3ULEB

Structure of bos taurus arp2/3 complex with bound inhibitor ck-869 and atp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
351
structure length
236
Chain Sequence
CDNGTGFVLLTEPPMAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRHMVFLGGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 65
structure length 236
sequence length 351
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3uleB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3uleB02
1J6ZA 5AQSA 3LL3A 5AQTA 5F2RA 3SK3A 1HPMA 3DXMA 2Q36A 2P9KB 4A61A 1Q18A 4CZJA 5BPMA 2GTDA 5EVZA 1BDGA 2FXUA 3B8AX 1GLJO 4JN4A 4AM6A 4BR0A 3AAPA 3AY9A 2A6AA 5B8HA 3UE5A 3FZHA 5AZJA 2FLOA 3GBTA 2YI1A 4BRQA 4BRPA 4IJAA 1HUXA 5KPRA 1EQYA 4JNEA 5AQZA 1NGEA 4XH4A 4H5WA 5BN9A 3ID8A 4IZ9A 5EOYA 2CGKA 4HTLA 2E8AA 3WT0A 4EAHD 2VWBA 4EFHA 3H45C 1NMDA 4CBWA 4FO0A 1ZBSA 1NGDA 2P9NA 4B1ZA 3FZLA 4RCHA 2BTFA 2GWJA 3RSEA 3WQUA 5F1XA 4Z94A 4B1UB 5BR9A 3MCPA 1C0GA 4IWVA 1T6CA 2DPNA 3HZ6A 1YXQA 5JLFA 4BC5A 3BP8A 3H1VX 3HTVA 2WUSA 3ULEB 2ASPA 4F9OA 1RFQA 3DXKA 3VPZA 2KHOA 3L4IA 3QBXA 4CZHA 4C23A 3CQXA 1NM1A 2HOEA 3MK6A 5AZIB 2IVPA 4H5VA 3U9ZA 4QS9A 3MN9A 3VEWA 1MA9B 5I9EB 3FZKA 2E88A 5AQOA 5JICA 3I33A 4K43A 2ASOA 5KQ8A 4DHYA 2F9WA 3UKUA 4BRKA 2PBDA 4PKGA 4MLEA 2QWNA 4QS7A 1R59O 3CI5A 1OKJA 4EHTA 2QWOA 1ZC6A 4I6MA 4GY2B 3DWLA 2Q1NA 5BRHA 3AARA 3C0BA 3J8AA 1XC3A 3AAQA 2QWLA 4B1YB 1X3MA 4FOEA 1Z6RA 4H0XB 3VEYA 2ZGYA 1NGCA 4FPAA 5BPLA 5JMVA 3SMSA 5AZJB 2D1KA 3GG4A 4FSVA 4EIAA 2PAVA 3S41A 2CH5A 5AQRA 2GEMA 5AQPA 4H03B 3GDQA 3VEVA 2F9TA 4O8KA 1BU6O 2ITMA 5FPMA 3QFPA 3CQYA 4FWKA 2UYTA 1YAGA 4FPBA 3R9PA 1LCUA 2YHWA 5ADXA 1G99A 5AQYA 4BVPA 3CJCA 1HX1A 2HMPA 4CD1A 1ATSA 2A40A 2QM1A 3WXKA 1GLLO 3H3NO 4B9QA 1SAZA 5EX5A 4IJNA 2E2PA 3LM2A 3L6QA 3CJBA 2FF3B 3FGUA 3EKSA 1C0FA 4ISGA 3G25A 3QBWA 3WXJA 4QS8A 5AQVA 3IFRA 5FPEA 4BG9A 3IMXA 3U9DA 1HKCA 3VGLA 2J4RA 3OHRA 4ISEA 4NB4A 4BG8A 2I7NA 3BEXA 1SZ2A 3LDPA 4CI6A 4BREA 3O80A 4M7XA 3WUHA 2A3ZA 3LDNA 3LDQA 3QFUA 4CBUA 1LOTB 3ENOA 4H0TB 2OANA 3GOIA 3QICA 4BGBA 2P9PB 5E84A 1NGJA 4JD2A 2A42A 3R6MA 4BRFA 2GUPA 4FWRA 3A5LC 3A5OC 3ULEA 2ASMA 3FE1A 4B1XB 1DKGD 1NGFA 2CGLA 3IDHA 4CJ7A 3WXLA 4AM7A 1BO5O 1RGIA 3ZX3A 1V4TA 2P9LB 1IG8A 2Q2RA 1IJJA 4RWTA 2P9UB 1V4SA 3I8BA 5AZIA 5BRFA 4BRLA 3M6GA 1WOQA 1U6ZA 3GE1A 2A5XA 4BRGA 4MO4A 5AR0A 3HM8A 4WQ4C 5AQWA 4BRMA 1QQNA 2IVOA 2NLXA 3DAWA 3A0IX 3W0LA 1NGGA 1U2VB 5BREA 5LY3A 3TPQA 1GLAG 2Q0RA 3JXUA 5AQMA 3O1WA 4E1JA 1S3XA 5FPDA 3H3OB 5JLHA 1S22A 4M7YA 5AQNA 2FSKA 1ATNA 3VENA 2P9IA 4CZGA 5EXWA 4CZEA 3WEEA 1MDUB 3JS6A 1GLCG 3MN5A 2EWSA 2P9KA 3VESA 2W40A 4DQ8A 4JAXA 1HKBA 4BC2A 3DXMB 1BWFO 4CZFA 4XEIA 4CBXA 3C7NB 2IIRA 1HJOA 3M3ZA 4WQ5A 2QWPA 1K8KA 2D0PA 3C7NA 4PL8A 3DJCA 3F9MA 3ATUA 2E20A 1K8KB 4H0OA 3VEZA 5AQJA 1ESVA 4Y0WA 1JCFA 2VYPA 