3UL8A

Crystal structure of the tv3 mutant v134l
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
277
structure length
277
Chain Sequence
EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVALETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 86
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ul8A00
3G06A 1P8VA 1QYYA 3OGMB 3WPDA 3G39A 3ULAA 1O6VA 2WQUA 3KJ4A 4Z94G 1JL5A 1PGVA 4MQWX 2OMZA 4ARRA 3G3AA 3WPEA 2Z66A 5B0TA 3C6NB 4RCWA 3RFEA 4RWTC 4QBZA 4H09A 2V9SA 2Z64A 3RW7A 3VQ2A 3A79B 4R6FA 3O6NA 2Z62A 4J4LA 5AWDA 4Y61B 3GOZA 2XOTA 3G3BA 1DS9A 4QXEA 4Z61C 5CMNA 5D3IA 1KOHA 4CC4A 2P1OB 1IO0A 1FS2A 3OJAA 4YEBB 4R09A 4LXRA 4BSUA 4FS7A 3WPFA 4AY9X 4R5CA 2UZYA 4CP6A 4LSXC 3W3LA 2ASSB 2Y5QA 5GS2B 3OGKB 3WPBA 3ZYNA 3WPHA 2P1QB 1OOKG 4BSSA 3RIZA 1OTMA 2A0ZA 4FMZA 4B8CD 3ZYJA 3RJ0A 2WFHA 4U06A 4EZGA 1A4YA 4LSCA 4PERA 1XEUA 3UL7A 2OMTA 5GMFA 4ARNA 4KXFB 2XWTC 4M7EA 3RW6A 4LI1A 1LTXA 1D0BA 3CVRA 4PEQB 3UL8A 3P72A 4R0AA 1Z7XW 5HDHA 4M7EC 2Z63A 4GT6A 2OMUA 3O53A 3JB9j 5AWCA 4KT1A 4ECOA 2JE1A 5IJCA 2JE0A 2P1NB 1O6TA 4NKGA 4PSJA 4C2BB 3RFSA 1XECA 2Q4GW 4R6GA 1WWLA 3CIGA 2OMVA 3WN4A 1H6TA 2OMXA 2Z7XB 3UL9A 2Z65A 3RFJA 1XKUA 4R6AA 2V70A 4CNMA 5GS0A 1OTOA 3E6JA 4KNGA 3M18A 3DZEA 1M0ZA 1FQVA 3ULUA 1G9UA 4V2EA 4FDWA 4R6JA 5AWBA 1XCDA 1W8AA 1OZNA 1P8TA 3E4GA 5GMHA 4PKIG 4CILA 1M9SA 4CC4C 1GWBA 3SB4A 4IM6A 2O6SA 4QC0A 4Z64C 4LXSA 4Q3IA 3CIYA 5AZ5A 4UFRA 2O6QA 3FXIA 4BSRA 1K5GC 4XSQA 4RCAB 5GMGA 1OGQA 4Z8GA 4I6JB 2JQDA 3REZA 4MN8B 3VQ1A 3WPCA 2BNHA 3W3GA 5AWAA 4XOSA 3C6OB 4FCGA 3W3JA 4FD0A 5IJBA 2ID5A 2RA8A 4K17A 1KOOA 3BZ5A 4CNCA 2UZXA 3PMHG 3UN9A 4NKHA 3W3KA 2Z7XA 1FT8A 4C2AB 3W3MA 1M9LA 1ZIWA 1DFJI 3TSRE 5HZLB 4TZHA 4R58A 4U08A 4HQ1A 4U09A 2RR6A 1SQ0B 4WP6A 2FT3A 1O6SA 4L3FA 4PQ8A 3E2JA 3OGLB 4XGOA 3RGXA 4Q62A 2IFGA 2ELLA 3WPIA 5B0NA 1P9AG 3ZYOA 1DCEA 2CA6A 4ECNA 4R08A 2R9UA 3WPGA 2Z81A 