3UL6A

Saccharum officinarum canecystatin-1 in space group p6422
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
b'DLEAIELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKVWENFKQLQSFQPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Canecystatin-1
publication title X-ray crystallography and NMR studies of domain-swapped canecystatin-1.
pubmed doi rcsb
source organism Saccharum officinarum
molecule tags Hydrolase inhibitor
total genus 13
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16845 SQAPI Aspartic acid proteinase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ul6A00
4N6MA 3L0RA 2BO9B 4N6UA 1N9JA 3MWZA 4IT7A 3QRDA 3K9MC 1CEWI 1R4CA 3GAXA 4N6NB 1FUWA 1STFI 3LH4A 1G96A 4N6TA 1A67A 1FA3A 2OCTA 3KFQC 1MOLA 2KXGA 3S67A 5LC7A 4EYCA 5A0OB 4N6V0 1IV9A 1DVDA 5ELUA 4CCVA 3PYJA 3IMAB 5LC6A 1NB5I 1N5PA 1GD4A 3KSED 1ROAA 1TIJA 1YVBI 1M9GA 3UL6A 1MNLA 1GD3A 4TX4A 1RN7A 4ZM8A 3PS8A 1IV7A 1LXEA 1CYUA 2O9UX 1CYVA 3PXMA 3NX0A 3UL5A 1EQKA 4N6OB 1WNHA 2W9QA 1N5HA 5ELJA 1KWIA 2CH9A 3SVAA 1PFPA 4N6LA 5EQLA 1NB3I 1DVCA 3Q2PA 1A90A 4LZIA 2W9PA
chains in the Genus database with same CATH superfamily
1RCKA 2C4BA 3X3ZA 3CCL3 1CH0A 5IF6A 1PYLA 5BVBA 1B2XA 1B27A 2QIYA 3KZTA 1VQO3 4X2OA 1VQL3 1BSCA 1AY7A 1GOYA 1OACA 3OWSA 1E97A 1GMQA 3NM2A 4MEIA 2K0MA 2BMQB 7STDA 1X1YA 3X40A 1RNTA 1RGLA 1YIT3 3PCSA 1GY5A 1WMPA 3F14A 4FMAA 1NO3A 4R80A 2ZDJA 4J5KA 3HZPA 5CK6A 4PEJA 1K8A4 5G1KA 1BU4A 1B2ZA 2BT3A 2STDA 3DH2A 4OK0A 1VQQA 4H61A 4HM8B 3BNCA 5AYSC 1W02A 1YNVX 4JF8A 3LTAA 5D83A 1DETA 4WP5A 3FH1A 1SIHA 1X1WA 2SBLA 5M1AA 2E2TA 1RTUA 4OUQA 1R4CA 1BRHA 3ZFZA 1S723 5JBSA 1OHOA 3DGNA 1NNVA 1BRNL 1UGHI 3IJEB 3DM8A 3LH4A 2D1WA 3WOEB 3ER7A 1V74A 4K1VA 1WMNA 2KAAA 4KFDA 1A67A 1AR0A 1GOUA 3VGNA 3S5CA 2QA43 3G0KA 2ML5A 4RBNA 1EUIC 2Y74A 3D9RA 1MOLA 2AADA 2HMKB 1MWRA 2SARA 2W2CA 3NXJA 1RDSA 2UGIA 2H0IA 2OWPA 2QEX3 2W56A 2KRTA 1RGCA 1YJ93 3KE7A 1B2UA 3NBJA 3G4S3 1GY6A 1LQMB 2CFWA 1Z1SA 2ZA4A 4KFEA 1VQ83 1BGSA 2GSPA 1J2BA 3SYUA 1OHSA 1Q42A 1NB5I 1W6YA 1QJGA 3GSPA 3NBBA 3MKIA 1O7WB 4JRFA 4MJDA 3NHXA 5TGNA 3FZWA 4K61A 2OQEC 5EVHA 3RGAA 1IDPA 1TU5A 1OGZA 1QAKA 1GS3A 2B24B 1ROAA 4BTXA 4LGQA 2F5WA 2CX0A 1N9EA 1B3SA 4O2HA 1B21A 1MNLA 1LOVA 3HX8A 1GD3A 1UUVB 2RGQA 5GSPA 1BUJA 1DE3A 1VQK3 4FMBA 1BNSA 3DUKA 4L8PA 5IEOA 1FGTA 3AHWA 3O8YA 1UGIA 2K3DA 2XSOB 1YGEA 1YVSA 2CWTA 1LNHA 2Q07A 3LZAA 3FG3A 3NM7A 3G713 3N9HA 4ORLA 1CYVA 3NBRA 3KSPA 1KSIA 4N3VA 4OVMA 4XBTA 2XRXB 1V57A 3SLUA 1I0XA 5AEWB 4CDLA 1JJ22 2UUGC 5FW5A 1IVUA 1BNIA 1WNHA 1Y4KA 2W9QA 4J8TA 2UX0A 2Z77A 4HKVB 1FGQA 3UNLA 1ZGXA 3CPOA 4K90B 5IG0A 5JPUA 3CCM3 1I2GA 1YJN3 2CWUA 4BTWA 1YHQ3 3NUVA 4KVHA 1W4NA 1I2FA 2ML6A 2YFLB 3B8LA 2B1XB 3RGRA 3B4PA 4RZMA 2CFGA 1NB3I 3WA2X 1ISKA 2CWVA 2CW9A 1BRSA 3M8CA 1A90A 4U13A 3CNMA 1TJDA 1FGRA 4HM0B 4X2HA 2LYXA 3DGLA 4FMDA 1RGHA 4KT3B 4RNYA 4XBYA 3X42A 5IW9A 1AQZA 5AIFA 2RNTA 1VQ63 2CHCA 1GYBA 3H51A 3MG2A 3PZWA 1X1XA 3K5TA 2CFDA 3RDEA 2BO9B 4N6UA 1ASKA 1IVVA 1BOXA 1HKXA 1FZUA 4EV2A 1Q9EA 3RNTA 1VQ43 3V99A 4XM4A 3MPHA 3MWZA 3CCE3 2PNCA 2YX9A 5KP1A 1RRHA 1RMSA 3B4OA 1QAFA 4IT7A 1K41A 2A15A 1FUTA 1RGGA 2XGLA 3UJMA 1OF5B 1CEWI 3D5GA 3D79A 3EB8A 4R1KA 1UCKA 1W2B2 3GAXA 5AIGA 1X1UA 3Q1CA 1FUWA 1M1XB 3MSOA 4KZ1A 3F7SA 1OGXA 2ZHXB 5I97A 1STFI 1TFOA 2XFSA 1VQN3 3F8HA 3CCU3 2RCDA 1DMNA 2W56B 1FA3A 1GSPA 1IU7A 1MWUA 3JUMA 4MMZB 4XBXA 2GXFA 3KFQC 2XF3A 3AHSA 2BMRB 4WFOA 2KXGA 1MWTA 2KCDA 2JDIH 4EC6A 3IPTA 4QWTA 4N6V0 3DZLA 2Z6BA 2H0GA 4J9AA 1K9M4 1RCLA 1UDII 1TUHA 1UW1A 4AKZA 4MMXB 3JUOA 1OPYA 3BLZA 1FGOA 1JB4A 3GZXB 3CPW2 1FUSA 1JNQA 4FR9A 1I2EA 3KSED 1BANA 2XGNA 1OF5A 3T0UA 1JBTA 5AI1A 2AAEA 1TIJA 3FGYA 1DYUA 5AYRB 4LEHA 1IQYA 3S29A 4NREA 1WQLB 5HGRA 1TP6A 2GU3A 1Q7HA 3D3LA 3WMDA 2CG0A 1RN7A 1CQSA 