3UL6A

Saccharum officinarum canecystatin-1 in space group p6422
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
DLEAIELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKVWENFKQLQSFQPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography and NMR studies of domain-swapped canecystatin-1.
pubmed doi rcsb
source organism Saccharum officinarum
molecule tags Hydrolase inhibitor
molecule keywords Canecystatin-1
total genus 13
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16845 SQAPI Aspartic acid proteinase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ul6A00
3LH4A 3S67A 5A0OB 1A67A 3KSED 4EYCA 1MOLA 1FA3A 4ZM8A 3IMAB 5LC6A 1R4CA 2BO9B 2O9UX 1MNLA 1KWIA 4CCVA 1FUWA 3UL6A 3PYJA 3GAXA 2W9PA 1STFI 5ELJA 1IV7A 1GD4A 1N9JA 1CEWI 1CYUA 1RN7A 1G96A 3NX0A 4N6UA 3K9MC 4N6V0 1NB3I 1PFPA 4LZIA 5ELUA 3UL5A 3KFQC 1A90A 1M9GA 1WNHA 4N6MA 1N5PA 4N6OB 4N6TA 1N5HA 3SVAA 3L0RA 3MWZA 5EQLA 4TX4A 1DVDA 1TIJA 1GD3A 4N6LA 1IV9A 1CYVA 3Q2PA 4N6NB 2KXGA 1LXEA 2W9QA 4IT7A 1EQKA 2CH9A 2OCTA 3PS8A 1NB5I 3QRDA 1DVCA 5LC7A 1YVBI 1ROAA 3PXMA
chains in the Genus database with same CATH superfamily
3GZYB 4K1VA 1YIJ3 4KZ1A 1Q42A 4OK0A 2B24B 3FLJA 1OHOA 3KKGA 2E2VA 4EC6A 1ISKA 1BUQA 3CCL3 1J2BA 1UI8A 2Z76A 1MGWA 1TTOA 1X1UA 3HK4A 1IQ8A 2KCDA 3DZLA 4X2HA 1STFI 2ZHXB 1YJ93 1DMQA 2BNGA 1VQ53 1EKMA 1PFPA 3CD63 3KFQC 4LSOA 4AKZA 3X3ZA 4HM3B 1X1WA 1GMQA 1UGHI 1OACA 5KP1A 1RGGA 2XR8B 1V58A 3GZBA 1X1YA 5KP4A 1M1K4 1GD3A 4XDWA 2P0MA 1US1A 2GSPA 1N9EA 4JRFA 1LXEA 4KT3B 3I553 1UCIA 1JBTA 1RHLA 1GOVA 1A2KA 1O7WB 3KN4A 3DUKA 3WMDA 2F5MA 1W6CA 3Q3FA 3ZG5A 1SPUA 1VQ63 3FZWA 1Q7HA 1I2FA 1JV2B 3CNMA 3HIIA 3OWYA 1UUGB 4HOHA 1UUWB 3SX1A 1G96A 1QALA 3CCS3 1NB3I 1STDA 1FGQA 4FCMA 6RNTA 4N3VA 1MWRA 2HMJB 2K0MA 3BNEA 4J5GA 1M1XB 2XFSA 4MJDA 1QMAA 2BHMA 1O7NB 3BU4A 3OWUA 4HM5B 1K9M4 1KC84 1WTHA 3B4PA 4FCZA 1JJ22 4GSPA 2XH9A 5G1KA 1AVLA 1BNEA 1E3RA 3DGNA 1RGFA 3AGNA 4LGQA 1JKGA 1YVBI 3LMLA 3PCSA 1TFOA 9RNTA 4R9LA 1I2EA 3ER7A 1B20A 5IG3A 3J7Yd 1SIHA 1AVKA 2K54A 1LOXA 4RNZA 4XBXA 1B3SA 1QJGA 2PNCA 1VQ73 4EXRA 2K3DA 4HZ9B 2RBIA 1IVXA 4AEQA 1BRNL 1OH0A 3EN1B 1I2GA 2LQVA 4BTXA 3LTAA 3MKIA 4K90B 1I8VA 1LOWA 2HMKB 3DGLA 1OGXA 2F5WA 3G0KA 1N5PA 2C10A 3O8YA 3PGBA 1ZS7A 3FH1A 4G1MB 5EQLA 1GOYA 4Q53A 3GSPA 3UB1A 3FF0A 1BSAA 3CXC2 2D42A 2KF4A 1BNRA 5D81A 1RGAA 1W6YA 2J8XB 3SLUA 2OQEA 4R9KA 1RGCA 4CDLA 2HOHA 4L8PA 1CH0A 3K63A 3HX8A 4HVNA 2RNTA 3CCU3 1OF5B 3CPW2 1OHSA 1FA3A 1O7MB 3CCM3 1DETA 2IA7A 3S28A 4RNYA 2AADA 5M1AA 3WOEB 1B2ZA 4FMDA 5KP3A 3FGYA 1VQP3 3CC43 5ELUA 2BMRB 5AI1A 4LMIA 4HM0B 1K41A 1WNHA 7STDA 3SVAA 3EHCA 5FW5A 1DVDA 1TJDA 3OXAA 5IG5A 1IV9A 1AV4A 3Q2PA 2XF3A 1RCLA 1GYBA 1YNVX 2W9QA 4IT7A 4R1KA 4U13A 3I563 3IJEB 1BVIA 1VQL3 5CK6A 1CEWI 5DREA 1IQXA 1N8QA 3LH4A 1B2UA 1GOUA 5A0OB 4XDVA 2XFTA 3G4S3 1I3FA 1OUNA 7GSPA 2RCDA 3WHOA 1BSCA 4AKYA 1A2PA 2RGQA 1MNLA 4LEHA 3D5GA 1EA2A 1Q864 1NU3A 3A5EA 4H3UA 4OVMA 4IIAA 5AYSC 2GBWB 4LZIA 1OPYA 1YI23 1T2HA 5GSPA 1RN1A 3K5TA 1KQS2 3L0RA 1Q9EA 3MWZA 4BL2A 5IG4A 3ALAA 4TX4A 3DM8A 2QGUA 1TIJA 4O02B 2YFJB 4NREA 2CW9A 1CYVA 2ML5A 1RRHA 2E2TA 3ZG0A 1IK3A 3ECFA 1IVUA 3X3YA 3PS8A 3H3HA 1F8NA 1S723 4GHOA 4CJNA 1MWUA 5RNTA 3LZAA 5TGNA 1EUIC 1Y4KA 4O3VA 1IDPA 3U97A 2XGNA 2R41A 2H0IA 1AY7A 1R4CA 1W5ZA 2BO9B 2O9UX 1KWIA 3HI7A 4IPBA 2YFIB 3AHWA 1BRKA 1GMPA 5IENA 1IVWA 2Y73A 1JBSA 5BVBA 2ZDJA 3CCJ3 2STDA 3LOYA 1HYFA 2BU4A 2F56A 3KZTA 3NQYA 4HM4B 2HMOB 1HKXA 3G8ZA 1VQ43 1TFKA 4N6NB 5IERA 3DMCA 2KXGA 5AEWB 1EQKA 1YGEA 1LVNA 3AMOB 1RN4A 1YJW3 1UI7A 4FMAA 3D5IA 4MEIA 1RRLA 3PXMA 4NHFA 2JQ5A 2XSHB 1TUHA 2D1WA 4ZM8A 1BNSA 4KVHA 1YJN3 1BIRA 3WR2A 2WGQA 3KE7A 1IV7A 3NBJA 4HAAA 1NWWA 3KCHA 1RN7A 3NX0A 3BIRA 1W4NA 3SEDA 3VF1A 1BSEA 4GL6A 1B2XA 1IT7A 1SARA 2UX0A 1UCLA 