2WQXA 1A9NA 5IYXC 3RGZA 3W3NA 4P8SA 4AW4A 2WQVA 4LSXA 4L3AA 4V2DA 4P91A 2V9TB 4FHOA 4GLPA 1FO1A 2P1MB 2OMYA 1M10B 4BV4R 5IJDA 1OTNA 2BEXA 2ASTB 2OMWA 4WYKA 5A5CA 3OJAB 1YRGA 4LSAA 4U7LA 2P1PB 3C6PB 3ULVA 3M19A 4R07A 4R5DA 5GQRK 3ZYIA 4Q3GA 5B4PA 5LFNA 2WQWA 1H6UA 3G04C 4V2CA 2O6RA 2Z82A 5CMPA 1XWDC 1K5DC 4G8AA 4Z79A 3E3ZA 4LI2A 1U0ND 5FTTB 4J0MA 4OQTA
chains in the Genus database with same CATH superfamily
3G06A 1P8VA 1QYYA 3OGMB 3WPDA 3G39A 3ULAA 1O6VA 2WQUA 3KJ4A 4Z94G 1JL5A 1PGVA 4MQWX 2OMZA 4ARRA 3G3AA 3WPEA 2Z66A 5B0TA 3C6NB 4RCWA 3RFEA 4RWTC 4QBZA 4H09A 2V9SA 2Z64A 3RW7A 3VQ2A 3A79B 4R6FA 3O6NA 2Z62A 4J4LA 5AWDA 4Y61B 3GOZA 2XOTA 3G3BA 1DS9A 4QXEA 4Z61C 5CMNA 5D3IA 1KOHA 4CC4A 2P1OB 1IO0A 1FS2A 3OJAA 4YEBB 4NZTM 4LXRA 4BSUA 4R09A 4FS7A 3WPFA 4AY9X 4R5CA 2UZYA 4CP6A 4LSXC 3W3LA 2ASSB 2Y5QA 5GS2B 3OGKB 3WPBA 3ZYNA 3WPHA 2P1QB 1OOKG 4BSSA 3RIZA 1OTMA 2A0ZA 4FMZA 4B8CD 3ZYJA 3RJ0A 2WFHA 4U06A 4EZGA 1A4YA 4LSCA 4PERA 1XEUA 3UL7A 2OMTA 5GMFA 4ARNA 4KXFB 2XWTC 4M7EA 3RW6A 4LI1A 1LTXA 1D0BA 3CVRA 4PEQB 3UL8A 3P72A 4R0AA 1Z7XW 5HDHA 4M7EC 2Z63A 4GT6A 2OMUA 3O53A 3JB9j 5AWCA 4KT1A 4ECOA 2JE1A 5IJCA 2JE0A 2P1NB 1O6TA 4NKGA 4PSJA 4C2BB 3RFSA 1XECA 2Q4GW 4R6GA 1WWLA 3CIGA 2OMVA 3WN4A 1H6TA 2OMXA 2Z7XB 3UL9A 2Z65A 3RFJA 1XKUA 4R6AA 2V70A 4CNMA 5GS0A 1OTOA 3E6JA 4KNGA 3M18A 3DZEA 1M0ZA 1FQVA 3ULUA 1G9UA 4V2EA 4FDWA 4R6JA 5AWBA 1XCDA 1W8AA 1OZNA 1P8TA 3E4GA 5GMHA 4PKIG 4CILA 1M9SA 4CC4C 1GWBA 3SB4A 4IM6A 2O6SA 4QC0A 4Z64C 4LXSA 4Q3IA 3CIYA 5AZ5A 4UFRA 2O6QA 3FXIA 4BSRA 1K5GC 4XSQA 4RCAB 4NZRM 5GMGA 1OGQA 4Z8GA 4I6JB 2JQDA 3REZA 4MN8B 3VQ1A 3WPCA 2BNHA 3W3GA 5AWAA 4XOSA 3C6OB 4FCGA 3W3JA 4FD0A 5IJBA 2ID5A 2RA8A 4K17A 1KOOA 3BZ5A 4CNCA 2UZXA 3PMHG 3UN9A 4NKHA 3W3KA 2Z7XA 1FT8A 4C2AB 3W3MA 1M9LA 1ZIWA 1DFJI 3TSRE 5HZLB 4TZHA 4R58A 4U08A 4HQ1A 4U09A 2RR6A 1SQ0B 4WP6A 2FT3A 1O6SA 4L3FA 4PQ8A 3E2JA 3OGLB 