3GZYB 4XB5A 2GBWB 3HOHA 3LTBA 4I5QA 1LXEA 2CG1A 1SARA 2IA7A 1G0TA 1VQ93 2INXA 1JN5B 2GBXB 4BL2A 3NX0A 3MG3A 4L7KA 3SOAA 1OCVA 1F8NA 2L4VA 1N8QA 2P09A 2W04A 2MF7A 4EW5A 2RBIA 1EQKA 1Q824 5DRVA 3CMA3 1O7PB 1W2ZA 4L8OA 1BNGA 2FXTA 1SQWA 3WR2A 3SVAA 6RNTA 4RNZA 3LTDA 4N6LA 3OX9A 1RGEA 2P0XA 2W03A 5D82A 5EQLA 5RNTA 3QK9A 3BIRA 3OWYA 2OOVC 1TTOA 3FG1A 1EEJA 5CLKA 5G2GA 1IVXA 3CU3A 2R41A 2QGUA 2KF3A 3F7XA 1OH0A 1ULJB 4HM5B 3N54B 1NWWA 2WOFA 2J8XB 4LYLB 4LZIA 5IG4A 1IT8A 2WGQA 3DGOA 3U1WA 4N6MA 5AIIA 1LOYA 3CME3 3S28A 1JRQA 3EBTA 1RLSA 1RGFA 2ZL8A 1SJWA 3K0ZA 3STDA 4BIRA 1M1K4 1NU3A 1O7MB 4DKIA 3S27A 3CC43 1BNFA 1W5ZA 9RNTA 1M904 1JN5A 1RGAA 3FSDA 1G02A 3EF8A 4HM3B 3X3YA 2P0MA 1WTHA 3G16A 5M18A 3G6E3 2F5MA 5CXOA 3K7CA 2HMOB 5IG3A 1AV4A 4FCJA 1IT7A 3HI7A 2LQVA 1GY7A 4XDWA 1JZOA 1VQM3 2HMMB 1T2IA 5KP3A 1FGMA 5M19A 3QRDA 4KFFA 3K9MC 1BRGA 1I8VA 1UUWB 8CHOA 1QMAA 1K734 3A76A 3LT8A 1KD14 1Q40B 3CD63 4N6NB 2FNQA 4I4KA 3ROBA 1IQXA 4H3UA 1RKYA 1G96A 3LYGA 3VSYA 1RJOA 7RNTA 1ZS7A 4HYZA 1SIIA 3PCRA 4EXRA 2I9WA 1LQGC 2OCTA 3HIGA 5FGOA 2O3OA 1ROVA 1FW7A 2GEYA 4R4KA 1YJW3 2XFTA 1BIRA 2P05A 5A0OB 1VQ53 1Q864 1GOVA 1BSBA 3EC9A 3VF1A 3FCSB 1AVLA 3K63A 5ELUA 4R9LA 2HMNB 1R4YA 3IMAB 3BNBA 1EKMA 5LC6A 3SOYA 3DXOA 4WHAA 3SEDA 1DMMA 1OHPA 2FGTA 1N5PA 3MHEA 3DGYA 3CCS3 2Z7AA 4FCZA 3CXC2 3JVCA 1JKGB 2GEXA 1SPUA 5AEUB 1O7HB 3OWUA 1VQP3 3LT9A 7GSPA 1VQ73 4O3VA 1M9GA 2W6JH 1Q40A 2GU1A 5STDA 4LMIA 2OQEA 3UL6A 1RN4A 3ALAA 3BU4A 3NQZA 4TX4A 1HU9A 1O7GB 3D5IA 1A2VA 5HOHA 1BUQA 1EG9B 4HM7B 1BRJA 2F98A 2L1SA 3CCJ3 3D4AA 3BNDA 1YGWA 3LMLA 2K54A 3PS8A 1IV7A 4HZ9B 4BTYA 1A2PA 1E3RA 2OOVA 2V1LA 3E99A 3HIIA 3I0YA 1WMOA 3UB1A 5IEPA 3PXMA 1LOWA 4J5GA 4K1UA 3ZG0A 1I70A 3UL5A 1JV2B 1E3VA 3B7CA 4HJLB 3FG4A 4CJNA 3WOFB 2KF6A 2OTJ3 1PY3A 5ELJA 3OXAA 3V92A 4GSPA 3AMOB 1UCLA 1Q7Y4 3HK4A 1BNRA 4IIAA 3G8ZA 1N8R4 4HM1B 4XDVA 1BSEA 6STDA 3CCQ3 1NJI4 2MC8A 5BU4A 1JKGA 1B20A 3JUNA 3EN8A 4G1MB 1DVCA 1FYSA 4FCMA 1UI7A 3J7Yd 2C11A 4EBGA 1GMPA 1W6GA 1B2SA 1YI23 1BRIA 3OW22 3JUPA 1QALA 4HM4B 3NV0B 3BB9A 1VZZA 2C10A 8RNTA 2M7OA 2R4IA 1W01A 3AGOA 1UCJA 1W7CA 2WGOA 3DGMA 1T3BA 3DMCA 3X3XA 4GHOA 4WWUC 1US1A 4HAAA 3T8UA 3U97A 1TFKA 6GSPA 5JPPA 5AIHA 1KQS2 1MGWA 3L0RA 2WO0A 4LSOA 3Q3FA 1OUNA 4HVNA 1C54A 3AGNA 1STDA 3FF2A 5CF1A 1BSDA 2OTL3 2IUJA 1JBRA 1LOXA 2YFIB 3FKAA 1D6ZA 1NDOB 2Z76A 3JUQA 4STDA 3BNEA 4AEQA 3GZRA 1HZ1A 3X41A 3PGBA 1C7HA 1N9JA 2XR8B 3AMOA 2KF4A 2XH9A 2XEPA 3EE1A 1MWSA 4CPKA 3LXUX 1UI8A 1LRAA 2IYJA 1QVG2 1ULIB 2CX1A 1BNEA 1W00A 3DY5A 2WOHA 2IY2A 3GRDA 3GZBA 4O8SA 4HM2B 1IK3A 2CFLA 3GWRA 2BU4A 2HOHA 4O02B 1D6YA 1BRKA 1I3IA 2RFRA 1K28A 3KN4A 3NQYA 4N6TA 4Q53A 1KC84 3EBYA 3EN1B 2PZVA 3SX1A 4R9KA 3A5EA 3NV0A 2E2UA 4HBRA 4BU4A 1TRPA 1RNBA 3KIIA 2F4YA 3H3HA 1D6UA 2CC3A 1RSNA 1ZO2A 2D42A 3MYTA 3S67A 3WHOA 4EV5A 1LVNA 1MGRA 4WYKB 5LC7A 4EYCA 4GL6A 4HZBB 1IV9A 2CFKA 4RNTA 1UCIA 3EQQB 1DVDA 1LNIA 1GMRA 4NPBA 5CF2A 1U5OA 3TDGA 1HYFA 3PYJA 3URPA 4CCVA 3Q90A 1RGKA 2KF5A 1T5YA 3WA3A 1B2MA 3FLJA 1L5GB 1W6CA 2XSHB 1YIJ3 1GD4A 2P38A 1IQ8A 1S5AA 2HMJB 2HMLB 2YFJB 5G1LA 3EJVA 2E2VA 1BSAA 2JQ5A 1Q814 1YVBI 3CC73 1ZX2A 1I3FA 3EHCA 2IMJA 2BIRA 5IG5A 1PU4A 2BMOB 1BAOA 3MG1A 1JB5A 3CC23 5BIRA 1IYYA 3F9SA 2CIUA 4HOHA 3N8BA 4FMCA 3KKGA 4ZM8A 2F99A 3I553 2CK3H 1QVF2 1JZDA 2RSXA 4GB5A 1CYUA 2O9UX 1T2HA 4IPBA 4WYKA 3I563 2CKFB 4AKYA 1RHLA 1EA2A 3WDGB 1BVIA 2BNGA 3ECFA 4HM6B 4MMYB 1A2KA 4NHFA 1JBSA 1I0VA 3KCHA 1V58A 3EX9A 1UUGB 5D81A 2F56A 4N6OB 5DREA 3CCR3 1RN1A 1N5HA 3CNXA 3F40A 1KWIA 5EEOA 2BHMA 3ZG5A 1BNJA 2CH9A 2F86B 2Y73A 5IENA 1O7NB 3T8NA 2W0QA 1PFPA 5IERA 3OV4A 4BL3A 1U8CB 3SXXA 5KP4A 2IUKA 1IVWA 1DMQA 3WODG 3CCV3 2H0HA 3F8XA 3LOYA 3V98A 1AVKA 3Q2PA 3LTCA 4ILFA 1RRLA 3FF0A 1JB2A 5BXQA 2W9PA 1TRQA