3U1WA 3JUNA 1Q814 1DMNA 5EVHA 4XBYA 4JF8A 3PCRA 1I3IA 2CFDA 4R80A 1I70A 1NO3A 2KF3A 2Z77A 1K28A 2CWVA 3AHSA 2H0HA 2XSOB 3NBBA 4LYLB 1GY5A 5IEOA 1B2SA 1UCJA 1TRQA 1UGIA 1A90A 1ROAA 2W56B 3FG1A 1BOXA 1BRHA 1FGOA 3B8LA 3DXOA 3LTBA 3MG3A 3KSED 3Q90A 4ILFA 1MOLA 1JB4A 2GU1A 2ZL8A 2RSXA 3DGOA 4EYCA 1FYSA 2GXFA 2ZA4A 3SYUA 3WDGB 1RKYA 2OTL3 1JNQA 3EN8A 3GAXA 5ELJA 2C11A 4XM4A 4L8OA 1JN5A 3K9MC 4N6V0 5CXOA 1A2VA 1D6YA 2FGTA 2KRTA 2WO0A 3FCSB 4K61A 3CMA3 4FCJA 1DE3A 1JBRA 1YGWA 1LNIA 3NM2A 4N6LA 2KF5A 3MYTA 3VGNA 2P09A 1NDOB 3EF8A 1OGZA 3V98A 4J5KA 2CFGA 3VSYA 2CH9A 4H61A 5D83A 1NB5I 4HKVB 2SARA 1TP6A 1JN5B 4HZBB 1QVG2 5IF6A 5BIRA 4RZMA 8CHOA 2Q07A 1IYYA 2FXTA 5FGOA 3F8HA 1IT8A 4CCVA 1GY6A 3BNDA 6STDA 3UL6A 1K734 1LOVA 3TDGA 1N9JA 1CYUA 2I9WA 4HM7B 1IQYA 3MHEA 3NXJA 4BIRA 3KSPA 2BIRA 3LTCA 1MGRA 3BNBA 4ORLA 1WMNA 1AR0A 3M8CA 4EV2A 3G6E3 2CFWA 2RFRA 1OF5A 1KD14 3NHXA 3GWRA 1X1XA 3FSDA 3RDEA 3X42A 2WGOA 3MG1A 1O7GB 1NNVA 2H0GA 2Z6BA 1RNTA 1SIIA 3S67A 1A67A 1HU9A 4O8SA 3X40A 3NQZA 1VQO3 1G0TA 2CKFB 4BL3A 2QIYA 2CG1A 5IW9A 2KAAA 1BUJA 3PYJA 2LYXA 1VQM3 1R4YA 1GS3A 1GY7A 1BNGA 1MWSA 4MMYB 2C4BA 4STDA 1M9GA 4EW5A 1SQWA 1BNJA 3AMOA 3DGYA 1ULJB 4K1UA 3CCQ3 5DRVA 1FUTA 2Z7AA 3BB9A 3FKAA 4QWTA 1FZUA 3B7CA 3FG3A 4NPBA 7RNTA 1YHQ3 1JKGB 2Y74A 1DMMA 1W01A 2W56A 3FF2A 3NUVA 3SOAA 2P0XA 3CCR3 1WMPA 3D3LA 1BNIA 1EG9B 2W04A 1RGLA 5AIGA 4KFDA 1N8R4 1VQ93 3RGAA 1ZX2A 1UCKA 3HIGA 2IUKA 1IVVA 2AAEA 2HMMB 3K7CA 1WQLB 3LTDA 4HM2B 4J8TA 3QK9A 5AIIA 1N5HA 1FUSA 2A15A 2CC3A 2WOFA 3D79A 3URPA 5G2GA 3DH2A 5IG0A 5CF2A 2F86B 3BNCA 3HZPA 1RLSA 3T0UA 1BANA 3RGRA 5JPUA 3F40A 4WHAA 2UGIA 1RGEA 3NV0A 3F9SA 4OUQA 2CG0A 4WP5A 4GB5A 1CQSA 3ROBA 1Q40B 4FMBA 1Q40A 1EEJA 1FGMA 2XGLA 3MPHA 5BU4A 4FR9A 3EC9A 2GU3A 3I0YA 1O7PB 3F14A 1TU5A 2F4YA 1OCVA 1W6GA 1OHPA 4PEJA 1FGRA 1VZZA 4HYZA 2GEYA 5CLKA 3AGOA 3V92A 1LNHA 2HMNB 6GSPA 1HZ1A 1BRJA 3EE1A 2CHCA 3JVCA 3GZRA 4O2HA 2OQEC 4WWUC 1MWTA 1B27A 2OWPA 2M7OA 1BGSA 2O3OA 4XB5A 1VQQA 4I5QA 3LT9A 4L7KA 1VQK3 3CME3 2PZVA 1V74A 3QRDA 5BXQA 1O7HB 3ZFZA 2CFKA 1IU7A 4HM6B 3NBRA 1W2ZA 3NM7A 5D82A 1LRAA 3D9RA 2IMJA 3SXXA 1BSBA 3E99A 3BLZA 3EBYA 3EQQB 4RNTA 3T8NA 1GD4A 3SOYA 2CWUA 4N6UA 1BAOA 1M904 2MC8A 1Z1SA 1GMRA 2BMQB 4N6MA 4N6OB 1LQGC 1JB5A 4N6TA 1PYLA 2QEX3 3LXUX 3OWSA 5AIFA 3DGMA 3N8BA 2V1LA 1SJWA 2SBLA 1I0VA 3OV4A 2CX1A 1G02A 3CPOA 2HMLB 1RCKA 3EBTA 2INXA 1B21A 2BT3A 1U5OA 5JBSA 3F7XA 3JUOA 1ULIB 1UDII 1D6ZA 1JZDA 3NV0B 5HGRA 1ZGXA 4BTYA 1C54A 2W9PA 3RNTA 3N9HA 1UW1A 3HOHA 2P05A 1AQZA 2JDIH 1K8A4 3OX9A 3KIIA 1T2IA 4HBRA 2IUJA 4HJLB 3UL5A 5HOHA 2F98A 4MMXB 1RGKA 1V57A 2ML6A 2UUGC 4WYKA 4R4KA 3STDA 1LOYA 5M18A 1Q824 1FGTA 1WMOA 3CCE3 2MF7A 1W7CA 3F7SA 3CNXA 4FMCA 3CC23 1E97A 3WOFB 1RMSA 1S5AA 1L5GB 3JUMA 5G1LA 4KFEA 4EBGA 1DVCA 3LYGA 5LC7A 1QVF2 3GRDA 5I97A 4XBTA 1RGHA 4KFFA 2IY2A 5STDA 3H51A 1BNFA 3IPTA 1E3VA 3DY5A 3IMAB 2W0QA 3EJVA 3GZXB 5LC6A 4WYKB 1KSIA 3G713 2B1XB 2E2UA 4BTWA 1D6UA 2YFLB 4WFOA 3PZWA 2WOHA 2L4VA 3Q1CA 1VQ83 3WA2X 4CPKA 2CFLA 1BU4A 1U8CB 2W2CA 1LQMB 3N54B 1VQN3 1RNBA 2P38A 3EX9A 3S5CA 1PY3A 2W03A 1BRIA 2L1SA 1UUVB 4BU4A 5AEUB 2R4IA 1GSPA 1RTUA 4HM1B 1I0XA 3S29A 3MSOA 3UJMA 3EB8A 3MG2A 3CU3A 4I4KA 1BRGA 3UNLA 5EEOA 1T3BA 1W2B2 2W6JH 3OW22 1JRQA 3B4OA 2CK3H 3V99A 1FUWA 1C7HA 2F99A 2GBXB 2GEXA 3A76A 3D4AA 3S27A 1W02A 1BRSA 3K0ZA 2CIUA 5AIHA 4RBNA 2IYJA 5IEPA 1Q7Y4 1ZO2A 1T5YA 1YIT3 1YVSA 3LT8A 5CF1A 1TRPA 5M19A 2CWTA 1DYUA 3T8UA 1JZOA 8RNTA 1W00A 4J9AA 3JUQA 3WODG 1JB2A 3WA3A 2CX0A 2QA43 1NJI4 1RJOA 1QAFA 4X2OA 3CC73 1ROVA 4DKIA 1QAKA 2OOVA 2BMOB 2YX9A 1RDSA 3JUPA 3FG4A 2XRXB 3G16A 4EV5A 5JPPA 1FW7A 2OOVC 3X3XA 1B2MA 2KF6A 1RSNA 4HM8B 1BSDA 3F8XA 2OTJ3 4MMZB 2XEPA 2OCTA 1PU4A 2FNQA 3X41A 3CCV3 5AYRB 1ASKA
chains in the Genus database with same CATH topology
