3UL8A

Crystal structure of the tv3 mutant v134l
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
277
structure length
277
Chain Sequence
b'EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVALETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 86
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ul8A00
2WQUA 3G3AA 3VQ1A 1KOHA 5GS0A 2P1PB 2UZYA 2ASTB 2CA6A 1A4YA 4ECOA 4U09A 5IYXC 3UL9A 3P72A 4J0MA 4RCWA 4AW4A 1H6UA 1XCDA 1ZIWA 4PSJA 2OMTA 4XSQA 1Z7XW 2OMXA 1O6SA 4LXRA 5GQRK 3RGZA 2ELLA 4R07A 2P1QB 3WN4A 4CNCA 3ULAA 5IJBA 2UZXA 3CIGA 4C2BB 4YEBB 3ZYJA 4R6AA 4RCAB 4FMZA 4QC0A 4U08A 4ARRA 2P1MB 2V9TB 4R5DA 5GMFA 3RFJA 4V2EA 4CILA 2WQWA 4HQ1A 3E2JA 2P1OB 2BEXA 4CC4C 4R6GA 2IFGA 2R9UA 5B4PA 1O6TA 4FS7A 3E4GA 4QBZA 4WYKA 2Z64A 4Q62A 4CC4A 2Q4GW 5AWAA 3G39A 4U7LA 4Y61B 4TZHA 2JE1A 1A9NA 4NKGA 3RW6A 5IJCA 1JL5A 1FO1A 2OMWA 4LSAA 4M7EC 5CMPA 3G04C 3O6NA 4P91A 2Z7XA 4V2CA 4M7EA 3CIYA 3A79B 3OJAA 5LFNA 4H09A 2JQDA 2BNHA 3BZ5A 4Z8GA 4ECNA 4LSXA 3W3JA 1OTNA 4BV4R 1P8TA 3CVRA 2WQXA 4WP6A 2OMUA 2O6QA 1H6TA 3E6JA 2A0ZA 3OGMB 4UFRA 3WPEA 2Y5QA 1OTOA 2Z65A 1U0ND 1DFJI 2V9SA 4Z79A 1XEUA 3KJ4A 5FTTB 4BSUA 4ARNA 2OMZA 1OGQA 1QYYA 1K5GC 3WPIA 4KXFB 1OTMA 2V70A 5B0NA 4LXSA 3WPBA 3PMHG 2JE0A 3WPGA 1D0BA 4Z61C 4PKIG 4OQTA 1XWDC 4P8SA 4R08A 3W3LA 4XOSA 1O6VA 5AWCA 1P9AG 1XKUA 3WPHA 3W3MA 1FQVA 2Z7XB 4FHOA 3OJAB 5GMGA 2P1NB 2WQVA 4R09A 3ZYOA 4V2DA 1WWLA 4L3FA 1P8VA 1OZNA 4Q3GA 2Z81A 3ZYNA 3W3NA 3C6OB 4K17A 4GLPA 3OGLB 1GWBA 5AZ5A 1M9LA 4GT6A 1SQ0B 1FT8A 4LI1A 4LSCA 2Z62A 3ULUA 3C6NB 4EZGA 4LSXC 2Z66A 3RW7A 5B0TA 4L3AA 4FCGA 2RR6A 4G8AA 2ASSB 3G06A 3C6PB 3ZYIA 3W3GA 1XECA 4B8CD 5GS2B 4IM6A 1M10B 4XGOA 4RWTC 4PERA 5IJDA 4Z94G 1M0ZA 3G3BA 4I6JB 3M18A 4Q3IA 3RJ0A 3GOZA 4KT1A 1KOOA 1G9UA 3JB9j 3UN9A 3SB4A 4U06A 1DS9A 4PQ8A 3ULVA 2WFHA 1YRGA 3TSRE 5GMHA 2OMVA 3RFEA 1FS2A 5CMNA 2OMYA 4CNMA 4Z64C 3O53A 