chains in the Genus database with same CATH topology
3X3ZA 3CCL3 5IF6A 5BVBA 3KZTA 2QIYA 1VQO3 4X2OA 1VQL3 1OACA 3OWSA 1E97A 4MEIA 3NM2A 2K0MA 2BMQB 7STDA 3X40A 1YIT3 3PCSA 1GY5A 1WMPA 3F14A 4FMAA 1NO3A 4R80A 2ZDJA 3HZPA 5CK6A 4PEJA 1K8A4 2BT3A 2STDA 4OK0A 4H61A 4HM8B 3BNCA 5AYSC 1W02A 4JF8A 3LTAA 5D83A 4WP5A 3FH1A 1SIHA 2SBLA 2E2TA 4OUQA 1R4CA 1S723 5JBSA 1OHOA 3DGNA 3IJEB 3DM8A 3LH4A 2D1WA 3WOEB 3ER7A 1V74A 4K1VA 1WMNA 4KFDA 1A67A 1AR0A 3VGNA 3S5CA 2QA43 3G0KA 2ML5A 4RBNA 2Y74A 3D9RA 1MOLA 2HMKB 3NXJA 2W2CA 2OWPA 2QEX3 2W56A 2KRTA 1YJ93 3KE7A 3NBJA 3G4S3 1GY6A 2CFWA 1Z1SA 4KFEA 1VQ83 1J2BA 1OHSA 1Q42A 1NB5I 1W6YA 1QJGA 3NBBA 4JRFA 3MKIA 1O7WB 4MJDA 5TGNA 3NHXA 3RGAA 3FZWA 4K61A 2OQEC 5EVHA 1IDPA 1TU5A 1OGZA 1QAKA 1GS3A 2B24B 1ROAA 4BTXA 4LGQA 1N9EA 4O2HA 1MNLA 3HX8A 1GD3A 1UUVB 2RGQA 1VQK3 4FMBA 3DUKA 4L8PA 5IEOA 1FGTA 3O8YA 2XSOB 1YGEA 2CWTA 1LNHA 2Q07A 3LZAA 3FG3A 3NM7A 3G713 3N9HA 4ORLA 1CYVA 3NBRA 3KSPA 1KSIA 4N3VA 4OVMA 4XBTA 2XRXB 3SLUA 5AEWB 4CDLA 1JJ22 5FW5A 1IVUA 1WNHA 1Y4KA 2W9QA 4J8TA 2UX0A 2Z77A 4HKVB 1FGQA 3UNLA 3CPOA 4K90B 5IG0A 5JPUA 3CCM3 1YJN3 2CWUA 4BTWA 1YHQ3 3NUVA 4KVHA 1W4NA 2YFLB 2ML6A 3B8LA 3RGRA 2B1XB 3B4PA 4RZMA 2CFGA 1NB3I 3WA2X 1ISKA 2CWVA 2CW9A 3M8CA 1A90A 4U13A 3CNMA 1FGRA 4HM0B 4X2HA 2LYXA 3DGLA 4FMDA 4RNYA 4XBYA 3X42A 5IW9A 5AIFA 1VQ63 2CHCA 1GYBA 3H51A 3MG2A 3PZWA 3K5TA 2CFDA 3RDEA 2BO9B 4N6UA 1ASKA 1IVVA 1HKXA 1VQ43 3V99A 4XM4A 3MPHA 3MWZA 3CCE3 2PNCA 2YX9A 5KP1A 1RRHA 3B4OA 1QAFA 4IT7A 1K41A 2A15A 3UJMA 2XGLA 1OF5B 1CEWI 3EB8A 4R1KA 1W2B2 3GAXA 5AIGA 3Q1CA 1FUWA 1M1XB 3MSOA 4KZ1A 3F7SA 1OGXA 5I97A 1STFI 1TFOA 2XFSA 1VQN3 3F8HA 3CCU3 2RCDA 1DMNA 2W56B 1FA3A 1IU7A 3JUMA 4MMZB 4XBXA 2GXFA 3KFQC 2XF3A 2BMRB 4WFOA 2KXGA 2KCDA 2JDIH 4EC6A 3IPTA 4QWTA 4N6V0 3DZLA 2Z6BA 4J9AA 1K9M4 1UW1A 1TUHA 4AKZA 4MMXB 3JUOA 1OPYA 3BLZA 1FGOA 1JB4A 3GZXB 3CPW2 1JNQA 4FR9A 3KSED 2XGNA 1OF5A 3T0UA 5AI1A 1TIJA 3FGYA 1DYUA 5AYRB 4LEHA 1IQYA 3S29A 4NREA 1WQLB 5HGRA 1TP6A 2GU3A 3WMDA 3D3LA 2CG0A 1RN7A 1CQSA 3GZYB 4XB5A 2GBWB 3LTBA 1LXEA 2CG1A 2IA7A 1VQ93 2INXA 1JN5B 2GBXB 3NX0A 3MG3A 4L7KA 3SOAA 1OCVA 1F8NA 2L4VA 1N8QA 2P09A 2W04A 2MF7A 1EQKA 1Q824 5DRVA 3CMA3 1O7PB 1W2ZA 4L8OA 2FXTA 1SQWA 3SVAA 4RNZA 3LTDA 4N6LA 3OX9A 2W03A 2P0XA 5D82A 5EQLA 3QK9A 3OWYA 2OOVC 3FG1A 5CLKA 5G2GA 1IVXA 3CU3A 2QGUA 3F7XA 1OH0A 1ULJB 4HM5B 3N54B 1NWWA 2WOFA 4LZIA 5IG4A 1IT8A 2WGQA 3DGOA 3U1WA 4N6MA 5AIIA 3CME3 3S28A 1JRQA 3EBTA 2ZL8A 1SJWA 3K0ZA 3STDA 1M1K4 1NU3A 1O7MB 3S27A 1W5ZA 1M904 1JN5A 3FSDA 3EF8A 4HM3B 3X3YA 2P0MA 1WTHA 3G16A 3G6E3 5CXOA 3K7CA 2HMOB 5IG3A 1AV4A 4FCJA 1IT7A 3HI7A 2LQVA 1GY7A 4XDWA 1VQM3 2HMMB 5KP3A 1FGMA 3QRDA 4KFFA 3K9MC 1UUWB 8CHOA 1QMAA 1K734 3A76A 3LT8A 1KD14 1Q40B 3CD63 4N6NB 2FNQA 4I4KA 3ROBA 1IQXA 4H3UA 1RKYA 1G96A 3LYGA 3VSYA 1RJOA 4HYZA 1SIIA 3PCRA 4EXRA 2I9WA 2OCTA 3HIGA 5FGOA 2O3OA 1ROVA 2GEYA 4R4KA 1YJW3 2XFTA 2P05A 5A0OB 1VQ53 1Q864 3EC9A 3VF1A 3FCSB 1AVLA 3K63A 5ELUA 4R9LA 2HMNB 3IMAB 3BNBA 1EKMA 5LC6A 3SOYA 3DXOA 4WHAA 3SEDA 1DMMA 2FGTA 1OHPA 1N5PA 3MHEA 3CCS3 2Z7AA 4FCZA 3CXC2 3JVCA 1JKGB 2GEXA 1SPUA 5AEUB 1O7HB 3OWUA 1VQP3 3LT9A 1VQ73 4O3VA 1M9GA 2W6JH 1Q40A 2GU1A 5STDA 4LMIA 2OQEA 3UL6A 3ALAA 3NQZA 4TX4A 1HU9A 1O7GB 1A2VA 1BUQA 1EG9B 4HM7B 2F98A 3CCJ3 3BNDA 3LMLA 3PS8A 2K54A 4HZ9B 1IV7A 4BTYA 1E3RA 2OOVA 2V1LA 3E99A 3HIIA 3I0YA 1WMOA 3UB1A 5IEPA 3PXMA 4K1UA 3UL5A 1JV2B 1E3VA 3B7CA 4HJLB 3FG4A 3WOFB 2OTJ3 5ELJA 3OXAA 3V92A 3AMOB 1Q7Y4 3HK4A 4IIAA 3G8ZA 1N8R4 4HM1B 4XDVA 6STDA 3CCQ3 1NJI4 2MC8A 1JKGA 3JUNA 3EN8A 4G1MB 1DVCA 4FCMA 1UI7A 3J7Yd 2C11A 4EBGA 1W6GA 1YI23 3OW22 3JUPA 1QALA 4HM4B 3NV0B 3BB9A 1VZZA 2C10A 2M7OA 2R4IA 1W01A 3DMCA 3DGMA 1W7CA 2WGOA 3X3XA 4EV2A 3CC43 4WWUC 1US1A 3U97A 3T8UA 5JPPA 1TFKA 5AIHA 1KQS2 3L0RA 4LSOA 2WO0A 4HVNA 