3UL9A

Structure of the tv3 mutant m41e
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
276
Chain Sequence
PCVEVVPNITYQCEELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ul9A00
3BZ5A 4C2AB 2OMWA 4B8CD 4Q62A 3JB9j 4V2EA 2Z64A 1FO1A 3UL7A 3WN4A 1G9UA 4V2DA 3W3MA 3UN9A 4Z64C 5IJDA 3PMHG 4U08A 5HZLB 3WPCA 5GMGA 4RCWA 4FDWA 5GMFA 2V9SA 4R5CA 3UL8A 1XKUA 4BSSA 3E6JA 5GMHA 4QXEA 1WWLA 5AWCA 1SQ0B 3CIGA 4FD0A 2V9TB 2BNHA 3C6OB 4Q3IA 4XGOA 4LSXA 1XCDA 4TZHA 4BSRA 5A5CA 3G3AA 1P8VA 3OGMB 1OTOA 4RCAB 4C2BB 4P91A 2RR6A 4LI1A 1OGQA 1K5GC 2Z65A 2Z7XB 1LTXA 4LSCA 3ULAA 4Q3GA 1FT8A 4LI2A 4PKIG 4AW4A 3RW7A 5HDHA 4R6AA 4AY9X 1U0ND 4QBZA 3O53A 4FS7A 2UZXA 4KNGA 4V2CA 3G04C 3G3BA 4R6JA 4CC4C 5AWDA 4LXRA 4ARNA 2CA6A 4GT6A 4M7EC 1W8AA 2RA8A 2P1QB 3RFSA 1H6TA 3VQ2A 2BEXA 4U06A 3W3KA 1FS2A 4P8SA 3RFEA 2P1NB 5AWAA 4R09A 4UFRA 1A9NA 4CNCA 5FTTB 3W3NA 2OMXA 2A0ZA 4LSXC 2P1MB 3RIZA 1M9SA 1XECA 4Z94G 4G8AA 3RW6A 4LXSA 5CMNA 1OOKG 4NKHA 3O6NA 3WPFA 4WP6A 2P1PB 2Z63A 1OZNA 3SB4A 4R6FA 4FMZA 4PEQB 2O6RA 3WPIA 5LFNA 4Y61B 3M18A 2ASSB 3DZEA 2JE1A 3RFJA 1M9LA 3OGLB 5GS2B 5D3IA 3OGKB 5IJCA 4U7LA 3CIYA 5AZ5A 2OMUA 4KXFB 5GS0A 3C6NB 4IM6A 3UL9A 3W3JA 3W3GA 2FT3A 3RGXA 1DS9A 2R9UA 4H09A 4R07A 1A4YA 1PGVA 4CNMA 3E2JA 5IYXC 2Z66A 3ZYJA 2JE0A 4J4LA 5CMPA 2XOTA 2ID5A 1O6SA 2Z82A 2Z62A 4R5DA 1KOHA 2Z81A 3WPHA 3ZYIA 4MQWX 1K5DC 4BV4R 4L3FA 5AWBA 2Y5QA 3C6PB 4R58A 4GLPA 3G06A 4FHOA 1XWDC 4PSJA 4L3AA 3ULVA 1FQVA 2O6SA 2Z7XA 3WPEA 3ZYOA 2OMZA 1D0BA 1YRGA 4CP6A 4HQ1A 4CILA 2WFHA 4OQTA 2OMVA 2WQWA 3FXIA 4U09A 2WQUA 2Q4GW 2WQXA 5B0NA 4CC4A 1M0ZA 2UZYA 4FCGA 4M7EA 4RWTC 3REZA 4NKGA 2XWTC 3E3ZA 2JQDA 1XEUA 1OTNA 1ZIWA 1DCEA 2OMTA 3WPDA 3ZYNA 3W3LA 4PERA 2O6QA 4MN8B 3OJAB 5B0TA 4K17A 1Z7XW 1O6TA 3E4GA 3VQ1A 4ARRA 1GWBA 1IO0A 5B4PA 4Z61C 4EZGA 4LSAA 1P9AG 4BSUA 2IFGA 2V70A 3TSRE 4R08A 2OMYA 2ASTB 3CVRA 1H6UA 3RGZA 1DFJI 3RJ0A 3ULUA 3A79B 4WYKA 2WQVA 1JL5A 1P8TA 3GOZA 3G39A 1QYYA 5IJBA 4KT1A 4Z8GA 4J0MA 1OTMA 4XOSA 5GQRK 4Z79A 3WPGA 4ECOA 1O6VA 3KJ4A 2P1OB 4QC0A 4R6GA 4XSQA 3OJAA 4PQ8A 4YEBB 1KOOA 3P72A 2ELLA 4I6JB 1M10B 4R0AA 4ECNA 3WPBA 3M19A