4XGOA 3RGXA 4Q62A 2IFGA 2ELLA 3WPIA 5B0NA 1P9AG 3ZYOA 1DCEA 2CA6A 4ECNA 4R08A 2R9UA 3WPGA 2Z81A 2WQXA 1A9NA 5IYXC 3RGZA 3W3NA 4P8SA 4AW4A 2WQVA 4LSXA 4L3AA 4V2DA 4P91A 2V9TB 4FHOA 4GLPA 1FO1A 2P1MB 2OMYA 1M10B 4BV4R 5IJDA 1OTNA 2BEXA 2ASTB 2OMWA 4WYKA 5A5CA 3OJAB 1YRGA 4LSAA 4U7LA 2P1PB 3C6PB 3ULVA 3M19A 4R07A 4R5DA 5GQRK 3ZYIA 4Q3GA 5B4PA 5LFNA 2WQWA 1H6UA 3G04C 4V2CA 2O6RA 2Z82A 5CMPA 1XWDC 1K5DC 4G8AA 4Z79A 3E3ZA 4LI2A 1U0ND 5FTTB 4J0MA 4OQTA
chains in the Genus database with same CATH topology
3G06A 1P8VA 1QYYA 3OGMB 3WPDA 3G39A 3ULAA 1O6VA 2WQUA 3KJ4A 4Z94G 1JL5A 1PGVA 4MQWX 2OMZA 4ARRA 3G3AA 3WPEA 2Z66A 5B0TA 3C6NB 4RCWA 3RFEA 4RWTC 4QBZA 4H09A 2V9SA 2Z64A 3RW7A 3VQ2A 3A79B 4R6FA 3O6NA 2Z62A 4J4LA 5AWDA 4Y61B 3GOZA 2XOTA 3G3BA 1DS9A 4QXEA 4Z61C 5CMNA 5D3IA 1KOHA 4CC4A 2P1OB 1IO0A 1FS2A 3OJAA 4YEBB 4R09A 4LXRA 4BSUA 4FS7A 3WPFA 4AY9X 4R5CA 2UZYA 4CP6A 4LSXC 3W3LA 2ASSB 2Y5QA 5GS2B 3OGKB 3WPBA 3ZYNA 3WPHA 2P1QB 1OOKG 4BSSA 3RIZA 1OTMA 2A0ZA 4FMZA 4B8CD 3ZYJA 3RJ0A 2WFHA 4U06A 4EZGA 1A4YA 4LSCA 4PERA 1XEUA 3UL7A 2OMTA 5GMFA 4ARNA 4KXFB 2XWTC 4M7EA 3RW6A 4LI1A 1LTXA 1D0BA 3CVRA 4PEQB 3UL8A 3P72A 4R0AA 1Z7XW 5HDHA 4M7EC 2Z63A 4GT6A 2OMUA 3O53A 3JB9j 5AWCA 4KT1A 4ECOA 2JE1A 5IJCA 2JE0A 2P1NB 1O6TA 4NKGA 4PSJA 4C2BB 3RFSA 1XECA 2Q4GW 4R6GA 1WWLA 3CIGA 2OMVA 3WN4A 1H6TA 2OMXA 2Z7XB 3UL9A 2Z65A 3RFJA 1XKUA 4R6AA 2V70A 4CNMA 5GS0A 1OTOA 3E6JA 4KNGA 3M18A 3DZEA 1M0ZA 1FQVA 3ULUA 1G9UA 4V2EA 4FDWA 4R6JA 5AWBA 1XCDA 1W8AA 1OZNA 1P8TA 3E4GA 5GMHA 4PKIG 4CILA 1M9SA 4CC4C 1GWBA 3SB4A 4IM6A 2O6SA 4QC0A 4Z64C 4LXSA 4Q3IA 3CIYA 5AZ5A 4UFRA 2O6QA 3FXIA 4BSRA 1K5GC 4XSQA 4RCAB 5GMGA 1OGQA 4Z8GA 4I6JB 2JQDA 3REZA 4MN8B 3VQ1A 3WPCA 2BNHA 3W3GA 5AWAA 4XOSA 3C6OB 4FCGA 3W3JA 4FD0A 5IJBA 2ID5A 2RA8A 4K17A 1KOOA 3BZ5A 4CNCA 2UZXA 3PMHG 3UN9A 4NKHA 3W3KA 2Z7XA 1FT8A 4C2AB 3W3MA 1M9LA 1ZIWA 1DFJI 3TSRE 5HZLB 