1OUNA 1STDA 3FF2A 5CF1A 2OTL3 2IUJA 1LOXA 2YFIB 3FKAA 1D6ZA 1NDOB 2Z76A 3JUQA 4STDA 3BNEA 4AEQA 3GZRA 3X41A 3PGBA 1C7HA 1N9JA 2XR8B 3AMOA 2XH9A 2XEPA 3EE1A 3LXUX 1UI8A 1QVG2 1ULIB 3GRDA 1W00A 3DY5A 2WOHA 3GZBA 4O8SA 4HM2B 1IK3A 2CFLA 3GWRA 4O02B 1D6YA 3KN4A 2RFRA 3NQYA 1K28A 4N6TA 4Q53A 1KC84 3EBYA 3EN1B 2PZVA 3SX1A 4R9KA 3NV0A 2E2UA 4HBRA 3KIIA 3H3HA 1D6UA 2CC3A 1ZO2A 2D42A 3MYTA 3S67A 4EV5A 1LVNA 4WYKB 5LC7A 4EYCA 4GL6A 4HZBB 1IV9A 2CFKA 3EQQB 1DVDA 5CF2A 1U5OA 3TDGA 4CCVA 3PYJA 3Q90A 1T5YA 3WA3A 3FLJA 1L5GB 1W6CA 2XSHB 1YIJ3 1GD4A 2P38A 1IQ8A 1S5AA 2HMJB 2HMLB 2YFJB 3EJVA 2E2VA 2JQ5A 1Q814 1YVBI 3CC73 1ZX2A 3EHCA 2IMJA 5IG5A 1PU4A 2BMOB 3MG1A 3CC23 1JB5A 3F9SA 2CIUA 3N8BA 4FMCA 3KKGA 4ZM8A 2F99A 3I553 2CK3H 1QVF2 2RSXA 4GB5A 1CYUA 2O9UX 4WYKA 4IPBA 3I563 2CKFB 4AKYA 1EA2A 3WDGB 2BNGA 3ECFA 4HM6B 4MMYB 1A2KA 4NHFA 3EX9A 5D81A 4N6OB 5DREA 3CCR3 3CNXA 1N5HA 3F40A 5EEOA 1KWIA 5IENA 2BHMA 2F86B 2CH9A 2Y73A 1O7NB 3T8NA 2W0QA 1PFPA 5IERA 3OV4A 1U8CB 3SXXA 5KP4A 2IUKA 1IVWA 1DMQA 3WODG 3CCV3 3LOYA 3F8XA 3V98A 1AVKA 3Q2PA 3LTCA 1RRLA 3FF0A 1JB2A 5BXQA 2W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6M A;  3L0R A;  2BO9 B;  4N6U A;  1N9J A;  3MWZ A;  4IT7 A;  3QRD A;  3K9M C;  1CEW I;  1R4C A;  3GAX A;  4N6N B;  1FUW A;  1STF I;  3LH4 A;  1G96 A;  4N6T A;  1A67 A;  1FA3 A;  2OCT A;  3KFQ C;  1MOL A;  2KXG A;  3S67 A;  5LC7 A;  4EYC A;  5A0O B;  4N6V 0;  1IV9 A;  1DVD A;  5ELU A;  4CCV A;  3PYJ A;  3IMA B;  5LC6 A;  1NB5 I;  1N5P A;  1GD4 A;  3KSE D;  1ROA A;  1TIJ A;  1YVB I;  1M9G A;  3UL6 A;  1MNL A;  1GD3 A;  4TX4 A;  1RN7 A;  4ZM8 A;  3PS8 A;  1IV7 A;  1LXE A;  1CYU A;  2O9U X;  1CYV A;  3PXM A;  3NX0 A;  3UL5 A;  1EQK A;  4N6O B;  1WNH A;  2W9Q A;  1N5H A;  5ELJ A;  1KWI A;  2CH9 A;  3SVA A;  1PFP A;  4N6L A;  5EQL A;  1NB3 I;  1DVC A;  3Q2P A;  1A90 A;  4LZI A;  2W9P A; 
#chains in the Genus database with same CATH topology
 1RCK A;  2C4B A;  3X3Z A;  3CCL 3;  1CH0 A;  5IF6 A;  1PYL A;  5BVB A;  1B2X A;  1B27 A;  2QIY A;  3KZT A;  1VQO 3;  4X2O A;  1VQL 3;  1BSC A;  1AY7 A;  1GOY A;  1OAC A;  3OWS A;  1E97 A;  1GMQ A;  3NM2 A;  4MEI A;  2K0M A;  2BMQ B;  7STD A;  1X1Y A;  3X40 A;  1RNT A;  1RGL A;  1YIT 3;  3PCS A;  1GY5 A;  1WMP A;  3F14 A;  4FMA A;  1NO3 A;  4R80 A;  2ZDJ A;  4J5K A;  3HZP A;  5CK6 A;  4PEJ A;  1K8A 4;  5G1K A;  1BU4 A;  1B2Z A;  2BT3 A;  2STD A;  3DH2 A;  4OK0 A;  1VQQ A;  4H61 A;  4HM8 B;  3BNC A;  5AYS C;  1W02 A;  1YNV X;  4JF8 A;  3LTA A;  5D83 A;  1DET A;  4WP5 A;  3FH1 A;  1SIH A;  1X1W A;  2SBL A;  5M1A A;  2E2T A;  1RTU A;  4OUQ A;  1R4C A;  1BRH A;  3ZFZ A;  1S72 3;  5JBS A;  1OHO A;  3DGN A;  1NNV A;  1BRN L;  1UGH I;  3IJE B;  3DM8 A;  3LH4 A;  2D1W A;  3WOE B;  3ER7 A;  1V74 A;  4K1V A;  1WMN A;  2KAA A;  4KFD A;  1A67 A;  1AR0 A;  1GOU A;  3VGN A;  3S5C A;  2QA4 3;  3G0K A;  2ML5 A;  4RBN A;  1EUI C;  2Y74 A;  3D9R A;  1MOL A;  2AAD A;  2HMK B;  1MWR A;  2SAR A;  2W2C A;  3NXJ A;  1RDS A;  2UGI A;  2H0I A;  2OWP A;  2QEX 3;  2W56 A;  2KRT A;  1RGC A;  1YJ9 3;  3KE7 A;  1B2U A;  3NBJ A;  3G4S 3;  1GY6 A;  1LQM B;  2CFW A;  1Z1S A;  2ZA4 A;  4KFE A;  1VQ8 3;  1BGS A;  2GSP A;  1J2B A;  3SYU A;  1OHS A;  1Q42 A;  1NB5 I;  1W6Y A;  1QJG A;  3GSP A;  3NBB A;  3MKI A;  1O7W B;  4JRF A;  4MJD A;  3NHX A;  5TGN A;  3FZW A;  4K61 A;  2OQE C;  5EVH A;  3RGA A;  1IDP A;  1TU5 A;  1OGZ A;  1QAK A;  1GS3 A;  2B24 B;  1ROA A;  4BTX A;  4LGQ A;  2F5W A;  2CX0 A;  1N9E A;  1B3S A;  4O2H A;  1B21 A;  1MNL A;  1LOV A;  3HX8 A;  1GD3 A;  1UUV B;  2RGQ A;  5GSP A;  1BUJ A;  1DE3 A;  1VQK 3;  4FMB A;  1BNS A;  3DUK A;  4L8P A;  5IEO A;  1FGT A;  3AHW A;  3O8Y A;  1UGI A;  2K3D A;  2XSO B;  1YGE A;  1YVS A;  2CWT A;  1LNH A;  