3UL9A

Structure of the tv3 mutant m41e
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
276
Chain Sequence
PCVEVVPNITYQCEELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ul9A00
1Z7XW 3G39A 2WQUA 4YEBB 3WPDA 5IYXC 4UFRA 2XOTA 3RGZA 4CILA 2P1PB 1XKUA 5IJCA 1ZIWA 3G04C 3W3KA 2O6QA 5AWCA 3WPEA 3E2JA 4R0AA 5AWBA 4V2EA 2JE1A 3WPBA 4FMZA 4XSQA 2V9TB 3O53A 4U7LA 3A79B 2WFHA 4WP6A 2Q4GW 4LSXC 3RW7A 4R6GA 4P8SA 5IJDA 1O6TA 4ARRA 1P8TA 1FO1A 4R08A 4TZHA 2Z63A 1QYYA 3M18A 3JB9j 5D3IA 1PGVA 4K17A 3W3MA 1U0ND 4Z79A 4R6JA 5B4PA 3E4GA 1P8VA 3W3NA 4U06A 4OQTA 5GMGA 2V70A 3O6NA 4CNMA 4FDWA 4BV4R 3RFJA 1FT8A 4U08A 4PQ8A 3TSRE 3PMHG 1O6SA 4R5DA 4Z61C 4I6JB 2OMZA 1H6TA 4LSXA 4PKIG 3RW6A 4J0MA 2P1QB 2Z64A 3BZ5A 4AY9X 2V9SA 4QBZA 1H6UA 3VQ2A 1KOOA 2Z66A 1A9NA 2ASTB 4CNCA 4GLPA 4G8AA 3CIGA 3WPGA 3RJ0A 1KOHA 4AW4A 3UN9A 3GOZA 4MQWX 3REZA 4Y61B 3CVRA 4Q3GA 2WQWA 1M0ZA 2OMWA 3SB4A 1SQ0B 5HZLB 4CC4C 4BSSA 1DS9A 3W3GA 3M19A 4L3AA 4R07A 2RR6A 3OGKB 2OMTA 2CA6A 3OJAB 4V2DA 1OTOA 1XCDA 3RGXA 4C2AB 4XGOA 3ZYNA 4BSRA 2Z7XA 5FTTB 1OTMA 1OTNA 4C2BB 1LTXA 3WPFA 5GS2B 4ARNA 2ASSB 4LXSA 3ULAA 2JE0A 5AWDA 3C6NB 4BSUA 1XEUA 2OMXA 3KJ4A 4LI2A 1OGQA 4FD0A 4HQ1A 2OMUA 5IJBA 3ZYJA 1DCEA 5AZ5A 5CMNA 4R6AA 3RFSA 4RCAB 2ID5A 4CC4A 4RCWA 4R5CA 5GS0A 1OZNA 2Z65A 4WYKA 2OMVA 4FCGA 4Q3IA 4LSCA 4Q62A 2FT3A 5GMHA 1XECA 4P91A 4QXEA 2BNHA 4XOSA 4QC0A 1YRGA 3UL9A 2UZYA 4LXRA 4FS7A 2P1NB 4Z64C 4IM6A 4CP6A 4NKGA 1A4YA 4J4LA 4GT6A 3WN4A 2O6SA 3ULUA 1WWLA 4KNGA 4ECNA 4NKHA 3UL7A 4LI1A 3C6OB 1M9LA 5HDHA 4PEQB 4KXFB 2ELLA 3VQ1A 1DFJI 3DZEA 4FHOA 2Z82A 3ZYOA 4RWTC 2UZXA 2WQXA 3P72A 2Y5QA 3CIYA 2IFGA 5GMFA 5CMPA 3RFEA 1M10B 1M9SA 3G06A 5B0NA 1IO0A 5GQRK 2Z81A 3W3LA 2XWTC 3ULVA 4KT1A 1OOKG 4M7EC 4MN8B 4B8CD 4R6FA 3G3AA 2Z62A 1D0BA 2JQDA 2A0ZA 4U09A 4LSAA 4V2CA 3E3ZA 1K5GC 2BEXA 5B0TA 2OMYA 3WPCA 4R58A 1P9AG 3OGLB 5LFNA 4Z8GA 2RA8A 3C6PB 4L3FA 4EZGA 3UL8A 2WQVA 1FS2A 5AWAA 3OGMB 1GWBA 1W8AA 3OJAA 2P1OB 2R9UA 5A5CA 1XWDC 1K5DC 4Z94G 3RIZA 1O6VA 4ECOA 2P1MB 3FXIA 3ZYIA 4PERA 4R09A 3WPIA 1FQVA 1JL5A 4H09A 4M7EA 2O6RA 3E6JA 2Z7XB 3W3JA 3G3BA 4PSJA 3WPHA 1G9UA
