3UL7A

Crystal structure of the tv3 mutant f63w
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
276
structure length
276
Chain Sequence
b'PCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSWNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 91
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ul7A00
1JL5A 1FQVA 4FD0A 5GMHA 3CVRA 3ZYIA 5GMFA 2Z7XA 3W3LA 2P1NB 1OTOA 4LXSA 4M7EC 2P1QB 2OMUA 4Q3GA 4J4LA 5B0NA 4AW4A 1YRGA 1P8TA 5CMNA 1DFJI 2A0ZA 2OMXA 4RCAB 4UFRA 1M9LA 1XEUA 3KJ4A 2WQVA 4EZGA 3CIGA 1OZNA 4PEQB 5A5CA 2WQUA 3M19A 2O6QA 4WYKA 4R6JA 2O6RA 2XOTA 4QBZA 2Z66A 4BSSA 2Z81A 4PSJA 4CP6A 3ZYOA 1K5DC 2OMWA 3DZEA 4ECOA 1QYYA 1A4YA 4R6FA 3P72A 2P1OB 1K5GC 4LI2A 3W3GA 5B0TA 3C6OB 4CC4A 1PGVA 3RGXA 1OTNA 2FT3A 5AWBA 3ULVA 4BSRA 1G9UA 4FCGA 4LSAA 4LSCA 4YEBB 4LI1A 4FMZA 3GOZA 3UL7A 2BEXA 4MN8B 4NKGA 2OMYA 3OJAA 3UN9A 4KT1A 1LTXA 2OMZA 1H6TA 4AY9X 3W3NA 3RGZA 2V9SA 5IYXC 1O6VA 5LFNA 4CILA 4XOSA 5HZLB 1FO1A 3E6JA 2Z7XB 3E3ZA 3ULUA 4B8CD 1WWLA 1FS2A 4R6GA 3BZ5A 4Z8GA 5B4PA 4LSXA 5IJBA 3WPDA 2BNHA 2WQXA 4P8SA 3TSRE 3ZYNA 1W8AA 3G39A 4NKHA 4J0MA 3RW7A 5IJCA 3E2JA 5AWDA 1M9SA 3E4GA 1P9AG 4C2AB 4RCWA 4R09A 2V9TB 3UL8A 4FS7A 1KOOA 2ELLA 2RA8A 4R58A 1FT8A 5AZ5A 3O6NA 1KOHA 3W3JA 1M0ZA 4R5CA 3G3AA 3C6PB 2P1MB 4TZHA 5HDHA 3WN4A 4Y61B 1XCDA 2ID5A 2JE0A 5GS2B 2ASSB 2JE1A 3ULAA 5GQRK 1OTMA 4PERA 1SQ0B 1OGQA 4KXFB 2WQWA 4CC4C 2OMVA 3WPGA 4RWTC 2Y5QA 1H6UA 2Z65A 3RIZA 4R6AA 4Z94G 1Z7XW 2Z62A 5GS0A 2P1PB 4BV4R 3WPCA 4R0AA 1GWBA 1U0ND 4KNGA 5AWAA 4PKIG 3CIYA 3OJAB 4Q62A 3WPBA 3ZYJA 3W3KA 4R07A 4PQ8A 2UZXA 3WPHA 3RW6A 2ASTB 3OGMB 4U7LA 4ECNA 3M18A 4C2BB 4IM6A 4QC0A 4LSXC 2IFGA 4LXRA 4FDWA 4V2CA 2UZYA 3G04C 2WFHA 4ARRA 1DCEA 4ARNA 3VQ1A 3WPEA 4QXEA 4M7EA 4L3AA 4Z79A 4U08A 1P8VA 2XWTC 3RFEA 3JB9j 3W3MA 4HQ1A 5AWCA 3OGLB 2V70A 4I6JB 4G8AA 5CMPA 1IO0A 2RR6A 4V2EA 1M10B 4Z61C 2CA6A 5FTTB 2R9UA 4L3FA 