4TZHA 4R58A 4U08A 4HQ1A 4U09A 2RR6A 1SQ0B 4WP6A 2FT3A 1O6SA 4L3FA 4PQ8A 3E2JA 3OGLB 4XGOA 3RGXA 4Q62A 2IFGA 2ELLA 3WPIA 5B0NA 1P9AG 3ZYOA 1DCEA 2CA6A 4ECNA 4R08A 2R9UA 3WPGA 2Z81A 2WQXA 1A9NA 5IYXC 3RGZA 3W3NA 4P8SA 4AW4A 2WQVA 4LSXA 4L3AA 4V2DA 4P91A 2V9TB 4FHOA 4GLPA 1FO1A 2P1MB 2OMYA 1M10B 4BV4R 5IJDA 1OTNA 2BEXA 2ASTB 2OMWA 4WYKA 5A5CA 3OJAB 1YRGA 4LSAA 4U7LA 2P1PB 3C6PB 3ULVA 3M19A 4R07A 4R5DA 5GQRK 3ZYIA 4Q3GA 5B4PA 5LFNA 2WQWA 1H6UA 3G04C 4V2CA 2O6RA 2Z82A 5CMPA 1XWDC 1K5DC 4G8AA 4Z79A 3E3ZA 4LI2A 1U0ND 5FTTB 4J0MA 4OQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G06 A;  1P8V A;  1QYY A;  3OGM B;  3WPD A;  3G39 A;  3ULA A;  1O6V A;  2WQU A;  3KJ4 A;  4Z94 G;  1JL5 A;  1PGV A;  4MQW X;  2OMZ A;  4ARR A;  3G3A A;  3WPE A;  2Z66 A;  5B0T A;  3C6N B;  4RCW A;  3RFE A;  4RWT C;  4QBZ A;  4H09 A;  2V9S A;  2Z64 A;  3RW7 A;  3VQ2 A;  3A79 B;  4R6F A;  3O6N A;  2Z62 A;  4J4L A;  5AWD A;  4Y61 B;  3GOZ A;  2XOT A;  3G3B A;  1DS9 A;  4QXE A;  4Z61 C;  5CMN A;  5D3I A;  1KOH A;  4CC4 A;  2P1O B;  1IO0 A;  1FS2 A;  3OJA A;  4YEB B;  4R09 A;  4LXR A;  4BSU A;  4FS7 A;  3WPF A;  4AY9 X;  4R5C A;  2UZY A;  4CP6 A;  4LSX C;  3W3L A;  2ASS B;  2Y5Q A;  5GS2 B;  3OGK B;  3WPB A;  3ZYN A;  3WPH A;  2P1Q B;  1OOK G;  4BSS A;  3RIZ A;  1OTM A;  2A0Z A;  4FMZ A;  4B8C D;  3ZYJ A;  3RJ0 A;  2WFH A;  4U06 A;  4EZG A;  1A4Y A;  4LSC A;  4PER A;  1XEU A;  3UL7 A;  2OMT A;  5GMF A;  4ARN A;  4KXF B;  2XWT C;  4M7E A;  3RW6 A;  4LI1 A;  1LTX A;  1D0B A;  3CVR A;  4PEQ B;  3UL8 A;  3P72 A;  4R0A A;  1Z7X W;  5HDH A;  4M7E C;  2Z63 A;  4GT6 A;  2OMU A;  3O53 A;  3JB9 j;  5AWC A;  4KT1 A;  4ECO A;  2JE1 A;  5IJC A;  2JE0 A;  2P1N B;  1O6T A;  4NKG A;  4PSJ A;  4C2B B;  3RFS A;  1XEC A;  2Q4G W;  4R6G A;  1WWL A;  3CIG A;  2OMV A;  3WN4 A;  1H6T A;  2OMX A;  2Z7X B;  3UL9 A;  2Z65 A;  3RFJ A;  1XKU