chains in the Genus database with same CATH superfamily
1Z7XW 3G39A 2WQUA 4YEBB 3WPDA 5IYXC 4UFRA 2XOTA 3RGZA 4CILA 2P1PB 1XKUA 5IJCA 1ZIWA 3G04C 3W3KA 2O6QA 5AWCA 3WPEA 3E2JA 4R0AA 5AWBA 4V2EA 2JE1A 3WPBA 4FMZA 4XSQA 2V9TB 3O53A 4U7LA 3A79B 2WFHA 4WP6A 2Q4GW 4LSXC 3RW7A 4R6GA 4P8SA 5IJDA 1O6TA 4ARRA 1P8TA 1FO1A 4R08A 4TZHA 2Z63A 1QYYA 3M18A 3JB9j 5D3IA 1PGVA 4K17A 3W3MA 1U0ND 4Z79A 4R6JA 5B4PA 3E4GA 1P8VA 3W3NA 4U06A 4OQTA 5GMGA 2V70A 3O6NA 4CNMA 4FDWA 4BV4R 3RFJA 1FT8A 4U08A 4PQ8A 3TSRE 3PMHG 1O6SA 4R5DA 4Z61C 4I6JB 2OMZA 1H6TA 4LSXA 4PKIG 3RW6A 4J0MA 2P1QB 2Z64A 3BZ5A 4AY9X 2V9SA 4QBZA 1H6UA 3VQ2A 1KOOA 2Z66A 1A9NA 2ASTB 4CNCA 4GLPA 4G8AA 3CIGA 3WPGA 3RJ0A 1KOHA 4AW4A 3UN9A 3GOZA 4MQWX 3REZA 4Y61B 3CVRA 4Q3GA 2WQWA 1M0ZA 2OMWA 3SB4A 1SQ0B 5HZLB 4CC4C 4BSSA 1DS9A 3W3GA 3M19A 4L3AA 4R07A 2RR6A 3OGKB 2OMTA 2CA6A 3OJAB 4V2DA 1OTOA 1XCDA 3RGXA 4C2AB 4XGOA 3ZYNA 4BSRA 2Z7XA 5FTTB 1OTMA 1OTNA 4C2BB 1LTXA 3WPFA 5GS2B 4ARNA 2ASSB 4LXSA 3ULAA 2JE0A 5AWDA 3C6NB 4BSUA 1XEUA 2OMXA 3KJ4A 4LI2A 1OGQA 4FD0A 4HQ1A 2OMUA 5IJBA 3ZYJA 1DCEA 5AZ5A 5CMNA 4R6AA 3RFSA 4RCAB 2ID5A 4CC4A 4RCWA 4R5CA 5GS0A 1OZNA 2Z65A 4WYKA 2OMVA 4FCGA 4Q3IA 4LSCA 4Q62A 2FT3A 4NZRM 5GMHA 1XECA 4P91A 4QXEA 2BNHA 4XOSA 4QC0A 1YRGA 3UL9A 2UZYA 4LXRA 4FS7A 2P1NB 4Z64C 4IM6A 4CP6A 4NKGA 1A4YA 4J4LA 4GT6A 3WN4A 2O6SA 3ULUA 1WWLA 4KNGA 4ECNA 4NKHA 3UL7A 4LI1A 3C6OB 1M9LA 5HDHA 4PEQB 4KXFB 2ELLA 3VQ1A 1DFJI 3DZEA 4FHOA 2Z82A 3ZYOA 4RWTC 2UZXA 2WQXA 3P72A 4NZTM 2Y5QA 3CIYA 2IFGA 5GMFA 5CMPA 3RFEA 1M10B 1M9SA 3G06A 5B0NA 1IO0A 5GQRK 2Z81A 3W3LA 2XWTC 3ULVA 4KT1A 1OOKG 4M7EC 4MN8B 4B8CD 