2JQDA 3WPIA 4BSUA 1O6TA 3RFJA 4H09A 3RJ0A 3UL9A 3SB4A 1ZIWA 1D0BA 1OOKG 3PMHG 5D3IA 4V2DA 3C6NB 3O53A 2OMTA 3A79B 3WPFA 3G3BA 2Z82A 3G06A 2O6SA 4XGOA 1O6SA 5GMGA 1XECA 4Z64C 4K17A 4XSQA 4Q3IA 4U06A 4MQWX 4R08A 4FHOA 4P91A 4OQTA 1DS9A 4WP6A 3VQ2A 4CNCA 3REZA 1XKUA 3RFSA 2Z64A 1A9NA 4GT6A 3FXIA 5IJDA 3OGKB 2Z63A 4U09A 4R5DA 4GLPA 2Q4GW 4CNMA 1XWDC
chains in the Genus database with same CATH superfamily
1JL5A 1FQVA 4FD0A 5GMHA 3CVRA 3ZYIA 5GMFA 2Z7XA 3W3LA 2P1NB 1OTOA 4LXSA 4M7EC 2P1QB 2OMUA 4Q3GA 4J4LA 5B0NA 4AW4A 1YRGA 1P8TA 5CMNA 1DFJI 2A0ZA 2OMXA 4RCAB 4UFRA 1M9LA 1XEUA 3KJ4A 2WQVA 4EZGA 3CIGA 1OZNA 4PEQB 5A5CA 2WQUA 3M19A 2O6QA 4WYKA 4R6JA 2O6RA 2XOTA 4NZTM 4QBZA 2Z66A 4BSSA 2Z81A 4PSJA 4CP6A 3ZYOA 1K5DC 2OMWA 3DZEA 4ECOA 1QYYA 1A4YA 4R6FA 3P72A 2P1OB 1K5GC 4LI2A 3W3GA 5B0TA 3C6OB 4CC4A 1PGVA 3RGXA 1OTNA 2FT3A 5AWBA 3ULVA 4BSRA 1G9UA 4FCGA 4LSAA 4LSCA 4YEBB 4LI1A 4FMZA 3GOZA 3UL7A 2BEXA 4MN8B 4NKGA 2OMYA 3OJAA 3UN9A 4KT1A 1LTXA 2OMZA 1H6TA 4AY9X 3W3NA 3RGZA 2V9SA 5IYXC 1O6VA 5LFNA 4CILA 4XOSA 5HZLB 1FO1A 3E6JA 2Z7XB 3E3ZA 3ULUA 4B8CD 1WWLA 1FS2A 4R6GA 3BZ5A 4Z8GA 5B4PA 4LSXA 5IJBA 3WPDA 2BNHA 2WQXA 4P8SA 3TSRE 3ZYNA 1W8AA 3G39A 4NKHA 4J0MA 3RW7A 5IJCA 3E2JA 5AWDA 1M9SA 3E4GA 1P9AG 4C2AB 4RCWA 4R09A 2V9TB 3UL8A 4FS7A 1KOOA 2ELLA 2RA8A 4R58A 1FT8A 5AZ5A 3O6NA 1KOHA 3W3JA 4NZRM 1M0ZA 4R5CA 3G3AA 3C6PB 2P1MB 4TZHA 5HDHA 3WN4A 4Y61B 1XCDA 2ID5A 2JE0A 5GS2B 2ASSB 2JE1A 3ULAA 5GQRK 1OTMA 4PERA 1SQ0B 1OGQA 4KXFB 2WQWA 4CC4C 2OMVA 3WPGA 4RWTC 2Y5QA 1H6UA 2Z65A 3RIZA 4R6AA 4Z94G 1Z7XW 2Z62A 5GS0A 2P1PB 4BV4R 3WPCA 4R0AA 1GWBA 1U0ND 4KNGA 5AWAA 4PKIG 3CIYA 3OJAB 4Q62A 3WPBA 3ZYJA 3W3KA 4R07A 4PQ8A 2UZXA 3WPHA 3RW6A 2ASTB 3OGMB 4U7LA 4ECNA 3M18A 4C2BB 4IM6A 4QC0A 4LSXC 2IFGA 4LXRA 4FDWA 4V2CA 2UZYA 3G04C 2WFHA 4ARRA 1DCEA 4ARNA 3VQ1A 3WPEA 4QXEA 4M7EA 4L3AA 4Z79A 4U08A 1P8VA 2XWTC 3RFEA 3JB9j 