2QWRA 1NGBA 2V7ZA 1JCGA 5AQUA 5AQKA 4O5FA 2CGJA 5AQLA 5FPNA 3ZETB 1GLDG 4BRCA 3O08A 3U4LA 1YVNA 4JHDB 1WUAA 2E2OA 4FWQA 3RSEB 3KZBA 4YDUA 4BR4A 4JHDA 5EY4A 4XH1A 4CZKA 5F0XA 1BOTO 2P9NB 2W41A 3GL1A 4H0VB 3BUZB 2Q31A 3ZEUB 4DB3A 5ELZA 4PKHA 4M63C 3CETA 3M1FA 1KAZA 2YHXA 3D2FA 1SQKA 1X9JA 3UB5A 4BC4A 1GLEG 4BRNA 1YUWA 3H6EA 3MMVA 3FR0A 3D2FB 1T6DA 5BN8A 4I6MB 3EL2A 1BA0A 3ZEUA 4BGAA 2E1YA 2QXLA 3SJHA 1KXPA 1Y64A 2CH6A 2Q0UA 4FWSA 4B1WB 4K41A 2GELA 4BR7A 3QDKA 4K25A 4HWIA 1NLVA 3CIPA 4EHUA 2HF3A 5CE3A 1ZXOA 5ADXH 3KVGA 5KQDA 3ZX2A 1E4GT 1MWMA 4BRDA 5BPNA 2P9SB 2E1ZA 2FSJA 3MN6A 5AFUH 3P4IA 4BR2A 1BG3A 3O6WA 2ZWHA 3D7EO 3DXKB 2D0OA 5AQIA 3SLCA 2YJEA 1GLFO 4BVOA 4BRIA 5LJVA 2VCPA 1HKGA 1NGAA 5AQFA 5AQQA 4A2AA 3EN9A 3WEEB 3D2EA 1TUUA 2P9UA 2D4WA 1XQSC 3ENHA 1NGHA 1QHAA 5KPZA 3EKUA 4KBOA 2AA4A 4L3QA 1T44A 1HLUA 4WQ4A 2P9IB 1KAXA 5AQXA 1P8ZA 2ZGZA 1CZAN 4H5TA 4BRAA 1U2VA 4H5RA 3WXIA 3CHWA 1TUYA 4K42A 4PKIA 3EZWA 2HF4A 1KAYA 3H1QA 5AQGA 4H0PA 3ZETA 4YDUC 3R8EA 3VERA 4FWMA 3VF4A 2Q97A 4BRHA 3O5BA 1RDWX 4BQZA 2AP1A 4NO7A 3BF1A 3FZMA 2YJFA 3VEOA 4FL9A 2P9LA 1QQOA 3EO3A 4BR9A 1XUPO 1E4FT 1BUPA 2YCHA 4WQ5C 4A2BA 3HBTA 3O4WA 2E2NA 2IVNA 4BC3A 5BRDA 2QW9A 3VGMA 2H3GX 2BUPA 4CD3A 3HSCA 1H1VA 3A5NC 1DEJA 2QWQA 1Z05A 1MWKA 2FSNA 2NRHA 2A41A 4WYBA 3MN7A 2GWKA 1X3NA 4CZMA 3FZFA 3SMPA 3CJ7A 4H0YB 3O8MA 3VEXA 3CERA 3FFKB 2ZF5O 2V51B 4GNIA 1JCEA 4FOIA 3KHYA 1NGIA 3WQTA 2V52B 4FWNA 1NWKA 3O1BA 3L0QA 1GLBG 4BROA 5LJWA 3LDOA 4BQLA 3W3DA 3LM9A 3VGKA 4XH5A 3TU5A 1DGKN 2QWMA 4MLHA 3VF2A 1TYQB 4A62A 2V7YA 4FWLA 4DCHA 3CJ9A 4RTFD 4J8FA 3UKRB 1ATRA 4JD2B 4MO5A 2E2QA 3H46O 2P9PA 3LDLA 3UKRA 2P9SA 3FLCO 5KPTA 2NZTA 1TYQA 4BR5A 4B1VA 3U8XA 3VOVA 3BF3A 3HI0A 3CJAA 5AQHA 5AFUA 4CZLA 1QZ6A 3VF6A 1NBWA 2I7PA 3A8YA 3MDQA 5E26A 3CJ1A 4ISFA 3IUCA 3D2EB 3UKUB 1QZ5A 4FWOA 5TKYA 3QMLA 3ATVA 4PL7A 1QQMA 4IXCA 2FF6A 3ZX0A 3QB0A 3VETA 2YHYA 1D4XA 4CZIA 3A5MC 4FWPA 4IO8A 4H5NA 4LC9B 1BA1A
chains in the Genus database with same CATH superfamily
1NK0A 4B9TA 2HHTA 2Z1JA 2BDPA 5F2RA 3SK3A 1XNQK 4KTZA 2Q36A 1B92A 4DTOA 3EYZA 5KGWA 2GTDA 4JI7K 3B8AX 5GADP 3DLRA 5B8HA 3AAPA 3AY9A 5HBMA 1EETA 4I7FA 3J81O 5JS1A 3FFIA 5AZJA 3DLLL 2YI1A 3OJSA 3TTCA 4IJAA 4IDHA 4JNEA 1G15A 2HSTA 1NGEA 4B9NA 2Y1JA 3KKRA 3AVKA 1XWLA 5GAEP 5EOYA 2O8EB 1TVRA 3AO3A 3R3LA 3WT0A 4EFHA 4ELTA 3SQ2A 1NK8A 3HPOA 3ZLJA 3TSUA 1NGDA 2ZE2A 1KLNA 3V6DA 1NKCA 2NNWA 1VAZA 1KTQA 4XJXA 4CFBA 3MCPA 3CXCM 4DR1K 3OW2M 3V1RA 4A5AA 3EY1A 2Q3SA 3U3GA 1YXQA 4JKEA 3H1VX 3I8DA 3ULEB 3BZKA 3L4QA 2F8TA 1RFQA 4CZHA 2HBLA 4QCLA 1NM1A 4XIUA 1SV5A 4CEQA 5AZIB 3SPZA 1IBKK 4H5VA 3U9ZA 4FW1A 3VEWA 4BWMA 1RT2A 1QHTA 4HTUA 1KLMA 3PIOL 3I33A 3QLHA 4M3ZA 3OYMA 2PBDA 3AO2A 4IG0A 4LH5A 4MLEA 2QWNA 3QINA 4BY9C 3E9OA 1R59O 4W5OA 5HRNA 4DFPA 2QWOA 1ZC6A 