3UL7A

Crystal structure of the tv3 mutant f63w
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
276
structure length
276
Chain Sequence
PCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSWNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
molecule tags Immune system
source organism Homo sapiens
total genus 91
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ul7A00
2ASSB 4Z8GA 3WPEA 4L3FA 3VQ1A 2P1MB 1A4YA 5B0NA 2V9TB 4FMZA 1JL5A 1FS2A 1KOHA 4PKIG 1H6UA 4R5DA 1XCDA 2RA8A 5GMGA 4RWTC 3SB4A 3O53A 3RW7A 4BSUA 3W3JA 4Z94G 2OMYA 2RR6A 3UL8A 1PGVA 1OTMA 4Z64C 3E6JA 4P8SA 4XOSA 4C2BB 3CIYA 1H6TA 4R6JA 3RW6A 1M10B 1XEUA 2OMUA 2R9UA 4CC4C 1M9LA 1W8AA 1P9AG 4U08A 3OGMB 4ECNA 1DCEA 3OGLB 2UZXA 4FCGA 2ID5A 3A79B 3ULAA 2P1PB 2Z65A 2Z7XA 3G3AA 2ASTB 4LSXC 3W3GA 3G39A 3CVRA 4CC4A 4I6JB 5IJBA 5B0TA 2Z82A 2OMTA 5HDHA 5B4PA 1D0BA 2UZYA 3W3LA 1K5GC 4RCAB 3WPBA 4LSXA 4J4LA 4OQTA 1P8TA 3UL9A 3C6NB 4KXFB 1OGQA 3RGZA 4YEBB 4WYKA 4CILA 2Z66A 3OGKB 1OTOA 3E4GA 4LSCA 2P1NB 4UFRA 2OMWA 4Q3GA 5CMPA 4BSRA 4NKHA 1LTXA 4Z79A 1WWLA 1DFJI 4IM6A 1XWDC 1Z7XW 5AZ5A 1M9SA 1G9UA 2Z62A 4R0AA 5GQRK 4KNGA 3P72A 4R6FA 4G8AA 1GWBA 2Z7XB 4K17A 1IO0A 4FD0A 3C6OB 5GS0A 1OTNA 3BZ5A 4R6GA 4BV4R 4V2CA 4V2DA 4L3AA 4XSQA 4CP6A 4FHOA 4M7EC 1O6VA 2P1QB 4PQ8A 2XWTC 4H09A 1SQ0B 2P1OB 4Q62A 2CA6A 4QXEA 3JB9j 5HZLB 2JQDA 3RFSA 4M7EA 2WQUA 2WFHA 4LI1A 1O6TA 4FS7A 4LXSA 3KJ4A 4MQWX 2Z63A 5AWCA 4R5CA 3WPIA 3WPFA 4ARRA 4V2EA 4LXRA 1K5DC 2OMXA 3UN9A 2OMZA 1U0ND 4LSAA 3WPCA 1OZNA 1YRGA 4CNMA 4CNCA 4AW4A 3ZYIA 4Z61C 3OJAA 3E2JA 3ZYJA 4KT1A 1XECA 2O6SA 2WQXA 2Z81A 4RCWA 4U7LA 4Y61B 4AY9X 5A5CA 3PMHG 2XOTA 4GT6A 4J0MA 3FXIA 4PERA 4LI2A 4R58A 5FTTB 1M0ZA 4Q3IA 3RFJA 4ECOA 3WPDA 4MN8B 3VQ2A 4PSJA 4R09A 3G06A 1ZIWA 2WQVA 3RIZA 1P8VA 5AWAA 5D3IA 2Z64A 3M18A 3ULVA 4C2AB 5GMFA 4ARNA 3DZEA 4NKGA 4U06A 2JE0A 5AWDA 3ZYNA 3UL7A 5CMNA 1FO1A 3GOZA 2OMVA 