2L4V A;  2E2T A;  3ZFZ A;  3U1W A;  1RGE A;  2RBI A;  3DXO A;  4R4K A;  3OWY A;  4WP5 A;  1Q7H A;  8CHO A;  1I2F A;  2OQE C;  3ER7 A;  4MEI A;  3S29 A;  4O02 B;  5JBS A;  2YX9 A;  3LTC A;  2HMM B;  1Q40 A;  1BIR A;  5CXO A;  2B1X B;  3G6E 3;  1FA3 A;  1BRS A;  3DUK A;  2GXF A;  3EQQ B;  4LEH A;  1QAK A;  3UL6 A;  3KSP A;  4HBR A;  2XFS A;  4XBY A;  6RNT A;  2C11 A;  4HM4 B;  2K54 A;  2F5M A;  1RN4 A;  3EBY A;  1OCV A;  3MG1 A;  3WR2 A;  1D6Y A;  3UJM A;  4ZM8 A;  1I8V A;  1STF I;  2KCD A;  3VSY A;  1FGT A;  4QWT A;  1JN5 B;  2W04 A;  5JPU A;  4LZI A;  1TFK A;  3MG3 A;  3NXJ A;  5D83 A;  1FUW A;  1JB5 A;  2IUJ A;  2H0H A;  3H51 A;  3B4O A;  1TFO A;  5RNT A;  1IV9 A;  1JBS A;  4KZ1 A;  1BSD A;  2KF4 A;  3CCE 3;  1KD1 4;  4ORL A;  3LTB A;  1FGM A;  3PCS A;  4WWU C;  2XRX B;  5BIR A;  1GOU A;  4EW5 A;  2K0M A;  1Q81 4;  1RCK A;  1R4C A;  3F40 A;  4BTY A;  5A0O B;  1VZZ A;  1ZO2 A;  3HOH A;  3GRD A;  2P09 A;  2XH9 A;  1IQX A;  3EBT A;  2CWU A;  4XDV A;  1OUN A;  1Q42 A;  1US1 A;  2JQ5 A;  3G16 A;  4HM7 B;  3WA2 X;  1VQ7 3;  5FGO A;  1W6Y A;  1T3B A;  2XGL A;  1EEJ A;  1HU9 A;  1I70 A;  5HGR A;  3NBJ A;  2D42 A;  1AV4 A;  2GSP A;  2BIR A;  2R4I A;  4HM6 B;  1JBT A;  2B24 B;  2ML6 A;  2W03 A;  1NJI 4;  1FGO A;  1BUQ A;  1VQP 3;  1O7P B;  4BL2 A;  3NV0 A;  5ELJ A;  4N6T A;  1AVK A;  1M90 4;  3BU4 A;  4XBT A;  2F86 B;  1IT8 A;  3F8X A;  4OUQ A;  3F9S A;  4RNT A;  3BIR A;  1PFP A;  2YFI B;  3WA3 A;  1RNB A;  3IJE B;  2W56 A;  1E3R A;  3DGO A;  4CCV A;  1EA2 A;  1QAF A;  1VQ6 3;  2HML B;  1DE3 A;  1OHS A;  2FGT A;  1RGG A;  1GY6 A;  3HI7 A;  2CC3 A;  3CCM 3;  4O3V A;  1BRN L;  2P0X A;  3DGN A;  3EHC A;  4FMA A;  1V57 A;  1B2Z A;  2F5W A;  3F14 A;  5LC7 A;  5KP4 A;  1RKY A;  4HYZ A;  3AGN A;  1MGR A;  2KRT A;  3EC9 A;  4K1U A;  1AVL A;  4R1K A;  4RBN A;  1BAO A;  2XR8 B;  3K7C A;  4TX4 A;  3JUM A;  2OCT A;  3DGM A;  1TRQ A;  3UNL A;  4N3V A;  1QMA A;  1BNS A;  3D5I A;  3PYJ A;  4G1M B;  1BUJ A;  4FMB A;  2CH9 A;  2YFL B;  1ULI B;  4K1V A;  4R9K A;  3EN8 A;  4JRF A;  1YJ9 3;  1YI2 3;  2IMJ A;  1JV2 B;  1UCL A;  2SBL A;  1IYY A;  4EV5 A;  3RDE A;  1DVC A;  1MGW A;  3OWS A;  1GMQ A;  3NM2 A;  3N9H A;  3NX0 A;  1BRI A;  1WMP A;  5TGN A;  1GMR A;  1LOV A;  5D82 A;  1BGS A;  2CWV A;  