4R6FA 3G3AA 2Z62A 1D0BA 2JQDA 2A0ZA 4U09A 4LSAA 4V2CA 3E3ZA 1K5GC 2BEXA 5B0TA 2OMYA 3WPCA 4R58A 1P9AG 3OGLB 5LFNA 4Z8GA 2RA8A 3C6PB 4L3FA 4EZGA 3UL8A 2WQVA 1FS2A 5AWAA 3OGMB 1GWBA 1W8AA 3OJAA 2P1OB 2R9UA 5A5CA 1XWDC 1K5DC 4Z94G 3RIZA 1O6VA 4ECOA 2P1MB 3FXIA 3ZYIA 4PERA 4R09A 3WPIA 1FQVA 1JL5A 4H09A 4M7EA 2O6RA 3E6JA 2Z7XB 3W3JA 3G3BA 4PSJA 3WPHA 1G9UA
chains in the Genus database with same CATH topology
1Z7XW 3G39A 2WQUA 4YEBB 3WPDA 5IYXC 4UFRA 2XOTA 3RGZA 4CILA 2P1PB 1XKUA 5IJCA 1ZIWA 3G04C 3W3KA 2O6QA 5AWCA 3WPEA 3E2JA 4R0AA 5AWBA 4V2EA 2JE1A 3WPBA 4FMZA 4XSQA 2V9TB 3O53A 4U7LA 3A79B 2WFHA 4WP6A 2Q4GW 4LSXC 3RW7A 4R6GA 4P8SA 5IJDA 1O6TA 4ARRA 1P8TA 1FO1A 4R08A 4TZHA 2Z63A 1QYYA 3M18A 3JB9j 5D3IA 1PGVA 4K17A 3W3MA 1U0ND 4Z79A 4R6JA 5B4PA 3E4GA 1P8VA 3W3NA 4U06A 4OQTA 5GMGA 2V70A 3O6NA 4CNMA 4FDWA 4BV4R 3RFJA 1FT8A 4U08A 4PQ8A 3TSRE 3PMHG 1O6SA 4R5DA 4Z61C 4I6JB 2OMZA 1H6TA 4LSXA 4PKIG 3RW6A 4J0MA 2P1QB 2Z64A 3BZ5A 4AY9X 2V9SA 4QBZA 1H6UA 3VQ2A 1KOOA 2Z66A 1A9NA 2ASTB 4CNCA 4GLPA 4G8AA 3CIGA 3WPGA 3RJ0A 1KOHA 4AW4A 3UN9A 3GOZA 4MQWX 3REZA 4Y61B 3CVRA 4Q3GA 2WQWA 1M0ZA 2OMWA 3SB4A 1SQ0B 5HZLB 4CC4C 4BSSA 1DS9A 3W3GA 3M19A 4L3AA 4R07A 2RR6A 3OGKB 2OMTA 2CA6A 3OJAB 4V2DA 1OTOA 1XCDA 3RGXA 4C2AB 4XGOA 3ZYNA 4BSRA 2Z7XA 5FTTB 1OTMA 1OTNA 4C2BB 1LTXA 3WPFA 5GS2B 4ARNA 2ASSB 4LXSA 3ULAA 2JE0A 5AWDA 3C6NB 4BSUA 1XEUA 2OMXA 3KJ4A 4LI2A 1OGQA 4FD0A 4HQ1A 2OMUA 5IJBA 3ZYJA 1DCEA 5AZ5A 5CMNA 4R6AA 3RFSA 4RCAB 2ID5A 4CC4A 4RCWA 4R5CA 5GS0A 1OZNA 2Z65A 4WYKA 2OMVA 4FCGA 4Q3IA 4LSCA 4Q62A 2FT3A 5GMHA 1XECA 4P91A 4QXEA 2BNHA 4XOSA 4QC0A 1YRGA 3UL9A 2UZYA 4LXRA 4FS7A 2P1NB 4Z64C 4IM6A 4CP6A 4NKGA 1A4YA 4J4LA 4GT6A 3WN4A 2O6SA 3ULUA 1WWLA 4KNGA 4ECNA 4NKHA 3UL7A 4LI1A 3C6OB 1M9LA 5HDHA 4PEQB 4KXFB 2ELLA 3VQ1A 1DFJI 3DZEA 4FHOA 2Z82A 3ZYOA 4RWTC 2UZXA 2WQXA 3P72A 2Y5QA 3CIYA 2IFGA 5GMFA 