A;  4R6A A;  2V70 A;  4CNM A;  5GS0 A;  1OTO A;  3E6J A;  4KNG A;  3M18 A;  3DZE A;  1M0Z A;  1FQV A;  3ULU A;  1G9U A;  4V2E A;  4FDW A;  4R6J A;  5AWB A;  1XCD A;  1W8A A;  1OZN A;  1P8T A;  3E4G A;  5GMH A;  4PKI G;  4CIL A;  1M9S A;  4CC4 C;  1GWB A;  3SB4 A;  4IM6 A;  2O6S A;  4QC0 A;  4Z64 C;  4LXS A;  4Q3I A;  3CIY A;  5AZ5 A;  4UFR A;  2O6Q A;  3FXI A;  4BSR A;  1K5G C;  4XSQ A;  4RCA B;  5GMG A;  1OGQ A;  4Z8G A;  4I6J B;  2JQD A;  3REZ A;  4MN8 B;  3VQ1 A;  3WPC A;  2BNH A;  3W3G A;  5AWA A;  4XOS A;  3C6O B;  4FCG A;  3W3J A;  4FD0 A;  5IJB A;  2ID5 A;  2RA8 A;  4K17 A;  1KOO A;  3BZ5 A;  4CNC A;  2UZX A;  3PMH G;  3UN9 A;  4NKH A;  3W3K A;  2Z7X A;  1FT8 A;  4C2A B;  3W3M A;  1M9L A;  1ZIW A;  1DFJ I;  3TSR E;  5HZL B;  4TZH A;  4R58 A;  4U08 A;  4HQ1 A;  4U09 A;  2RR6 A;  1SQ0 B;  4WP6 A;  2FT3 A;  1O6S A;  4L3F A;  4PQ8 A;  3E2J A;  3OGL B;  4XGO A;  3RGX A;  4Q62 A;  2IFG A;  2ELL A;  3WPI A;  5B0N A;  1P9A G;  3ZYO A;  1DCE A;  2CA6 A;  4ECN A;  4R08 A;  2R9U A;  3WPG A;  2Z81 A;  2WQX A;  1A9N A;  5IYX C;  3RGZ A;  3W3N A;  4P8S A;  4AW4 A;  2WQV A;  4LSX A;  4L3A A;  4V2D A;  4P91 A;  2V9T B;  4FHO A;  4GLP A;  1FO1 A;  2P1M B;  2OMY A;  1M10 B;  4BV4 R;  5IJD A;  1OTN A;  2BEX A;  2AST B;  2OMW A;  4WYK A;  5A5C A;  3OJA B;  1YRG A;  4LSA A;  4U7L A;  2P1P B;  3C6P B;  3ULV A;  3M19 A;  4R07 A;  4R5D A;  5GQR K;  3ZYI A;  4Q3G A;  5B4P A;  5LFN A;  2WQW A;  1H6U A;  3G04 C;  4V2C A;  2O6R A;  2Z82 A;  5CMP A;  1XWD C;  1K5D C;  4G8A A;  4Z79 A;  3E3Z A;  4LI2 A;  1U0N D;  5FTT B;  4J0M A;  4OQT A; 
#chains in the Genus database with same CATH topology