1GOY A;  4HM8 B;  4XB5 A;  3NQZ A;  1GYB A;  2ZHX B;  2UX0 A;  3HK4 A;  3PS8 A;  2RFR A;  1YVB I;  3LXU X;  1JNQ A;  5IEP A;  4HM0 B;  4WYK B;  3BNE A;  1JZO A;  4HM1 B;  3ROB A;  4EV2 A;  5IG0 A;  1YGW A;  1W2B 2;  1W7C A;  3WHO A;  1UI8 A;  1ASK A;  1K41 A;  1X1Y A;  3NHX A;  5AYR B;  3Q3F A;  2OTL 3;  4GB5 A;  1RGH A;  1OF5 A;  2XF3 A;  3D5G A;  4FMD A;  3X3Y A;  3CCV 3;  4FMC A;  1VQL 3;  2XEP A;  2Y74 A;  3TDG A;  1GD3 A;  2KF6 A;  3B8L A;  3AMO B;  1OHO A;  1Q86 4;  1BVI A;  1RGC A;  1ULJ B;  3I0Y A;  3GAX A;  1EG9 B;  3GSP A;  3G0K A;  1N5H A;  3N8B A;  3WOD G;  1I3I A;  2OOV A;  3SOY A;  3QRD A;  2FNQ A;  2XFT A;  3J7Y d;  1IVU A;  1A90 A;  2Y73 A;  3Q1C A;  2HMK B;  3URP A;  1MWT A;  5M18 A;  1WNH A;  3DH2 A;  2QA4 3;  2W2C A;  1VQ4 3;  2RNT A;  1M9G A;  2BHM A;  2RGQ A;  1LXE A;  2W9Q A;  4EC6 A;  4AKZ A;  3Q2P A;  5BU4 A;  1NWW A;  3MWZ A;  4HZ9 B;  1AQZ A;  3CC7 3;  2IYJ A;  1MWR A;  3X40 A;  3CCQ 3;  3D3L A;  1RLS A;  2F98 A;  3D4A A;  2HMN B;  2CFG A;  1X1X A;  5M1A A;  3S28 A;  2W56 B;  3CMA 3;  1VQK 3;  2CIU A;  3DM8 A;  1D6U A;  1E97 A;  1N5P A;  1TJD A;  1TIJ A;  1W02 A;  4N6M A;  3T8U A;  3DGL A;  2ZL8 A;  2CG0 A;  3G4S 3;  1WQL B;  2WOH A;  5EEO A;  1ZS7 A;  1CQS A;  1OAC A;  1ROA A;  1HZ1 A;  5D81 A;  2STD A;  3FLJ A;  3ZG5 A;  1E3V A;  1F8N A;  1CYV A;  1LQM B;  1M1X B;  2Z7A A;  1RSN A;  2PNC A;  1DVD A;  3OW2 2;  3UB1 A;  1QVG 2;  1O7H B;  3LT8 A;  1SQW A;  5IW9 A;  3D79 A;  1LQG C;  5AIH A;  3SLU A;  1FUT A;  4LSO A;  1Z1S A;  1RRL A;  5G2G A;  6STD A;  1RGA A;  3DGY A;  3BNC A;  1WMO A;  1Q40 B;  1W6C A;  1U5O A;  2BT3 A;  2QGU A;  3AGO A;  3FF2 A;  3B4P A;  4HM3 B;  4OK0 A;  4R80 A;  4H61 A;  1YGE A;  1MWS A;  4X2H A;  1W5Z A;  3SYU A;  2IA7 A;  3KN4 A;  1UCI A;  1V58 A;  1UCJ A; 
#chains in the Genus database with same CATH homology
 2QIY A;  3BLZ A;  1MOL A;  3DMC A;  1A2K A;  1JKG A;  1K73 4;  1L5G B;  2OOV C;  1OHP A;  3V98 A;  4HM5 B;  1LOX A;  5IEN A;  4N6O B;  5IER A;  1O7M B;  3MPH A;  1FGR A;  1GS3 A;  1VQN 3;  3EN1 B;  1KSI A;  3LML A;  3LTD A;  5I97 A;  3FG3 A;  5AIG A;  3EX9 A;  4MJD A;  3CCL 3;  1LVN A;  3A76 A;  3ALA A;  3MKI A;  4HZB B;  4I4K A;  3S67 A;  1IT7 A;  2JDI H;  2OTJ 3;  3CNX A;  4BTX A;  2P38 A;  3KFQ C;  1UUV