3W3MA 4HQ1A 5AWCA 3OGLB 2V70A 4I6JB 4G8AA 5CMPA 1IO0A 2RR6A 4V2EA 1M10B 4Z61C 2CA6A 5FTTB 2R9UA 4L3FA 2JQDA 3WPIA 4BSUA 1O6TA 3RFJA 4H09A 3RJ0A 3UL9A 3SB4A 1ZIWA 1D0BA 1OOKG 3PMHG 5D3IA 4V2DA 3C6NB 3O53A 2OMTA 3A79B 3WPFA 3G3BA 2Z82A 3G06A 2O6SA 4XGOA 1O6SA 5GMGA 1XECA 4Z64C 4K17A 4XSQA 4Q3IA 4U06A 4MQWX 4R08A 4FHOA 4P91A 4OQTA 1DS9A 4WP6A 3VQ2A 4CNCA 3REZA 1XKUA 3RFSA 2Z64A 1A9NA 4GT6A 3FXIA 5IJDA 3OGKB 2Z63A 4U09A 4R5DA 4GLPA 2Q4GW 4CNMA 1XWDC
chains in the Genus database with same CATH topology
1JL5A 1FQVA 4FD0A 5GMHA 3CVRA 3ZYIA 5GMFA 2Z7XA 3W3LA 2P1NB 1OTOA 4LXSA 4M7EC 2P1QB 2OMUA 4Q3GA 4J4LA 5B0NA 4AW4A 1YRGA 1P8TA 5CMNA 1DFJI 2A0ZA 2OMXA 4RCAB 4UFRA 1M9LA 1XEUA 3KJ4A 2WQVA 4EZGA 3CIGA 1OZNA 4PEQB 5A5CA 2WQUA 3M19A 2O6QA 4WYKA 4R6JA 2O6RA 2XOTA 4QBZA 2Z66A 4BSSA 2Z81A 4PSJA 4CP6A 3ZYOA 1K5DC 2OMWA 3DZEA 4ECOA 1QYYA 1A4YA 4R6FA 3P72A 2P1OB 1K5GC 4LI2A 3W3GA 5B0TA 3C6OB 4CC4A 1PGVA 3RGXA 1OTNA 2FT3A 5AWBA 3ULVA 4BSRA 1G9UA 4FCGA 4LSAA 4LSCA 4YEBB 4LI1A 4FMZA 3GOZA 3UL7A 2BEXA 4MN8B 4NKGA 2OMYA 3OJAA 3UN9A 4KT1A 1LTXA 2OMZA 1H6TA 4AY9X 3W3NA 3RGZA 2V9SA 5IYXC 1O6VA 5LFNA 4CILA 4XOSA 5HZLB 1FO1A 3E6JA 2Z7XB 3E3ZA 3ULUA 4B8CD 1WWLA 1FS2A 4R6GA 3BZ5A 4Z8GA 5B4PA 4LSXA 5IJBA 3WPDA 2BNHA 2WQXA 4P8SA 3TSRE 3ZYNA 1W8AA 3G39A 4NKHA 4J0MA 3RW7A 5IJCA 3E2JA 5AWDA 1M9SA 3E4GA 1P9AG 4C2AB 4RCWA 4R09A 2V9TB 3UL8A 4FS7A 1KOOA 2ELLA 2RA8A 4R58A 1FT8A 5AZ5A 3O6NA 1KOHA 3W3JA 1M0ZA 4R5CA 3G3AA 3C6PB 2P1MB 4TZHA 5HDHA 3WN4A 4Y61B 1XCDA 2ID5A 2JE0A 5GS2B 2ASSB 2JE1A 3ULAA 5GQRK 1OTMA 4PERA 1SQ0B 1OGQA 4KXFB 2WQWA 4CC4C 2OMVA 3WPGA 4RWTC 2Y5QA 1H6UA 2Z65A 3RIZA 4R6AA 4Z94G 1Z7XW 2Z62A 5GS0A 2P1PB 4BV4R 3WPCA 4R0AA 1GWBA 1U0ND 4KNGA 5AWAA 4PKIG 3CIYA 3OJAB 4Q62A 3WPBA 3ZYJA 3W3KA 4R07A 4PQ8A 2UZXA 3WPHA 3RW6A 2ASTB 3OGMB 4U7LA 4ECNA 3M18A 4C2BB 4IM6A 4QC0A 4LSXC 2IFGA 4LXRA 4FDWA 4V2CA 2UZYA 3G04C 2WFHA 