 3G06 A;  1P8V A;  1QYY A;  3OGM B;  3WPD A;  3G39 A;  3ULA A;  1O6V A;  2WQU A;  3KJ4 A;  4Z94 G;  1JL5 A;  1PGV A;  4MQW X;  2OMZ A;  4ARR A;  3G3A A;  3WPE A;  2Z66 A;  5B0T A;  3C6N B;  4RCW A;  3RFE A;  4RWT C;  4QBZ A;  4H09 A;  2V9S A;  2Z64 A;  3RW7 A;  3VQ2 A;  3A79 B;  4R6F A;  3O6N A;  2Z62 A;  4J4L A;  5AWD A;  4Y61 B;  3GOZ A;  2XOT A;  3G3B A;  1DS9 A;  4QXE A;  4Z61 C;  5CMN A;  5D3I A;  1KOH A;  4CC4 A;  2P1O B;  1IO0 A;  1FS2 A;  3OJA A;  4YEB B;  4NZT M;  4LXR A;  4BSU A;  4R09 A;  4FS7 A;  3WPF A;  4AY9 X;  4R5C A;  2UZY A;  4CP6 A;  4LSX C;  3W3L A;  2ASS B;  2Y5Q A;  5GS2 B;  3OGK B;  3WPB A;  3ZYN A;  3WPH A;  2P1Q B;  1OOK G;  4BSS A;  3RIZ A;  1OTM A;  2A0Z A;  4FMZ A;  4B8C D;  3ZYJ A;  3RJ0 A;  2WFH A;  4U06 A;  4EZG A;  1A4Y A;  4LSC A;  4PER A;  1XEU A;  3UL7 A;  2OMT A;  5GMF A;  4ARN A;  4KXF B;  2XWT C;  4M7E A;  3RW6 A;  4LI1 A;  1LTX A;  1D0B A;  3CVR A;  4PEQ B;  3UL8 A;  3P72 A;  4R0A A;  1Z7X W;  5HDH A;  4M7E C;  2Z63 A;  4GT6 A;  2OMU A;  3O53 A;  3JB9 j;  5AWC A;  4KT1 A;  4ECO A;  2JE1 A;  5IJC A;  2JE0 A;  2P1N B;  1O6T A;  4NKG A;  4PSJ A;  4C2B B;  3RFS A;  1XEC A;  2Q4G W;  4R6G A;  1WWL A;  3CIG A;  2OMV A;  3WN4 A;  1H6T A;  2OMX A;  2Z7X B;  3UL9 A;  2Z65 A;  3RFJ A;  1XKU A;  4R6A A;  2V70 A;  4CNM A;  5GS0 A;  1OTO A;  3E6J A;  4KNG A;  3M18 A;  3DZE A;  1M0Z A;  1FQV A;  3ULU A;  1G9U A;  4V2E A;  4FDW A;  4R6J A;  5AWB A;  1XCD A;  1W8A A;  1OZN A;  1P8T A;  3E4G A;  5GMH A;  4PKI G;  4CIL A;  1M9S A;  4CC4 C;  1GWB A;  3SB4 A;  4IM6 A;  2O6S A;  4QC0 A;  4Z64 C;  4LXS A;  4Q3I A;  3CIY A;  5AZ5 A;  4UFR A;  2O6Q A;  3FXI A;  4BSR A;  1K5G C;  4XSQ A;  4RCA B;  4NZR M;  5GMG A;  1OGQ A;  4Z8G A;  4I6J B;  2JQD A;  3REZ A;  4MN8 B;  3VQ1 A;  3WPC A;  2BNH A;  3W3G A;  5AWA A;  4XOS A;  3C6O B;  4FCG A;  3W3J A;  4FD0 A;  5IJB A;  2ID5 A;  2RA8 A;  4K17 A;  1KOO A;  3BZ5 A;  4CNC A;  2UZX A;  3PMH G;  3UN9 A;  4NKH A;  3W3K A;  2Z7X A;  1FT8 A;  4C2A B;  3W3M A;  1M9L A;  1ZIW A;  1DFJ I;  3TSR E;  5HZL B;  4TZH A;  4R58 A;  4U08 A;  4HQ1 A;  4U09 A;  