B;  3GZB A;  3IMA B;  5AIF A;  3HII A;  4BTW A;  3NQY A;  3E99 A;  1KWI A;  3S27 A;  1IVW A;  4PEJ A;  4MMZ B;  1EKM A;  1SII A;  4KFD A;  3VF1 A;  1C7H A;  1K8A 4;  3KKG A;  3PXM A;  2ML5 A;  2GU3 A;  3HX8 A;  4XM4 A;  1UI7 A;  3FG1 A;  1VQM 3;  3FGY A;  2PZV A;  3EJV A;  4XBX A;  1YIJ 3;  1S72 3;  2CHC A;  2E2U A;  3GZR A;  5STD A;  5IG4 A;  1YHQ 3;  1N8R 4;  2KXG A;  3GWR A;  1SJW A;  3WMD A;  1WMN A;  2CFD A;  1J2B A;  4K61 A;  3FH1 A;  3NBB A;  5AYS C;  1YIT 3;  1Y4K A;  1D6Z A;  1O7N B;  3BND A;  3PGB A;  2Z6B A;  1OGX A;  7STD A;  2HMJ B;  2Q07 A;  5IG3 A;  1W00 A;  3DZL A;  1OH0 A;  2A15 A;  1NO3 A;  3CCU 3;  4IIA A;  2CKF B;  2F99 A;  2LQV A;  3JUO A;  3CPW 2;  2MC8 A;  4NRE A;  1O7G B;  1SIH A;  1STD A;  2GBW B;  1JN5 A;  3EF8 A;  2GU1 A;  2W0Q A;  3GZY B;  3CCJ 3;  3CD6 3;  1TU5 A;  5IG5 A;  4J9A A;  4CDL A;  1PU4 A;  3JUP A;  1A2V A;  3OV4 A;  3X3X A;  2D1W A;  1N8Q A;  1RRH A;  4R9L A;  4AKY A;  3BNB A;  3N54 B;  4WYK A;  1DMM A;  4Q53 A;  2QEX 3;  3I56 3;  4HM2 B;  3OX9 A;  3RGA A;  2OQE A;  3CPO A;  3K5T A;  3CC4 3;  1CEW I;  1ROV A;  5ELU A;  3WDG B;  2BMR B;  5IF6 A;  4EXR A;  3S5C A;  1YJW 3;  3KZT A;  5KP1 A;  1K9M 4;  1U8C B;  1NB5 I;  3CME 3;  5AII A;  3RGR A;  1NU3 A;  4FR9 A;  5AEW B;  3WOE B;  1T5Y A;  1N9E A;  1QJG A;  2CK3 H;  3CU3 A;  3O8Y A;  2WO0 A;  2CFL A;  1GD4 A;  3U97 A;  1IQ8 A;  1DYU A;  3OWU A;  3MYT A;  1IV7 A;  3NV0 B;  3UL5 A;  4O8S A;  2P05 A;  3OXA A;  1IVV A;  3LT9 A;  3SED A;  3EB8 A;  1RN7 A;  2GBX B;  1W01 A;  4N6U A;  5CLK A;  1VQ8 3;  4FCM A;  1NB3 I;  4U13 A;  3T8N A;  2CG1 A;  4OVM A;  1WTH A;  4EYC A;  2CW9 A;  1DMQ A;  4IT7 A;  2OWP A;  2WGO A;  1IVX A;  2M7O A;  4HJL B;  2W9P A;  3V92 A;  1G96 A;  4MMY B;  3FF0 A;  1IU7 A;  3NUV A;  4N6V 0;  2RCD A;  4X2O A;  3KE7 A;  3FCS B;  4RZM A;  3I55 3;  2WGQ A;  5IEO A;  5JPP A;  3LYG A;  3K9M C;  4L8O A;  5CF1 A;  3H3H A;  3LOY A;  2FXT A;  2Z77 A;  4IPB A;  4L8P A;  5DRV A;  2MF7 A;  4NHF A;  1O7W B;  2GEX A;  3MG2 A;  2BMO B;  3L0R A;  1RJO A;  4WHA A;  2Z76 A;  1GY5 A;  3B7C A;  1QAL A;  5KP3 A;  3PZW A;  4HKV B;  1KQS 2;  4MMX B;  4AEQ A;  5BXQ A;  2E2V A;  1UW1 A;  4GL6 A;  4N6N B;  3LTA A;  1YJN 3;  3DY5 A;  1N9J A;  3F7X A;  2BNG A;  1FGQ A;  1ZX2 A;  3F8H A;  3LH4 