2XOTA 1LTXA 4KNGA 3OGKB 1DCEA 4AY9X 5AWDA 4R0AA 1IO0A 5HDHA 2ID5A 1K5DC 2FT3A 2RA8A 4FDWA 4BSRA 3RIZA 3WPCA 4LI2A 2XWTC 5AWBA 4J4LA 4R58A 3W3KA 4PEQB 3WPDA 3RFSA 1OOKG 1PGVA 3FXIA 3WPFA 3M19A 4R6JA 4C2AB 3E3ZA 4R6FA 4MN8B 4QXEA 4NKHA 3UL8A 4CP6A 1M9SA 5A5CA 1W8AA 3DZEA 3VQ2A 2Z63A 2O6SA 4R5CA 4BSSA 5HZLB 3REZA 3RGXA 4MQWX 5D3IA 2O6RA 4FD0A 3UL7A 2Z82A
chains in the Genus database with same CATH superfamily
2WQUA 3G3AA 3VQ1A 1KOHA 5GS0A 2P1PB 2UZYA 2ASTB 2CA6A 1A4YA 4ECOA 4U09A 5IYXC 3UL9A 3P72A 4J0MA 4RCWA 4AW4A 1H6UA 1XCDA 1ZIWA 4PSJA 2OMTA 4XSQA 1Z7XW 2OMXA 1O6SA 4LXRA 5GQRK 3RGZA 2ELLA 4R07A 2P1QB 3WN4A 4CNCA 3ULAA 5IJBA 2UZXA 3CIGA 4C2BB 4YEBB 3ZYJA 4R6AA 4RCAB 4FMZA 4QC0A 4U08A 4ARRA 2P1MB 2V9TB 4R5DA 5GMFA 3RFJA 4V2EA 4CILA 2WQWA 4HQ1A 3E2JA 2P1OB 2BEXA 4CC4C 4R6GA 2IFGA 2R9UA 5B4PA 1O6TA 4FS7A 3E4GA 4QBZA 4WYKA 2Z64A 4Q62A 4CC4A 2Q4GW 5AWAA 3G39A 4U7LA 4Y61B 4TZHA 2JE1A 1A9NA 4NKGA 3RW6A 5IJCA 1JL5A 1FO1A 2OMWA 4LSAA 4M7EC 5CMPA 3G04C 3O6NA 4P91A 2Z7XA 4V2CA 4M7EA 3CIYA 3A79B 3OJAA 5LFNA 4H09A 2JQDA 2BNHA 3BZ5A 4Z8GA 4ECNA 4LSXA 3W3JA 1OTNA 4BV4R 1P8TA 3CVRA 2WQXA 4WP6A 2OMUA 2O6QA 1H6TA 3E6JA 2A0ZA 3OGMB 4UFRA 3WPEA 2Y5QA 1OTOA 2Z65A 1U0ND 1DFJI 2V9SA 4Z79A 1XEUA 3KJ4A 5FTTB 4BSUA 4ARNA 2OMZA 1OGQA 1QYYA 1K5GC 3WPIA 4KXFB 1OTMA 2V70A 5B0NA 4LXSA 3WPBA 3PMHG 2JE0A 3WPGA 1D0BA 4Z61C 4PKIG 4OQTA 1XWDC 4P8SA 4R08A 3W3LA 4XOSA 1O6VA 5AWCA 1P9AG 1XKUA 3WPHA 3W3MA 1FQVA 2Z7XB 4FHOA 3OJAB 5GMGA 2P1NB 2WQVA 4R09A 3ZYOA 4V2DA 1WWLA 4L3FA 1P8VA 1OZNA 4Q3GA 2Z81A 3ZYNA 3W3NA 3C6OB 4K17A 4GLPA 3OGLB 1GWBA 5AZ5A 1M9LA 4GT6A 1SQ0B 1FT8A 4LI1A 4LSCA 2Z62A 3ULUA 3C6NB 4EZGA 4LSXC 2Z66A 3RW7A 5B0TA 4L3AA 4FCGA 2RR6A 4G8AA 2ASSB 3G06A 3C6PB 3ZYIA 3W3GA 1XECA 4B8CD 5GS2B 4IM6A 1M10B 4XGOA 4RWTC 4PERA 5IJDA 4Z94G 1M0ZA 3G3BA 4I6JB 3M18A 4Q3IA 3RJ0A 3GOZA 4KT1A 1KOOA 1G9UA 4NZRM 3JB9j 3UN9A 3SB4A 4U06A 