chains in the Genus database with same CATH superfamily
3BZ5A 4C2AB 2OMWA 4B8CD 4Q62A 3JB9j 4V2EA 2Z64A 1FO1A 3UL7A 3WN4A 1G9UA 4V2DA 3W3MA 3UN9A 4Z64C 5IJDA 3PMHG 4U08A 5HZLB 3WPCA 5GMGA 4RCWA 4FDWA 5GMFA 2V9SA 4R5CA 3UL8A 4NZTM 1XKUA 4BSSA 3E6JA 5GMHA 4QXEA 1WWLA 5AWCA 1SQ0B 3CIGA 4FD0A 2V9TB 2BNHA 3C6OB 4Q3IA 4XGOA 4LSXA 1XCDA 4TZHA 4BSRA 5A5CA 3G3AA 1P8VA 3OGMB 1OTOA 4RCAB 4C2BB 4P91A 2RR6A 4LI1A 1OGQA 1K5GC 2Z65A 2Z7XB 1LTXA 4LSCA 3ULAA 4Q3GA 1FT8A 4LI2A 4PKIG 4AW4A 3RW7A 5HDHA 4R6AA 4AY9X 1U0ND 4QBZA 3O53A 4FS7A 2UZXA 4NZRM 4KNGA 4V2CA 3G04C 3G3BA 4R6JA 4CC4C 5AWDA 4LXRA 4ARNA 2CA6A 4GT6A 4M7EC 1W8AA 2RA8A 2P1QB 3RFSA 1H6TA 3VQ2A 2BEXA 4U06A 3W3KA 1FS2A 4P8SA 3RFEA 2P1NB 5AWAA 4R09A 4UFRA 1A9NA 4CNCA 5FTTB 3W3NA 2OMXA 2A0ZA 4LSXC 2P1MB 3RIZA 1M9SA 1XECA 4Z94G 4G8AA 3RW6A 4LXSA 5CMNA 1OOKG 4NKHA 3O6NA 3WPFA 4WP6A 2P1PB 2Z63A 1OZNA 3SB4A 4R6FA 4FMZA 4PEQB 2O6RA 3WPIA 5LFNA 4Y61B 3M18A 2ASSB 3DZEA 2JE1A 3RFJA 1M9LA 3OGLB 5GS2B 5D3IA 3OGKB 5IJCA 4U7LA 3CIYA 5AZ5A 2OMUA 4KXFB 5GS0A 3C6NB 4IM6A 3UL9A 3W3JA 3W3GA 2FT3A 3RGXA 1DS9A 2R9UA 4H09A 4R07A 1A4YA 1PGVA 4CNMA 3E2JA 5IYXC 2Z66A 3ZYJA 2JE0A 4J4LA 5CMPA 2XOTA 2ID5A 1O6SA 2Z82A 2Z62A 4R5DA 1KOHA 2Z81A 3WPHA 3ZYIA 4MQWX 1K5DC 4BV4R 4L3FA 5AWBA 2Y5QA 3C6PB 4R58A 4GLPA 3G06A 4FHOA 1XWDC 4PSJA 4L3AA 3ULVA 1FQVA 2O6SA 2Z7XA 3WPEA 3ZYOA 2OMZA 1D0BA 1YRGA 4CP6A 4HQ1A 4CILA 2WFHA 4OQTA 2OMVA 2WQWA 3FXIA 4U09A 2WQUA 2Q4GW 2WQXA 5B0NA 4CC4A 1M0ZA 2UZYA 4FCGA 4M7EA 4RWTC 3REZA 4NKGA 2XWTC 3E3ZA 2JQDA 1XEUA 1OTNA 1ZIWA 1DCEA 2OMTA 3WPDA 3ZYNA 3W3LA 4PERA 2O6QA 4MN8B 3OJAB 5B0TA 4K17A 1Z7XW 1O6TA 