4ARRA 1DCEA 4ARNA 3VQ1A 3WPEA 4QXEA 4M7EA 4L3AA 4Z79A 4U08A 1P8VA 2XWTC 3RFEA 3JB9j 3W3MA 4HQ1A 5AWCA 3OGLB 2V70A 4I6JB 4G8AA 5CMPA 1IO0A 2RR6A 4V2EA 1M10B 4Z61C 2CA6A 5FTTB 2R9UA 4L3FA 2JQDA 3WPIA 4BSUA 1O6TA 3RFJA 4H09A 3RJ0A 3UL9A 3SB4A 1ZIWA 1D0BA 1OOKG 3PMHG 5D3IA 4V2DA 3C6NB 3O53A 2OMTA 3A79B 3WPFA 3G3BA 2Z82A 3G06A 2O6SA 4XGOA 1O6SA 5GMGA 1XECA 4Z64C 4K17A 4XSQA 4Q3IA 4U06A 4MQWX 4R08A 4FHOA 4P91A 4OQTA 1DS9A 4WP6A 3VQ2A 4CNCA 3REZA 1XKUA 3RFSA 2Z64A 1A9NA 4GT6A 3FXIA 5IJDA 3OGKB 2Z63A 4U09A 4R5DA 4GLPA 2Q4GW 4CNMA 1XWDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JL5 A;  1FQV A;  4FD0 A;  5GMH A;  3CVR A;  3ZYI A;  5GMF A;  2Z7X A;  3W3L A;  2P1N B;  1OTO A;  4LXS A;  4M7E C;  2P1Q B;  2OMU A;  4Q3G A;  4J4L A;  5B0N A;  4AW4 A;  1YRG A;  1P8T A;  5CMN A;  1DFJ I;  2A0Z A;  2OMX A;  4RCA B;  4UFR A;  1M9L A;  1XEU A;  3KJ4 A;  2WQV A;  4EZG A;  3CIG A;  1OZN A;  4PEQ B;  5A5C A;  2WQU A;  3M19 A;  2O6Q A;  4WYK A;  4R6J A;  2O6R A;  2XOT A;  4QBZ A;  2Z66 A;  4BSS A;  2Z81 A;  4PSJ A;  4CP6 A;  3ZYO A;  1K5D C;  2OMW A;  3DZE A;  4ECO A;  1QYY A;  1A4Y A;  4R6F A;  3P72 A;  2P1O B;  1K5G C;  4LI2 A;  3W3G A;  5B0T A;  3C6O B;  4CC4 A;  1PGV A;  3RGX A;  1OTN A;  2FT3 A;  5AWB A;  3ULV A;  4BSR A;  1G9U A;  4FCG A;  4LSA A;  4LSC A;  4YEB B;  4LI1 A;  4FMZ A;  3GOZ A;  3UL7 A;  2BEX A;  4MN8 B;  4NKG A;  2OMY A;  3OJA A;  3UN9 A;  4KT1 A;  1LTX A;  2OMZ A;  1H6T A;  4AY9 X;  3W3N A;  3RGZ A;  2V9S A;  5IYX C;  1O6V A;  5LFN A;  4CIL A;  4XOS A;  5HZL B;  1FO1 A;  3E6J A;  2Z7X B;  3E3Z A;  3ULU A;  4B8C D;  1WWL A;  1FS2 A;  4R6G A;  3BZ5 A;  4Z8G A;  5B4P A;  4LSX A;  5IJB A;  3WPD A;  2BNH A;  2WQX A;  4P8S A;  3TSR E;  3ZYN A;  1W8A A;  3G39 A;  4NKH A;  4J0M A;  3RW7 A;  5IJC A;  3E2J A;  5AWD A;  1M9S A;  3E4G A;  1P9A G;  4C2A B;  4RCW A;  4R09 A;  2V9T B;  3UL8 