2Q07 A;  3LZA A;  3FG3 A;  3NM7 A;  3G71 3;  3N9H A;  4ORL A;  1CYV A;  3NBR A;  3KSP A;  1KSI A;  4N3V A;  4OVM A;  4XBT A;  2XRX B;  1V57 A;  3SLU A;  1I0X A;  5AEW B;  4CDL A;  1JJ2 2;  2UUG C;  5FW5 A;  1IVU A;  1BNI A;  1WNH A;  1Y4K A;  2W9Q A;  4J8T A;  2UX0 A;  2Z77 A;  4HKV B;  1FGQ A;  3UNL A;  1ZGX A;  3CPO A;  4K90 B;  5IG0 A;  5JPU A;  3CCM 3;  1I2G A;  1YJN 3;  2CWU A;  4BTW A;  1YHQ 3;  3NUV A;  4KVH A;  1W4N A;  1I2F A;  2ML6 A;  2YFL B;  3B8L A;  2B1X B;  3RGR A;  3B4P A;  4RZM A;  2CFG A;  1NB3 I;  3WA2 X;  1ISK A;  2CWV A;  2CW9 A;  1BRS A;  3M8C A;  1A90 A;  4U13 A;  3CNM A;  1TJD A;  1FGR A;  4HM0 B;  4X2H A;  2LYX A;  3DGL A;  4FMD A;  1RGH A;  4KT3 B;  4RNY A;  4XBY A;  3X42 A;  5IW9 A;  1AQZ A;  5AIF A;  2RNT A;  1VQ6 3;  2CHC A;  1GYB A;  3H51 A;  3MG2 A;  3PZW A;  1X1X A;  3K5T A;  2CFD A;  3RDE A;  2BO9 B;  4N6U A;  1ASK A;  1IVV A;  1BOX A;  1HKX A;  1FZU A;  4EV2 A;  1Q9E A;  3RNT A;  1VQ4 3;  3V99 A;  4XM4 A;  3MPH A;  3MWZ A;  3CCE 3;  2PNC A;  2YX9 A;  5KP1 A;  1RRH A;  1RMS A;  3B4O A;  1QAF A;  4IT7 A;  1K41 A;  2A15 A;  1FUT A;  1RGG A;  2XGL A;  3UJM A;  1OF5 B;  1CEW I;  3D5G A;  3D79 A;  3EB8 A;  4R1K A;  1UCK A;  1W2B 2;  3GAX A;  5AIG A;  1X1U A;  3Q1C A;  1FUW A;  1M1X B;  3MSO A;  4KZ1 A;  3F7S A;  1OGX A;  2ZHX B;  5I97 A;  1STF I;  1TFO A;  2XFS A;  1VQN 3;  3F8H A;  3CCU 3;  2RCD A;  1DMN A;  2W56 B;  1FA3 A;  1GSP A;  1IU7 A;  1MWU A;  3JUM A;  4MMZ B;  4XBX A;  2GXF A;  3KFQ C;  2XF3 A;  3AHS A;  2BMR B;  4WFO A;  2KXG A;  1MWT A;  2KCD A;  2JDI H;  4EC6 A;  3IPT A;  4QWT A;  4N6V 0;  3DZL A;  2Z6B A;  2H0G A;  4J9A A;  1K9M 4;  1RCL A;  1UDI I;  1TUH A;  1UW1 A;  4AKZ A;  4MMX B;  3JUO A;  1OPY A;  3BLZ A;  1FGO A;  1JB4 A;  3GZX B;  3CPW 2;  1FUS A;  1JNQ A;  4FR9 A;  1I2E A;  3KSE D;  1BAN A;  2XGN A;  1OF5 A;  3T0U A;  1JBT A;  5AI1 A;  2AAE A;  1TIJ A;  3FGY A;  1DYU A;  5AYR B;  4LEH A;  1IQY A;  3S29 A;  4NRE A;  1WQL B;  5HGR A;  1TP6 A;  2GU3 A;  1Q7H A;  3D3L A;  3WMD A;  2CG0 A;  1RN7 A;  1CQS A;  3GZY B;  4XB5 A;  2GBW B;  3HOH A;  3LTB A;  4I5Q A;  1LXE A;  2CG1 A;  1SAR A;  2IA7 A;  1G0T A;  1VQ9 3;  2INX A;  1JN5 B;  2GBX B;  4BL2 A;  3NX0 A;  3MG3 A;  4L7K A;  3SOA A;  1OCV A;  1F8N A;  2L4V A;  1N8Q A;  2P09 A;  2W04 A;  2MF7 A;  4EW5 A;  2RBI A;  1EQK A;  1Q82 4;  5DRV A;  3CMA 3;  1O7P B;  1W2Z A;  4L8O A;  1BNG A;  2FXT A;  1SQW A;  3WR2 A;  3SVA A;  6RNT A;  4RNZ A;  3LTD A;  4N6L A;  3OX9 A;  1RGE A;  2P0X A;  2W03 A;  5D82 A;  5EQL A;  5RNT A;  3QK9 A;  3BIR A;  3OWY A;  2OOV C;  1TTO A;  3FG1 A;  1EEJ A;  5CLK A;  5G2G A;  1IVX A;  3CU3 A;  2R41 A;  2QGU A;  2KF3 A;  3F7X A;  1OH0 A;  1ULJ B;  4HM5 B;  3N54 B;  1NWW A;  2WOF A;  2J8X B;  4LYL B;  4LZI A;  5IG4 A;  1IT8 A;  2WGQ A;  3DGO A;  3U1W A;  4N6M A;  5AII A;  1LOY A;  3CME 3;  3S28 A;  1JRQ A;  3EBT A;  1RLS A;  1RGF A;  2ZL8 A;  1SJW A;  3K0Z A;  3STD A;  4BIR A;  1M1K 4;  1NU3 A;  1O7M B;  4DKI A;  3S27 A;  3CC4 3;  1BNF A;  1W5Z A;  9RNT A;  1M90 4;  1JN5 A;  1RGA A;  3FSD A;  1G02 A;  3EF8 A;  4HM3 B;  3X3Y A;  2P0M A;  1WTH A;  3G16 A;  5M18 A;  3G6E 3;  2F5M A;  5CXO A;  3K7C A;  2HMO B;  5IG3 A;  1AV4 A;  4FCJ A;  1IT7 A;  3HI7 A;  2LQV A;  1GY7 A;  4XDW A;  1JZO A;  1VQM 3;  2HMM B;  1T2I A;  5KP3 A;  1FGM A;  5M19 A;  3QRD A;  4KFF A;  3K9M C;  1BRG A;  1I8V A;  1UUW B;  8CHO A;  1QMA A;  1K73 4;  3A76 A;  3LT8 A;  1KD1 4;  1Q40 B;  3CD6 3;  4N6N B;  2FNQ A;  4I4K A;  3ROB A;  1IQX A;  4H3U A;  1RKY A;  1G96 A;  3LYG A;  3VSY A;  1RJO A;  7RNT A;  1ZS7 A;  4HYZ A;  1SII A;  3PCR A;  4EXR A;  2I9W A;  1LQG C;  2OCT A;  3HIG A;  5FGO A;  2O3O A;  1ROV A;  1FW7 A;  2GEY A;  4R4K A;  1YJW 3;  2XFT A;  1BIR A;  2P05 