1DS9A 4PQ8A 3ULVA 2WFHA 1YRGA 3TSRE 5GMHA 2OMVA 3RFEA 1FS2A 5CMNA 2OMYA 4NZTM 4CNMA 4Z64C 3O53A 2XOTA 1LTXA 4KNGA 3OGKB 1DCEA 4AY9X 5AWDA 4R0AA 1IO0A 5HDHA 2ID5A 1K5DC 2FT3A 2RA8A 4FDWA 4BSRA 3RIZA 3WPCA 4LI2A 2XWTC 5AWBA 4J4LA 4R58A 3W3KA 4PEQB 3WPDA 3RFSA 1OOKG 1PGVA 3FXIA 3WPFA 3M19A 4R6JA 4C2AB 3E3ZA 4R6FA 4MN8B 4QXEA 4NKHA 3UL8A 4CP6A 1M9SA 5A5CA 1W8AA 3DZEA 3VQ2A 2Z63A 2O6SA 4R5CA 4BSSA 5HZLB 3REZA 3RGXA 4MQWX 5D3IA 2O6RA 4FD0A 3UL7A 2Z82A
chains in the Genus database with same CATH topology
2WQUA 3G3AA 3VQ1A 1KOHA 5GS0A 2P1PB 2UZYA 2ASTB 2CA6A 1A4YA 4ECOA 4U09A 5IYXC 3UL9A 3P72A 4J0MA 4RCWA 4AW4A 1H6UA 1XCDA 1ZIWA 4PSJA 2OMTA 4XSQA 1Z7XW 2OMXA 1O6SA 4LXRA 5GQRK 3RGZA 2ELLA 4R07A 2P1QB 3WN4A 4CNCA 3ULAA 5IJBA 2UZXA 3CIGA 4C2BB 4YEBB 3ZYJA 4R6AA 4RCAB 4FMZA 4QC0A 4U08A 4ARRA 2P1MB 2V9TB 4R5DA 5GMFA 3RFJA 4V2EA 4CILA 2WQWA 4HQ1A 3E2JA 2P1OB 2BEXA 4CC4C 4R6GA 2IFGA 2R9UA 5B4PA 1O6TA 4FS7A 3E4GA 4QBZA 4WYKA 2Z64A 4Q62A 4CC4A 2Q4GW 5AWAA 3G39A 4U7LA 4Y61B 4TZHA 2JE1A 1A9NA 4NKGA 3RW6A 5IJCA 1JL5A 1FO1A 2OMWA 4LSAA 4M7EC 5CMPA 3G04C 3O6NA 4P91A 2Z7XA 4V2CA 4M7EA 3CIYA 3A79B 3OJAA 5LFNA 4H09A 2JQDA 2BNHA 3BZ5A 4Z8GA 4ECNA 4LSXA 3W3JA 1OTNA 4BV4R 1P8TA 3CVRA 2WQXA 4WP6A 2OMUA 2O6QA 1H6TA 3E6JA 2A0ZA 3OGMB 4UFRA 3WPEA 2Y5QA 1OTOA 2Z65A 1U0ND 1DFJI 2V9SA 4Z79A 1XEUA 3KJ4A 5FTTB 4BSUA 4ARNA 2OMZA 1OGQA 1QYYA 1K5GC 3WPIA 4KXFB 1OTMA 2V70A 5B0NA 4LXSA 3WPBA 3PMHG 2JE0A 3WPGA 1D0BA 4Z61C 4PKIG 4OQTA 1XWDC 4P8SA 4R08A 3W3LA 4XOSA 1O6VA 5AWCA 1P9AG 1XKUA 3WPHA 3W3MA 1FQVA 2Z7XB 4FHOA 3OJAB 5GMGA 2P1NB 2WQVA 4R09A 3ZYOA 4V2DA 1WWLA 4L3FA 1P8VA 1OZNA 4Q3GA 2Z81A 3ZYNA 3W3NA 3C6OB 4K17A 4GLPA 3OGLB 1GWBA 5AZ5A 1M9LA 4GT6A 1SQ0B 1FT8A 4LI1A 4LSCA 2Z62A 3ULUA 3C6NB 4EZGA 4LSXC 2Z66A 3RW7A 5B0TA 4L3AA 4FCGA 2RR6A 4G8AA 2ASSB 3G06A 3C6PB 3ZYIA 3W3GA 1XECA 4B8CD 5GS2B 4IM6A 1M10B 4XGOA 4RWTC 4PERA 