A;  3EE1 A;  3BB9 A;  1M1K 4;  1Q7Y 4;  3IPT A;  3MHE A;  5FW5 A;  3HIG A;  3WOF B;  5EVH A;  4KFE A;  2XSH B;  1GY7 A;  3G71 3;  4WFO A;  3SVA A;  4HVN A;  4LMI A;  1IDP A;  5AEU B;  1V74 A;  1JB4 A;  3V99 A;  2GEY A;  2BO9 B;  3HZP A;  5LC6 A;  5AI1 A;  1KC8 4;  2CWT A;  1W6G A;  4STD A;  3Q90 A;  2ZDJ A;  2HMO B;  4O2H A;  1LNH A;  2YFJ B;  5CK6 A;  3X42 A;  3FKA A;  1CYU A;  2O3O A;  3KSE D;  3K0Z A;  3KII A;  2XGN A;  3JVC A;  3CCR 3;  4EBG A;  4J8T A;  4XDW A;  1JKG B;  5CF2 A;  2CFK A;  3FSD A;  2W6J H;  4KVH A;  1K28 A;  1UUW B;  3X41 A;  3SXX A;  4FCZ A;  1AR0 A;  3CC2 3;  3LZA A;  4LGQ A;  1Q82 4;  2XSO B;  3AMO A;  1S5A A;  4L7K A;  4JF8 A;  1MNL A;  3QK9 A;  3NM7 A;  1OPY A;  2IUK A;  1JJ2 2;  1JRQ A;  1OF5 B;  3ECF A;  4RNZ A;  3GZX B;  5DRE A;  2P0M A;  2INX A;  3M8C A;  3SX1 A;  2V1L A;  3CXC 2;  4N6L A;  2CFW A;  3SOA A;  1HKX A;  3MSO A;  3PCR A;  3STD A;  3NBR A;  3G8Z A;  2BMQ B;  3JUN A;  1NDO B;  1TUH A;  2I9W A;  3F7S A;  1QVF 2;  2RSX A;  3FZW A;  3X3Z A;  3T0U A;  3CNM A;  1A67 A;  1JB2 A;  2C10 A;  4FCJ A;  2O9U X;  3JUQ A;  2LYX A;  3D9R A;  3K63 A;  1IK3 A;  1W4N A;  4KFF A;  3VGN A;  5BVB A;  1EQK A;  1ISK A;  1W2Z A;  1DMN A;  1VQ9 3;  1TP6 A;  1IQY A;  2WOF A;  1VQO 3;  3CCS 3;  3FG4 A;  1OGZ A;  5EQL A;  1SPU A;  4H3U A;  4K90 B;  4RNY A;  1VQ5 3;  2L4V A;  2E2T A;  3U1W A;  3DXO A;  4R4K A;  3OWY A;  4WP5 A;  8CHO A;  2OQE C;  3ER7 A;  4MEI A;  3S29 A;  4O02 B;  5JBS A;  2YX9 A;  3LTC A;  2HMM B;  1Q40 A;  5CXO A;  2B1X B;  3G6E 3;  1FA3 A;  3DUK A;  2GXF A;  3EQQ B;  4LEH A;  1QAK A;  3UL6 A;  3KSP A;  4HBR A;  2XFS A;  4XBY A;  2C11 A;  4HM4 B;  2K54 A;  3EBY A;  1OCV A;  3MG1 A;  1D6Y A;  3UJM A;  4ZM8 A;  1STF I;  2KCD A;  3VSY A;  1FGT A;  4QWT A;  1JN5 B;  2W04 A;  5JPU A;  4LZI A;  1TFK A;  3MG3 A;  3NXJ A;  5D83 A;  1FUW A;  1JB5 A;  2IUJ A;  3H51 A;  3B4O A;  1TFO A;  1IV9 A;  4KZ1 A;  3CCE 3;  1KD1 4;  4ORL A;  3LTB A;  1FGM A;  3PCS A;  4WWU C;  2XRX B;  2K0M A;  1Q81 4;  1R4C A;  3F40 A;  4BTY A;  5A0O B;  1VZZ A;  1ZO2 A;  3GRD A;  2P09 A;  2XH9 A;  1IQX A;  3EBT A;  2CWU A;  4XDV A;  1OUN A;  1Q42 A;  1US1 A;  2JQ5 A;  3G16 A;  4HM7 B;  3WA2 X;  1VQ7 3;  5FGO A;  1W6Y A;  2XGL A;  1HU9 A;  5HGR A;  3NBJ A;  1AV4 A;  2D42 