3E4GA 3VQ1A 4ARRA 1GWBA 1IO0A 5B4PA 4Z61C 4EZGA 4LSAA 1P9AG 4BSUA 2IFGA 2V70A 3TSRE 4R08A 2OMYA 2ASTB 3CVRA 1H6UA 3RGZA 1DFJI 3RJ0A 3ULUA 3A79B 4WYKA 2WQVA 1JL5A 1P8TA 3GOZA 3G39A 1QYYA 5IJBA 4KT1A 4Z8GA 4J0MA 1OTMA 4XOSA 5GQRK 4Z79A 3WPGA 4ECOA 1O6VA 3KJ4A 2P1OB 4QC0A 4R6GA 4XSQA 3OJAA 4PQ8A 4YEBB 1KOOA 3P72A 2ELLA 4I6JB 1M10B 4R0AA 4ECNA 3WPBA 3M19A
chains in the Genus database with same CATH topology
3BZ5A 4C2AB 2OMWA 4B8CD 4Q62A 3JB9j 4V2EA 2Z64A 1FO1A 3UL7A 3WN4A 1G9UA 4V2DA 3W3MA 3UN9A 4Z64C 5IJDA 3PMHG 4U08A 5HZLB 3WPCA 5GMGA 4RCWA 4FDWA 5GMFA 2V9SA 4R5CA 3UL8A 1XKUA 4BSSA 3E6JA 5GMHA 4QXEA 1WWLA 5AWCA 1SQ0B 3CIGA 4FD0A 2V9TB 2BNHA 3C6OB 4Q3IA 4XGOA 4LSXA 1XCDA 4TZHA 4BSRA 5A5CA 3G3AA 1P8VA 3OGMB 1OTOA 4RCAB 4C2BB 4P91A 2RR6A 4LI1A 1OGQA 1K5GC 2Z65A 2Z7XB 1LTXA 4LSCA 3ULAA 4Q3GA 1FT8A 4LI2A 4PKIG 4AW4A 3RW7A 5HDHA 4R6AA 4AY9X 1U0ND 4QBZA 3O53A 4FS7A 2UZXA 4KNGA 4V2CA 3G04C 3G3BA 4R6JA 4CC4C 5AWDA 4LXRA 4ARNA 2CA6A 4GT6A 4M7EC 1W8AA 2RA8A 2P1QB 3RFSA 1H6TA 3VQ2A 2BEXA 4U06A 3W3KA 1FS2A 4P8SA 3RFEA 2P1NB 5AWAA 4R09A 4UFRA 1A9NA 4CNCA 5FTTB 3W3NA 2OMXA 2A0ZA 4LSXC 2P1MB 3RIZA 1M9SA 1XECA 4Z94G 4G8AA 3RW6A 4LXSA 5CMNA 1OOKG 4NKHA 3O6NA 3WPFA 4WP6A 2P1PB 2Z63A 1OZNA 3SB4A 4R6FA 4FMZA 4PEQB 2O6RA 3WPIA 5LFNA 4Y61B 3M18A 2ASSB 3DZEA 2JE1A 3RFJA 1M9LA 3OGLB 5GS2B 5D3IA 3OGKB 5IJCA 4U7LA 3CIYA 5AZ5A 2OMUA 4KXFB 5GS0A 3C6NB 4IM6A 3UL9A 3W3JA 3W3GA 2FT3A 3RGXA 1DS9A 2R9UA 4H09A 4R07A 1A4YA 1PGVA 4CNMA 3E2JA 5IYXC 2Z66A 3ZYJA 2JE0A 4J4LA 5CMPA 2XOTA 2ID5A 1O6SA 2Z82A 2Z62A 4R5DA 1KOHA 2Z81A 3WPHA 3ZYIA 4MQWX 1K5DC 4BV4R 4L3FA 5AWBA 2Y5QA 3C6PB 4R58A 4GLPA 3G06A 4FHOA 1XWDC 4PSJA 4L3AA 3ULVA 1FQVA 2O6SA 2Z7XA 3WPEA 3ZYOA 2OMZA 1D0BA 1YRGA 4CP6A 4HQ1A 4CILA 2WFHA 4OQTA 2OMVA 2WQWA 3FXIA 4U09A 2WQUA 2Q4GW 2WQXA 5B0NA 4CC4A 1M0ZA 2UZYA 4FCGA 4M7EA 4RWTC 3REZA 4NKGA 2XWTC 3E3ZA 