5IJDA 4Z94G 1M0ZA 3G3BA 4I6JB 3M18A 4Q3IA 3RJ0A 3GOZA 4KT1A 1KOOA 1G9UA 3JB9j 3UN9A 3SB4A 4U06A 1DS9A 4PQ8A 3ULVA 2WFHA 1YRGA 3TSRE 5GMHA 2OMVA 3RFEA 1FS2A 5CMNA 2OMYA 4CNMA 4Z64C 3O53A 2XOTA 1LTXA 4KNGA 3OGKB 1DCEA 4AY9X 5AWDA 4R0AA 1IO0A 5HDHA 2ID5A 1K5DC 2FT3A 2RA8A 4FDWA 4BSRA 3RIZA 3WPCA 4LI2A 2XWTC 5AWBA 4J4LA 4R58A 3W3KA 4PEQB 3WPDA 3RFSA 1OOKG 1PGVA 3FXIA 3WPFA 3M19A 4R6JA 4C2AB 3E3ZA 4R6FA 4MN8B 4QXEA 4NKHA 3UL8A 4CP6A 1M9SA 5A5CA 1W8AA 3DZEA 3VQ2A 2Z63A 2O6SA 4R5CA 4BSSA 5HZLB 3REZA 3RGXA 4MQWX 5D3IA 2O6RA 4FD0A 3UL7A 2Z82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQU A;  3G3A A;  3VQ1 A;  1KOH A;  5GS0 A;  2P1P B;  2UZY A;  2AST B;  2CA6 A;  1A4Y A;  4ECO A;  4U09 A;  5IYX C;  3UL9 A;  3P72 A;  4J0M A;  4RCW A;  4AW4 A;  1H6U A;  1XCD A;  1ZIW A;  4PSJ A;  2OMT A;  4XSQ A;  1Z7X W;  2OMX A;  1O6S A;  4LXR A;  5GQR K;  3RGZ A;  2ELL A;  4R07 A;  2P1Q B;  3WN4 A;  4CNC A;  3ULA A;  5IJB A;  2UZX A;  3CIG A;  4C2B B;  4YEB B;  3ZYJ A;  4R6A A;  4RCA B;  4FMZ A;  4QC0 A;  4U08 A;  4ARR A;  2P1M B;  2V9T B;  4R5D A;  5GMF A;  3RFJ A;  4V2E A;  4CIL A;  2WQW A;  4HQ1 A;  3E2J A;  2P1O B;  2BEX A;  4CC4 C;  4R6G A;  2IFG A;  2R9U A;  5B4P A;  1O6T A;  4FS7 A;  3E4G A;  4QBZ A;  4WYK A;  2Z64 A;  4Q62 A;  4CC4 A;  2Q4G W;  5AWA A;  3G39 A;  4U7L A;  4Y61 B;  4TZH A;  2JE1 A;  1A9N A;  4NKG A;  3RW6 A;  5IJC A;  1JL5 A;  1FO1 A;  2OMW A;  4LSA A;  4M7E C;  5CMP A;  3G04 C;  3O6N A;  4P91 A;  2Z7X A;  4V2C A;  4M7E A;  3CIY A;  3A79 B;  3OJA A;  5LFN A;  4H09 A;  2JQD A;  2BNH A;  3BZ5 A;  4Z8G A;  4ECN A;  4LSX A;  3W3J A;  1OTN A;  4BV4 R;  1P8T A;  3CVR A;  2WQX A;  4WP6 A;  2OMU A;  2O6Q A;  1H6T A;  3E6J A;  2A0Z A;  3OGM B;  4UFR A;  3WPE A;  2Y5Q A;  1OTO A;  2Z65 A;  1U0N D;  1DFJ I;  2V9S A;  4Z79 A;  1XEU A;  3KJ4 A;  5FTT B;  4BSU A;  4ARN A;  2OMZ A;  1OGQ A;  1QYY