5CMPA 3RFEA 1M10B 1M9SA 3G06A 5B0NA 1IO0A 5GQRK 2Z81A 3W3LA 2XWTC 3ULVA 4KT1A 1OOKG 4M7EC 4MN8B 4B8CD 4R6FA 3G3AA 2Z62A 1D0BA 2JQDA 2A0ZA 4U09A 4LSAA 4V2CA 3E3ZA 1K5GC 2BEXA 5B0TA 2OMYA 3WPCA 4R58A 1P9AG 3OGLB 5LFNA 4Z8GA 2RA8A 3C6PB 4L3FA 4EZGA 3UL8A 2WQVA 1FS2A 5AWAA 3OGMB 1GWBA 1W8AA 3OJAA 2P1OB 2R9UA 5A5CA 1XWDC 1K5DC 4Z94G 3RIZA 1O6VA 4ECOA 2P1MB 3FXIA 3ZYIA 4PERA 4R09A 3WPIA 1FQVA 1JL5A 4H09A 4M7EA 2O6RA 3E6JA 2Z7XB 3W3JA 3G3BA 4PSJA 3WPHA 1G9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7X W;  3G39 A;  2WQU A;  4YEB B;  3WPD A;  5IYX C;  4UFR A;  2XOT A;  3RGZ A;  4CIL A;  2P1P B;  1XKU A;  5IJC A;  1ZIW A;  3G04 C;  3W3K A;  2O6Q A;  5AWC A;  3WPE A;  3E2J A;  4R0A A;  5AWB A;  4V2E A;  2JE1 A;  3WPB A;  4FMZ A;  4XSQ A;  2V9T B;  3O53 A;  4U7L A;  3A79 B;  2WFH A;  4WP6 A;  2Q4G W;  4LSX C;  3RW7 A;  4R6G A;  4P8S A;  5IJD A;  1O6T A;  4ARR A;  1P8T A;  1FO1 A;  4R08 A;  4TZH A;  2Z63 A;  1QYY A;  3M18 A;  3JB9 j;  5D3I A;  1PGV A;  4K17 A;  3W3M A;  1U0N D;  4Z79 A;  4R6J A;  5B4P A;  3E4G A;  1P8V A;  3W3N A;  4U06 A;  4OQT A;  5GMG A;  2V70 A;  3O6N A;  4CNM A;  4FDW A;  4BV4 R;  3RFJ A;  1FT8 A;  4U08 A;  4PQ8 A;  3TSR E;  3PMH G;  1O6S A;  4R5D A;  4Z61 C;  4I6J B;  2OMZ A;  1H6T A;  4LSX A;  4PKI G;  3RW6 A;  4J0M A;  2P1Q B;  2Z64 A;  3BZ5 A;  4AY9 X;  2V9S A;  4QBZ A;  1H6U A;  3VQ2 A;  1KOO A;  2Z66 A;  1A9N A;  2AST B;  4CNC A;  4GLP A;  4G8A A;  3CIG A;  3WPG A;  3RJ0 A;  1KOH A;  4AW4 A;  3UN9 A;  3GOZ A;  4MQW X;  3REZ A;  4Y61 B;  3CVR A;  4Q3G A;  2WQW A;  1M0Z A;  2OMW A;  3SB4 A;  1SQ0 B;  5HZL B;  4CC4 C;  4BSS A;  1DS9 A;  3W3G A;  3M19 A;  4L3A A;  4R07 A;  2RR6 A;  3OGK B;  2OMT A;  2CA6 A;  3OJA B;  4V2D A;  1OTO A;  1XCD A;  3RGX A;  4C2A B;  4XGO A;  3ZYN A;  4BSR A;  2Z7X A;  5FTT B;  1OTM A;  1OTN A;  4C2B B;  1LTX A;  3WPF A;  