1GOAA 3OYDA 5BRHA 1UAXA 4FZZA 3SUQA 1REVA 2O8DB 3J8AA 1XC3A 3AAQA 1X3MA 4FOEA 3TABA 3C6HA 3U6FA 4JKGB 2YX6A 2F4VK 1S6PA 2O8FB 3GG4A 2PAVA 5AQRA 4AQYK 4BACA 3GDQA 2F9TA 3J7AP 4DG1A 4OKJA 3NF7A 5FPMA 4GKKK 1S9EA 4CJKA 3CC4N 1Z25A 2ZD1A 3QFPA 3V9ZA 2UYTA 4FPBA 3BGRA 2WC9A 1LCUA 1RTHA 3L3VA 1G99A 5AQYA 2G8WA 2W00A 3LAMA 1O1WA 2HMPA 2QM1A 2FC0A 3DYAA 3WXKA 3H3NO 1JL1A 4DS4A 1Q9YA 1T7PA 2QA4N 3FGUA 3NFAA 1T05A 4ISGA 3G25A 4B8CA 2Z1IA 1J53A 2HHHK 3QBWA 3HRGA 4HUEA 4QS8A 1QSYA 3IMXA 1HKCA 3VGLA 3SPYA 4BE2A 1HPZA 4ZTJA 2JWKA 3RRHA 2I7NA 3TSQA 3OY9A 4CI6A 4FK4A 2E4LA 2IDOA 3M5RA 3T3FA 3SQ4A 4CBUA 2P9PB 1GOCA 1RDAA 2A42A 4BRFA 1VHXA 3THXA 1DKGD 3T19A 2ATQA 4DR7K 5C25A 1FJGK 5GIPA 4KHNA 4CK1A 2JWLA 4AM7A 5D3GA 4I2PA 2UXCK 1QE1A 1V4TA 1IG8A 2G8HA 1V4SA 3CCQN 1WOQA 4JK7A 4OPKA 1U6ZA 4FJ5A 2NRTA 4MO4A 3THYA 4WQ4C 3O9SA 5AQWA 2NLXA 1X9WA 4DSLA 4YY3K 3A0IX 1NGGA 4CF2A 4J2EA 3VTHA 3TPQA 1X1PA 5AQMA 4KI6A 1W2BM 1Q82O 3PLAA 5FPDA 3H3OB 5AQNA 1RBRA 1NK4A 4CZGA 1M1KO 3B6OA 4CZEA 3WEEA 4FM1A 1RBUA 4FCYA 1MDUB 3JS6A 2EWSA 3VESA 3SBGA 4EZ6A 4BC2A 1BWFO 3AVFA 1B9DA 2YHBA 4O0JA 3OYIA 4CGHA 1BCMA 1VQON 2O8CB 2YNIA 4WQ5A 2DFEA 2DFHA 5SZTA 4F4KA 3C7NA 4DV6K 3ATUA 4M3XA 2OPSA 3QEVA 2XY7A 1BIZA 3LP0A 3H08A 3HP9A 4ILJA 4B3TK 1TKZA 5AQUA 4O5FA 1YTAA 1HNIA 4EP4A 3U4LA 4DU1A 4RW6A 1YVNA 1WUAA 3VQEA 4B3MK 4FLYA 4JKBA 1L5UA 1YIJN 3SZ2A 4OKKA 3RSEB 4C8OA 4JHDA 3AVNA 1LWEA 3KWIA 4M3TA 5BR8K 2W41A 2Q31A 4GVMA 1RT4A 4UQGA 5HOOA 1X9JA 4BC4A 1JJ2M 4B9UA 4OX9K 3THWB 1FW6A 1GOBA 2RE2A 5DM7L 3D2FB 1RT7A 3DRSA 1SL2A 1BA0A 2B6AA 4PUOA 1BGXT 2X6SA 4FWSA 4B1WB 4E1MA 1D5AA 2GELA 4BR7A 4K25A 4HWIA 3CIPA 4CESA 3MEGA 3DLGA 1C1AA 4CEAA 3ZX2A 3S3OA 1MWMA 5MLCQ 4CIGA 2E1ZA 5AFUH 4CJPA 4CEEA 3P4IA 4X62K 1NMNA 2XRIA 4JV5K 1WAFA 3CFPA 5FLXO 4YOWA 3SLCA 1SKRA 1HKGA 3C6TA 1LAVA 3RTVA 2ITGA 1NJXA 3EKUA 4L3QA 3K9KA 3KJVA 3OYNA 1P8ZA 3V4IA 1HQUA 3MX2A 2WTUA 3EZWA 4JRPA 3HJFA 3L3UA 1C0UA 3L8BA 1KQSM 3VERA 4M41A 4FWMA 2UXDK 2DY4A 1Z26A 1NOZA 3O5BA 4BQZA 2AP1A 3MX5A 1KSPA 3VEOA 3KIOA 1RBSA 3PSIA 4KHWA 1J9AA 1NKEA 3K2PA 1RT1A 4ILGB 4PA1A 4B8AB 4BDYA 1U49A 3HBTA 2JGUA 3O4WA 4O8UA 3KD1E 4LSNA 3ZT2A 4CD3A 3HSCA 4JK9A 1HNXK 4K0KK 3A5NC 3G71N 4X66K 1A5VA 4WYBA 3MN7A 3CCVN 4IEEA 1JLEA 1X3NA 3J7YP 3M8RA 3CJ7A 2QI2A 1R0AA 3O8MA 3CERA 3QESA 2ZF5O 1SKWA 2V51B 5KRSA 4GNIA 1SL0A 1NGIA 4DTRA 2V52B 4CF8A 4IDKA 1QVGM 3W3DA 2NRRA 3VGKA 1XMOK 2HHXA 3NVMA 3O9UA 2QWMA 4RG8A 2RHKA 1J5EK 4A62A 4DCHA 4QAGA 3OYAA 2C1GA 4JD2B 2E2QA 5IWAK 4JKFA 1VSKA 2GV9A 4J2DA 2JLEA 1JLBA 3AVCA 3U8XA 2O8DA 2HHVA 4OVLA 4H8KA 1EKEA 1BQNA 2G8KA 1XI1A 3VF6A 1KVBA 3CJ1A 4ISFA 1QTMA 4LF8K 3SJJA 3D2EB 3NGIA 4FWOA 5TKYA 5M1PA 3E01A 3QMLA 3DMJA 4PL7A 2FF6A 3ZX0A 2QTDA 2IAJA 1RT6A 1SUQA 4IO8A 4KHQA 4N41A 2O8CA 4TSXA 5AQTA 5CY4A 1HPMA 3ID6A 5LL6Z 4LFCK 