4QC0A 1KOOA 3G3BA 1DS9A 1FT8A 3G04C 2V9SA 1O6SA 3E3ZA 3RGXA 1A9NA 3C6PB 2ELLA 4U09A 1QYYA 3ULUA 2O6RA 2V70A 3CIGA 4P91A 4FDWA 3OJAB 2FT3A 4R07A 3WN4A 4XGOA 3ZYOA 4HQ1A 5AWBA 3O6NA 3WPHA 4BSSA 4TZHA 1XKUA 4B8CD 3REZA 4WP6A 3M19A 4EZGA 4R6AA 2WQWA 3TSRE 2BEXA 4R08A 2BNHA 3WPGA 5GMHA 3RJ0A 4GLPA 4QBZA 5IJCA 2A0ZA 1OOKG 5GS2B 3W3MA 5IJDA 3W3KA 4PEQB 2JE1A 2IFGA 2O6QA 1FQVA 3RFEA 2Q4GW 5IYXC 5LFNA 3W3NA 2Y5QA
chains in the Genus database with same CATH superfamily
2ASSB 4Z8GA 3WPEA 4L3FA 3VQ1A 2P1MB 1A4YA 5B0NA 2V9TB 4FMZA 1JL5A 1FS2A 1KOHA 4PKIG 1H6UA 4R5DA 1XCDA 2RA8A 5GMGA 4RWTC 3SB4A 3O53A 3RW7A 4BSUA 3W3JA 4Z94G 2OMYA 2RR6A 3UL8A 1PGVA 1OTMA 4Z64C 3E6JA 4P8SA 4XOSA 4C2BB 3CIYA 1H6TA 4R6JA 3RW6A 1M10B 1XEUA 2OMUA 2R9UA 4CC4C 1M9LA 1W8AA 1P9AG 4U08A 3OGMB 4ECNA 1DCEA 3OGLB 2UZXA 4FCGA 2ID5A 3A79B 3ULAA 2P1PB 2Z65A 2Z7XA 3G3AA 2ASTB 4LSXC 3W3GA 3G39A 3CVRA 4CC4A 4I6JB 5IJBA 5B0TA 2Z82A 2OMTA 5HDHA 5B4PA 1D0BA 2UZYA 3W3LA 1K5GC 4RCAB 3WPBA 4LSXA 4J4LA 4OQTA 1P8TA 3UL9A 3C6NB 4KXFB 1OGQA 3RGZA 4YEBB 4WYKA 4CILA 2Z66A 3OGKB 1OTOA 3E4GA 4LSCA 2P1NB 4UFRA 2OMWA 4Q3GA 5CMPA 4BSRA 4NKHA 1LTXA 4Z79A 1WWLA 1DFJI 4IM6A 1XWDC 1Z7XW 5AZ5A 1M9SA 1G9UA 2Z62A 4R0AA 5GQRK 4KNGA 3P72A 4R6FA 4G8AA 1GWBA 2Z7XB 4K17A 1IO0A 4FD0A 3C6OB 5GS0A 1OTNA 3BZ5A 4R6GA 4BV4R 4V2CA 4V2DA 4L3AA 4XSQA 4CP6A 4FHOA 4M7EC 1O6VA 2P1QB 4NZTM 4PQ8A 2XWTC 4H09A 1SQ0B 2P1OB 4Q62A 2CA6A 4QXEA 3JB9j 5HZLB 2JQDA 3RFSA 4M7EA 2WQUA 2WFHA 4LI1A 1O6TA 4FS7A 4LXSA 3KJ4A 4MQWX 2Z63A 5AWCA 4R5CA 3WPIA 3WPFA 4ARRA 4V2EA 4LXRA 1K5DC 2OMXA 3UN9A 2OMZA 1U0ND 4LSAA 3WPCA 1OZNA 1YRGA 4CNMA 4CNCA 4AW4A 3ZYIA 4Z61C 3OJAA 3E2JA 3ZYJA 4KT1A 1XECA 2O6SA 2WQXA 2Z81A 4RCWA 4U7LA 4Y61B 4AY9X 5A5CA 3PMHG 2XOTA 4GT6A 4J0MA 3FXIA 4PERA 4LI2A 4R58A 5FTTB 1M0ZA 4Q3IA 3RFJA 4ECOA 3WPDA 4MN8B 3VQ2A 4PSJA 4R09A 3G06A 1ZIWA 2WQVA 3RIZA 1P8VA 5AWAA 5D3IA 2Z64A 3M18A 