2RR6 A;  1SQ0 B;  4WP6 A;  2FT3 A;  1O6S A;  4L3F A;  4PQ8 A;  3E2J A;  3OGL B;  4XGO A;  3RGX A;  4Q62 A;  2IFG A;  2ELL A;  3WPI A;  5B0N A;  1P9A G;  3ZYO A;  1DCE A;  2CA6 A;  4ECN A;  4R08 A;  2R9U A;  3WPG A;  2Z81 A;  2WQX A;  1A9N A;  5IYX C;  3RGZ A;  3W3N A;  4P8S A;  4AW4 A;  2WQV A;  4LSX A;  4L3A A;  4V2D A;  4P91 A;  2V9T B;  4FHO A;  4GLP A;  1FO1 A;  2P1M B;  2OMY A;  1M10 B;  4BV4 R;  5IJD A;  1OTN A;  2BEX A;  2AST B;  2OMW A;  4WYK A;  5A5C A;  3OJA B;  1YRG A;  4LSA A;  4U7L A;  2P1P B;  3C6P B;  3ULV A;  3M19 A;  4R07 A;  4R5D A;  5GQR K;  3ZYI A;  4Q3G A;  5B4P A;  5LFN A;  2WQW A;  1H6U A;  3G04 C;  4V2C A;  2O6R A;  2Z82 A;  5CMP A;  1XWD C;  1K5D C;  4G8A A;  4Z79 A;  3E3Z A;  4LI2 A;  1U0N D;  5FTT B;  4J0M A;  4OQT A; 
#chains in the Genus database with same CATH homology
 3G06 A;  1P8V A;  1QYY A;  3OGM B;  3WPD A;  3G39 A;  3ULA A;  1O6V A;  2WQU A;  3KJ4 A;  4Z94 G;  1JL5 A;  1PGV A;  4MQW X;  2OMZ A;  4ARR A;  3G3A A;  3WPE A;  2Z66 A;  5B0T A;  3C6N B;  4RCW A;  3RFE A;  4RWT C;  4QBZ A;  4H09 A;  2V9S A;  2Z64 A;  3RW7 A;  3VQ2 A;  3A79 B;  4R6F A;  3O6N A;  2Z62 A;  4J4L A;  5AWD A;  4Y61 B;  3GOZ A;  2XOT A;  3G3B A;  1DS9 A;  4QXE A;  4Z61 C;  5CMN A;  5D3I A;  1KOH A;  4CC4 A;  2P1O B;  1IO0 A;  1FS2 A;  3OJA A;  4YEB B;  4R09 A;  4LXR A;  4BSU A;  4FS7 A;  3WPF A;  4AY9 X;  4R5C A;  2UZY A;  4CP6 A;  4LSX C;  3W3L A;  2ASS B;  2Y5Q A;  5GS2 B;  3OGK B;  3WPB A;  3ZYN A;  3WPH A;  2P1Q B;  1OOK G;  4BSS A;  3RIZ A;  1OTM A;  2A0Z A;  4FMZ A;  4B8C D;  3ZYJ A;  3RJ0 A;  2WFH A;  4U06 A;  4EZG A;  1A4Y A;  4LSC A;  4PER A;  1XEU A;  3UL7 A;  2OMT A;  5GMF A;  4ARN A;  4KXF B;  2XWT C;  4M7E A;  3RW6 A;  4LI1 A;  1LTX A;  1D0B A;  3CVR A;  4PEQ B;  3UL8 A;  3P72 A;  4R0A A;  1Z7X W;  5HDH A;  4M7E C;  2Z63 A;  4GT6 A;  2OMU A;  3O53 A;  3JB9 j;  5AWC A;  