A;  4FS7 A;  1KOO A;  2ELL A;  2RA8 A;  4R58 A;  1FT8 A;  5AZ5 A;  3O6N A;  1KOH A;  3W3J A;  1M0Z A;  4R5C A;  3G3A A;  3C6P B;  2P1M B;  4TZH A;  5HDH A;  3WN4 A;  4Y61 B;  1XCD A;  2ID5 A;  2JE0 A;  5GS2 B;  2ASS B;  2JE1 A;  3ULA A;  5GQR K;  1OTM A;  4PER A;  1SQ0 B;  1OGQ A;  4KXF B;  2WQW A;  4CC4 C;  2OMV A;  3WPG A;  4RWT C;  2Y5Q A;  1H6U A;  2Z65 A;  3RIZ A;  4R6A A;  4Z94 G;  1Z7X W;  2Z62 A;  5GS0 A;  2P1P B;  4BV4 R;  3WPC A;  4R0A A;  1GWB A;  1U0N D;  4KNG A;  5AWA A;  4PKI G;  3CIY A;  3OJA B;  4Q62 A;  3WPB A;  3ZYJ A;  3W3K A;  4R07 A;  4PQ8 A;  2UZX A;  3WPH A;  3RW6 A;  2AST B;  3OGM B;  4U7L A;  4ECN A;  3M18 A;  4C2B B;  4IM6 A;  4QC0 A;  4LSX C;  2IFG A;  4LXR A;  4FDW A;  4V2C A;  2UZY A;  3G04 C;  2WFH A;  4ARR A;  1DCE A;  4ARN A;  3VQ1 A;  3WPE A;  4QXE A;  4M7E A;  4L3A A;  4Z79 A;  4U08 A;  1P8V A;  2XWT C;  3RFE A;  3JB9 j;  3W3M A;  4HQ1 A;  5AWC A;  3OGL B;  2V70 A;  4I6J B;  4G8A A;  5CMP A;  1IO0 A;  2RR6 A;  4V2E A;  1M10 B;  4Z61 C;  2CA6 A;  5FTT B;  2R9U A;  4L3F A;  2JQD A;  3WPI A;  4BSU A;  1O6T A;  3RFJ A;  4H09 A;  3RJ0 A;  3UL9 A;  3SB4 A;  1ZIW A;  1D0B A;  1OOK G;  3PMH G;  5D3I A;  4V2D A;  3C6N B;  3O53 A;  2OMT A;  3A79 B;  3WPF A;  3G3B A;  2Z82 A;  3G06 A;  2O6S A;  4XGO A;  1O6S A;  5GMG A;  1XEC A;  4Z64 C;  4K17 A;  4XSQ A;  4Q3I A;  4U06 A;  4MQW X;  4R08 A;  4FHO A;  4P91 A;  4OQT A;  1DS9 A;  4WP6 A;  3VQ2 A;  4CNC A;  3REZ A;  1XKU A;  3RFS A;  2Z64 A;  1A9N A;  4GT6 A;  3FXI A;  5IJD A;  3OGK B;  2Z63 A;  4U09 A;  4R5D A;  4GLP A;  2Q4G W;  4CNM A;  1XWD C; 
#chains in the Genus database with same CATH topology