2JQDA 1XEUA 1OTNA 1ZIWA 1DCEA 2OMTA 3WPDA 3ZYNA 3W3LA 4PERA 2O6QA 4MN8B 3OJAB 5B0TA 4K17A 1Z7XW 1O6TA 3E4GA 3VQ1A 4ARRA 1GWBA 1IO0A 5B4PA 4Z61C 4EZGA 4LSAA 1P9AG 4BSUA 2IFGA 2V70A 3TSRE 4R08A 2OMYA 2ASTB 3CVRA 1H6UA 3RGZA 1DFJI 3RJ0A 3ULUA 3A79B 4WYKA 2WQVA 1JL5A 1P8TA 3GOZA 3G39A 1QYYA 5IJBA 4KT1A 4Z8GA 4J0MA 1OTMA 4XOSA 5GQRK 4Z79A 3WPGA 4ECOA 1O6VA 3KJ4A 2P1OB 4QC0A 4R6GA 4XSQA 3OJAA 4PQ8A 4YEBB 1KOOA 3P72A 2ELLA 4I6JB 1M10B 4R0AA 4ECNA 3WPBA 3M19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZ5 A;  4C2A B;  2OMW A;  4B8C D;  4Q62 A;  3JB9 j;  4V2E A;  2Z64 A;  1FO1 A;  3UL7 A;  3WN4 A;  1G9U A;  4V2D A;  3W3M A;  3UN9 A;  4Z64 C;  5IJD A;  3PMH G;  4U08 A;  5HZL B;  3WPC A;  5GMG A;  4RCW A;  4FDW A;  5GMF A;  2V9S A;  4R5C A;  3UL8 A;  1XKU A;  4BSS A;  3E6J A;  5GMH A;  4QXE A;  1WWL A;  5AWC A;  1SQ0 B;  3CIG A;  4FD0 A;  2V9T B;  2BNH A;  3C6O B;  4Q3I A;  4XGO A;  4LSX A;  1XCD A;  4TZH A;  4BSR A;  5A5C A;  3G3A A;  1P8V A;  3OGM B;  1OTO A;  4RCA B;  4C2B B;  4P91 A;  2RR6 A;  4LI1 A;  1OGQ A;  1K5G C;  2Z65 A;  2Z7X B;  1LTX A;  4LSC A;  3ULA A;  4Q3G A;  1FT8 A;  4LI2 A;  4PKI G;  4AW4 A;  3RW7 A;  5HDH A;  4R6A A;  4AY9 X;  1U0N D;  4QBZ A;  3O53 A;  4FS7 A;  2UZX A;  4KNG A;  4V2C A;  3G04 C;  3G3B A;  4R6J A;  4CC4 C;  5AWD A;  4LXR A;  4ARN A;  2CA6 A;  4GT6 A;  4M7E C;  1W8A A;  2RA8 A;  2P1Q B;  3RFS A;  1H6T A;  3VQ2 A;  2BEX A;  4U06 A;  3W3K A;  1FS2 A;  4P8S A;  3RFE A;  2P1N B;  5AWA A;  4R09 A;  4UFR A;  1A9N A;  4CNC A;  5FTT B;  3W3N A;  2OMX A;  2A0Z A;  4LSX C;  2P1M B;  3RIZ A;  1M9S A;  1XEC A;  4Z94 G;  4G8A A;  3RW6 A;  4LXS A;  5CMN A;  1OOK G;  4NKH A;  3O6N A;  3WPF A;  4WP6 A;  2P1P B;  2Z63 A;  1OZN A;  3SB4 A;  4R6F A;  4FMZ A;  4PEQ B;  2O6R A;  3WPI A;  5LFN A;  4Y61 B;  3M18 A;  2ASS B;  3DZE A;  2JE1 A;  3RFJ A;  1M9L A;  