4IFVA 2YNFA 4MDAA 3ZCMA 4CZJA 5BPMA 5EVZA 3WNFA 1WB9A 3IG1A 4BR0A 1K73O 3AO1A 4C8KA 4BRPA 4W5QA 1HUXA 1EQYA 3WNGA 3QIOA 5JS2A 4E72A 3KLIA 3QEXA 5BN9A 1XNRK 3T1HK 4AHRA 2VWBA 2HBJA 4DR6K 3QEWA 4FO0A 3LWLA 3SQ1A 1YTUA 1I39A 2LSNA 3B6PA 4B1ZA 4HCCA 4Z4EA 2BANA 4CJ3A 5FDLA 3NH1A 4RCHA 3WQUA 1OVQA 3K5LA 3OS2A 2PZSA 3BY5A 4CVNE 4X64K 3OYKA 4GV6A 2DPNA 4ILHA 3HZ6A 3DRPA 1U48A 4BC5A 1OVYA 2WUSA 4KFBA 4CJSA 2DFFA 3S3NA 3DXKA 3F2KA 3L4IA 3QBXA 1JL2A 3RR8A 5TKWA 1D8YA 4C23A 2HVHA 3CQXA 4YNQA 2GX9A 2IVPA 4QS9A 3THWA 4ID5A 3MN9A 2X74A 1Q9XA 5I9EB 3PO5A 3FZKA 4M3RA 2E88A 4KI4A 2FBTA 1ZBLA 3MEEA 4K43A 3VQCA 2ASOA 2A1SA 5KQ8A 1N5YA 1N34K 2G8VA 2PYLA 3G10A 1HMVA 4PKGA 4QS7A 2HHWA 4FM0A 4KKOA 2P5GA 1WN7A 4I6MA 4Y1DA 3CQ8A 2Q1NA 2OZSA 4B1YB 4CHPA 4HUFA 4CGGA 1OH6A 4M3WA 1NGCA 5BPLA 1RNHA 2WBNA 3SMSA 4B08A 1KCFA 2D1KA 1TKXA 2BH1A 4N47A 2R7YA 4FK0A 3SV4A 3S9HA 3CFRA 1S72N 2CH5A 2GEMA 3CFOA 3IKMA 4BE1A 1IKYA 3CJCA 4DQQA 1ATSA 2A40A 2RN2A 5EX5A 4IJNA 3SAGA 2XHBA 4DV4K 4F2RA 1EXQA 1C0FA 5C12A 1BCOA 4DV5K 1IBLK 2HMIA 5CHIA 5AQVA 3IFRA 4DQIA 3NF8A 1JLFA 1NU0A 5FPEA 1KVCA 3TANA 1OH5A 4FZXC 3U9DA 3OHRA 4IO9L 2HBKA 4OO1J 4KTWA 4BE0A 4CJFA 4BG8A 5E41A 3O80A 4M7XA 3QFUA 4HCBA 4EZ9A 4IG3A 3ENOA 4H0TB 1K8AO 4GVEA 3QICA 4KB1A 2F96A 4NLBA 5GAGP 5E84A 1NGJA 2I5JA 4CFCA 3OYGA 3AV9A 4NCGA 1LW2A 3ZSVA 1NK7A 3ULEA 3VMFB 2ASMA 2O4IA 4ELUA 1NGFA 1A5XA 3K5MA 3BDPA 2CGLA 3IDHA 3VQPA 3WNHA 4AHUA 1DT9A 3WXLA 3NAEA 1KC8O 5AJ3K 1S9GA 3ZX3A 4G9ZA 3V1OA 2P9LB 1IJJA 1JXBA 3E66A 2UXBK 3MCAB 3GE1A 4C8NA 2B4JA 2A5XA 4BRGA 3HM8A 3T69A 4O0IA 1WSEA 3KK2A 4RW7A 3DAWA 3W0LA 4DTXA 1GLAG 4A5BA 3JXUA 1S3XA 2P9IA 4KREA 4ZTFA 1CZBA 5M1KA 4M3YA 4CEFA 1D9DA 3MN5A 3AVLA 1HKBA 3QNNA 4YFUA 1HYZA 3PSFA 4XEIA 3MWTA 3LALA 1U4BA 2GBZA 1BHLA 2ETJA 4FJXA 3DJCA 4IOAL 2E20A 1KRPA 4H0OA 3TAPA 4FJIA 4E7KA 4Y0WA 2W6LA 1L3UA 2QWRA 4DTMA 4KO0A 1NGBA 1JCGA 1ASUA 5AQKA 4CGFA 2NRZA 5AQLA 3M8SA 1GLDG 4YOYA 4B9VA 4AHCA 4JHDB 1YF5L 2E2OA 1TL3A 1T03A 4KV8A 4DFMA 4DF4A 3ITHA 3TARA 4YDUA 3LAKA 1WSJA 4XH1A 5FRNA 2IS3A 2G8FA 3O3GA 1JLQA 4CE9A 3ZEUB 5ELZA 4PKHA 1BQMA 4M63C 3CETA 3UB5A 3RMAA 1YUWA 3FR0A 2B5JA 5C24A 4M3UA 3EL2A 1Q8IA 3ZEUA 2OTJN 3ASMA 3SJHA 2XY8A 3LWMA 2YNHA 4DSKA 5EU7A 1VQ8N 1NLVA 4EHUA 5CE3A 2HF3A 3KVGA 4KH4A 3C6UA 3TR8A 5KQDA 4DSJA 1IKWA 4CIFA 1FXXA 2P9SB 1VSJA 3VQDA 3MN6A 3DRRA 1BG3A 3QIPA 5DM6L 4DKWA 3MECA 1U45A 2QKBA 1L3VA 3OBYA 5AQIA 3KKSA 2YJEA 5LJVA 4O44A 4CJUA 2VCPA 4OGCA 1NGAA 5AQFA 5AQQA 1IG9A 4GV9A 3ZSZA 3D2EA 1TUUA 3P39A 1XQSC 2XY5A 4KBOA 4OLBA 1KVAA 2D5RA 5FROA 3P31A 4WQ4A 2P9IB 1KAXA 4H5TA 1U2VA 4H5RA 4RW4A 5M1QA 1YJ9N 3WXIA 5C2DA 4DFJA 4CERA 3HOSA 4DV0K 1IV0A 4DTPA 4DR5K 3K9JA 4H0PA 4YDUC 4ICLA 3I55N 4YOUA 3R1XA 4BRHA 2VQFK 3AVGA 5C15A 4V19S 4L8RB 4J2AA 2PFUA 4BR9A 4PHTX 1E4FT 1BUPA 4FLTA 3LPUA 