4KT1 A;  4ECO A;  2JE1 A;  5IJC A;  2JE0 A;  2P1N B;  1O6T A;  4NKG A;  4PSJ A;  4C2B B;  3RFS A;  1XEC A;  2Q4G W;  4R6G A;  1WWL A;  3CIG A;  2OMV A;  3WN4 A;  1H6T A;  2OMX A;  2Z7X B;  3UL9 A;  2Z65 A;  3RFJ A;  1XKU A;  4R6A A;  2V70 A;  4CNM A;  5GS0 A;  1OTO A;  3E6J A;  4KNG A;  3M18 A;  3DZE A;  1M0Z A;  1FQV A;  3ULU A;  1G9U A;  4V2E A;  4FDW A;  4R6J A;  5AWB A;  1XCD A;  1W8A A;  1OZN A;  1P8T A;  3E4G A;  5GMH A;  4PKI G;  4CIL A;  1M9S A;  4CC4 C;  1GWB A;  3SB4 A;  4IM6 A;  2O6S A;  4QC0 A;  4Z64 C;  4LXS A;  4Q3I A;  3CIY A;  5AZ5 A;  4UFR A;  2O6Q A;  3FXI A;  4BSR A;  1K5G C;  4XSQ A;  4RCA B;  5GMG A;  1OGQ A;  4Z8G A;  4I6J B;  2JQD A;  3REZ A;  4MN8 B;  3VQ1 A;  3WPC A;  2BNH A;  3W3G A;  5AWA A;  4XOS A;  3C6O B;  4FCG A;  3W3J A;  4FD0 A;  5IJB A;  2ID5 A;  2RA8 A;  4K17 A;  1KOO A;  3BZ5 A;  4CNC A;  2UZX A;  3PMH G;  3UN9 A;  4NKH A;  3W3K A;  2Z7X A;  1FT8 A;  4C2A B;  3W3M A;  1M9L A;  1ZIW A;  1DFJ I;  3TSR E;  5HZL B;  4TZH A;  4R58 A;  4U08 A;  4HQ1 A;  4U09 A;  2RR6 A;  1SQ0 B;  4WP6 A;  2FT3 A;  1O6S A;  4L3F A;  4PQ8 A;  3E2J A;  3OGL B;  4XGO A;  3RGX A;  4Q62 A;  2IFG A;  2ELL A;  3WPI A;  5B0N A;  1P9A G;  3ZYO A;  1DCE A;  2CA6 A;  4ECN A;  4R08 A;  2R9U A;  3WPG A;  2Z81 A;  2WQX A;  1A9N A;  5IYX C;  3RGZ A;  3W3N A;  4P8S A;  4AW4 A;  2WQV A;  4LSX A;  4L3A A;  4V2D A;  4P91 A;  2V9T B;  4FHO A;  4GLP A;  1FO1 A;  2P1M B;  2OMY A;  1M10 B;  4BV4 R;  5IJD A;  1OTN A;  2BEX A;  2AST B;  2OMW A;  4WYK A;  5A5C A;  3OJA B;  1YRG A;  4LSA A;  4U7L A;  2P1P B;  3C6P B;  3ULV A;  3M19 A;  4R07 A;  4R5D A;  5GQR K;  3ZYI A;  4Q3G A;  5B4P A;  5LFN A;  2WQW A;  1H6U A;  3G04 C;  4V2C A;  2O6R A;  2Z82 A;  5CMP A;  1XWD C;  1K5D C;  4G8A A;  4Z79 A;  3E3Z A;  4LI2 A;  1U0N D;  5FTT B;  4J0M A;  4OQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...