3ULVA 4C2AB 5GMFA 4ARNA 3DZEA 4NKGA 4U06A 2JE0A 5AWDA 3ZYNA 3UL7A 5CMNA 1FO1A 3GOZA 2OMVA 4QC0A 1KOOA 3G3BA 1DS9A 4NZRM 1FT8A 3G04C 2V9SA 1O6SA 3E3ZA 3RGXA 1A9NA 3C6PB 2ELLA 4U09A 1QYYA 3ULUA 2O6RA 2V70A 3CIGA 4P91A 4FDWA 3OJAB 2FT3A 4R07A 3WN4A 4XGOA 3ZYOA 4HQ1A 5AWBA 3O6NA 3WPHA 4BSSA 4TZHA 1XKUA 4B8CD 3REZA 4WP6A 3M19A 4EZGA 4R6AA 2WQWA 3TSRE 2BEXA 4R08A 2BNHA 3WPGA 5GMHA 3RJ0A 4GLPA 4QBZA 5IJCA 2A0ZA 1OOKG 5GS2B 3W3MA 5IJDA 3W3KA 4PEQB 2JE1A 2IFGA 2O6QA 1FQVA 3RFEA 2Q4GW 5IYXC 5LFNA 3W3NA 2Y5QA
chains in the Genus database with same CATH topology
2ASSB 4Z8GA 3WPEA 4L3FA 3VQ1A 2P1MB 1A4YA 5B0NA 2V9TB 4FMZA 1JL5A 1FS2A 1KOHA 4PKIG 1H6UA 4R5DA 1XCDA 2RA8A 5GMGA 4RWTC 3SB4A 3O53A 3RW7A 4BSUA 3W3JA 4Z94G 2OMYA 2RR6A 3UL8A 1PGVA 1OTMA 4Z64C 3E6JA 4P8SA 4XOSA 4C2BB 3CIYA 1H6TA 4R6JA 3RW6A 1M10B 1XEUA 2OMUA 2R9UA 4CC4C 1M9LA 1W8AA 1P9AG 4U08A 3OGMB 4ECNA 1DCEA 3OGLB 2UZXA 4FCGA 2ID5A 3A79B 3ULAA 2P1PB 2Z65A 2Z7XA 3G3AA 2ASTB 4LSXC 3W3GA 3G39A 3CVRA 4CC4A 4I6JB 5IJBA 5B0TA 2Z82A 2OMTA 5HDHA 5B4PA 1D0BA 2UZYA 3W3LA 1K5GC 4RCAB 3WPBA 4LSXA 4J4LA 4OQTA 1P8TA 3UL9A 3C6NB 4KXFB 1OGQA 3RGZA 4YEBB 4WYKA 4CILA 2Z66A 3OGKB 1OTOA 3E4GA 4LSCA 2P1NB 4UFRA 2OMWA 4Q3GA 5CMPA 4BSRA 4NKHA 1LTXA 4Z79A 1WWLA 1DFJI 4IM6A 1XWDC 1Z7XW 5AZ5A 1M9SA 1G9UA 2Z62A 4R0AA 5GQRK 4KNGA 3P72A 4R6FA 4G8AA 1GWBA 2Z7XB 4K17A 1IO0A 4FD0A 3C6OB 5GS0A 1OTNA 3BZ5A 4R6GA 4BV4R 4V2CA 4V2DA 4L3AA 4XSQA 4CP6A 4FHOA 4M7EC 1O6VA 2P1QB 4PQ8A 2XWTC 4H09A 1SQ0B 2P1OB 4Q62A 2CA6A 4QXEA 3JB9j 5HZLB 2JQDA 3RFSA 4M7EA 2WQUA 2WFHA 4LI1A 1O6TA 4FS7A 4LXSA 3KJ4A 4MQWX 2Z63A 5AWCA 4R5CA 3WPIA 3WPFA 4ARRA 4V2EA 4LXRA 1K5DC 2OMXA 3UN9A 2OMZA 1U0ND 4LSAA 3WPCA 1OZNA 1YRGA 4CNMA 4CNCA 4AW4A 3ZYIA 4Z61C 3OJAA 3E2JA 3ZYJA 4KT1A 1XECA 2O6SA 2WQXA 2Z81A 4RCWA 4U7LA 4Y61B 4AY9X 5A5CA 3PMHG 2XOTA 4GT6A 4J0MA 3FXIA 4PERA 4LI2A 4R58A 5FTTB 1M0ZA 4Q3IA 3RFJA 4ECOA 3WPDA 