5GS2 B;  4ARN A;  2ASS B;  4LXS A;  3ULA A;  2JE0 A;  5AWD A;  3C6N B;  4BSU A;  1XEU A;  2OMX A;  3KJ4 A;  4LI2 A;  1OGQ A;  4FD0 A;  4HQ1 A;  2OMU A;  5IJB A;  3ZYJ A;  1DCE A;  5AZ5 A;  5CMN A;  4R6A A;  3RFS A;  4RCA B;  2ID5 A;  4CC4 A;  4RCW A;  4R5C A;  5GS0 A;  1OZN A;  2Z65 A;  4WYK A;  2OMV A;  4FCG A;  4Q3I A;  4LSC A;  4Q62 A;  2FT3 A;  5GMH A;  1XEC A;  4P91 A;  4QXE A;  2BNH A;  4XOS A;  4QC0 A;  1YRG A;  3UL9 A;  2UZY A;  4LXR A;  4FS7 A;  2P1N B;  4Z64 C;  4IM6 A;  4CP6 A;  4NKG A;  1A4Y A;  4J4L A;  4GT6 A;  3WN4 A;  2O6S A;  3ULU A;  1WWL A;  4KNG A;  4ECN A;  4NKH A;  3UL7 A;  4LI1 A;  3C6O B;  1M9L A;  5HDH A;  4PEQ B;  4KXF B;  2ELL A;  3VQ1 A;  1DFJ I;  3DZE A;  4FHO A;  2Z82 A;  3ZYO A;  4RWT C;  2UZX A;  2WQX A;  3P72 A;  2Y5Q A;  3CIY A;  2IFG A;  5GMF A;  5CMP A;  3RFE A;  1M10 B;  1M9S A;  3G06 A;  5B0N A;  1IO0 A;  5GQR K;  2Z81 A;  3W3L A;  2XWT C;  3ULV A;  4KT1 A;  1OOK G;  4M7E C;  4MN8 B;  4B8C D;  4R6F A;  3G3A A;  2Z62 A;  1D0B A;  2JQD A;  2A0Z A;  4U09 A;  4LSA A;  4V2C A;  3E3Z A;  1K5G C;  2BEX A;  5B0T A;  2OMY A;  3WPC A;  4R58 A;  1P9A G;  3OGL B;  5LFN A;  4Z8G A;  2RA8 A;  3C6P B;  4L3F A;  4EZG A;  3UL8 A;  2WQV A;  1FS2 A;  5AWA A;  3OGM B;  1GWB A;  1W8A A;  3OJA A;  2P1O B;  2R9U A;  5A5C A;  1XWD C;  1K5D C;  4Z94 G;  3RIZ A;  1O6V A;  4ECO A;  2P1M B;  3FXI A;  3ZYI A;  4PER A;  4R09 A;  3WPI A;  1FQV A;  1JL5 A;  4H09 A;  4M7E A;  2O6R A;  3E6J A;  2Z7X B;  3W3J A;  3G3B A;  4PSJ A;  3WPH A;  1G9U A; 
#chains in the Genus database with same CATH topology