3GZYB 4K1VA 1YIJ3 4KZ1A 1Q42A 4OK0A 2B24B 3FLJA 1OHOA 3KKGA 2E2VA 4EC6A 1ISKA 1BUQA 3CCL3 1J2BA 1UI8A 2Z76A 3HK4A 4X2HA 5IG0A 1IQ8A 2KCDA 3DZLA 1YJ93 1STFI 1DMQA 2BNGA 1VQ53 1EKMA 1PFPA 3CD63 3KFQC 4LSOA 4AKZA 3X3ZA 4HM3B 1OACA 5KP1A 2XR8B 3GZBA 5KP4A 1M1K4 1GD3A 4XDWA 2P0MA 1US1A 1N9EA 4JRFA 1LXEA 3I553 1A2KA 1O7WB 3KN4A 3DUKA 3WMDA 1W6CA 1VQ63 1SPUA 3FZWA 1JV2B 3CNMA 3HIIA 3OWYA 1UUWB 3SX1A 1G96A 1QALA 3CCS3 1NB3I 1STDA 1FGQA 4FCMA 4N3VA 2HMJB 2K0MA 3BNEA 1M1XB 2XFSA 4MJDA 1QMAA 2BHMA 1O7NB 3OWUA 4HM5B 1K9M4 1KC84 1WTHA 3B4PA 4FCZA 1JJ22 2XH9A 1AVLA 1E3RA 3DGNA 4LGQA 1JKGA 1YVBI 3LMLA 3PCSA 1TFOA 4R9LA 3ER7A 5IG3A 3J7Yd 1SIHA 1AVKA 2K54A 1LOXA 4RNZA 4XBXA 1QJGA 2PNCA 1VQ73 4EXRA 4HZ9B 1IVXA 4AEQA 1OH0A 3EN1B 2LQVA 4BTXA 3LTAA 3MKIA 4K90B 2HMKB 3G0KA 3DGLA 3O8YA 1OGXA 1A90A 3PGBA 1N5PA 2C10A 3FH1A 4G1MB 5EQLA 4Q53A 3UB1A 3FF0A 3CXC2 2D42A 5D81A 1W6YA 3SLUA 2OQEA 4R9KA 4CDLA 4L8PA 3K63A 3HX8A 4HVNA 3CCU3 1OF5B 3CPW2 1OHSA 1FA3A 1O7MB 3CCM3 2IA7A 3S28A 4RNYA 3WOEB 4FMDA 5KP3A 3FGYA 1VQP3 3CC43 5ELUA 2BMRB 5AI1A 4LMIA 4HM0B 1K41A 1WNHA 7STDA 3SVAA 3EHCA 5FW5A 1DVDA 3OXAA 5IG5A 1IV9A 1AV4A 3Q2PA 2XF3A 1GYBA 4R1KA 2W9QA 4IT7A 4U13A 3I563 3IJEB 1VQL3 5CK6A 1CEWI 5DREA 1IQXA 1N8QA 3LH4A 5A0OB 4XDVA 2XFTA 3G4S3 1OUNA 2RCDA 2RGQA 1MNLA 4LEHA 1EA2A 1Q864 1NU3A 4H3UA 4OVMA 4IIAA 5AYSC 2GBWB 4LZIA 1OPYA 1YI23 3K5TA 1KQS2 3L0RA 3MWZA 5IG4A 3ALAA 4TX4A 3DM8A 2QGUA 1TIJA 4O02B 2YFJB 4NREA 2CW9A 1CYVA 2ML5A 1RRHA 2E2TA 1IK3A 3ECFA 1IVUA 3X3YA 3PS8A 3H3HA 1F8NA 1S723 3LZAA 5TGNA 1Y4KA 4O3VA 1IDPA 3U97A 2XGNA 1R4CA 2BO9B 1W5ZA 2O9UX 3HI7A 1KWIA 4IPBA 2YFIB 5IENA 1IVWA 2Y73A 5BVBA 2ZDJA 3CCJ3 2STDA 3LOYA 3KZTA 3NQYA 4HM4B 2HMOB 1HKXA 3G8ZA 1VQ43 1TFKA 4N6NB 5IERA 3DMCA 2KXGA 5AEWB 1EQKA 1LVNA 1YGEA 3AMOB 1YJW3 1UI7A 4FMAA 4MEIA 1RRLA 3PXMA 4NHFA 2JQ5A 2XSHB 1TUHA 2D1WA 4ZM8A 4KVHA 1YJN3 2WGQA 3KE7A 1IV7A 3NBJA 1NWWA 1RN7A 3NX0A 1W4NA 3SEDA 3VF1A 4GL6A 1IT7A 2UX0A 3U1WA 1Q814 3JUNA 1DMNA 5EVHA 4XBYA 4JF8A 3PCRA 4R80A 2CFDA 2Z77A 1NO3A 1K28A 2CWVA 2XSOB 3NBBA 1GY5A 5IEOA 1ROAA 2W56B 3FG1A 3DXOA 1FGOA 3B8LA 3MG3A 3LTBA 3KSED 3Q90A 4EYCA 1MOLA 1JB4A 2GU1A 2ZL8A 2RSXA 3DGOA 1RKYA 2OTL3 2GXFA 3WDGB 1JNQA 3EN8A 3GAXA 5ELJA 2C11A 4XM4A 4L8OA 1JN5A 3K9MC 4N6V0 5CXOA 1A2VA 1D6YA 2FGTA 2KRTA 2WO0A 3FCSB 4K61A 3CMA3 4FCJA 3NM2A 4N6LA 3MYTA 3VGNA 2P09A 1NDOB 3EF8A 1OGZA 3V98A 2CFGA 3VSYA 2CH9A 4H61A 5D83A 1NB5I 4HKVB 1TP6A 1JN5B 4HZBB 1QVG2 5IF6A 8CHOA 4RZMA 2Q07A 2FXTA 5FGOA 3F8HA 1IT8A 4CCVA 1GY6A 3BNDA 6STDA 3UL6A 1K734 3TDGA 1N9JA 1CYUA 2I9WA 4HM7B 1IQYA 3MHEA 3NXJA 3KSPA 3LTCA 3BNBA 4ORLA 1WMNA 1AR0A 3M8CA 4EV2A 3G6E3 2CFWA 2RFRA 1OF5A 1KD14 3NHXA 3GWRA 3FSDA 3RDEA 3X42A 2WGOA 3MG1A 1O7GB 2Z6BA 1SIIA 3S67A 1A67A 1HU9A 4O8SA 3X40A 3NQZA 1VQO3 2CKFB 2QIYA 2CG1A 5IW9A 3PYJA 2LYXA 1VQM3 1GS3A 1GY7A 4MMYB 4STDA 1M9GA 1SQWA 3AMOA 1ULJB 4K1UA 3CCQ3 5DRVA 2Z7AA 3BB9A 3FKAA 4QWTA 3B7CA 3FG3A 1YHQ3 1JKGB 2Y74A 1DMMA 1W01A 2W56A 3FF2A 3NUVA 3SOAA 2P0XA 3CCR3 1WMPA 3D3LA 1EG9B 2W04A 5AIGA 4KFDA 1N8R4 1VQ93 3RGAA 1ZX2A 3HIGA 2IUKA 1IVVA 2HMMB 3K7CA 3LTDA 1WQLB 4HM2B 4J8TA 5AIIA 3QK9A 1N5HA 2A15A 2CC3A 2WOFA 5G2GA 5CF2A 2F86B 3BNCA 3HZPA 3T0UA 3RGRA 5JPUA 3F40A 4WHAA 3NV0A 3F9SA 4OUQA 2CG0A 4WP5A 4GB5A 1CQSA 3ROBA 1Q40B 4FMBA 1Q40A 1FGMA 2XGLA 3MPHA 4FR9A 3EC9A 2GU3A 3I0YA 1O7PB 3F14A 1TU5A 1OCVA 1W6GA 1OHPA 4PEJA 1FGRA 1VZZA 4HYZA 2GEYA 5CLKA 3V92A 1LNHA 2HMNB 3EE1A 2CHCA 3JVCA 3GZRA 4O2HA 2OQEC 4WWUC 2OWPA 2M7OA 2O3OA 4XB5A 1VQK3 4L7KA 3LT9A 3CME3 2PZVA 1V74A 3QRDA 5BXQA 1O7HB 2CFKA 1IU7A 4HM6B 3NBRA 1W2ZA 3NM7A 5D82A 3D9RA 2IMJA 3SXXA 3E99A 3BLZA 3EBYA 3EQQB 3T8NA 1GD4A 3SOYA 2CWUA 4N6UA 1M904 2MC8A 1Z1SA 2BMQB 4N6MA 4N6OB 4N6TA 1JB5A 2QEX3 3LXUX 3OWSA 5AIFA 3DGMA 