 1JL5 A;  1FQV A;  4FD0 A;  5GMH A;  3CVR A;  3ZYI A;  5GMF A;  2Z7X A;  3W3L A;  2P1N B;  1OTO A;  4LXS A;  4M7E C;  2P1Q B;  2OMU A;  4Q3G A;  4J4L A;  5B0N A;  4AW4 A;  1YRG A;  1P8T A;  5CMN A;  1DFJ I;  2A0Z A;  2OMX A;  4RCA B;  4UFR A;  1M9L A;  1XEU A;  3KJ4 A;  2WQV A;  4EZG A;  3CIG A;  1OZN A;  4PEQ B;  5A5C A;  2WQU A;  3M19 A;  2O6Q A;  4WYK A;  4R6J A;  2O6R A;  2XOT A;  4NZT M;  4QBZ A;  2Z66 A;  4BSS A;  2Z81 A;  4PSJ A;  4CP6 A;  3ZYO A;  1K5D C;  2OMW A;  3DZE A;  4ECO A;  1QYY A;  1A4Y A;  4R6F A;  3P72 A;  2P1O B;  1K5G C;  4LI2 A;  3W3G A;  5B0T A;  3C6O B;  4CC4 A;  1PGV A;  3RGX A;  1OTN A;  2FT3 A;  5AWB A;  3ULV A;  4BSR A;  1G9U A;  4FCG A;  4LSA A;  4LSC A;  4YEB B;  4LI1 A;  4FMZ A;  3GOZ A;  3UL7 A;  2BEX A;  4MN8 B;  4NKG A;  2OMY A;  3OJA A;  3UN9 A;  4KT1 A;  1LTX A;  2OMZ A;  1H6T A;  4AY9 X;  3W3N A;  3RGZ A;  2V9S A;  5IYX C;  1O6V A;  5LFN A;  4CIL A;  4XOS A;  5HZL B;  1FO1 A;  3E6J A;  2Z7X B;  3E3Z A;  3ULU A;  4B8C D;  1WWL A;  1FS2 A;  4R6G A;  3BZ5 A;  4Z8G A;  5B4P A;  4LSX A;  5IJB A;  3WPD A;  2BNH A;  2WQX A;  4P8S A;  3TSR E;  3ZYN A;  1W8A A;  3G39 A;  4NKH A;  4J0M A;  3RW7 A;  5IJC A;  3E2J A;  5AWD A;  1M9S A;  3E4G A;  1P9A G;  4C2A B;  4RCW A;  4R09 A;  2V9T B;  3UL8 A;  4FS7 A;  1KOO A;  2ELL A;  2RA8 A;  4R58 A;  1FT8 A;  5AZ5 A;  3O6N A;  1KOH A;  3W3J A;  4NZR M;  1M0Z A;  4R5C A;  3G3A A;  3C6P B;  2P1M B;  4TZH A;  5HDH A;  3WN4 A;  4Y61 B;  1XCD A;  2ID5 A;  2JE0 A;  5GS2 B;  2ASS B;  2JE1 A;  3ULA A;  5GQR K;  1OTM A;  4PER A;  1SQ0 B;  1OGQ A;  4KXF B;  2WQW A;  4CC4 C;  2OMV A;  3WPG A;  4RWT C;  2Y5Q A;  1H6U A;  2Z65 A;  3RIZ A;  4R6A A;  4Z94 G;  1Z7X W;  2Z62 A;  5GS0 A;  2P1P B;  4BV4 R;  3WPC A;  4R0A A;  1GWB A;  1U0N D;  4KNG A;  5AWA A;  4PKI G;  3CIY A;  3OJA B;  4Q62 A;  3WPB A;  3ZYJ A;  3W3K A;  4R07 A;  4PQ8 A;  2UZX A;  3WPH A;  3RW6 A;  2AST B;  3OGM B;  4U7L A;  4ECN A;  3M18 A;  4C2B B;  4IM6 A;  4QC0 A;  4LSX C;  2IFG A;  4LXR A;  4FDW A;  4V2C A;  2UZY A;  3G04 C;  2WFH A;  4ARR A;  1DCE A;  4ARN A;  3VQ1 A;  3WPE A;  