4MN8B 3VQ2A 4PSJA 4R09A 3G06A 1ZIWA 2WQVA 3RIZA 1P8VA 5AWAA 5D3IA 2Z64A 3M18A 3ULVA 4C2AB 5GMFA 4ARNA 3DZEA 4NKGA 4U06A 2JE0A 5AWDA 3ZYNA 3UL7A 5CMNA 1FO1A 3GOZA 2OMVA 4QC0A 1KOOA 3G3BA 1DS9A 1FT8A 3G04C 2V9SA 1O6SA 3E3ZA 3RGXA 1A9NA 3C6PB 2ELLA 4U09A 1QYYA 3ULUA 2O6RA 2V70A 3CIGA 4P91A 4FDWA 3OJAB 2FT3A 4R07A 3WN4A 4XGOA 3ZYOA 4HQ1A 5AWBA 3O6NA 3WPHA 4BSSA 4TZHA 1XKUA 4B8CD 3REZA 4WP6A 3M19A 4EZGA 4R6AA 2WQWA 3TSRE 2BEXA 4R08A 2BNHA 3WPGA 5GMHA 3RJ0A 4GLPA 4QBZA 5IJCA 2A0ZA 1OOKG 5GS2B 3W3MA 5IJDA 3W3KA 4PEQB 2JE1A 2IFGA 2O6QA 1FQVA 3RFEA 2Q4GW 5IYXC 5LFNA 3W3NA 2Y5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASS B;  4Z8G A;  3WPE A;  4L3F A;  3VQ1 A;  2P1M B;  1A4Y A;  5B0N A;  2V9T B;  4FMZ A;  1JL5 A;  1FS2 A;  1KOH A;  4PKI G;  1H6U A;  4R5D A;  1XCD A;  2RA8 A;  5GMG A;  4RWT C;  3SB4 A;  3O53 A;  3RW7 A;  4BSU A;  3W3J A;  4Z94 G;  2OMY A;  2RR6 A;  3UL8 A;  1PGV A;  1OTM A;  4Z64 C;  3E6J A;  4P8S A;  4XOS A;  4C2B B;  3CIY A;  1H6T A;  4R6J A;  3RW6 A;  1M10 B;  1XEU A;  2OMU A;  2R9U A;  4CC4 C;  1M9L A;  1W8A A;  1P9A G;  4U08 A;  3OGM B;  4ECN A;  1DCE A;  3OGL B;  2UZX A;  4FCG A;  2ID5 A;  3A79 B;  3ULA A;  2P1P B;  2Z65 A;  2Z7X A;  3G3A A;  2AST B;  4LSX C;  3W3G A;  3G39 A;  3CVR A;  4CC4 A;  4I6J B;  5IJB A;  5B0T A;  2Z82 A;  2OMT A;  5HDH A;  5B4P A;  1D0B A;  2UZY A;  3W3L A;  1K5G C;  4RCA B;  3WPB A;  4LSX A;  4J4L A;  4OQT A;  1P8T A;  3UL9 A;  3C6N B;  4KXF B;  1OGQ A;  3RGZ A;  4YEB B;  4WYK A;  4CIL A;  2Z66 A;  3OGK B;  1OTO A;  3E4G A;  4LSC A;  2P1N B;  4UFR A;  2OMW A;  4Q3G A;  5CMP A;  4BSR A;  4NKH A;  1LTX A;  4Z79 A;  1WWL A;  1DFJ I;  4IM6 A;  1XWD C;  1Z7X W;  5AZ5 A;  1M9S A;  1G9U A;  2Z62 A;  4R0A A;  5GQR K;  4KNG A;  3P72 A;  4R6F A;  4G8A A;  1GWB A;  2Z7X B;  4K17 A;  1IO0 A;  4FD0 A;  3C6O B;  5GS0 A;  1OTN A;  3BZ5 A;  4R6G A;  4BV4 R;  