A;  1K5G C;  3WPI A;  4KXF B;  1OTM A;  2V70 A;  5B0N A;  4LXS A;  3WPB A;  3PMH G;  2JE0 A;  3WPG A;  1D0B A;  4Z61 C;  4PKI G;  4OQT A;  1XWD C;  4P8S A;  4R08 A;  3W3L A;  4XOS A;  1O6V A;  5AWC A;  1P9A G;  1XKU A;  3WPH A;  3W3M A;  1FQV A;  2Z7X B;  4FHO A;  3OJA B;  5GMG A;  2P1N B;  2WQV A;  4R09 A;  3ZYO A;  4V2D A;  1WWL A;  4L3F A;  1P8V A;  1OZN A;  4Q3G A;  2Z81 A;  3ZYN A;  3W3N A;  3C6O B;  4K17 A;  4GLP A;  3OGL B;  1GWB A;  5AZ5 A;  1M9L A;  4GT6 A;  1SQ0 B;  1FT8 A;  4LI1 A;  4LSC A;  2Z62 A;  3ULU A;  3C6N B;  4EZG A;  4LSX C;  2Z66 A;  3RW7 A;  5B0T A;  4L3A A;  4FCG A;  2RR6 A;  4G8A A;  2ASS B;  3G06 A;  3C6P B;  3ZYI A;  3W3G A;  1XEC A;  4B8C D;  5GS2 B;  4IM6 A;  1M10 B;  4XGO A;  4RWT C;  4PER A;  5IJD A;  4Z94 G;  1M0Z A;  3G3B A;  4I6J B;  3M18 A;  4Q3I A;  3RJ0 A;  3GOZ A;  4KT1 A;  1KOO A;  1G9U A;  3JB9 j;  3UN9 A;  3SB4 A;  4U06 A;  1DS9 A;  4PQ8 A;  3ULV A;  2WFH A;  1YRG A;  3TSR E;  5GMH A;  2OMV A;  3RFE A;  1FS2 A;  5CMN A;  2OMY A;  4CNM A;  4Z64 C;  3O53 A;  2XOT A;  1LTX A;  4KNG A;  3OGK B;  1DCE A;  4AY9 X;  5AWD A;  4R0A A;  1IO0 A;  5HDH A;  2ID5 A;  1K5D C;  2FT3 A;  2RA8 A;  4FDW A;  4BSR A;  3RIZ A;  3WPC A;  4LI2 A;  2XWT C;  5AWB A;  4J4L A;  4R58 A;  3W3K A;  4PEQ B;  3WPD A;  3RFS A;  1OOK G;  1PGV A;  3FXI A;  3WPF A;  3M19 A;  4R6J A;  4C2A B;  3E3Z A;  4R6F A;  4MN8 B;  4QXE A;  4NKH A;  3UL8 A;  4CP6 A;  1M9S A;  5A5C A;  1W8A A;  3DZE A;  3VQ2 A;  2Z63 A;  2O6S A;  4R5C A;  4BSS A;  5HZL B;  3REZ A;  3RGX A;  4MQW X;  5D3I A;  2O6R A;  4FD0 A;  3UL7 A;  2Z82 A; 
#chains in the Genus database with same CATH topology