A;  5A0O B;  1VQ5 3;  1Q86 4;  1GOV A;  1BSB A;  3EC9 A;  3VF1 A;  3FCS B;  1AVL A;  3K63 A;  5ELU A;  4R9L A;  2HMN B;  1R4Y A;  3IMA B;  3BNB A;  1EKM A;  5LC6 A;  3SOY A;  3DXO A;  4WHA A;  3SED A;  1DMM A;  1OHP A;  2FGT A;  1N5P A;  3MHE A;  3DGY A;  3CCS 3;  2Z7A A;  4FCZ A;  3CXC 2;  3JVC A;  1JKG B;  2GEX A;  1SPU A;  5AEU B;  1O7H B;  3OWU A;  1VQP 3;  3LT9 A;  7GSP A;  1VQ7 3;  4O3V A;  1M9G A;  2W6J H;  1Q40 A;  2GU1 A;  5STD A;  4LMI A;  2OQE A;  3UL6 A;  1RN4 A;  3ALA A;  3BU4 A;  3NQZ A;  4TX4 A;  1HU9 A;  1O7G B;  3D5I A;  1A2V A;  5HOH A;  1BUQ A;  1EG9 B;  4HM7 B;  1BRJ A;  2F98 A;  2L1S A;  3CCJ 3;  3D4A A;  3BND A;  1YGW A;  3LML A;  2K54 A;  3PS8 A;  1IV7 A;  4HZ9 B;  4BTY A;  1A2P A;  1E3R A;  2OOV A;  2V1L A;  3E99 A;  3HII A;  3I0Y A;  1WMO A;  3UB1 A;  5IEP A;  3PXM A;  1LOW A;  4J5G A;  4K1U A;  3ZG0 A;  1I70 A;  3UL5 A;  1JV2 B;  1E3V A;  3B7C A;  4HJL B;  3FG4 A;  4CJN A;  3WOF B;  2KF6 A;  2OTJ 3;  1PY3 A;  5ELJ A;  3OXA A;  3V92 A;  4GSP A;  3AMO B;  1UCL A;  1Q7Y 4;  3HK4 A;  1BNR A;  4IIA A;  3G8Z A;  1N8R 4;  4HM1 B;  4XDV A;  1BSE A;  6STD A;  3CCQ 3;  1NJI 4;  2MC8 A;  5BU4 A;  1JKG A;  1B20 A;  3JUN A;  3EN8 A;  4G1M B;  1DVC A;  1FYS A;  4FCM A;  1UI7 A;  3J7Y d;  2C11 A;  4EBG A;  1GMP A;  1W6G A;  1B2S A;  1YI2 3;  1BRI A;  3OW2 2;  3JUP A;  1QAL A;  4HM4 B;  3NV0 B;  3BB9 A;  1VZZ A;  2C10 A;  8RNT A;  2M7O A;  2R4I A;  1W01 A;  3AGO A;  1UCJ A;  1W7C A;  2WGO A;  3DGM A;  1T3B A;  3DMC A;  3X3X A;  4GHO A;  4WWU C;  1US1 A;  4HAA A;  3T8U A;  3U97 A;  1TFK A;  6GSP A;  5JPP A;  5AIH A;  1KQS 2;  1MGW A;  3L0R A;  2WO0 A;  4LSO A;  3Q3F A;  1OUN A;  4HVN A;  1C54 A;  3AGN A;  1STD A;  3FF2 A;  5CF1 A;  1BSD A;  2OTL 3;  2IUJ A;  1JBR A;  1LOX A;  2YFI B;  3FKA A;  1D6Z A;  1NDO B;  2Z76 A;  3JUQ A;  4STD A;  3BNE A;  4AEQ A;  3GZR A;  1HZ1 A;  3X41 A;  3PGB A;  1C7H A;  1N9J A;  2XR8 B;  3AMO A;  2KF4 A;  2XH9 A;  2XEP A;  3EE1 A;  1MWS A;  4CPK A;  3LXU X;  1UI8 A;  1LRA A;  2IYJ A;  1QVG 2;  1ULI B;  2CX1 A;  1BNE A;  1W00 A;  3DY5 A;  2WOH A;  2IY2 A;  3GRD A;  3GZB A;  4O8S A;  4HM2 B;  1IK3 A;  2CFL A;  3GWR A;  2BU4 A;  2HOH A;  4O02 B;  1D6Y A;  1BRK A;  1I3I A;  2RFR A;  1K28 A;  3KN4 A;  3NQY A;  4N6T A;  4Q53 A;  1KC8 4;  3EBY A;  3EN1 B;  2PZV A;  3SX1 A;  4R9K A;  3A5E A;  3NV0 A;  2E2U A;  4HBR A;  4BU4 A;  1TRP A;  1RNB A;  3KII A;  2F4Y A;  3H3H A;  1D6U A;  2CC3 A;  1RSN A;  1ZO2 A;  2D42 A;  3MYT A;  3S67 A;  3WHO A;  4EV5 A;  1LVN A;  1MGR A;  4WYK B;  5LC7 A;  4EYC A;  4GL6 A;  4HZB B;  1IV9 A;  2CFK A;  4RNT A;  1UCI A;  3EQQ B;  1DVD A;  1LNI A;  1GMR A;  4NPB A;  5CF2 A;  1U5O A;  3TDG A;  1HYF A;  3PYJ A;  3URP A;  4CCV A;  3Q90 A;  1RGK A;  2KF5 A;  1T5Y A;  3WA3 A;  1B2M A;  3FLJ A;  1L5G B;  1W6C A;  2XSH B;  1YIJ 3;  1GD4 A;  2P38 A;  1IQ8 A;  1S5A A;  2HMJ B;  2HML B;  2YFJ B;  5G1L A;  3EJV A;  2E2V A;  1BSA A;  2JQ5 A;  1Q81 4;  1YVB I;  3CC7 3;  1ZX2 A;  1I3F A;  3EHC A;  2IMJ A;  2BIR A;  5IG5 A;  1PU4 A;  2BMO B;  1BAO A;  3MG1 A;  1JB5 A;  3CC2 3;  5BIR A;  1IYY A;  3F9S A;  2CIU A;  4HOH A;  3N8B A;  4FMC A;  3KKG A;  4ZM8 A;  2F99 A;  3I55 3;  2CK3 H;  1QVF 2;  1JZD A;  2RSX A;  4GB5 A;  1CYU A;  2O9U X;  1T2H A;  4IPB A;  4WYK A;  3I56 3;  2CKF B;  4AKY A;  1RHL A;  1EA2 A;  3WDG B;  1BVI A;  2BNG A;  3ECF A;  4HM6 B;  4MMY B;  1A2K A;  4NHF A;  1JBS A;  1I0V A;  3KCH A;  1V58 A;  3EX9 A;  1UUG B;  5D81 A;  2F56 A;  4N6O B;  5DRE A;  3CCR 3;  1RN1 A;  1N5H A;  3CNX A;  3F40 A;  1KWI A;  5EEO A;  2BHM A;  3ZG5 A;  1BNJ A;  2CH9 A;  2F86 B;  2Y73 A;  5IEN A;  1O7N B;  3T8N A;  2W0Q A;  1PFP A;  5IER A;  3OV4 A;  4BL3 A;  1U8C B;  3SXX A;  5KP4 A;  2IUK A;  1IVW A;  1DMQ A;  3WOD G;  3CCV 3;  2H0H A;  3F8X A;  3LOY A;  3V98 A;  1AVK A;  3Q2P A;  3LTC A;  4ILF A;  1RRL A;  3FF0 A;  1JB2 A;  5BXQ A;  2W9P A;  1TRQ A; 