 1Z7X W;  3G39 A;  2WQU A;  4YEB B;  3WPD A;  5IYX C;  4UFR A;  2XOT A;  3RGZ A;  4CIL A;  2P1P B;  1XKU A;  5IJC A;  1ZIW A;  3G04 C;  3W3K A;  2O6Q A;  5AWC A;  3WPE A;  3E2J A;  4R0A A;  5AWB A;  4V2E A;  2JE1 A;  3WPB A;  4FMZ A;  4XSQ A;  2V9T B;  3O53 A;  4U7L A;  3A79 B;  2WFH A;  4WP6 A;  2Q4G W;  4LSX C;  3RW7 A;  4R6G A;  4P8S A;  5IJD A;  1O6T A;  4ARR A;  1P8T A;  1FO1 A;  4R08 A;  4TZH A;  2Z63 A;  1QYY A;  3M18 A;  3JB9 j;  5D3I A;  1PGV A;  4K17 A;  3W3M A;  1U0N D;  4Z79 A;  4R6J A;  5B4P A;  3E4G A;  1P8V A;  3W3N A;  4U06 A;  4OQT A;  5GMG A;  2V70 A;  3O6N A;  4CNM A;  4FDW A;  4BV4 R;  3RFJ A;  1FT8 A;  4U08 A;  4PQ8 A;  3TSR E;  3PMH G;  1O6S A;  4R5D A;  4Z61 C;  4I6J B;  2OMZ A;  1H6T A;  4LSX A;  4PKI G;  3RW6 A;  4J0M A;  2P1Q B;  2Z64 A;  3BZ5 A;  4AY9 X;  2V9S A;  4QBZ A;  1H6U A;  3VQ2 A;  1KOO A;  2Z66 A;  1A9N A;  2AST B;  4CNC A;  4GLP A;  4G8A A;  3CIG A;  3WPG A;  3RJ0 A;  1KOH A;  4AW4 A;  3UN9 A;  3GOZ A;  4MQW X;  3REZ A;  4Y61 B;  3CVR A;  4Q3G A;  2WQW A;  1M0Z A;  2OMW A;  3SB4 A;  1SQ0 B;  5HZL B;  4CC4 C;  4BSS A;  1DS9 A;  3W3G A;  3M19 A;  4L3A A;  4R07 A;  2RR6 A;  3OGK B;  2OMT A;  2CA6 A;  3OJA B;  4V2D A;  1OTO A;  1XCD A;  3RGX A;  4C2A B;  4XGO A;  3ZYN A;  4BSR A;  2Z7X A;  5FTT B;  1OTM A;  1OTN A;  4C2B B;  1LTX A;  3WPF A;  5GS2 B;  4ARN A;  2ASS B;  4LXS A;  3ULA A;  2JE0 A;  5AWD A;  3C6N B;  4BSU A;  1XEU A;  2OMX A;  3KJ4 A;  4LI2 A;  1OGQ A;  4FD0 A;  4HQ1 A;  2OMU A;  5IJB A;  3ZYJ A;  1DCE A;  5AZ5 A;  5CMN A;  4R6A A;  3RFS A;  4RCA B;  2ID5 A;  4CC4 A;  4RCW A;  4R5C A;  5GS0 A;  1OZN A;  2Z65 A;  4WYK A;  2OMV A;  4FCG A;  4Q3I A;  4LSC A;  4Q62 A;  2FT3 A;  4NZR M;  5GMH A;  1XEC A;  4P91 A;  4QXE A;  2BNH A;  4XOS A;  4QC0 A;  1YRG A;  3UL9 A;  2UZY A;  4LXR A;  4FS7 A;  2P1N B;  4Z64 C;  4IM6 A;  4CP6 A;  4NKG A;  1A4Y A;  4J4L A;  4GT6 A;  3WN4 A;  2O6S A;  3ULU A;  1WWL A;  4KNG A;  4ECN A;  4NKH A;  3UL7 A;  4LI1 A;  3C6O B;  1M9L A;  5HDH A;  4PEQ B;  4KXF B;  2ELL A;  3VQ1 A;  1DFJ I;  3DZE A;  4FHO A;  2Z82 A;  3ZYO A;  4RWT C;  2UZX A;  2WQX A;  3P72 A;  4NZT