2OCEA 5LMNK 1HJRA 3HXMA 4DU4A 2D0CA 4CEZA 5BRDA 2QW9A 3O4QA 3OYLA 1TK8A 3L2RA 5DK5A 5IT9O 2QWQA 1Z05A 4CIEA 4CHNA 2NRHA 3LANA 4IBNA 1JXEA 3SCXA 1WLJA 3SMPA 2HHSA 3TWHA 3RVCA 1ZBFA 3DI6A 4IOCL 2PYJA 1WBBA 4DMNA 4FWNA 3C6AA 1NWKA 4FJ7A 4CF9A 4DU3A 3TAFA 1GLBG 5LJWA 4FLWA 4OJRA 1I3AA 3LM9A 1KFSA 4XH5A 4CJWA 1DGKN 3O3FA 1TYQB 1DLOA 4CFDA 1ATRA 4GV3A 3O4NA 3NE6A 1N8RO 2P9SA 3FLCO 5KPTA 1TYQA 3AVJA 3PV8A 3ZT1A 1VQ6N 3CCEN 4JS4A 1DTTA 1WSIA 4BWJA 5CYQA 1C1CA 5AQHA 4DV3K 1T8EA 1QZ6A 4I2QA 4IFEA 2ZJRL 1BI4A 2RKIA 3UKUB 1VRTA 3K5NA 1YJWN 3K5OA 2W6KA 3PO4A 4IXCA 2X78A 3VETA 3L2WA 4DR4K 4FXDA 1S1XA 3TAQA 1RT3A 1W7AA 5AQSA 3S3MA 1C0MA 4NCAA 1HYVA 4DLGA 5KTQA 4CJQA 3SV3A 4F3TA 2VG6A 4CEOA 1Q18A 4DWIA 4I9LA 1TAUA 1GLJO 4B9MA 4CHOA 4AM6A 4CECA 4CK3A 3UE5A 3FZHA 1UOCA 3DLHA 3GBTA 5KPRA 4CEDA 4JKCA 4JRQA 5AQZA 3G0ZA 4XH4A 4H5WA 2EX3A 2CGKA 4HTLA 4PQUA 1TK5A 4EAHD 4DV7K 1NMDA 1YITN 3ALYA 4CHYA 4CF1A 2BTFA 2GWJA 3RSEA 4U67L 5F1XA 1ZBUA 4Z94A 5BR9A 2UUCK 1C0GA 4IWVA 1ZBHA 4IOXA 5SWMA 2VQEK 2ASPA 5KRTA 4FJMA 2KHOA 3SUPA 2VWKA 1UWBA 3MK6A 4F3OA 1C1BA 1TGOA 1B9FA 2YKMA 2ZJQL 1MA9B 2VG5A 3M8PA 3IRXA 5JICA 1N36K 4CJEA 1UA1A 1XMQK 4H4OA 2F9WA 4FYDA 4BRKA 1S5JA 4N56A 1BL3A 4JKGA 1YI2N 1WNSA 1OKJA 1K6YA 3V9UA 2HW3A 3NDKA 4GY2B 1MU2A 2D0AA 4JI1K 1Z6RA 4H0XB 4AF1A 5T7BA 4CW7B 1NKBA 4X65K 4Z0UA 3HVTA 2ZGYA 4OPHA 2HHQA 2C1IA 3KK7A 5JMVA 5I42A 4ZHRA 2KW4A 4FSVA 4EIAA 1HNZK 5AQPA 3O9TA 3ENBA 1BU6O 4JI2K 2ITMA 4HUGA 1NJZA 2WFBA 4JEPA 3RMCA 4DQPA 4BE7B 3ZSWA 4WFBL 2HB5A 4DS5A 4FM2A 2YHWA 4BVPA 2NUBA 1HX1A 1GLLO 4Z4CA 1SAZA 4DTSA 4M42A 3SQ0A 2E2PA 1VSLA 4CGDA 1VQKN 3MWPA 4DSIA 1SS6A 1O13A 3WXJA 3UIQA 4W5NA 3SBTA 4MDBA 3ZSRA 2J4RA 3ZT4A 1SZ2A 2F7TA 2KLAA 3LDPA 5J2NA 1NK9A 3Q7BA 2IC3A 4J2BA 3V9XA 2BGGA 3KLEA 2A3ZA 3LDNA 3LDQA 4FJKA 1LOTB 3HVRA 4ELVA 2QKKA 4JD2A 3R6MA 4KHSA 3NH0A 3D6RA 3FE1A 3TAMA 3EEQA 4OGEA 2Z1GA 3AA4A 4EP5A 4CJ7A 4FJ9A 3E9LA 4LFBK 1NNEA 1BO5O 3SYZA 4FJLA 1RGIA 1XHZA 4BECA 1TK0A 2P9UB 3I8BA 4Q5VA 3AVBA 4LH4A 1HQEA 5AR0A 4M45A 5A2QO 5CZ2A 1U2VB 5BREA 3D45A 4DV2K 3QEPA 4CHZA 4JKHA 3O3HA 3HSTB 3IS9A 4E1JA 3OS1A 5JLHA 1RDBA 1S22A 4M7YA 4YORA 3PX4A 1NOYA 4JKDA 4K8ZA 4E3SA 1ATNA 3VENA 2F8SA 1JLCA 4GKJK 2A1RA 5CR4A 1I94K 4DQ8A 2P9KA 2W40A 4JAXA 1K9MO 3CF5L 2QK9A 3DXMB 4CZFA 3RMDA 1A5WA 3KD5E 5HRSA 3SAFA 5C10A 2OZMA 4BDZA 4A59A 3C7NB 4UY8O 3M3ZA 2QWPA 1K8KA 3KLFA 4Z4HA 3O9RA 2UUAK 3F9KA 5AQJA 3CC7N 1ESVA 4KPYA 3AO4A 3HK2A 4B3OA 3JYTA 3EE8A 2HVIA 2V7ZA 3V1QA 3ZETB 2HBMA 3HP6A 4BRCA 4JLHA 3O08A 1HNVA 3HPGA 4FWQA 3NGYA 2X6NA 4E0DA 4CZKA 4W5TA 5F0XA 1BOTO 1WAJA 4DB3A 4DUYK 3G4SN 4FLXA 1KAZA 2YHXA 3D2FA 2P51A 1SQKA 3J80O 2O8EA 3ZSXA 4BRNA 3H6EA 3MMVA 3NGZA 4I6MB 4DSFA 2E6LA 2YV0X 2E1YA 2QXLA 2HNYA 2CH6A 3DLKA 4LSLA 3J7ZO 3VQ4A 1U47A 3ZT0A 4A57A 3AA3A 2WOMA 5ADXH 3NCIA 