3OGL B;  5GS2 B;  5D3I A;  3OGK B;  5IJC A;  4U7L A;  3CIY A;  5AZ5 A;  2OMU A;  4KXF B;  5GS0 A;  3C6N B;  4IM6 A;  3UL9 A;  3W3J A;  3W3G A;  2FT3 A;  3RGX A;  1DS9 A;  2R9U A;  4H09 A;  4R07 A;  1A4Y A;  1PGV A;  4CNM A;  3E2J A;  5IYX C;  2Z66 A;  3ZYJ A;  2JE0 A;  4J4L A;  5CMP A;  2XOT A;  2ID5 A;  1O6S A;  2Z82 A;  2Z62 A;  4R5D A;  1KOH A;  2Z81 A;  3WPH A;  3ZYI A;  4MQW X;  1K5D C;  4BV4 R;  4L3F A;  5AWB A;  2Y5Q A;  3C6P B;  4R58 A;  4GLP A;  3G06 A;  4FHO A;  1XWD C;  4PSJ A;  4L3A A;  3ULV A;  1FQV A;  2O6S A;  2Z7X A;  3WPE A;  3ZYO A;  2OMZ A;  1D0B A;  1YRG A;  4CP6 A;  4HQ1 A;  4CIL A;  2WFH A;  4OQT A;  2OMV A;  2WQW A;  3FXI A;  4U09 A;  2WQU A;  2Q4G W;  2WQX A;  5B0N A;  4CC4 A;  1M0Z A;  2UZY A;  4FCG A;  4M7E A;  4RWT C;  3REZ A;  4NKG A;  2XWT C;  3E3Z A;  2JQD A;  1XEU A;  1OTN A;  1ZIW A;  1DCE A;  2OMT A;  3WPD A;  3ZYN A;  3W3L A;  4PER A;  2O6Q A;  4MN8 B;  3OJA B;  5B0T A;  4K17 A;  1Z7X W;  1O6T A;  3E4G A;  3VQ1 A;  4ARR A;  1GWB A;  1IO0 A;  5B4P A;  4Z61 C;  4EZG A;  4LSA A;  1P9A G;  4BSU A;  2IFG A;  2V70 A;  3TSR E;  4R08 A;  2OMY A;  2AST B;  3CVR A;  1H6U A;  3RGZ A;  1DFJ I;  3RJ0 A;  3ULU A;  3A79 B;  4WYK A;  2WQV A;  1JL5 A;  1P8T A;  3GOZ A;  3G39 A;  1QYY A;  5IJB A;  4KT1 A;  4Z8G A;  4J0M A;  1OTM A;  4XOS A;  5GQR K;  4Z79 A;  3WPG A;  4ECO A;  1O6V A;  3KJ4 A;  2P1O B;  4QC0 A;  4R6G A;  4XSQ A;  3OJA A;  4PQ8 A;  4YEB B;  1KOO A;  3P72 A;  2ELL A;  4I6J B;  1M10 B;  4R0A A;  4ECN A;  3WPB A;  3M19 A; 
#chains in the Genus database with same CATH topology