3N8BA 2V1LA 1SJWA 2SBLA 3OV4A 3CPOA 2HMLB 3EBTA 2INXA 2BT3A 1U5OA 5JBSA 3F7XA 3JUOA 1ULIB 1D6ZA 3NV0B 5HGRA 4BTYA 2W9PA 3N9HA 1UW1A 2P05A 2JDIH 1K8A4 3OX9A 3KIIA 4HBRA 2IUJA 4HJLB 3UL5A 2F98A 4MMXB 2ML6A 4WYKA 4R4KA 3STDA 1Q824 1FGTA 1WMOA 3CCE3 2MF7A 1W7CA 3F7SA 3CNXA 4FMCA 3CC23 1E97A 3WOFB 1S5AA 1L5GB 3JUMA 4EBGA 4KFEA 1QVF2 1DVCA 3LYGA 5LC7A 3GRDA 5I97A 4XBTA 4KFFA 5STDA 3H51A 3IPTA 1E3VA 3DY5A 3IMAB 2W0QA 3EJVA 3GZXB 5LC6A 4WYKB 1KSIA 3G713 2B1XB 2E2UA 4BTWA 1D6UA 2YFLB 4WFOA 3PZWA 2WOHA 2L4VA 3Q1CA 1VQ83 3WA2X 2CFLA 1U8CB 2W2CA 3N54B 1VQN3 2P38A 3EX9A 3S5CA 2W03A 1UUVB 5AEUB 2R4IA 4HM1B 3S29A 3MSOA 3UJMA 3EB8A 3MG2A 3CU3A 4I4KA 3UNLA 5EEOA 1W2B2 2W6JH 3OW22 1JRQA 3B4OA 2CK3H 3V99A 1FUWA 1C7HA 2F99A 2GBXB 2GEXA 3A76A 3S27A 4AKYA 1W02A 3K0ZA 5AIHA 2CIUA 4RBNA 5IEPA 1Q7Y4 1ZO2A 1T5YA 1YIT3 5CF1A 3LT8A 2CWTA 1DYUA 3T8UA 3WA3A 1W00A 4J9AA 3JUQA 3WODG 1JB2A 2QA43 1NJI4 1RJOA 1QAFA 4X2OA 3CC73 1ROVA 1QAKA 2OOVA 2BMOB 2YX9A 3JUPA 3FG4A 2XRXB 3G16A 4EV5A 5JPPA 2OOVC 3X3XA 4HM8B 3F8XA 2OTJ3 4MMZB 2XEPA 2OCTA 1PU4A 2FNQA 3X41A 3CCV3 5AYRB 1ASKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH4 A;  3S67 A;  5A0O B;  1A67 A;  3KSE D;  4EYC A;  1MOL A;  1FA3 A;  4ZM8 A;  3IMA B;  5LC6 A;  1R4C A;  2BO9 B;  2O9U X;  1MNL A;  1KWI A;  4CCV A;  1FUW A;  3UL6 A;  3PYJ A;  3GAX A;  2W9P A;  1STF I;  5ELJ A;  1IV7 A;  1GD4 A;  1N9J A;  1CEW I;  1CYU A;  1RN7 A;  1G96 A;  3NX0 A;  4N6U A;  3K9M C;  4N6V 0;  1NB3 I;  1PFP A;  4LZI A;  5ELU A;  3UL5 A;  3KFQ C;  1A90 A;  1M9G A;  1WNH A;  4N6M A;  1N5P A;  4N6O B;  4N6T A;  1N5H A;  3SVA A;  3L0R A;  3MWZ A;  5EQL A;  4TX4 A;  1DVD A;  1TIJ A;  1GD3 A;  4N6L A;  1IV9 A;  1CYV A;  3Q2P A;  4N6N B;  2KXG A;  1LXE A;  2W9Q A;  4IT7 A;  1EQK A;  2CH9 A;  2OCT A;  3PS8 A;  1NB5 I;  3QRD A;  1DVC A;  5LC7 A;  1YVB I;  1ROA A;  3PXM A; 
#chains in the Genus database with same CATH topology
 3GZY B;  4K1V A;  1YIJ 3;  4KZ1 A;  1Q42 A;  4OK0 A;  2B24 B;  3FLJ A;  1OHO A;  3KKG A;  2E2V A;  4EC6 A;  1ISK A;  1BUQ A;  3CCL 3;  1J2B A;  1UI8 A;  2Z76 A;  1MGW A;  1TTO A;  1X1U A;  3HK4 A;  1IQ8 A;  2KCD A;  3DZL A;  4X2H A;  1STF I;  2ZHX B;  1YJ9 3;  1DMQ A;  2BNG A;  1VQ5 3;  1EKM A;  1PFP A;  3CD6 3;  3KFQ C;  4LSO A;  4AKZ A;  3X3Z A;  4HM3 B;  1X1W A;  1GMQ A;  1UGH I;  1OAC A;  5KP1 A;  1RGG A;  2XR8 B;  1V58 A;  3GZB A;  1X1Y A;  5KP4 A;  1M1K 4;  1GD3 A;  4XDW A;  2P0M A;  1US1 A;  2GSP A;  1N9E A;  4JRF A;  1LXE A;  4KT3 B;  3I55 3;  1UCI A;  1JBT A;  1RHL A;  1GOV A;  1A2K A;  1O7W B;  3KN4 A;  3DUK A;  3WMD A;  2F5M A;  1W6C A;  3Q3F A;  3ZG5 A;  1SPU A;  1VQ6 3;  3FZW A;  1Q7H A;  1I2F A;  1JV2 B;  3CNM A;  3HII A;  3OWY A;  1UUG B;  4HOH A;  1UUW B;  3SX1 A;  1G96 A;  1QAL A;  3CCS 3;  1NB3 I;  1STD A;  1FGQ A;  4FCM A;  6RNT A;  4N3V A;  1MWR A;  2HMJ B;  2K0M A;  3BNE A;  4J5G A;  1M1X B;  2XFS A;  4MJD A;  1QMA A;  2BHM A;  1O7N B;  3BU4 A;  3OWU A;  4HM5 B;  1K9M 4;  1KC8 4;  1WTH A;  3B4P A;  4FCZ A;  1JJ2 2;  4GSP A;  2XH9 A;  5G1K A;  1AVL A;  1BNE A;  1E3R A;  3DGN A;  1RGF A;  3AGN A;  4LGQ A;  1JKG A;  1YVB I;  3LML A;  3PCS A;  1TFO A;  9RNT A;  4R9L A;  1I2E A;  3ER7 A;  1B20 A;  5IG3 A;  3J7Y d;  1SIH A;  1AVK A;  2K54 A;  1LOX A;  4RNZ A;  4XBX A;  1B3S A;  1QJG A;  2PNC A;  1VQ7 3;  4EXR A;  2K3D A;  4HZ9 B;  2RBI A;  1IVX A;  4AEQ A;  1BRN L;  1OH0 A;  3EN1 B;  1I2G A;  2LQV A;  4BTX A;  3LTA A;  3MKI A;  4K90 B;  1I8V A;  1LOW A;  2HMK B;  3DGL A;  1OGX A;  2F5W A;  3G0K A;  1N5P A;  2C10 A;  3O8Y A;  3PGB A;  1ZS7 A;  3FH1 A;  4G1M B;  5EQL A;  1GOY A;  4Q53 A;  3GSP A;  3UB1 A;  3FF0 A;  1BSA A;  3CXC 2;  2D42 A;  2KF4 A;  1BNR A;  5D81 A;  1RGA A;  1W6Y A;  2J8X B;  3SLU A;  2OQE A;  