M;  2Y5Q A;  3CIY A;  2IFG A;  5GMF A;  5CMP A;  3RFE A;  1M10 B;  1M9S A;  3G06 A;  5B0N A;  1IO0 A;  5GQR K;  2Z81 A;  3W3L A;  2XWT C;  3ULV A;  4KT1 A;  1OOK G;  4M7E C;  4MN8 B;  4B8C D;  4R6F A;  3G3A A;  2Z62 A;  1D0B A;  2JQD A;  2A0Z A;  4U09 A;  4LSA A;  4V2C A;  3E3Z A;  1K5G C;  2BEX A;  5B0T A;  2OMY A;  3WPC A;  4R58 A;  1P9A G;  3OGL B;  5LFN A;  4Z8G A;  2RA8 A;  3C6P B;  4L3F A;  4EZG A;  3UL8 A;  2WQV A;  1FS2 A;  5AWA A;  3OGM B;  1GWB A;  1W8A A;  3OJA A;  2P1O B;  2R9U A;  5A5C A;  1XWD C;  1K5D C;  4Z94 G;  3RIZ A;  1O6V A;  4ECO A;  2P1M B;  3FXI A;  3ZYI A;  4PER A;  4R09 A;  3WPI A;  1FQV A;  1JL5 A;  4H09 A;  4M7E A;  2O6R A;  3E6J A;  2Z7X B;  3W3J A;  3G3B A;  4PSJ A;  3WPH A;  1G9U A; 
#chains in the Genus database with same CATH homology
 1Z7X W;  3G39 A;  2WQU A;  4YEB B;  3WPD A;  5IYX C;  4UFR A;  2XOT A;  3RGZ A;  4CIL A;  2P1P B;  1XKU A;  5IJC A;  1ZIW A;  3G04 C;  3W3K A;  2O6Q A;  5AWC A;  3WPE A;  3E2J A;  4R0A A;  5AWB A;  4V2E A;  2JE1 A;  3WPB A;  4FMZ A;  4XSQ A;  2V9T B;  3O53 A;  4U7L A;  3A79 B;  2WFH A;  4WP6 A;  2Q4G W;  4LSX C;  3RW7 A;  4R6G A;  4P8S A;  5IJD A;  1O6T A;  4ARR A;  1P8T A;  1FO1 A;  4R08 A;  4TZH A;  2Z63 A;  1QYY A;  3M18 A;  3JB9 j;  5D3I A;  1PGV A;  4K17 A;  3W3M A;  1U0N D;  4Z79 A;  4R6J A;  5B4P A;  3E4G A;  1P8V A;  3W3N A;  4U06 A;  4OQT A;  5GMG A;  2V70 A;  3O6N A;  4CNM A;  4FDW A;  4BV4 R;  3RFJ A;  1FT8 A;  4U08 A;  4PQ8 A;  3TSR E;  3PMH G;  1O6S A;  4R5D A;  4Z61 C;  4I6J B;  2OMZ A;  1H6T A;  4LSX A;  4PKI G;  3RW6 A;  4J0M A;  2P1Q B;  2Z64 A;  3BZ5 A;  4AY9 X;  2V9S A;  4QBZ A;  1H6U A;  3VQ2 A;  1KOO A;  2Z66 A;  1A9N A;  2AST B;  4CNC A;  4GLP A;  4G8A A;  3CIG A;  3WPG A;  3RJ0 A;  1KOH A;  4AW4 A;  3UN9 A;  3GOZ A;  4MQW X;  3REZ A;  4Y61 B;  3CVR A;  4Q3G A;  2WQW A;  1M0Z A;  2OMW