4QXE A;  4M7E A;  4L3A A;  4Z79 A;  4U08 A;  1P8V A;  2XWT C;  3RFE A;  3JB9 j;  3W3M A;  4HQ1 A;  5AWC A;  3OGL B;  2V70 A;  4I6J B;  4G8A A;  5CMP A;  1IO0 A;  2RR6 A;  4V2E A;  1M10 B;  4Z61 C;  2CA6 A;  5FTT B;  2R9U A;  4L3F A;  2JQD A;  3WPI A;  4BSU A;  1O6T A;  3RFJ A;  4H09 A;  3RJ0 A;  3UL9 A;  3SB4 A;  1ZIW A;  1D0B A;  1OOK G;  3PMH G;  5D3I A;  4V2D A;  3C6N B;  3O53 A;  2OMT A;  3A79 B;  3WPF A;  3G3B A;  2Z82 A;  3G06 A;  2O6S A;  4XGO A;  1O6S A;  5GMG A;  1XEC A;  4Z64 C;  4K17 A;  4XSQ A;  4Q3I A;  4U06 A;  4MQW X;  4R08 A;  4FHO A;  4P91 A;  4OQT A;  1DS9 A;  4WP6 A;  3VQ2 A;  4CNC A;  3REZ A;  1XKU A;  3RFS A;  2Z64 A;  1A9N A;  4GT6 A;  3FXI A;  5IJD A;  3OGK B;  2Z63 A;  4U09 A;  4R5D A;  4GLP A;  2Q4G W;  4CNM A;  1XWD C; 
#chains in the Genus database with same CATH homology
 1JL5 A;  1FQV A;  4FD0 A;  5GMH A;  3CVR A;  3ZYI A;  5GMF A;  2Z7X A;  3W3L A;  2P1N B;  1OTO A;  4LXS A;  4M7E C;  2P1Q B;  2OMU A;  4Q3G A;  4J4L A;  5B0N A;  4AW4 A;  1YRG A;  1P8T A;  5CMN A;  1DFJ I;  2A0Z A;  2OMX A;  4RCA B;  4UFR A;  1M9L A;  1XEU A;  3KJ4 A;  2WQV A;  4EZG A;  3CIG A;  1OZN A;  4PEQ B;  5A5C A;  2WQU A;  3M19 A;  2O6Q A;  4WYK A;  4R6J A;  2O6R A;  2XOT A;  4QBZ A;  2Z66 A;  4BSS A;  2Z81 A;  4PSJ A;  4CP6 A;  3ZYO A;  1K5D C;  2OMW A;  3DZE A;  4ECO A;  1QYY A;  1A4Y A;  4R6F A;  3P72 A;  2P1O B;  1K5G C;  4LI2 A;  3W3G A;  5B0T A;  3C6O B;  4CC4 A;  1PGV A;  3RGX A;  1OTN A;  2FT3 A;  5AWB A;  3ULV A;  4BSR A;  1G9U A;  4FCG A;  4LSA A;  4LSC A;  4YEB B;  4LI1 A;  4FMZ A;  3GOZ A;  3UL7 A;  2BEX A;  4MN8 B;  4NKG A;  2OMY A;  3OJA A;  3UN9 A;  4KT1 A;  1LTX A;  2OMZ A;  1H6T A;  4AY9 X;  3W3N A;  3RGZ A;  2V9S A;  5IYX C;  1O6V A;  5LFN A;  4CIL A;  4XOS A;  5HZL B;  1FO1 A;  3E6J A;  2Z7X B;  3E3Z A;  3ULU A;  4B8C D;  1WWL A;  1FS2 A;  4R6G A;  3BZ5 A;  4Z8G A;  