 2WQU A;  3G3A A;  3VQ1 A;  1KOH A;  5GS0 A;  2P1P B;  2UZY A;  2AST B;  2CA6 A;  1A4Y A;  4ECO A;  4U09 A;  5IYX C;  3UL9 A;  3P72 A;  4J0M A;  4RCW A;  4AW4 A;  1H6U A;  1XCD A;  1ZIW A;  4PSJ A;  2OMT A;  4XSQ A;  1Z7X W;  2OMX A;  1O6S A;  4LXR A;  5GQR K;  3RGZ A;  2ELL A;  4R07 A;  2P1Q B;  3WN4 A;  4CNC A;  3ULA A;  5IJB A;  2UZX A;  3CIG A;  4C2B B;  4YEB B;  3ZYJ A;  4R6A A;  4RCA B;  4FMZ A;  4QC0 A;  4U08 A;  4ARR A;  2P1M B;  2V9T B;  4R5D A;  5GMF A;  3RFJ A;  4V2E A;  4CIL A;  2WQW A;  4HQ1 A;  3E2J A;  2P1O B;  2BEX A;  4CC4 C;  4R6G A;  2IFG A;  2R9U A;  5B4P A;  1O6T A;  4FS7 A;  3E4G A;  4QBZ A;  4WYK A;  2Z64 A;  4Q62 A;  4CC4 A;  2Q4G W;  5AWA A;  3G39 A;  4U7L A;  4Y61 B;  4TZH A;  2JE1 A;  1A9N A;  4NKG A;  3RW6 A;  5IJC A;  1JL5 A;  1FO1 A;  2OMW A;  4LSA A;  4M7E C;  5CMP A;  3G04 C;  3O6N A;  4P91 A;  2Z7X A;  4V2C A;  4M7E A;  3CIY A;  3A79 B;  3OJA A;  5LFN A;  4H09 A;  2JQD A;  2BNH A;  3BZ5 A;  4Z8G A;  4ECN A;  4LSX A;  3W3J A;  1OTN A;  4BV4 R;  1P8T A;  3CVR A;  2WQX A;  4WP6 A;  2OMU A;  2O6Q A;  1H6T A;  3E6J A;  2A0Z A;  3OGM B;  4UFR A;  3WPE A;  2Y5Q A;  1OTO A;  2Z65 A;  1U0N D;  1DFJ I;  2V9S A;  4Z79 A;  1XEU A;  3KJ4 A;  5FTT B;  4BSU A;  4ARN A;  2OMZ A;  1OGQ A;  1QYY A;  1K5G C;  3WPI A;  4KXF B;  1OTM A;  2V70 A;  5B0N A;  4LXS A;  3WPB A;  3PMH G;  2JE0 A;  3WPG A;  1D0B A;  4Z61 C;  4PKI G;  4OQT A;  1XWD C;  4P8S A;  4R08 A;  3W3L A;  4XOS A;  1O6V A;  5AWC A;  1P9A G;  1XKU A;  3WPH A;  3W3M A;  1FQV A;  2Z7X B;  4FHO A;  3OJA B;  5GMG A;  2P1N B;  2WQV A;  4R09 A;  3ZYO A;  4V2D A;  1WWL A;  4L3F A;  1P8V A;  1OZN A;  4Q3G A;  2Z81 A;  3ZYN A;  3W3N A;  3C6O B;  4K17 A;  4GLP A;  3OGL B;  1GWB A;  5AZ5 A;  1M9L A;  4GT6 A;  1SQ0 B;  1FT8 A;  4LI1 A;  4LSC A;  2Z62 A;  3ULU A;  3C6N B;  4EZG A;  4LSX C;  2Z66 A;  3RW7 A;  5B0T A;  4L3A A;  4FCG A;  2RR6 A;  4G8A A;  2ASS B;  3G06 A;  3C6P B;  3ZYI A;  3W3G A;  1XEC A;  4B8C D;  5GS2 B;  4IM6 A;  1M10 B;  4XGO A;  4RWT C;  4PER A;  5IJD A;  4Z94 G;  1M0Z A;  3G3B A;  4I6J B;  3M18 A;  4Q3I A;  3RJ0 A;  