4V2C A;  4V2D A;  4L3A A;  4XSQ A;  4CP6 A;  4FHO A;  4M7E C;  1O6V A;  2P1Q B;  4PQ8 A;  2XWT C;  4H09 A;  1SQ0 B;  2P1O B;  4Q62 A;  2CA6 A;  4QXE A;  3JB9 j;  5HZL B;  2JQD A;  3RFS A;  4M7E A;  2WQU A;  2WFH A;  4LI1 A;  1O6T A;  4FS7 A;  4LXS A;  3KJ4 A;  4MQW X;  2Z63 A;  5AWC A;  4R5C A;  3WPI A;  3WPF A;  4ARR A;  4V2E A;  4LXR A;  1K5D C;  2OMX A;  3UN9 A;  2OMZ A;  1U0N D;  4LSA A;  3WPC A;  1OZN A;  1YRG A;  4CNM A;  4CNC A;  4AW4 A;  3ZYI A;  4Z61 C;  3OJA A;  3E2J A;  3ZYJ A;  4KT1 A;  1XEC A;  2O6S A;  2WQX A;  2Z81 A;  4RCW A;  4U7L A;  4Y61 B;  4AY9 X;  5A5C A;  3PMH G;  2XOT A;  4GT6 A;  4J0M A;  3FXI A;  4PER A;  4LI2 A;  4R58 A;  5FTT B;  1M0Z A;  4Q3I A;  3RFJ A;  4ECO A;  3WPD A;  4MN8 B;  3VQ2 A;  4PSJ A;  4R09 A;  3G06 A;  1ZIW A;  2WQV A;  3RIZ A;  1P8V A;  5AWA A;  5D3I A;  2Z64 A;  3M18 A;  3ULV A;  4C2A B;  5GMF A;  4ARN A;  3DZE A;  4NKG A;  4U06 A;  2JE0 A;  5AWD A;  3ZYN A;  3UL7 A;  5CMN A;  1FO1 A;  3GOZ A;  2OMV A;  4QC0 A;  1KOO A;  3G3B A;  1DS9 A;  1FT8 A;  3G04 C;  2V9S A;  1O6S A;  3E3Z A;  3RGX A;  1A9N A;  3C6P B;  2ELL A;  4U09 A;  1QYY A;  3ULU A;  2O6R A;  2V70 A;  3CIG A;  4P91 A;  4FDW A;  3OJA B;  2FT3 A;  4R07 A;  3WN4 A;  4XGO A;  3ZYO A;  4HQ1 A;  5AWB A;  3O6N A;  3WPH A;  4BSS A;  4TZH A;  1XKU A;  4B8C D;  3REZ A;  4WP6 A;  3M19 A;  4EZG A;  4R6A A;  2WQW A;  3TSR E;  2BEX A;  4R08 A;  2BNH A;  3WPG A;  5GMH A;  3RJ0 A;  4GLP A;  4QBZ A;  5IJC A;  2A0Z A;  1OOK G;  5GS2 B;  3W3M A;  5IJD A;  3W3K A;  4PEQ B;  2JE1 A;  2IFG A;  2O6Q A;  1FQV A;  3RFE A;  2Q4G W;  5IYX C;  5LFN A;  3W3N A;  2Y5Q A; 
#chains in the Genus database with same CATH topology