 3BZ5 A;  4C2A B;  2OMW A;  4B8C D;  4Q62 A;  3JB9 j;  4V2E A;  2Z64 A;  1FO1 A;  3UL7 A;  3WN4 A;  1G9U A;  4V2D A;  3W3M A;  3UN9 A;  4Z64 C;  5IJD A;  3PMH G;  4U08 A;  5HZL B;  3WPC A;  5GMG A;  4RCW A;  4FDW A;  5GMF A;  2V9S A;  4R5C A;  3UL8 A;  4NZT M;  1XKU A;  4BSS A;  3E6J A;  5GMH A;  4QXE A;  1WWL A;  5AWC A;  1SQ0 B;  3CIG A;  4FD0 A;  2V9T B;  2BNH A;  3C6O B;  4Q3I A;  4XGO A;  4LSX A;  1XCD A;  4TZH A;  4BSR A;  5A5C A;  3G3A A;  1P8V A;  3OGM B;  1OTO A;  4RCA B;  4C2B B;  4P91 A;  2RR6 A;  4LI1 A;  1OGQ A;  1K5G C;  2Z65 A;  2Z7X B;  1LTX A;  4LSC A;  3ULA A;  4Q3G A;  1FT8 A;  4LI2 A;  4PKI G;  4AW4 A;  3RW7 A;  5HDH A;  4R6A A;  4AY9 X;  1U0N D;  4QBZ A;  3O53 A;  4FS7 A;  2UZX A;  4NZR M;  4KNG A;  4V2C A;  3G04 C;  3G3B A;  4R6J A;  4CC4 C;  5AWD A;  4LXR A;  4ARN A;  2CA6 A;  4GT6 A;  4M7E C;  1W8A A;  2RA8 A;  2P1Q B;  3RFS A;  1H6T A;  3VQ2 A;  2BEX A;  4U06 A;  3W3K A;  1FS2 A;  4P8S A;  3RFE A;  2P1N B;  5AWA A;  4R09 A;  4UFR A;  1A9N A;  4CNC A;  5FTT B;  3W3N A;  2OMX A;  2A0Z A;  4LSX C;  2P1M B;  3RIZ A;  1M9S A;  1XEC A;  4Z94 G;  4G8A A;  3RW6 A;  4LXS A;  5CMN A;  1OOK G;  4NKH A;  3O6N A;  3WPF A;  4WP6 A;  2P1P B;  2Z63 A;  1OZN A;  3SB4 A;  4R6F A;  4FMZ A;  4PEQ B;  2O6R A;  3WPI A;  5LFN A;  4Y61 B;  3M18 A;  2ASS B;  3DZE A;  2JE1 A;  3RFJ A;  1M9L A;  3OGL B;  5GS2 B;  5D3I A;  3OGK B;  5IJC A;  4U7L A;  3CIY A;  5AZ5 A;  2OMU A;  4KXF B;  5GS0 A;  3C6N B;  4IM6 A;  3UL9 A;  3W3J A;  3W3G A;  2FT3 A;  3RGX A;  1DS9 A;  2R9U A;  4H09 A;  4R07 A;  1A4Y A;  1PGV A;  4CNM A;  3E2J A;  5IYX C;  2Z66 A;  3ZYJ A;  2JE0 A;  4J4L A;  5CMP A;  2XOT A;  2ID5 A;  1O6S A;  2Z82 A;  2Z62 A;  4R5D A;  1KOH A;  2Z81 A;  3WPH A;  3ZYI A;  4MQW X;  1K5D C;  4BV4 R;  4L3F A;  5AWB A;  2Y5Q A;  3C6P B;  4R58 A;  4GLP A;  3G06 A;  4FHO A;  1XWD C;  4PSJ A;  4L3A A;  3ULV A;  1FQV A;  2O6S A;  2Z7X A;  3WPE A;  3ZYO A;  2OMZ A;  1D0B A;  1YRG A;  4CP6 A;  4HQ1 A;  4CIL A;  2WFH A;  4OQT A;  2OMV A;  2WQW A;  3FXI A;  4U09 A;  2WQU A;  2Q4G W;  2WQX A;  5B0N A;  4CC4 A;  1M0Z A;  2UZY A;  4FCG A;  4M7E A;  4RWT C;  