3GOZ A;  4KT1 A;  1KOO A;  1G9U A;  4NZR M;  3JB9 j;  3UN9 A;  3SB4 A;  4U06 A;  1DS9 A;  4PQ8 A;  3ULV A;  2WFH A;  1YRG A;  3TSR E;  5GMH A;  2OMV A;  3RFE A;  1FS2 A;  5CMN A;  2OMY A;  4NZT M;  4CNM A;  4Z64 C;  3O53 A;  2XOT A;  1LTX A;  4KNG A;  3OGK B;  1DCE A;  4AY9 X;  5AWD A;  4R0A A;  1IO0 A;  5HDH A;  2ID5 A;  1K5D C;  2FT3 A;  2RA8 A;  4FDW A;  4BSR A;  3RIZ A;  3WPC A;  4LI2 A;  2XWT C;  5AWB A;  4J4L A;  4R58 A;  3W3K A;  4PEQ B;  3WPD A;  3RFS A;  1OOK G;  1PGV A;  3FXI A;  3WPF A;  3M19 A;  4R6J A;  4C2A B;  3E3Z A;  4R6F A;  4MN8 B;  4QXE A;  4NKH A;  3UL8 A;  4CP6 A;  1M9S A;  5A5C A;  1W8A A;  3DZE A;  3VQ2 A;  2Z63 A;  2O6S A;  4R5C A;  4BSS A;  5HZL B;  3REZ A;  3RGX A;  4MQW X;  5D3I A;  2O6R A;  4FD0 A;  3UL7 A;  2Z82 A; 
#chains in the Genus database with same CATH homology
 2WQU A;  3G3A A;  3VQ1 A;  1KOH A;  5GS0 A;  2P1P B;  2UZY A;  2AST B;  2CA6 A;  1A4Y A;  4ECO A;  4U09 A;  5IYX C;  3UL9 A;  3P72 A;  4J0M A;  4RCW A;  4AW4 A;  1H6U A;  1XCD A;  1ZIW A;  4PSJ A;  2OMT A;  4XSQ A;  1Z7X W;  2OMX A;  1O6S A;  4LXR A;  5GQR K;  3RGZ A;  2ELL A;  4R07 A;  2P1Q B;  3WN4 A;  4CNC A;  3ULA A;  5IJB A;  2UZX A;  3CIG A;  4C2B B;  4YEB B;  3ZYJ A;  4R6A A;  4RCA B;  4FMZ A;  4QC0 A;  4U08 A;  4ARR A;  2P1M B;  2V9T B;  4R5D A;  5GMF A;  3RFJ A;  4V2E A;  4CIL A;  2WQW A;  4HQ1 A;  3E2J A;  2P1O B;  2BEX A;  4CC4 C;  4R6G A;  2IFG A;  2R9U A;  5B4P A;  1O6T A;  4FS7 A;  3E4G A;  4QBZ A;  4WYK A;  2Z64 A;  4Q62 A;  4CC4 A;  2Q4G W;  5AWA A;  3G39 A;  4U7L A;  4Y61 B;  4TZH A;  2JE1 A;  1A9N A;  4NKG A;  3RW6 A;  5IJC A;  1JL5 A;  1FO1 A;  2OMW A;  4LSA A;  4M7E C;  5CMP A;  3G04 C;  3O6N A;  4P91 A;  2Z7X A;  4V2C A;  4M7E A;  3CIY A;  3A79 B;  3OJA A;  5LFN A;  4H09 A;  2JQD A;  2BNH A;  3BZ5 A;  4Z8G A;  4ECN A;  4LSX A;  3W3J A;  1OTN A;  4BV4 R;  1P8T A;  3CVR A;  