3AVMA 1RDUA 5HLFA 3F73A 2FSJA 3CCRN 4E89A 3M8QA 3MXMA 5HL7L 3O6WA 3ZSOA 4CJ4A 3K57A 1VSFA 2OTLN 4FLVA 4FK2A 3D7EO 3DXKB 2D0OA 1L3SA 4IKFA 1W9HA 3AVIA 1GLFO 4BVOA 1CXQA 4R5PA 4A2AA 3P38A 3HYFA 3I0SA 4K8XA 1QHAA 1Q7YO 4KB0A 2AA4A 1HLUA 4CEBA 3L2UA 2G8UA 4O5BA 3N4QA 5AQXA 1CZAN 1JKHA 4BRAA 3OVNA 4FJJA 4FJNA 3ULDA 4K42A 4PKIA 4WCEL 3CCLN 2QXFA 4KHYA 1P90A 3R8EA 3VF4A 1LAWA 3FZMA 4FJ8A 2YJFA 3CC2N 2EHGA 4FLZA 1TAQA 3ZYYX 2P9LA 5CYMA 3EO3A 1XUPO 3LPTA 2GUIA 4HHTA 4DFKA 2IGIA 4KH6A 1SKSA 3KLGA 3VQ8A 4CJVA 3AA5X 4KRFA 4BC3A 2XY6A 2VGNA 3KWGA 2KKZA 2H3GX 1ZBIA 4E19A 1X9MA 3OYHA 4LF7K 4OPJA 1DEJA 3MEDA 4U7BA 5HRPA 2A41A 2GWKA 2YKNA 1NJYA 2BE2A 4CZMA 1SL1A 4H0YB 5KI6A 4BEBA 4OLAA 4NXNK 2ZQBA 1N32K 3NF9A 3P83D 4FOIA 3QEIA 4DR3K 3AVHA 4WFAL 1RILA 1TKTA 3OS0A 1FKOA 4I9QA 4W5RA 1TL1A 1LV5A 3QNOA 3VA0A 4BROA 3LP3A 1HYSA 3LDOA 3DOKA 3TU5A 1KFDA 1YVUA 5J2MA 3VF2A 3CPEA 4FWLA 3CJ9A 4FLUA 4J8FA 3MAQA 2P9PA 4BR5A 3TI0A 4CK2A 1NG9A 4B1VA 3P5JA 4AHVA 4KAZA 2WONA 3OTOK 2NRVA 3LZIA 1NBWA 2I7PA 3A8YA 4KHUA 3CCJN 3SI6A 3IUCA 4FW2A 3OYFA 1W0HA 4PY5A 3OJUA 3ATVA 4FJHA 1QQMA 1OH7A 1RTIA 4GMJB 4FVMA 3CM6A 4DQSA 4CZIA 1QSLA 2P5OA 4FWPA 4LC9B 4WF9L 1BA1A 1IBMK 4E7HA 4LY7A 1J6ZA 3LL3A 3ZSQA 3VQ5A 3DXMA 3RRGA 4DR2K 2P9KB 1KD1O 4A61A 4FVUA 4NLCA 3VQ6A 4HVJA 1L3TA 1BDGA 2FXUA 2XO7A 1VSMA 4JN4A 3KLHA 1ASVA 4DTUA 2A6AA 2O8FA 2FLOA 4BRQA 4JYAK 4AH9A 4IFYA 4CJTA 2G8IA 1JLGA 3PUFA 3HOTA 1VK0A 2OPPA 3ID8A 1S6QA 4IZ9A 4WE1A 2E8AA 4CJRA 3H45C 1CLQA 3N4PA 3HL8A 4CBWA 3JAMO 1VQMN 1ZBSA 3PY8A 4C8MA 2P9NA 3U3YA 3HT3A 3FZLA 5C2FA 4B1UB 3RMBA 3CCMN 1T3VA 1T6CA 2KZZA 5JLFA 1X9SA 3BP8A 3HTVA 4CGJA 1EX4A 4F9OA 4LF9K 2O8BB 3VPZA 1VQ7N 4CJ5A 2HOEA 4MQ3A 4DF8A 4DLEA 2AJQA 3OA9A 2OPQA 3K58A 1CZ9A 4YHHK 2OYQA 5AQOA 4B9SA 1Q81O 1N33K 4DHYA 1J5OA 3OYCA 3UKUA 1BI4B 3THXB 3CI5A 4YOTA 2KQ2A 4EHTA 5CZ1A 4BDPA 3DWLA 4GW6A 2HHIA 3AARA 3C0BA 4H4MA 2E5LK 1QSSA 2QWLA 4E7JA 4E7LA 1HR0K 4Y1CA 2FBXA 2E6MA 3OYBA 2P1JA 3VEYA 2KFZA 3HO1A 2FBYA 3SUOA 1IO2A 1BIUA 4FPAA 5AZJB 1Y97A 1XHXA 4JI6K 1VRUA 3S41A 5HRRA 2ZM6K 4H03B 3VEVA 4O8KA 2D0BA 1C6VA 1HRHA 1Q86O 3CQYA 4FWKA 1YHQN 3SNNA 1YAGA 3R9PA 3LDSA 4B9LA 5ADXA 5I3UA 4DV1K 2RF2A 4CD1A 4B9QA 3NF6A 4N76A 3LM2A 5DMRA 3L6QA 4AILC 1RDCA 3NVKA 3TAEA 3CJBA 2FF3B 3BZCA 3EKSA 2NRWA 4C8LA 4AHSA 3CG7A 3LZJA 3E9PA 4BG9A 3TSPA 4NYFA 3CMAN 3THVA 4ISEA 4NB4A 3BEXA 2NRXA 4BREA 2OPRA 3WUHA 4QOZB 3ZSYA 4KTQA 5GIOA 2OANA 3GOIA 4Z4IA 4BGBA 4LFAK 4LD0A 1RTJA 4DTJA 2GUPA 4FWRA 4CF0A 3A5LC 3A5OC 5JVGL 4B1XB 3NMUA 4G1QA 2HNDA 2Z1HA 3EZ5A 4WFNL 3OYJA 4F8RA 5H1SQ 4DSEA 2KZMA 3TTDA 1NJIO 4CHQA 2Q2RA 4LF6K 3A2FA 4RWTA 5BRFA 5AZIA 3VQQA 1QS4A 4BRLA 3M6GA 3D0PA 3I0RA 1VQLN 1LWFA 4RW9A 3SAHA 4BRMA 1QQNA 2IVOA 4E7IA 3PIPL 4B3SK 5LY3A 4KH5A 3T1AA 3DM2A 1EP4A 2Q0RA 3IAYA 3ZT3A 3O1WA 1VSIA 1RBVA 