4R9K A;  1RGC A;  4CDL A;  2HOH A;  4L8P A;  1CH0 A;  3K63 A;  3HX8 A;  4HVN A;  2RNT A;  3CCU 3;  1OF5 B;  3CPW 2;  1OHS A;  1FA3 A;  1O7M B;  3CCM 3;  1DET A;  2IA7 A;  3S28 A;  4RNY A;  2AAD A;  5M1A A;  3WOE B;  1B2Z A;  4FMD A;  5KP3 A;  3FGY A;  1VQP 3;  3CC4 3;  5ELU A;  2BMR B;  5AI1 A;  4LMI A;  4HM0 B;  1K41 A;  1WNH A;  7STD A;  3SVA A;  3EHC A;  5FW5 A;  1DVD A;  1TJD A;  3OXA A;  5IG5 A;  1IV9 A;  1AV4 A;  3Q2P A;  2XF3 A;  1RCL A;  1GYB A;  1YNV X;  2W9Q A;  4IT7 A;  4R1K A;  4U13 A;  3I56 3;  3IJE B;  1BVI A;  1VQL 3;  5CK6 A;  1CEW I;  5DRE A;  1IQX A;  1N8Q A;  3LH4 A;  1B2U A;  1GOU A;  5A0O B;  4XDV A;  2XFT A;  3G4S 3;  1I3F A;  1OUN A;  7GSP A;  2RCD A;  3WHO A;  1BSC A;  4AKY A;  1A2P A;  2RGQ A;  1MNL A;  4LEH A;  3D5G A;  1EA2 A;  1Q86 4;  1NU3 A;  3A5E A;  4H3U A;  4OVM A;  4IIA A;  5AYS C;  2GBW B;  4LZI A;  1OPY A;  1YI2 3;  1T2H A;  5GSP A;  1RN1 A;  3K5T A;  1KQS 2;  3L0R A;  1Q9E A;  3MWZ A;  4BL2 A;  5IG4 A;  3ALA A;  4TX4 A;  3DM8 A;  2QGU A;  1TIJ A;  4O02 B;  2YFJ B;  4NRE A;  2CW9 A;  1CYV A;  2ML5 A;  1RRH A;  2E2T A;  3ZG0 A;  1IK3 A;  3ECF A;  1IVU A;  3X3Y A;  3PS8 A;  3H3H A;  1F8N A;  1S72 3;  4GHO A;  4CJN A;  1MWU A;  5RNT A;  3LZA A;  5TGN A;  1EUI C;  1Y4K A;  4O3V A;  1IDP A;  3U97 A;  2XGN A;  2R41 A;  2H0I A;  1AY7 A;  1R4C A;  1W5Z A;  2BO9 B;  2O9U X;  1KWI A;  3HI7 A;  4IPB A;  2YFI B;  3AHW A;  1BRK A;  1GMP A;  5IEN A;  1IVW A;  2Y73 A;  1JBS A;  5BVB A;  2ZDJ A;  3CCJ 3;  2STD A;  3LOY A;  1HYF A;  2BU4 A;  2F56 A;  3KZT A;  3NQY A;  4HM4 B;  2HMO B;  1HKX A;  3G8Z A;  1VQ4 3;  1TFK A;  4N6N B;  5IER A;  3DMC A;  2KXG A;  5AEW B;  1EQK A;  1YGE A;  1LVN A;  3AMO B;  1RN4 A;  1YJW 3;  1UI7 A;  4FMA A;  3D5I A;  4MEI A;  1RRL A;  3PXM A;  4NHF A;  2JQ5 A;  2XSH B;  1TUH A;  2D1W A;  4ZM8 A;  1BNS A;  4KVH A;  1YJN 3;  1BIR A;  3WR2 A;  2WGQ A;  3KE7 A;  1IV7 A;  3NBJ A;  4HAA A;  1NWW A;  3KCH A;  1RN7 A;  3NX0 A;  3BIR A;  1W4N A;  3SED A;  3VF1 A;  1BSE A;  4GL6 A;  1B2X A;  1IT7 A;  1SAR A;  2UX0 A;  1UCL A;  3U1W A;  3JUN A;  1Q81 4;  1DMN A;  5EVH A;  4XBY A;  4JF8 A;  3PCR A;  1I3I A;  2CFD A;  4R80 A;  1I70 A;  1NO3 A;  2KF3 A;  2Z77 A;  1K28 A;  2CWV A;  3AHS A;  2H0H A;  2XSO B;  3NBB A;  4LYL B;  1GY5 A;  5IEO A;  1B2S A;  1UCJ A;  1TRQ A;  1UGI A;  1A90 A;  1ROA A;  2W56 B;  3FG1 A;  1BOX A;  1BRH A;  1FGO A;  3B8L A;  3DXO A;  3LTB A;  3MG3 A;  3KSE D;  3Q90 A;  4ILF A;  1MOL A;  1JB4 A;  2GU1 A;  2ZL8 A;  2RSX A;  3DGO A;  4EYC A;  1FYS A;  2GXF A;  2ZA4 A;  3SYU A;  3WDG B;  1RKY A;  2OTL 3;  1JNQ A;  3EN8 A;  3GAX A;  5ELJ A;  2C11 A;  4XM4 A;  4L8O A;  1JN5 A;  3K9M C;  4N6V 0;  5CXO A;  1A2V A;  1D6Y A;  2FGT A;  2KRT A;  2WO0 A;  3FCS B;  4K61 A;  3CMA 3;  4FCJ A;  1DE3 A;  1JBR A;  1YGW A;  1LNI A;  3NM2 A;  4N6L A;  2KF5 A;  3MYT A;  3VGN A;  2P09 A;  1NDO B;  3EF8 A;  1OGZ A;  3V98 A;  4J5K A;  2CFG A;  3VSY A;  2CH9 A;  4H61 A;  5D83 A;  1NB5 I;  4HKV B;  2SAR A;  1TP6 A;  1JN5 B;  4HZB B;  1QVG 2;  5IF6 A;  5BIR A;  4RZM A;  8CHO A;  2Q07 A;  1IYY A;  2FXT A;  5FGO A;  3F8H A;  1IT8 A;  4CCV A;  1GY6 A;  3BND A;  6STD A;  3UL6 A;  1K73 4;  1LOV A;  3TDG A;  1N9J A;  1CYU A;  2I9W A;  4HM7 B;  1IQY A;  3MHE A;  3NXJ A;  4BIR A;  3KSP A;  2BIR A;  3LTC A;  1MGR A;  3BNB A;  4ORL A;  1WMN A;  1AR0 A;  3M8C A;  4EV2 A;  3G6E 3;  2CFW A;  2RFR A;  1OF5 A;  1KD1 4;  3NHX A;  3GWR A;  1X1X A;  3FSD A;  3RDE A;  3X42 A;  2WGO A;  3MG1 A;  1O7G B;  1NNV A;  2H0G A;  2Z6B A;  1RNT A;  1SII A;  3S67 A;  1A67 A;  1HU9 A;  4O8S A;  3X40 A;  3NQZ A;  1VQO 3;  1G0T A;  2CKF B;  4BL3 A;  2QIY A;  2CG1 A;  5IW9 A;  2KAA A;  1BUJ A;  3PYJ A;  2LYX A;  1VQM 3;  1R4Y A;  1GS3 A;  1GY7 A;  1BNG