 2ASS B;  4Z8G A;  3WPE A;  4L3F A;  3VQ1 A;  2P1M B;  1A4Y A;  5B0N A;  2V9T B;  4FMZ A;  1JL5 A;  1FS2 A;  1KOH A;  4PKI G;  1H6U A;  4R5D A;  1XCD A;  2RA8 A;  5GMG A;  4RWT C;  3SB4 A;  3O53 A;  3RW7 A;  4BSU A;  3W3J A;  4Z94 G;  2OMY A;  2RR6 A;  3UL8 A;  1PGV A;  1OTM A;  4Z64 C;  3E6J A;  4P8S A;  4XOS A;  4C2B B;  3CIY A;  1H6T A;  4R6J A;  3RW6 A;  1M10 B;  1XEU A;  2OMU A;  2R9U A;  4CC4 C;  1M9L A;  1W8A A;  1P9A G;  4U08 A;  3OGM B;  4ECN A;  1DCE A;  3OGL B;  2UZX A;  4FCG A;  2ID5 A;  3A79 B;  3ULA A;  2P1P B;  2Z65 A;  2Z7X A;  3G3A A;  2AST B;  4LSX C;  3W3G A;  3G39 A;  3CVR A;  4CC4 A;  4I6J B;  5IJB A;  5B0T A;  2Z82 A;  2OMT A;  5HDH A;  5B4P A;  1D0B A;  2UZY A;  3W3L A;  1K5G C;  4RCA B;  3WPB A;  4LSX A;  4J4L A;  4OQT A;  1P8T A;  3UL9 A;  3C6N B;  4KXF B;  1OGQ A;  3RGZ A;  4YEB B;  4WYK A;  4CIL A;  2Z66 A;  3OGK B;  1OTO A;  3E4G A;  4LSC A;  2P1N B;  4UFR A;  2OMW A;  4Q3G A;  5CMP A;  4BSR A;  4NKH A;  1LTX A;  4Z79 A;  1WWL A;  1DFJ I;  4IM6 A;  1XWD C;  1Z7X W;  5AZ5 A;  1M9S A;  1G9U A;  2Z62 A;  4R0A A;  5GQR K;  4KNG A;  3P72 A;  4R6F A;  4G8A A;  1GWB A;  2Z7X B;  4K17 A;  1IO0 A;  4FD0 A;  3C6O B;  5GS0 A;  1OTN A;  3BZ5 A;  4R6G A;  4BV4 R;  4V2C A;  4V2D A;  4L3A A;  4XSQ A;  4CP6 A;  4FHO A;  4M7E C;  1O6V A;  2P1Q B;  4NZT M;  4PQ8 A;  2XWT C;  4H09 A;  1SQ0 B;  2P1O B;  4Q62 A;  2CA6 A;  4QXE A;  3JB9 j;  5HZL B;  2JQD A;  3RFS A;  4M7E A;  2WQU A;  2WFH A;  4LI1 A;  1O6T A;  4FS7 A;  4LXS A;  3KJ4 A;  4MQW X;  2Z63 A;  5AWC A;  4R5C A;  3WPI A;  3WPF A;  4ARR A;  4V2E A;  4LXR A;  1K5D C;  2OMX A;  3UN9 A;  2OMZ A;  1U0N D;  4LSA A;  3WPC A;  1OZN A;  1YRG A;  4CNM A;  4CNC A;  4AW4 A;  3ZYI A;  4Z61 C;  3OJA A;  3E2J A;  3ZYJ A;  4KT1 A;  1XEC A;  2O6S A;  2WQX A;  2Z81 A;  4RCW A;  4U7L A;  4Y61 B;  4AY9 X;  5A5C A;  3PMH G;  2XOT A;  4GT6 A;  4J0M A;  3FXI A;  4PER A;  4LI2 A;  4R58 A;  5FTT B;  1M0Z A;  4Q3I A;  3RFJ A;  4ECO A;  3WPD A;  4MN8 B;  3VQ2 A;  4PSJ A;  4R09 A;  3G06 A;  1ZIW A;  2WQV A;  3RIZ A;  1P8V A;  5AWA A;  5D3I A;  