1S1UA 2FSKA 1IKXA 1ZYQA 2O4GA 1FK9A 5EXWA 3AGRA 5K14A 5M1OA 4JK8A 3QERA 1GLCG 3O9QA 3SUNA 1U04A 1BISA 5FRMA 4CBXA 4CFAA 2IIRA 1HJOA 4JI5K 2KFNA 2D0PA 4PL8A 3F9MA 1D9FA 1K8KB 1LWCA 3TTFA 1ITGA 3VEZA 5JENA 3RWUA 1JCFA 2VYPA 3V81A 2O8BA 3CYGA 1NJWA 3Q7CA 1ASWA 2CGJA 5FPNA 5JVHL 4AHTA 1YT3A 5M1FA 1RTDA 3CMEN 1RBTA 1VSHA 1VSDA 4BR4A 3KZBA 5C0YA 3MXIA 5EY4A 1F21A 5HP1A 2P9NB 3GL1A 4H0VB 3BUZB 3AGKA 3EE9A 3LP1A 3M1FA 1VQ4N 4FZYA 5J2QA 1GLEG 4MFBA 5LMUK 1T6DA 5BN8A 4JI4K 3VQBA 4ID1A 4BGAA 1KXPA 2YHAA 1VQNN 1Y64A 4YOXA 2Q0UA 3G6EN 4NXMK 3K59A 4K41A 1EO1A 3QDKA 3C94A 2UUBK 2ZJPL 1RCHA 1ZXOA 5HROA 1E4GT 4BRDA 3T1YK 5BPNA 3PX6A 4Z4GA 2VWJA 2KTQA 1J54A 3QETA 3ISNC 4DTNA 4N5SA 1NK5A 5KGXA 4BR2A 1WSHA 1RT5A 1HNWK 3OBWA 4F2SA 1FKPA 4JKAA 3DLEA 2ZWHA 4JI0K 3L2QA 3P1GA 3V9SA 4CJLA 3LP2A 3CM5A 4BRIA 3KTQA 2VG7A 3EN9A 3WEEB 2P9UA 2D4WA 1WSGA 3VN5A 3ENHA 2UU9K 5J1EA 1NGHA 5KPZA 1N6QA 3S5TA 1T44A 4FJGA 3K0SA 4Q0BA 2ZGZA 1W97L 1C0TA 3HPHA 3WNEA 3CHWA 1TUYA 1EWQA 3THYB 1XC9A 1KAYA 2HF4A 3H1QA 5AQGA 3ZETA 3VA3A 1WBDA 1VSEA 2Q97A 1RDWX 5GAHP 4NO7A 1S1VA 3BF1A 3VQ9A 4R79A 4FL9A 3F5TA 1QQOA 4PWDA 3C95A 2RPIA 4YOVA 3E1YA 2YCHA 4RW8A 4WQ5C 4A2BA 4OKEA 1IKVA 3MXJA 1WSFA 1IH7A 3HM9A 2E2NA 2IVNA 1QVFM 3CCUN 1VQ9N 3VGMA 1LW0A 3NHGA 2HHUA 2BUPA 3CYMA 1H1VA 2IOCA 4C1NI 4C1NK 1MWKA 2FSNA 2PY5A 4CGIA 4O55A 4KHPK 1S1TA 2YNGA 3FZFA 3I56N 1E3MA 3VEXA 3KK3A 3AVAA 3FFKB 3WXMB 3CD6N 1JCEA 3KHYA 2VGMA 4O4GA 3WQTA 1NK6A 4Z4FA 1VQ5N 3O1BA 3VQ7A 3C65A 2DTUA 1QQCA 1DTQA 3AO5A 2Y1IA 4OPAA 3L0QA 3JSMA 1TKDA 1TV6A 4BQLA 3QO9A 1M90O 3L2VA 3TAGA 1EWRA 4DQRA 3PX0A 4CCHA 4DUZK 1S1WA 4MLHA 1YJNN 5C42A 2HNZA 2V7YA 2OA8A 4RTFD 1UA0A 3UKRB 3VTIA 3DLBA 4MO5A 3H46O 3VQAA 5J2PA 3LDLA 3UKRA 4JI3K 2NZTA 3CPWM 3NBPA 2QEXN 4NCBA 3KK1A 3DOLA 5M1NA 1JLAA 4B3RK 3VOVA 3AA2A 3BF3A 3HI0A 5GINA 3CJAA 1VQPN 5AFUA 4CZLA 1RDDA 4E1NA 2FBVA 3NH2A 3MDQA 5E26A 3V9WA 1QZ5A 3CCSN 3RR7A 4JS5A 4IEIA 3T7ZA 2W42A 1ILYA 3QB0A 4NYNA 1CXUA 4LF5K 4LF4K 2YHYA 1D4XA 4JI8K 3OYEA 1OH8A 3A5MC 4H5NA
chains in the Genus database with same CATH topology
1J6ZA 5AQSA 3LL3A 5AQTA 5F2RA 3SK3A 1HPMA 3ID6A 3DXMA 2Q36A 2P9KB 1KD1O 4A61A 4FVUA 4NLCA 4MDAA 1Q18A 4CZJA 5BPMA 2GTDA 5EVZA 1BDGA 2FXUA 3B8AX 5GADP 1GLJO 4JN4A 4AM6A 4BR0A 3AAPA 3AY9A 2A6AA 5B8HA 3UE5A 1K73O 3FZHA 5AZJA 2FLOA 3DLLL 3GBTA 2YI1A 4BRQA 4BRPA 3TTCA 4IJAA 1HUXA 5KPRA 1EQYA 4IDHA 4JKCA 4JNEA 2HSTA 5AQZA 1NGEA 3HOTA 4XH4A 4H5WA 5BN9A 3ID8A 5GAEP 4IZ9A 5EOYA 2CGKA 4HTLA 3R3LA 2E8AA 3WT0A 4EAHD 2VWBA 4EFHA 3H45C 2HBJA 1NMDA 3N4PA 4CBWA 4FO0A 1YITN 1VQMN 3TSUA 1ZBSA 1NGDA 2P9NA 4B1ZA 3FZLA 2NNWA 1VAZA 4RCHA 2BTFA 2GWJA 5C2FA 3RSEA 4U67L 3WQUA 4XJXA 5F1XA 4Z94A 4B1UB 5BR9A 3MCPA 3CXCM 3CCMN 3OW2M 1C0GA 1T3VA 4IWVA 4GV6A 1T6CA 2DPNA 4IOXA 4A5AA 4ILHA 3HZ6A 1YXQA 4JKEA 5JLFA 