3REZ A;  4NKG A;  2XWT C;  3E3Z A;  2JQD A;  1XEU A;  1OTN A;  1ZIW A;  1DCE A;  2OMT A;  3WPD A;  3ZYN A;  3W3L A;  4PER A;  2O6Q A;  4MN8 B;  3OJA B;  5B0T A;  4K17 A;  1Z7X W;  1O6T A;  3E4G A;  3VQ1 A;  4ARR A;  1GWB A;  1IO0 A;  5B4P A;  4Z61 C;  4EZG A;  4LSA A;  1P9A G;  4BSU A;  2IFG A;  2V70 A;  3TSR E;  4R08 A;  2OMY A;  2AST B;  3CVR A;  1H6U A;  3RGZ A;  1DFJ I;  3RJ0 A;  3ULU A;  3A79 B;  4WYK A;  2WQV A;  1JL5 A;  1P8T A;  3GOZ A;  3G39 A;  1QYY A;  5IJB A;  4KT1 A;  4Z8G A;  4J0M A;  1OTM A;  4XOS A;  5GQR K;  4Z79 A;  3WPG A;  4ECO A;  1O6V A;  3KJ4 A;  2P1O B;  4QC0 A;  4R6G A;  4XSQ A;  3OJA A;  4PQ8 A;  4YEB B;  1KOO A;  3P72 A;  2ELL A;  4I6J B;  1M10 B;  4R0A A;  4ECN A;  3WPB A;  3M19 A; 
#chains in the Genus database with same CATH homology
 3BZ5 A;  4C2A B;  2OMW A;  4B8C D;  4Q62 A;  3JB9 j;  4V2E A;  2Z64 A;  1FO1 A;  3UL7 A;  3WN4 A;  1G9U A;  4V2D A;  3W3M A;  3UN9 A;  4Z64 C;  5IJD A;  3PMH G;  4U08 A;  5HZL B;  3WPC A;  5GMG A;  4RCW A;  4FDW A;  5GMF A;  2V9S A;  4R5C A;  3UL8 A;  1XKU A;  4BSS A;  3E6J A;  5GMH A;  4QXE A;  1WWL A;  5AWC A;  1SQ0 B;  3CIG A;  4FD0 A;  2V9T B;  2BNH A;  3C6O B;  4Q3I A;  4XGO A;  4LSX A;  1XCD A;  4TZH A;  4BSR A;  5A5C A;  3G3A A;  1P8V A;  3OGM B;  1OTO A;  4RCA B;  4C2B B;  4P91 A;  2RR6 A;  4LI1 A;  1OGQ A;  1K5G C;  2Z65 A;  2Z7X B;  1LTX A;  4LSC A;  3ULA A;  4Q3G A;  1FT8 A;  4LI2 A;  4PKI G;  4AW4 A;  3RW7 A;  5HDH A;  4R6A A;  4AY9 X;  1U0N D;  4QBZ A;  3O53 A;  4FS7 A;  2UZX A;  4KNG A;  4V2C A;  3G04 C;  3G3B A;  4R6J A;  4CC4 C;  5AWD A;  4LXR A;  4ARN A;  2CA6 A;  4GT6 A;  4M7E C;  1W8A A;  2RA8 A;  2P1Q B;  3RFS A;  1H6T A;  3VQ2 A;  2BEX A;  4U06 A;  3W3K A;  1FS2 A;  4P8S A;  3RFE A;  2P1N B;  5AWA A;  4R09 A;  4UFR A;  1A9N A;  4CNC A;  5FTT B;  3W3N A;  2OMX A;  2A0Z A;  4LSX C;  2P1M