A;  1MWS A;  4MMY B;  2C4B A;  4STD A;  1M9G A;  4EW5 A;  1SQW A;  1BNJ A;  3AMO A;  3DGY A;  1ULJ B;  4K1U A;  3CCQ 3;  5DRV A;  1FUT A;  2Z7A A;  3BB9 A;  3FKA A;  4QWT A;  1FZU A;  3B7C A;  3FG3 A;  4NPB A;  7RNT A;  1YHQ 3;  1JKG B;  2Y74 A;  1DMM A;  1W01 A;  2W56 A;  3FF2 A;  3NUV A;  3SOA A;  2P0X A;  3CCR 3;  1WMP A;  3D3L A;  1BNI A;  1EG9 B;  2W04 A;  1RGL A;  5AIG A;  4KFD A;  1N8R 4;  1VQ9 3;  3RGA A;  1ZX2 A;  1UCK A;  3HIG A;  2IUK A;  1IVV A;  2AAE A;  2HMM B;  3K7C A;  1WQL B;  3LTD A;  4HM2 B;  4J8T A;  3QK9 A;  5AII A;  1N5H A;  1FUS A;  2A15 A;  2CC3 A;  2WOF A;  3D79 A;  3URP A;  5G2G A;  3DH2 A;  5IG0 A;  5CF2 A;  2F86 B;  3BNC A;  3HZP A;  1RLS A;  3T0U A;  1BAN A;  3RGR A;  5JPU A;  3F40 A;  4WHA A;  2UGI A;  1RGE A;  3NV0 A;  3F9S A;  4OUQ A;  2CG0 A;  4WP5 A;  4GB5 A;  1CQS A;  3ROB A;  1Q40 B;  4FMB A;  1Q40 A;  1EEJ A;  1FGM A;  2XGL A;  3MPH A;  5BU4 A;  4FR9 A;  3EC9 A;  2GU3 A;  3I0Y A;  1O7P B;  3F14 A;  1TU5 A;  2F4Y A;  1OCV A;  1W6G A;  1OHP A;  4PEJ A;  1FGR A;  1VZZ A;  4HYZ A;  2GEY A;  5CLK A;  3AGO A;  3V92 A;  1LNH A;  2HMN B;  6GSP A;  1HZ1 A;  1BRJ A;  3EE1 A;  2CHC A;  3JVC A;  3GZR A;  4O2H A;  2OQE C;  4WWU C;  1MWT A;  1B27 A;  2OWP A;  2M7O A;  1BGS A;  2O3O A;  4XB5 A;  1VQQ A;  4I5Q A;  3LT9 A;  4L7K A;  1VQK 3;  3CME 3;  2PZV A;  1V74 A;  3QRD A;  5BXQ A;  1O7H B;  3ZFZ A;  2CFK A;  1IU7 A;  4HM6 B;  3NBR A;  1W2Z A;  3NM7 A;  5D82 A;  1LRA A;  3D9R A;  2IMJ A;  3SXX A;  1BSB A;  3E99 A;  3BLZ A;  3EBY A;  3EQQ B;  4RNT A;  3T8N A;  1GD4 A;  3SOY A;  2CWU A;  4N6U A;  1BAO A;  1M90 4;  2MC8 A;  1Z1S A;  1GMR A;  2BMQ B;  4N6M A;  4N6O B;  1LQG C;  1JB5 A;  4N6T A;  1PYL A;  2QEX 3;  3LXU X;  3OWS A;  5AIF A;  3DGM A;  3N8B A;  2V1L A;  1SJW A;  2SBL A;  1I0V A;  3OV4 A;  2CX1 A;  1G02 A;  3CPO A;  2HML B;  1RCK A;  3EBT A;  2INX A;  1B21 A;  2BT3 A;  1U5O A;  5JBS A;  3F7X A;  3JUO A;  1ULI B;  1UDI I;  1D6Z A;  1JZD A;  3NV0 B;  5HGR A;  1ZGX A;  4BTY A;  1C54 A;  2W9P A;  3RNT A;  3N9H A;  1UW1 A;  3HOH A;  2P05 A;  1AQZ A;  2JDI H;  1K8A 4;  3OX9 A;  3KII A;  1T2I A;  4HBR A;  2IUJ A;  4HJL B;  3UL5 A;  5HOH A;  2F98 A;  4MMX B;  1RGK A;  1V57 A;  2ML6 A;  2UUG C;  4WYK A;  4R4K A;  3STD A;  1LOY A;  5M18 A;  1Q82 4;  1FGT A;  1WMO A;  3CCE 3;  2MF7 A;  1W7C A;  3F7S A;  3CNX A;  4FMC A;  3CC2 3;  1E97 A;  3WOF B;  1RMS A;  1S5A A;  1L5G B;  3JUM A;  5G1L A;  4KFE A;  4EBG A;  1DVC A;  3LYG A;  5LC7 A;  1QVF 2;  3GRD A;  5I97 A;  4XBT A;  1RGH A;  4KFF A;  2IY2 A;  5STD A;  3H51 A;  1BNF A;  3IPT A;  1E3V A;  3DY5 A;  3IMA B;  2W0Q A;  3EJV A;  3GZX B;  5LC6 A;  4WYK B;  1KSI A;  3G71 3;  2B1X B;  2E2U A;  4BTW A;  1D6U A;  2YFL B;  4WFO A;  3PZW A;  2WOH A;  2L4V A;  3Q1C A;  1VQ8 3;  3WA2 X;  4CPK A;  2CFL A;  1BU4 A;  1U8C B;  2W2C A;  1LQM B;  3N54 B;  1VQN 3;  1RNB A;  2P38 A;  3EX9 A;  3S5C A;  1PY3 A;  2W03 A;  1BRI A;  2L1S A;  1UUV B;  4BU4 A;  5AEU B;  2R4I A;  1GSP A;  1RTU A;  4HM1 B;  1I0X A;  3S29 A;  3MSO A;  3UJM A;  3EB8 A;  3MG2 A;  3CU3 A;  4I4K A;  1BRG A;  3UNL A;  5EEO A;  1T3B A;  1W2B 2;  2W6J H;  3OW2 2;  1JRQ A;  3B4O A;  2CK3 H;  3V99 A;  1FUW A;  1C7H A;  2F99 A;  2GBX B;  2GEX A;  3A76 A;  3D4A A;  3S27 A;  1W02 A;  1BRS A;  3K0Z A;  2CIU A;  5AIH A;  4RBN A;  2IYJ A;  5IEP A;  1Q7Y 4;  1ZO2 A;  1T5Y A;  1YIT 3;  1YVS A;  3LT8 A;  5CF1 A;  1TRP A;  5M19 A;  2CWT A;  1DYU A;  3T8U A;  1JZO A;  8RNT A;  1W00 A;  4J9A A;  3JUQ A;  3WOD G;  1JB2 A;  3WA3 A;  2CX0 A;  2QA4 3;  1NJI 4;  1RJO A;  1QAF A;  4X2O A;  3CC7 3;  1ROV A;  4DKI A;  1QAK A;  2OOV A;  2BMO B;  2YX9 A;  1RDS A;  3JUP A;  3FG4 A;  2XRX B;  3G16 A;  4EV5 A;  5JPP A;  1FW7 A;  2OOV C;  3X3X A;  1B2M A;  2KF6 A;  1RSN A;  4HM8 B;  1BSD A;  3F8X A;  2OTJ 3;  4MMZ B;  2XEP A;  2OCT A;  1PU4 A;  2FNQ A;  3X41 A;  3CCV 3;  5AYR B;  1ASK A; 