A;  3SB4 A;  1SQ0 B;  5HZL B;  4CC4 C;  4BSS A;  1DS9 A;  3W3G A;  3M19 A;  4L3A A;  4R07 A;  2RR6 A;  3OGK B;  2OMT A;  2CA6 A;  3OJA B;  4V2D A;  1OTO A;  1XCD A;  3RGX A;  4C2A B;  4XGO A;  3ZYN A;  4BSR A;  2Z7X A;  5FTT B;  1OTM A;  1OTN A;  4C2B B;  1LTX A;  3WPF A;  5GS2 B;  4ARN A;  2ASS B;  4LXS A;  3ULA A;  2JE0 A;  5AWD A;  3C6N B;  4BSU A;  1XEU A;  2OMX A;  3KJ4 A;  4LI2 A;  1OGQ A;  4FD0 A;  4HQ1 A;  2OMU A;  5IJB A;  3ZYJ A;  1DCE A;  5AZ5 A;  5CMN A;  4R6A A;  3RFS A;  4RCA B;  2ID5 A;  4CC4 A;  4RCW A;  4R5C A;  5GS0 A;  1OZN A;  2Z65 A;  4WYK A;  2OMV A;  4FCG A;  4Q3I A;  4LSC A;  4Q62 A;  2FT3 A;  5GMH A;  1XEC A;  4P91 A;  4QXE A;  2BNH A;  4XOS A;  4QC0 A;  1YRG A;  3UL9 A;  2UZY A;  4LXR A;  4FS7 A;  2P1N B;  4Z64 C;  4IM6 A;  4CP6 A;  4NKG A;  1A4Y A;  4J4L A;  4GT6 A;  3WN4 A;  2O6S A;  3ULU A;  1WWL A;  4KNG A;  4ECN A;  4NKH A;  3UL7 A;  4LI1 A;  3C6O B;  1M9L A;  5HDH A;  4PEQ B;  4KXF B;  2ELL A;  3VQ1 A;  1DFJ I;  3DZE A;  4FHO A;  2Z82 A;  3ZYO A;  4RWT C;  2UZX A;  2WQX A;  3P72 A;  2Y5Q A;  3CIY A;  2IFG A;  5GMF A;  5CMP A;  3RFE A;  1M10 B;  1M9S A;  3G06 A;  5B0N A;  1IO0 A;  5GQR K;  2Z81 A;  3W3L A;  2XWT C;  3ULV A;  4KT1 A;  1OOK G;  4M7E C;  4MN8 B;  4B8C D;  4R6F A;  3G3A A;  2Z62 A;  1D0B A;  2JQD A;  2A0Z A;  4U09 A;  4LSA A;  4V2C A;  3E3Z A;  1K5G C;  2BEX A;  5B0T A;  2OMY A;  3WPC A;  4R58 A;  1P9A G;  3OGL B;  5LFN A;  4Z8G A;  2RA8 A;  3C6P B;  4L3F A;  4EZG A;  3UL8 A;  2WQV A;  1FS2 A;  5AWA A;  3OGM B;  1GWB A;  1W8A A;  3OJA A;  2P1O B;  2R9U A;  5A5C A;  1XWD C;  1K5D C;  4Z94 G;  3RIZ A;  1O6V A;  4ECO A;  2P1M B;  3FXI A;  3ZYI A;  4PER A;  4R09 A;  3WPI A;  1FQV A;  1JL5 A;  4H09 A;  4M7E A;  2O6R A;  3E6J A;  2Z7X B;  3W3J A;  3G3B A;  4PSJ A;  3WPH A;  1G9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...