#chains in the Genus database with same CATH homology
 3X3Z A;  3CCL 3;  5IF6 A;  5BVB A;  3KZT A;  2QIY A;  1VQO 3;  4X2O A;  1VQL 3;  1OAC A;  3OWS A;  1E97 A;  4MEI A;  3NM2 A;  2K0M A;  2BMQ B;  7STD A;  3X40 A;  1YIT 3;  3PCS A;  1GY5 A;  1WMP A;  3F14 A;  4FMA A;  1NO3 A;  4R80 A;  2ZDJ A;  3HZP A;  5CK6 A;  4PEJ A;  1K8A 4;  2BT3 A;  2STD A;  4OK0 A;  4H61 A;  4HM8 B;  3BNC A;  5AYS C;  1W02 A;  4JF8 A;  3LTA A;  5D83 A;  4WP5 A;  3FH1 A;  1SIH A;  2SBL A;  2E2T A;  4OUQ A;  1R4C A;  1S72 3;  5JBS A;  1OHO A;  3DGN A;  3IJE B;  3DM8 A;  3LH4 A;  2D1W A;  3WOE B;  3ER7 A;  1V74 A;  4K1V A;  1WMN A;  4KFD A;  1A67 A;  1AR0 A;  3VGN A;  3S5C A;  2QA4 3;  3G0K A;  2ML5 A;  4RBN A;  2Y74 A;  3D9R A;  1MOL A;  2HMK B;  3NXJ A;  2W2C A;  2OWP A;  2QEX 3;  2W56 A;  2KRT A;  1YJ9 3;  3KE7 A;  3NBJ A;  3G4S 3;  1GY6 A;  2CFW A;  1Z1S A;  4KFE A;  1VQ8 3;  1J2B A;  1OHS A;  1Q42 A;  1NB5 I;  1W6Y A;  1QJG A;  3NBB A;  4JRF A;  3MKI A;  1O7W B;  4MJD A;  5TGN A;  3NHX A;  3RGA A;  3FZW A;  4K61 A;  2OQE C;  5EVH A;  1IDP A;  1TU5 A;  1OGZ A;  1QAK A;  1GS3 A;  2B24 B;  1ROA A;  4BTX A;  4LGQ A;  1N9E A;  4O2H A;  1MNL A;  3HX8 A;  1GD3 A;  1UUV B;  2RGQ A;  1VQK 3;  4FMB A;  3DUK A;  4L8P A;  5IEO A;  1FGT A;  3O8Y A;  2XSO B;  1YGE A;  2CWT A;  1LNH A;  2Q07 A;  3LZA A;  3FG3 A;  3NM7 A;  3G71 3;  3N9H A;  4ORL A;  1CYV A;  3NBR A;  3KSP A;  1KSI A;  4N3V A;  4OVM A;  4XBT A;  2XRX B;  3SLU A;  5AEW B;  4CDL A;  1JJ2 2;  5FW5 A;  1IVU A;  1WNH A;  1Y4K A;  2W9Q A;  4J8T A;  2UX0 A;  2Z77 A;  4HKV B;  1FGQ A;  3UNL A;  3CPO A;  4K90 B;  5IG0 A;  5JPU A;  3CCM 3;  1YJN 3;  2CWU A;  4BTW A;  1YHQ 3;  3NUV A;  4KVH A;  1W4N A;  2YFL B;  2ML6 A;  3B8L A;  3RGR A;  2B1X B;  3B4P A;  4RZM A;  2CFG A;  1NB3 I;  3WA2 X;  1ISK A;  2CWV A;  2CW9 A;  3M8C A;  1A90 A;  4U13 A;  3CNM A;  1FGR A;  4HM0 B;  4X2H A;  2LYX A;  3DGL A;  4FMD A;  4RNY A;  4XBY A;  3X42 A;  5IW9 A;  5AIF A;  1VQ6 3;  2CHC A;  1GYB A;  3H51 A;  3MG2 A;  3PZW A;  3K5T A;  2CFD A;  3RDE A;  2BO9 B;  4N6U A;  1ASK A;  1IVV A;  1HKX A;  1VQ4 3;  3V99 A;  4XM4 A;  3MPH A;  3MWZ A;  3CCE 3;  2PNC A;  2YX9 A;  5KP1 A;  1RRH A;  3B4O A;  1QAF A;  4IT7 A;  1K41 A;  2A15 A;  3UJM A;  2XGL A;  1OF5 B;  1CEW I;  3EB8 A;  4R1K A;  1W2B 2;  3GAX A;  5AIG A;  3Q1C A;  1FUW A;  1M1X B;  3MSO A;  4KZ1 A;  3F7S A;  1OGX A;  5I97 A;  1STF I;  1TFO A;  2XFS A;  1VQN 3;  3F8H A;  3CCU 3;  2RCD A;  1DMN A;  2W56 B;  1FA3 A;  1IU7 A;  3JUM A;  4MMZ B;  4XBX A;  2GXF A;  3KFQ C;  2XF3 A;  2BMR B;  4WFO A;  2KXG A;  2KCD A;  2JDI H;  4EC6 A;  3IPT A;  4QWT A;  4N6V 0;  3DZL A;  2Z6B A;  4J9A A;  1K9M 4;  1UW1 A;  1TUH A;  4AKZ A;  4MMX B;  3JUO A;  1OPY A;  3BLZ A;  1FGO A;  1JB4 A;  3GZX B;  3CPW 2;  1JNQ A;  4FR9 A;  3KSE D;  2XGN A;  1OF5 A;  3T0U A;  5AI1 A;  1TIJ A;  3FGY A;  1DYU A;  5AYR B;  4LEH A;  1IQY A;  3S29 A;  4NRE A;  1WQL B;  5HGR A;  1TP6 A;  2GU3 A;  3WMD A;  3D3L A;  2CG0 A;  1RN7 A;  1CQS A;  3GZY B;  4XB5 A;  2GBW B;  3LTB A;  1LXE A;  2CG1 A;  2IA7 A;  1VQ9 3;  2INX A;  1JN5 B;  2GBX B;  3NX0 A;  3MG3 A;  4L7K A;  3SOA A;  1OCV A;  1F8N A;  2L4V A;  1N8Q A;  2P09 A;  2W04 A;  2MF7 A;  1EQK A;  1Q82 4;  5DRV A;  3CMA 3;  1O7P B;  1W2Z A;  4L8O A;  2FXT A;  1SQW A;  3SVA A;  4RNZ A;  3LTD A;  4N6L A;  3OX9 A;  2W03 A;  2P0X A;  5D82 A;  5EQL A;  3QK9 A;  3OWY A;  2OOV C;  3FG1 A;  5CLK A;  5G2G A;  1IVX A;  3CU3 A;  2QGU A;  3F7X A;  1OH0 A;  1ULJ B;  4HM5 B;  3N54 B;  1NWW A;  2WOF A;  4LZI A;  5IG4 A;  1IT8 A;  2WGQ A;  3DGO A;  3U1W A;  4N6M A;  