2Z64 A;  3M18 A;  3ULV A;  4C2A B;  5GMF A;  4ARN A;  3DZE A;  4NKG A;  4U06 A;  2JE0 A;  5AWD A;  3ZYN A;  3UL7 A;  5CMN A;  1FO1 A;  3GOZ A;  2OMV A;  4QC0 A;  1KOO A;  3G3B A;  1DS9 A;  4NZR M;  1FT8 A;  3G04 C;  2V9S A;  1O6S A;  3E3Z A;  3RGX A;  1A9N A;  3C6P B;  2ELL A;  4U09 A;  1QYY A;  3ULU A;  2O6R A;  2V70 A;  3CIG A;  4P91 A;  4FDW A;  3OJA B;  2FT3 A;  4R07 A;  3WN4 A;  4XGO A;  3ZYO A;  4HQ1 A;  5AWB A;  3O6N A;  3WPH A;  4BSS A;  4TZH A;  1XKU A;  4B8C D;  3REZ A;  4WP6 A;  3M19 A;  4EZG A;  4R6A A;  2WQW A;  3TSR E;  2BEX A;  4R08 A;  2BNH A;  3WPG A;  5GMH A;  3RJ0 A;  4GLP A;  4QBZ A;  5IJC A;  2A0Z A;  1OOK G;  5GS2 B;  3W3M A;  5IJD A;  3W3K A;  4PEQ B;  2JE1 A;  2IFG A;  2O6Q A;  1FQV A;  3RFE A;  2Q4G W;  5IYX C;  5LFN A;  3W3N A;  2Y5Q A; 
#chains in the Genus database with same CATH homology
 2ASS B;  4Z8G A;  3WPE A;  4L3F A;  3VQ1 A;  2P1M B;  1A4Y A;  5B0N A;  2V9T B;  4FMZ A;  1JL5 A;  1FS2 A;  1KOH A;  4PKI G;  1H6U A;  4R5D A;  1XCD A;  2RA8 A;  5GMG A;  4RWT C;  3SB4 A;  3O53 A;  3RW7 A;  4BSU A;  3W3J A;  4Z94 G;  2OMY A;  2RR6 A;  3UL8 A;  1PGV A;  1OTM A;  4Z64 C;  3E6J A;  4P8S A;  4XOS A;  4C2B B;  3CIY A;  1H6T A;  4R6J A;  3RW6 A;  1M10 B;  1XEU A;  2OMU A;  2R9U A;  4CC4 C;  1M9L A;  1W8A A;  1P9A G;  4U08 A;  3OGM B;  4ECN A;  1DCE A;  3OGL B;  2UZX A;  4FCG A;  2ID5 A;  3A79 B;  3ULA A;  2P1P B;  2Z65 A;  2Z7X A;  3G3A A;  2AST B;  4LSX C;  3W3G A;  3G39 A;  3CVR A;  4CC4 A;  4I6J B;  5IJB A;  5B0T A;  2Z82 A;  2OMT A;  5HDH A;  5B4P A;  1D0B A;  2UZY A;  3W3L A;  1K5G C;  4RCA B;  3WPB A;  4LSX A;  4J4L A;  4OQT A;  1P8T A;  3UL9 A;  3C6N B;  4KXF B;  1OGQ A;  3RGZ A;  4YEB B;  4WYK A;  4CIL A;  2Z66 A;  3OGK B;  1OTO A;  3E4G A;  4LSC A;  2P1N B;  4UFR A;  2OMW A;  4Q3G A;  5CMP A;  4BSR A;  4NKH A;  1LTX A;  4Z79 A;  1WWL A;  1DFJ I;  4IM6 A;  1XWD C;  1Z7X W;  5AZ5 A;  1M9S A;  1G9U A;  2Z62 A;  4R0A A;  5GQR K;  4KNG A;  3P72 A;  4R6F A;  4G8A A;  1GWB A;  2Z7X B;  4K17 A;  1IO0 A;  4FD0 A;  3C6O B;  5GS0 A;  1OTN A;  3BZ5 A;  4R6G A;  4BV4 R;  4V2C A;  4V2D A;  4L3A A;  4XSQ A;  4CP6 A;  4FHO A;  4M7E C;  1O6V A;  2P1Q B;  4PQ8 A;  2XWT C;  4H09 A;  1SQ0 B;  2P1O B;  4Q62 A;  2CA6 A;  4QXE A;  3JB9 j;  5HZL B;  2JQD A;  3RFS A;  4M7E A;  2WQU A;  2WFH A;  4LI1 A;  1O6T A;  4FS7 A;  4LXS A;  3KJ4 A;  4MQW X;  2Z63 A;  5AWC A;  4R5C A;  3WPI A;  3WPF A;  4ARR A;  4V2E A;  4LXR A;  1K5D C;  2OMX A;  3UN9 A;  2OMZ A;  1U0N D;  4LSA A;  3WPC A;  1OZN A;  1YRG A;  4CNM A;  4CNC A;  4AW4 A;  3ZYI A;  4Z61 C;  3OJA A;  3E2J A;  3ZYJ A;  4KT1 A;  1XEC A;  2O6S A;  2WQX A;  2Z81 A;  4RCW A;  4U7L A;  4Y61 B;  4AY9 X;  5A5C A;  3PMH G;  2XOT A;  4GT6 A;  4J0M A;  3FXI A;  4PER A;  4LI2 A;  4R58 A;  5FTT B;  1M0Z A;  4Q3I A;  3RFJ A;  4ECO A;  3WPD A;  4MN8 B;  3VQ2 A;  4PSJ A;  4R09 A;  3G06 A;  1ZIW A;  2WQV A;  3RIZ A;  1P8V A;  5AWA A;  5D3I A;  2Z64 A;  3M18 A;  3ULV A;  4C2A B;  5GMF A;  4ARN A;  3DZE A;  4NKG A;  4U06 A;  2JE0 A;  5AWD A;  3ZYN A;  3UL7 A;  5CMN A;  1FO1 A;  3GOZ A;  2OMV A;  4QC0 A;  1KOO A;  3G3B A;  1DS9 A;  1FT8 A;  3G04 C;  2V9S A;  1O6S A;  3E3Z A;  3RGX A;  1A9N A;  3C6P B;  2ELL A;  4U09 A;  1QYY A;  3ULU A;  2O6R A;  2V70 A;  3CIG A;  4P91 A;  4FDW A;  3OJA B;  2FT3 A;  4R07 A;  3WN4 A;  4XGO A;  3ZYO A;  4HQ1 A;  5AWB A;  3O6N A;  3WPH A;  4BSS A;  4TZH A;  1XKU A;  4B8C D;  3REZ A;  4WP6 A;  3M19 A;  4EZG A;  4R6A A;  2WQW A;  3TSR E;  2BEX A;  4R08 A;  2BNH A;  3WPG A;  5GMH A;  3RJ0 A;  4GLP A;  4QBZ A;  5IJC A;  2A0Z A;  1OOK G;  5GS2 B;  3W3M A;  5IJD A;  3W3K A;  4PEQ B;  2JE1 A;  2IFG A;  2O6Q A;  1FQV A;  3RFE A;  2Q4G W;  5IYX C;  5LFN A;  3W3N A;  2Y5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...