B;  3RIZ A;  1M9S A;  1XEC A;  4Z94 G;  4G8A A;  3RW6 A;  4LXS A;  5CMN A;  1OOK G;  4NKH A;  3O6N A;  3WPF A;  4WP6 A;  2P1P B;  2Z63 A;  1OZN A;  3SB4 A;  4R6F A;  4FMZ A;  4PEQ B;  2O6R A;  3WPI A;  5LFN A;  4Y61 B;  3M18 A;  2ASS B;  3DZE A;  2JE1 A;  3RFJ A;  1M9L A;  3OGL B;  5GS2 B;  5D3I A;  3OGK B;  5IJC A;  4U7L A;  3CIY A;  5AZ5 A;  2OMU A;  4KXF B;  5GS0 A;  3C6N B;  4IM6 A;  3UL9 A;  3W3J A;  3W3G A;  2FT3 A;  3RGX A;  1DS9 A;  2R9U A;  4H09 A;  4R07 A;  1A4Y A;  1PGV A;  4CNM A;  3E2J A;  5IYX C;  2Z66 A;  3ZYJ A;  2JE0 A;  4J4L A;  5CMP A;  2XOT A;  2ID5 A;  1O6S A;  2Z82 A;  2Z62 A;  4R5D A;  1KOH A;  2Z81 A;  3WPH A;  3ZYI A;  4MQW X;  1K5D C;  4BV4 R;  4L3F A;  5AWB A;  2Y5Q A;  3C6P B;  4R58 A;  4GLP A;  3G06 A;  4FHO A;  1XWD C;  4PSJ A;  4L3A A;  3ULV A;  1FQV A;  2O6S A;  2Z7X A;  3WPE A;  3ZYO A;  2OMZ A;  1D0B A;  1YRG A;  4CP6 A;  4HQ1 A;  4CIL A;  2WFH A;  4OQT A;  2OMV A;  2WQW A;  3FXI A;  4U09 A;  2WQU A;  2Q4G W;  2WQX A;  5B0N A;  4CC4 A;  1M0Z A;  2UZY A;  4FCG A;  4M7E A;  4RWT C;  3REZ A;  4NKG A;  2XWT C;  3E3Z A;  2JQD A;  1XEU A;  1OTN A;  1ZIW A;  1DCE A;  2OMT A;  3WPD A;  3ZYN A;  3W3L A;  4PER A;  2O6Q A;  4MN8 B;  3OJA B;  5B0T A;  4K17 A;  1Z7X W;  1O6T A;  3E4G A;  3VQ1 A;  4ARR A;  1GWB A;  1IO0 A;  5B4P A;  4Z61 C;  4EZG A;  4LSA A;  1P9A G;  4BSU A;  2IFG A;  2V70 A;  3TSR E;  4R08 A;  2OMY A;  2AST B;  3CVR A;  1H6U A;  3RGZ A;  1DFJ I;  3RJ0 A;  3ULU A;  3A79 B;  4WYK A;  2WQV A;  1JL5 A;  1P8T A;  3GOZ A;  3G39 A;  1QYY A;  5IJB A;  4KT1 A;  4Z8G A;  4J0M A;  1OTM A;  4XOS A;  5GQR K;  4Z79 A;  3WPG A;  4ECO A;  1O6V A;  3KJ4 A;  2P1O B;  4QC0 A;  4R6G A;  4XSQ A;  3OJA A;  4PQ8 A;  4YEB B;  1KOO A;  3P72 A;  2ELL A;  4I6J B;  1M10 B;  4R0A A;  4ECN A;  3WPB A;  3M19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...