A;  2R4I A;  4HM6 B;  2B24 B;  2ML6 A;  2W03 A;  1NJI 4;  1FGO A;  1BUQ A;  1VQP 3;  1O7P B;  3NV0 A;  5ELJ A;  4N6T A;  1AVK A;  1M90 4;  4XBT A;  2F86 B;  1IT8 A;  3F8X A;  4OUQ A;  3F9S A;  1PFP A;  2YFI B;  3WA3 A;  3IJE B;  2W56 A;  1E3R A;  3DGO A;  4CCV A;  1EA2 A;  1QAF A;  1VQ6 3;  2HML B;  1OHS A;  2FGT A;  1GY6 A;  3HI7 A;  2CC3 A;  3CCM 3;  4O3V A;  2P0X A;  3EHC A;  3DGN A;  4FMA A;  5LC7 A;  5KP4 A;  1RKY A;  3F14 A;  4HYZ A;  2KRT A;  3EC9 A;  4K1U A;  1AVL A;  4R1K A;  4RBN A;  2XR8 B;  3K7C A;  4TX4 A;  3JUM A;  2OCT A;  3DGM A;  3UNL A;  4N3V A;  1QMA A;  3PYJ A;  4G1M B;  4FMB A;  2CH9 A;  2YFL B;  1ULI B;  4K1V A;  4R9K A;  3EN8 A;  4JRF A;  1YJ9 3;  1YI2 3;  2IMJ A;  1JV2 B;  2SBL A;  4EV5 A;  3RDE A;  1DVC A;  3OWS A;  3NM2 A;  3N9H A;  3NX0 A;  1WMP A;  5TGN A;  5D82 A;  2CWV A;  4HM8 B;  4XB5 A;  3NQZ A;  1GYB A;  3HK4 A;  2UX0 A;  3PS8 A;  2RFR A;  1YVB I;  3LXU X;  1JNQ A;  5IEP A;  4HM0 B;  4WYK B;  3BNE A;  4HM1 B;  3ROB A;  4EV2 A;  5IG0 A;  1W2B 2;  1W7C A;  1UI8 A;  1ASK A;  1K41 A;  3NHX A;  5AYR B;  2OTL 3;  4GB5 A;  1OF5 A;  2XF3 A;  4FMD A;  3X3Y A;  3CCV 3;  4FMC A;  1VQL 3;  2XEP A;  2Y74 A;  3TDG A;  1GD3 A;  3B8L A;  1Q86 4;  3AMO B;  1OHO A;  1ULJ B;  3I0Y A;  3GAX A;  1EG9 B;  3G0K A;  1N5H A;  3N8B A;  3WOD G;  2OOV A;  3SOY A;  3QRD A;  2FNQ A;  2XFT A;  3J7Y d;  1IVU A;  1A90 A;  2Y73 A;  3Q1C A;  2HMK B;  1WNH A;  2QA4 3;  1VQ4 3;  2W2C A;  1M9G A;  2BHM A;  2RGQ A;  1LXE A;  2W9Q A;  4EC6 A;  4AKZ A;  3Q2P A;  1NWW A;  3MWZ A;  4HZ9 B;  3CC7 3;  3X40 A;  3CCQ 3;  3D3L A;  2F98 A;  2HMN B;  2CFG A;  3S28 A;  2W56 B;  3CMA 3;  1VQK 3;  2CIU A;  3DM8 A;  1D6U A;  1E97 A;  1N5P A;  4N6M A;  1TIJ A;  1W02 A;  3T8U A;  3DGL A;  2ZL8 A;  2CG0 A;  3G4S 3;  1WQL B;  2WOH A;  5EEO A;  1CQS A;  1OAC A;  1ROA A;  5D81 A;  2STD A;  3FLJ A;  1E3V A;  1F8N A;  1CYV A;  1M1X B;  2Z7A A;  2PNC A;  1DVD A;  3OW2 2;  3UB1 A;  1QVG 2;  1O7H B;  3LT8 A;  1SQW A;  5IW9 A;  5AIH A;  3SLU A;  4LSO A;  1Z1S A;  1RRL A;  5G2G A;  6STD A;  3BNC A;  1WMO A;  1Q40 B;  1W6C A;  1U5O A;  2QGU A;  2BT3 A;  3FF2 A;  4HM3 B;  3B4P A;  4OK0 A;  4R80 A;  4H61 A;  1YGE A;  4X2H A;  1W5Z A;  2IA7 A;  3KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...