5B4P A;  4LSX A;  5IJB A;  3WPD A;  2BNH A;  2WQX A;  4P8S A;  3TSR E;  3ZYN A;  1W8A A;  3G39 A;  4NKH A;  4J0M A;  3RW7 A;  5IJC A;  3E2J A;  5AWD A;  1M9S A;  3E4G A;  1P9A G;  4C2A B;  4RCW A;  4R09 A;  2V9T B;  3UL8 A;  4FS7 A;  1KOO A;  2ELL A;  2RA8 A;  4R58 A;  1FT8 A;  5AZ5 A;  3O6N A;  1KOH A;  3W3J A;  1M0Z A;  4R5C A;  3G3A A;  3C6P B;  2P1M B;  4TZH A;  5HDH A;  3WN4 A;  4Y61 B;  1XCD A;  2ID5 A;  2JE0 A;  5GS2 B;  2ASS B;  2JE1 A;  3ULA A;  5GQR K;  1OTM A;  4PER A;  1SQ0 B;  1OGQ A;  4KXF B;  2WQW A;  4CC4 C;  2OMV A;  3WPG A;  4RWT C;  2Y5Q A;  1H6U A;  2Z65 A;  3RIZ A;  4R6A A;  4Z94 G;  1Z7X W;  2Z62 A;  5GS0 A;  2P1P B;  4BV4 R;  3WPC A;  4R0A A;  1GWB A;  1U0N D;  4KNG A;  5AWA A;  4PKI G;  3CIY A;  3OJA B;  4Q62 A;  3WPB A;  3ZYJ A;  3W3K A;  4R07 A;  4PQ8 A;  2UZX A;  3WPH A;  3RW6 A;  2AST B;  3OGM B;  4U7L A;  4ECN A;  3M18 A;  4C2B B;  4IM6 A;  4QC0 A;  4LSX C;  2IFG A;  4LXR A;  4FDW A;  4V2C A;  2UZY A;  3G04 C;  2WFH A;  4ARR A;  1DCE A;  4ARN A;  3VQ1 A;  3WPE A;  4QXE A;  4M7E A;  4L3A A;  4Z79 A;  4U08 A;  1P8V A;  2XWT C;  3RFE A;  3JB9 j;  3W3M A;  4HQ1 A;  5AWC A;  3OGL B;  2V70 A;  4I6J B;  4G8A A;  5CMP A;  1IO0 A;  2RR6 A;  4V2E A;  1M10 B;  4Z61 C;  2CA6 A;  5FTT B;  2R9U A;  4L3F A;  2JQD A;  3WPI A;  4BSU A;  1O6T A;  3RFJ A;  4H09 A;  3RJ0 A;  3UL9 A;  3SB4 A;  1ZIW A;  1D0B A;  1OOK G;  3PMH G;  5D3I A;  4V2D A;  3C6N B;  3O53 A;  2OMT A;  3A79 B;  3WPF A;  3G3B A;  2Z82 A;  3G06 A;  2O6S A;  4XGO A;  1O6S A;  5GMG A;  1XEC A;  4Z64 C;  4K17 A;  4XSQ A;  4Q3I A;  4U06 A;  4MQW X;  4R08 A;  4FHO A;  4P91 A;  4OQT A;  1DS9 A;  4WP6 A;  3VQ2 A;  4CNC A;  3REZ A;  1XKU A;  3RFS A;  2Z64 A;  1A9N A;  4GT6 A;  3FXI A;  5IJD A;  3OGK B;  2Z63 A;  4U09 A;  4R5D A;  4GLP A;  2Q4G W;  4CNM A;  1XWD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...