2WQX A;  4WP6 A;  2OMU A;  2O6Q A;  1H6T A;  3E6J A;  2A0Z A;  3OGM B;  4UFR A;  3WPE A;  2Y5Q A;  1OTO A;  2Z65 A;  1U0N D;  1DFJ I;  2V9S A;  4Z79 A;  1XEU A;  3KJ4 A;  5FTT B;  4BSU A;  4ARN A;  2OMZ A;  1OGQ A;  1QYY A;  1K5G C;  3WPI A;  4KXF B;  1OTM A;  2V70 A;  5B0N A;  4LXS A;  3WPB A;  3PMH G;  2JE0 A;  3WPG A;  1D0B A;  4Z61 C;  4PKI G;  4OQT A;  1XWD C;  4P8S A;  4R08 A;  3W3L A;  4XOS A;  1O6V A;  5AWC A;  1P9A G;  1XKU A;  3WPH A;  3W3M A;  1FQV A;  2Z7X B;  4FHO A;  3OJA B;  5GMG A;  2P1N B;  2WQV A;  4R09 A;  3ZYO A;  4V2D A;  1WWL A;  4L3F A;  1P8V A;  1OZN A;  4Q3G A;  2Z81 A;  3ZYN A;  3W3N A;  3C6O B;  4K17 A;  4GLP A;  3OGL B;  1GWB A;  5AZ5 A;  1M9L A;  4GT6 A;  1SQ0 B;  1FT8 A;  4LI1 A;  4LSC A;  2Z62 A;  3ULU A;  3C6N B;  4EZG A;  4LSX C;  2Z66 A;  3RW7 A;  5B0T A;  4L3A A;  4FCG A;  2RR6 A;  4G8A A;  2ASS B;  3G06 A;  3C6P B;  3ZYI A;  3W3G A;  1XEC A;  4B8C D;  5GS2 B;  4IM6 A;  1M10 B;  4XGO A;  4RWT C;  4PER A;  5IJD A;  4Z94 G;  1M0Z A;  3G3B A;  4I6J B;  3M18 A;  4Q3I A;  3RJ0 A;  3GOZ A;  4KT1 A;  1KOO A;  1G9U A;  3JB9 j;  3UN9 A;  3SB4 A;  4U06 A;  1DS9 A;  4PQ8 A;  3ULV A;  2WFH A;  1YRG A;  3TSR E;  5GMH A;  2OMV A;  3RFE A;  1FS2 A;  5CMN A;  2OMY A;  4CNM A;  4Z64 C;  3O53 A;  2XOT A;  1LTX A;  4KNG A;  3OGK B;  1DCE A;  4AY9 X;  5AWD A;  4R0A A;  1IO0 A;  5HDH A;  2ID5 A;  1K5D C;  2FT3 A;  2RA8 A;  4FDW A;  4BSR A;  3RIZ A;  3WPC A;  4LI2 A;  2XWT C;  5AWB A;  4J4L A;  4R58 A;  3W3K A;  4PEQ B;  3WPD A;  3RFS A;  1OOK G;  1PGV A;  3FXI A;  3WPF A;  3M19 A;  4R6J A;  4C2A B;  3E3Z A;  4R6F A;  4MN8 B;  4QXE A;  4NKH A;  3UL8 A;  4CP6 A;  1M9S A;  5A5C A;  1W8A A;  3DZE A;  3VQ2 A;  2Z63 A;  2O6S A;  4R5C A;  4BSS A;  5HZL B;  3REZ A;  3RGX A;  4MQW X;  5D3I A;  2O6R A;  4FD0 A;  3UL7 A;  2Z82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...