5AII A;  3CME 3;  3S28 A;  1JRQ A;  3EBT A;  2ZL8 A;  1SJW A;  3K0Z A;  3STD A;  1M1K 4;  1NU3 A;  1O7M B;  3S27 A;  1W5Z A;  1M90 4;  1JN5 A;  3FSD A;  3EF8 A;  4HM3 B;  3X3Y A;  2P0M A;  1WTH A;  3G16 A;  3G6E 3;  5CXO A;  3K7C A;  2HMO B;  5IG3 A;  1AV4 A;  4FCJ A;  1IT7 A;  3HI7 A;  2LQV A;  1GY7 A;  4XDW A;  1VQM 3;  2HMM B;  5KP3 A;  1FGM A;  3QRD A;  4KFF A;  3K9M C;  1UUW B;  8CHO A;  1QMA A;  1K73 4;  3A76 A;  3LT8 A;  1KD1 4;  1Q40 B;  3CD6 3;  4N6N B;  2FNQ A;  4I4K A;  3ROB A;  1IQX A;  4H3U A;  1RKY A;  1G96 A;  3LYG A;  3VSY A;  1RJO A;  4HYZ A;  1SII A;  3PCR A;  4EXR A;  2I9W A;  2OCT A;  3HIG A;  5FGO A;  2O3O A;  1ROV A;  2GEY A;  4R4K A;  1YJW 3;  2XFT A;  2P05 A;  5A0O B;  1VQ5 3;  1Q86 4;  3EC9 A;  3VF1 A;  3FCS B;  1AVL A;  3K63 A;  5ELU A;  4R9L A;  2HMN B;  3IMA B;  3BNB A;  1EKM A;  5LC6 A;  3SOY A;  3DXO A;  4WHA A;  3SED A;  1DMM A;  2FGT A;  1OHP A;  1N5P A;  3MHE A;  3CCS 3;  2Z7A A;  4FCZ A;  3CXC 2;  3JVC A;  1JKG B;  2GEX A;  1SPU A;  5AEU B;  1O7H B;  3OWU A;  1VQP 3;  3LT9 A;  1VQ7 3;  4O3V A;  1M9G A;  2W6J H;  1Q40 A;  2GU1 A;  5STD A;  4LMI A;  2OQE A;  3UL6 A;  3ALA A;  3NQZ A;  4TX4 A;  1HU9 A;  1O7G B;  1A2V A;  1BUQ A;  1EG9 B;  4HM7 B;  2F98 A;  3CCJ 3;  3BND A;  3LML A;  3PS8 A;  2K54 A;  4HZ9 B;  1IV7 A;  4BTY A;  1E3R A;  2OOV A;  2V1L A;  3E99 A;  3HII A;  3I0Y A;  1WMO A;  3UB1 A;  5IEP A;  3PXM A;  4K1U A;  3UL5 A;  1JV2 B;  1E3V A;  3B7C A;  4HJL B;  3FG4 A;  3WOF B;  2OTJ 3;  5ELJ A;  3OXA A;  3V92 A;  3AMO B;  1Q7Y 4;  3HK4 A;  4IIA A;  3G8Z A;  1N8R 4;  4HM1 B;  4XDV A;  6STD A;  3CCQ 3;  1NJI 4;  2MC8 A;  1JKG A;  3JUN A;  3EN8 A;  4G1M B;  1DVC A;  4FCM A;  1UI7 A;  3J7Y d;  2C11 A;  4EBG A;  1W6G A;  1YI2 3;  3OW2 2;  3JUP A;  1QAL A;  4HM4 B;  3NV0 B;  3BB9 A;  1VZZ A;  2C10 A;  2M7O A;  2R4I A;  1W01 A;  3DMC A;  3DGM A;  1W7C A;  2WGO A;  3X3X A;  4EV2 A;  3CC4 3;  4WWU C;  1US1 A;  3U97 A;  3T8U A;  5JPP A;  1TFK A;  5AIH A;  1KQS 2;  3L0R A;  4LSO A;  2WO0 A;  4HVN A;  1OUN A;  1STD A;  3FF2 A;  5CF1 A;  2OTL 3;  2IUJ A;  1LOX A;  2YFI B;  3FKA A;  1D6Z A;  1NDO B;  2Z76 A;  3JUQ A;  4STD A;  3BNE A;  4AEQ A;  3GZR A;  3X41 A;  3PGB A;  1C7H A;  1N9J A;  2XR8 B;  3AMO A;  2XH9 A;  2XEP A;  3EE1 A;  3LXU X;  1UI8 A;  1QVG 2;  1ULI B;  3GRD A;  1W00 A;  3DY5 A;  2WOH A;  3GZB A;  4O8S A;  4HM2 B;  1IK3 A;  2CFL A;  3GWR A;  4O02 B;  1D6Y A;  3KN4 A;  2RFR A;  3NQY A;  1K28 A;  4N6T A;  4Q53 A;  1KC8 4;  3EBY A;  3EN1 B;  2PZV A;  3SX1 A;  4R9K A;  3NV0 A;  2E2U A;  4HBR A;  3KII A;  3H3H A;  1D6U A;  2CC3 A;  1ZO2 A;  2D42 A;  3MYT A;  3S67 A;  4EV5 A;  1LVN A;  4WYK B;  5LC7 A;  4EYC A;  4GL6 A;  4HZB B;  1IV9 A;  2CFK A;  3EQQ B;  1DVD A;  5CF2 A;  1U5O A;  3TDG A;  4CCV A;  3PYJ A;  3Q90 A;  1T5Y A;  3WA3 A;  3FLJ A;  1L5G B;  1W6C A;  2XSH B;  1YIJ 3;  1GD4 A;  2P38 A;  1IQ8 A;  1S5A A;  2HMJ B;  2HML B;  2YFJ B;  3EJV A;  2E2V A;  2JQ5 A;  1Q81 4;  1YVB I;  3CC7 3;  1ZX2 A;  3EHC A;  2IMJ A;  5IG5 A;  1PU4 A;  2BMO B;  3MG1 A;  3CC2 3;  1JB5 A;  3F9S A;  2CIU A;  3N8B A;  4FMC A;  3KKG A;  4ZM8 A;  2F99 A;  3I55 3;  2CK3 H;  1QVF 2;  2RSX A;  4GB5 A;  1CYU A;  2O9U X;  4WYK A;  4IPB A;  3I56 3;  2CKF B;  4AKY A;  1EA2 A;  3WDG B;  2BNG A;  3ECF A;  4HM6 B;  4MMY B;  1A2K A;  4NHF A;  3EX9 A;  5D81 A;  4N6O B;  5DRE A;  3CCR 3;  3CNX A;  1N5H A;  3F40 A;  5EEO A;  1KWI A;  5IEN A;  2BHM A;  2F86 B;  2CH9 A;  2Y73 A;  1O7N B;  3T8N A;  2W0Q A;  1PFP A;  5IER A;  3OV4 A;  1U8C B;  3SXX A;  5KP4 A;  2IUK A;  1IVW A;  1DMQ A;  3WOD G;  3CCV 3;  3LOY A;  3F8X A;  3V98 A;  1AVK A;  3Q2P A;  3LTC A;  1RRL A;  3FF0 A;  1JB2 A;  5BXQ A;  2W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...