#chains in the Genus database with same CATH homology
 3GZY B;  4K1V A;  1YIJ 3;  4KZ1 A;  1Q42 A;  4OK0 A;  2B24 B;  3FLJ A;  1OHO A;  3KKG A;  2E2V A;  4EC6 A;  1ISK A;  1BUQ A;  3CCL 3;  1J2B A;  1UI8 A;  2Z76 A;  3HK4 A;  4X2H A;  5IG0 A;  1IQ8 A;  2KCD A;  3DZL A;  1YJ9 3;  1STF I;  1DMQ A;  2BNG A;  1VQ5 3;  1EKM A;  1PFP A;  3CD6 3;  3KFQ C;  4LSO A;  4AKZ A;  3X3Z A;  4HM3 B;  1OAC A;  5KP1 A;  2XR8 B;  3GZB A;  5KP4 A;  1M1K 4;  1GD3 A;  4XDW A;  2P0M A;  1US1 A;  1N9E A;  4JRF A;  1LXE A;  3I55 3;  1A2K A;  1O7W B;  3KN4 A;  3DUK A;  3WMD A;  1W6C A;  1VQ6 3;  1SPU A;  3FZW A;  1JV2 B;  3CNM A;  3HII A;  3OWY A;  1UUW B;  3SX1 A;  1G96 A;  1QAL A;  3CCS 3;  1NB3 I;  1STD A;  1FGQ A;  4FCM A;  4N3V A;  2HMJ B;  2K0M A;  3BNE A;  1M1X B;  2XFS A;  4MJD A;  1QMA A;  2BHM A;  1O7N B;  3OWU A;  4HM5 B;  1K9M 4;  1KC8 4;  1WTH A;  3B4P A;  4FCZ A;  1JJ2 2;  2XH9 A;  1AVL A;  1E3R A;  3DGN A;  4LGQ A;  1JKG A;  1YVB I;  3LML A;  3PCS A;  1TFO A;  4R9L A;  3ER7 A;  5IG3 A;  3J7Y d;  1SIH A;  1AVK A;  2K54 A;  1LOX A;  4RNZ A;  4XBX A;  1QJG A;  2PNC A;  1VQ7 3;  4EXR A;  4HZ9 B;  1IVX A;  4AEQ A;  1OH0 A;  3EN1 B;  2LQV A;  4BTX A;  3LTA A;  3MKI A;  4K90 B;  2HMK B;  3G0K A;  3DGL A;  3O8Y A;  1OGX A;  1A90 A;  3PGB A;  1N5P A;  2C10 A;  3FH1 A;  4G1M B;  5EQL A;  4Q53 A;  3UB1 A;  3FF0 A;  3CXC 2;  2D42 A;  5D81 A;  1W6Y A;  3SLU A;  2OQE A;  4R9K A;  4CDL A;  4L8P A;  3K63 A;  3HX8 A;  4HVN A;  3CCU 3;  1OF5 B;  3CPW 2;  1OHS A;  1FA3 A;  1O7M B;  3CCM 3;  2IA7 A;  3S28 A;  4RNY A;  3WOE B;  4FMD A;  5KP3 A;  3FGY A;  1VQP 3;  3CC4 3;  5ELU A;  2BMR B;  5AI1 A;  4LMI A;  4HM0 B;  1K41 A;  1WNH A;  7STD A;  3SVA A;  3EHC A;  5FW5 A;  1DVD A;  3OXA A;  5IG5 A;  1IV9 A;  1AV4 A;  3Q2P A;  2XF3 A;  1GYB A;  4R1K A;  2W9Q A;  4IT7 A;  4U13 A;  3I56 3;  3IJE B;  1VQL 3;  5CK6 A;  1CEW I;  5DRE A;  1IQX A;  1N8Q A;  3LH4 A;  5A0O B;  4XDV A;  2XFT A;  3G4S 3;  1OUN A;  2RCD A;  2RGQ A;  1MNL A;  4LEH A;  1EA2 A;  1Q86 4;  1NU3 A;  4H3U A;  4OVM A;  4IIA A;  5AYS C;  2GBW B;  4LZI A;  1OPY A;  1YI2 3;  3K5T A;  1KQS 2;  3L0R A;  3MWZ A;  5IG4 A;  3ALA A;  4TX4 A;  3DM8 A;  2QGU A;  1TIJ A;  4O02 B;  2YFJ B;  4NRE A;  2CW9 A;  1CYV A;  2ML5 A;  1RRH A;  2E2T A;  1IK3 A;  3ECF A;  1IVU A;  3X3Y A;  3PS8 A;  3H3H A;  1F8N A;  1S72 3;  3LZA A;  5TGN A;  1Y4K A;  4O3V A;  1IDP A;  3U97 A;  2XGN A;  1R4C A;  2BO9 B;  1W5Z A;  2O9U X;  3HI7 A;  1KWI A;  4IPB A;  2YFI B;  5IEN A;  1IVW A;  2Y73 A;  5BVB A;  2ZDJ A;  3CCJ 3;  2STD A;  3LOY A;  3KZT A;  3NQY A;  4HM4 B;  2HMO B;  1HKX A;  3G8Z A;  1VQ4 3;  1TFK A;  4N6N B;  5IER A;  3DMC A;  2KXG A;  5AEW B;  1EQK A;  1LVN A;  1YGE A;  3AMO B;  1YJW 3;  1UI7 A;  4FMA A;  4MEI A;  1RRL A;  3PXM A;  4NHF A;  2JQ5 A;  2XSH B;  1TUH A;  2D1W A;  4ZM8 A;  4KVH A;  1YJN 3;  2WGQ A;  3KE7 A;  1IV7 A;  3NBJ A;  1NWW A;  1RN7 A;  3NX0 A;  1W4N A;  3SED A;  3VF1 A;  4GL6 A;  1IT7 A;  2UX0 A;  3U1W A;  1Q81 4;  3JUN A;  1DMN A;  5EVH A;  4XBY A;  4JF8 A;  3PCR A;  4R80 A;  2CFD A;  2Z77 A;  1NO3 A;  1K28 A;  2CWV A;  2XSO B;  3NBB A;  1GY5 A;  5IEO A;  1ROA A;  2W56 B;  3FG1 A;  3DXO A;  1FGO A;  3B8L A;  3MG3 A;  3LTB A;  3KSE D;  3Q90 A;  4EYC A;  1MOL A;  1JB4 A;  2GU1 A;  2ZL8 A;  2RSX A;  3DGO A;  1RKY A;  2OTL 3;  2GXF A;  3WDG B;  1JNQ A;  3EN8 A;  3GAX A;  5ELJ A;  2C11 A;  4XM4 A;  4L8O A;  1JN5 A;  3K9M C;  4N6V 0;  5CXO A;  1A2V A;  1D6Y A;  2FGT A;  2KRT A;  2WO0 A;  3FCS B;  4K61 A;  3CMA 3;  4FCJ A;  3NM2 A;  4N6L A;  3MYT A;  3VGN A;  2P09 A;  1NDO B;  3EF8 A;  1OGZ A;  3V98 A;  2CFG A;  3VSY A;  2CH9 A;  4H61 A;  5D83 A;  1NB5 I;  4HKV B;  1TP6 A;  1JN5 B;  4HZB B;  1QVG 2;  5IF6 A;  8CHO A;  4RZM A;  2Q07 A;  2FXT A;  5FGO A;  3F8H A;  1IT8 A;  4CCV A;  1GY6 A;  3BND A;  6STD A;  3UL6 A;  1K73 4;  3TDG A;  1N9J A;  1CYU A;  2I9W A;  4HM7 B;  1IQY A;  3MHE A;  3NXJ A;  3KSP A;  3LTC A;  3BNB A;  4ORL A;  1WMN A;  1AR0 A;  3M8C A;  4EV2 A;  3G6E 3;  2CFW A;  2RFR A;  1OF5 A;  1KD1 4;  3NHX A;  3GWR A;  3FSD A;  3RDE A;  3X42 A;  2WGO A;  3MG1 A;  1O7G B;  2Z6B A;  1SII A;  3S67 A;  1A67 A;  1HU9 A;  4O8S A;  3X40 A;  3NQZ A;  1VQO 3;  2CKF B;  2QIY A;  2CG1 A;  5IW9 A;  3PYJ A;  2LYX A;  1VQM 3;  1GS3 A;  1GY7 A;  4MMY B;  4STD A;  1M9G A;  1SQW A;  3AMO A;  1ULJ B;  4K1U A;  3CCQ 3;  5DRV A;  2Z7A A;  3BB9 A;  3FKA A;  4QWT A;  3B7C A;  3FG3 A;  1YHQ 3;  1JKG B;  2Y74 A;  1DMM A;  1W01 A;  2W56 A;  3FF2 A;  3NUV A;  3SOA A;  2P0X A;  3CCR 3;  1WMP A;  3D3L A;  1EG9 B;  2W04 A;  5AIG A;  4KFD A;  1N8R 4;  1VQ9 3;  3RGA A;  1ZX2 A;  3HIG A;  2IUK A;  1IVV A;  2HMM B;  3K7C A;  3LTD A;  1WQL B;  4HM2 B;  4J8T A;  5AII A;  3QK9 A;  1N5H A;  2A15 A;  2CC3 A;  2WOF A;  5G2G A;  5CF2 A;  2F86 B;  3BNC A;  3HZP A;  3T0U A;  3RGR A;  5JPU A;  3F40 A;  4WHA A;  3NV0 A;  3F9S A;  4OUQ A;  2CG0 A;  4WP5 A;  4GB5 A;  1CQS A;  3ROB A;  1Q40 B;  4FMB A;  1Q40 A;  1FGM A;  2XGL A;  3MPH A;  4FR9 A;  3EC9 A;  2GU3 A;  3I0Y A;  1O7P B;  3F14 A;  1TU5 A;  1OCV A;  1W6G A;  1OHP A;  4PEJ A;  1FGR A;  1VZZ A;  4HYZ A;  2GEY A;  5CLK A;  3V92 A;  1LNH A;  2HMN B;  3EE1 A;  2CHC A;  3JVC A;  3GZR A;  4O2H A;  2OQE C;  4WWU C;  2OWP A;  2M7O A;  2O3O A;  4XB5 A;  1VQK 3;  4L7K A;  3LT9 A;  3CME 3;  2PZV A;  1V74 A;  3QRD A;  5BXQ A;  1O7H B;  2CFK A;  1IU7 A;  4HM6 B;  3NBR A;  1W2Z A;  3NM7 A;  5D82 A;  3D9R A;  2IMJ A;  3SXX A;  3E99 A;  3BLZ A;  3EBY A;  3EQQ B;  3T8N A;  1GD4 A;  3SOY A;  2CWU A;  4N6U A;  1M90 4;  2MC8 A;  1Z1S A;  2BMQ B;  4N6M A;  4N6O B;  4N6T A;  1JB5 A;  2QEX 3;  3LXU X;  3OWS A;  5AIF A;  3DGM A;  3N8B A;  2V1L A;  1SJW A;  2SBL A;  3OV4 A;  3CPO A;  2HML B;  3EBT A;  2INX A;  2BT3 A;  1U5O A;  5JBS A;  3F7X A;  3JUO A;  1ULI B;  1D6Z A;  3NV0 B;  5HGR A;  4BTY A;  2W9P A;  3N9H A;  1UW1 A;  2P05 A;  2JDI H;  1K8A 4;  3OX9 A;  3KII A;  4HBR A;  2IUJ A;  4HJL B;  3UL5 A;  2F98 A;  4MMX B;  2ML6 A;  4WYK A;  4R4K A;  3STD A;  1Q82 4;  1FGT A;  1WMO A;  3CCE 3;  2MF7 A;  1W7C A;  3F7S A;  3CNX A;  4FMC A;  3CC2 3;  1E97 A;  3WOF B;  1S5A A;  1L5G B;  3JUM A;  4EBG A;  4KFE A;  1QVF 2;  1DVC A;  3LYG A;  5LC7 A;  3GRD A;  5I97 A;  4XBT A;  4KFF A;  5STD A;  3H51 A;  3IPT A;  1E3V A;  3DY5 A;  3IMA B;  2W0Q A;  3EJV A;  3GZX B;  5LC6 A;  4WYK B;  1KSI A;  3G71 3;  2B1X B;  2E2U A;  4BTW A;  1D6U A;  2YFL B;  4WFO A;  3PZW A;  2WOH A;  2L4V A;  3Q1C A;  1VQ8 3;  3WA2 X;  2CFL A;  1U8C B;  2W2C A;  3N54 B;  1VQN 3;  2P38 A;  3EX9 A;  3S5C A;  2W03 A;  1UUV B;  5AEU B;  2R4I A;  4HM1 B;  3S29 A;  3MSO A;  3UJM A;  3EB8 A;  3MG2 A;  3CU3 A;  4I4K A;  3UNL A;  5EEO A;  1W2B 2;  2W6J H;  3OW2 2;  1JRQ A;  3B4O A;  2CK3 H;  3V99 A;  1FUW A;  1C7H A;  2F99 A;  2GBX B;  2GEX A;  3A76 A;  3S27 A;  4AKY A;  1W02 A;  3K0Z A;  5AIH A;  2CIU A;  4RBN A;  5IEP A;  1Q7Y 4;  1ZO2 A;  1T5Y A;  1YIT 3;  5CF1 A;  3LT8 A;  2CWT A;  1DYU A;  3T8U A;  3WA3 A;  1W00 A;  4J9A A;  3JUQ A;  3WOD G;  1JB2 A;  2QA4 3;  1NJI 4;  1RJO A;  1QAF A;  4X2O A;  3CC7 3;  1ROV A;  1QAK A;  2OOV A;  2BMO B;  2YX9 A;  3JUP A;  3FG4 A;  2XRX B;  3G16 A;  4EV5 A;  5JPP A;  2OOV C;  3X3X A;  4HM8 B;  3F8X A;  2OTJ 3;  4MMZ B;  2XEP A;  2OCT A;  1PU4 A;  2FNQ A;  3X41 A;  3CCV 3;  5AYR B;  1ASK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...