4BC5A 3BP8A 3H1VX 3HTVA 1OVYA 2WUSA 3ULEB 3L4QA 2ASPA 4F9OA 1RFQA 3DXKA 3VPZA 2KHOA 2HBLA 3F2KA 3L4IA 3QBXA 4CZHA 1VQ7N 5TKWA 4C23A 3CQXA 1NM1A 2HOEA 3MK6A 2GX9A 5AZIB 2IVPA 3OA9A 4H5VA 4QS9A 3U9ZA 3MN9A 3VEWA 2ZJQL 1MA9B 5I9EB 3FZKA 2E88A 5AQOA 5JICA 3PIOL 3I33A 4K43A 2ASOA 5KQ8A 1Q81O 4DHYA 2F9WA 3UKUA 4BRKA 2PBDA 4PKGA 4MLEA 2QWNA 4QS7A 4BY9C 3E9OA 4JKGA 1YI2N 3I55N 1R59O 3CI5A 1OKJA 4YOTA 4EHTA 2QWOA 1ZC6A 4I6MA 4GY2B 3DWLA 2Q1NA 5BRHA 3AARA 3C0BA 3J8AA 1XC3A 3AAQA 2QWLA 4B1YB 1X3MA 4FOEA 1Z6RA 3C6HA 4H0XB 4AF1A 3VEYA 4JKGB 2ZGYA 4OPHA 2YX6A 1NGCA 2C1IA 4FPAA 3KK7A 5BPLA 2WBNA 3SMSA 5JMVA 5AZJB 2D1KA 2BH1A 3GG4A 4FSVA 4EIAA 2PAVA 1S72N 3S41A 2CH5A 5AQRA 2GEMA 5AQPA 3O9TA 3GDQA 4H03B 3ENBA 3VEVA 2F9TA 4O8KA 1BU6O 2ITMA 5FPMA 2WFBA 3IKMA 1Q86O 3CC4N 4JEPA 3QFPA 3CQYA 4FWKA 1YHQN 2UYTA 4BE7B 1YAGA 4WFBL 4FPBA 3R9PA 2WC9A 1LCUA 2YHWA 5ADXA 1G99A 5AQYA 4BVPA 2W00A 3CJCA 1HX1A 2HMPA 4CD1A 1ATSA 2A40A 2QM1A 3WXKA 1GLLO 3H3NO 4B9QA 1SAZA 5EX5A 4IJNA 2E2PA 3LM2A 3SAGA 3L6QA 3NVKA 1VQKN 3CJBA 3MWPA 2QA4N 2FF3B 3FGUA 3EKSA 1C0FA 5C12A 1SS6A 2NRWA 3G25A 1O13A 4ISGA 5CHIA 3QBWA 3HRGA 3WXJA 4QS8A 5AQVA 3SBTA 3E9PA 4MDBA 3IFRA 5FPEA 4BG9A 3IMXA 3U9DA 1HKCA 3TSPA 2J4RA 3OHRA 3VGLA 2HBKA 4IO9L 4OO1J 3CMAN 4ISEA 4NB4A 2JWKA 4BG8A 2I7NA 3BEXA 1SZ2A 2F7TA 2KLAA 3LDPA 3TSQA 4CI6A 2NRXA 3Q7BA 4BREA 3O80A 4M7XA 3WUHA 3M5RA 2A3ZA 3LDNA 3LDQA 3QFUA 4CBUA 1LOTB 3ENOA 4H0TB 5GIOA 1K8AO 2OANA 3GOIA 4GVEA 3QICA 4NLBA 4BGBA 2P9PB 5GAGP 5E84A 1NGJA 4JD2A 2A42A 3R6MA 4BRFA 2GUPA 4FWRA 3A5LC 3A5OC 3ULEA 3D6RA 2ASMA 3FE1A 3VMFB 1DKGD 1NGFA 4B1XB 5JVGL 3NMUA 2CGLA 3IDHA 4WFNL 5GIPA 1DT9A 4CJ7A 3WXLA 5H1SQ 3E9LA 2JWLA 4AM7A 1KC8O 3TTDA 1BO5O 1NJIO 1RGIA 3ZX3A 1V4TA 4G9ZA 2P9LB 1IG8A 2Q2RA 1IJJA 4BECA 4RWTA 2P9UB 1V4SA 3I8BA 5AZIA 5BRFA 3CCQN 4BRLA 3M6GA 1WOQA 4JK7A 3E66A 3MCAB 1VQLN 1U6ZA 3GE1A 2A5XA 2NRTA 4BRGA 4MO4A 5AR0A 3HM8A 3T69A 3SAHA 4WQ4C 3O9SA 5AQWA 4BRMA 1QQNA 2IVOA 2NLXA 3DAWA 3PIPL 3A0IX 3W0LA 1NGGA 1U2VB 5BREA 5LY3A 3VTHA 4KH5A 1GLAG 3TPQA 2Q0RA 4A5BA 3JXUA 4JKHA 5AQMA 3O1WA 1W2BM 1Q82O 4E1JA 1S3XA 5FPDA 3PLAA 3H3OB 5JLHA 4YORA 1S22A 4M7YA 5AQNA 4JKDA 2FSKA 1ATNA 3VENA 2P9IA 4CZGA 5EXWA 1M1KO 3AGRA 4CZEA 5M1OA 4JK8A 5CR4A 3WEEA 5M1KA 1MDUB 3JS6A 1GLCG 3MN5A 2EWSA 2P9KA 3O9QA 2W40A 3VESA 4DQ8A 3SBGA 4JAXA 1K9MO 1HKBA 3CF5L 4BC2A 3DXMB 1BWFO 4CZFA 3SAFA 5C10A 4XEIA 3MWTA 4CBXA 4A59A 3C7NB 2IIRA 1VQON 4UY8O 1HJOA 3M3ZA 4WQ5A 2QWPA 1K8KA 2D0PA 3C7NA 3O9RA 4PL8A 3DJCA 3F9MA 3ATUA 4IOAL 2E20A 1K8KB 3TTFA 4H0OA 3VEZA 5AQJA 3CC7N 1ESVA 4Y0WA 1JCFA 2VYPA 2QWRA 4ILJA 3EE8A 1NGBA 2V7ZA 3Q7CA 1JCGA 5AQUA 5AQKA 4O5FA 2CGJA 2NRZA 5AQLA 5FPNA 1GLDG 2HBMA 3ZETB 4YOYA 5JVHL 4BRCA 3O08A 3U4LA 5M1FA 1YVNA 4JHDB 1WUAA 1YF5L 2E2OA 4JKBA 3CMEN 4FWQA 1YIJN 3RSEB 3KZBA 4YDUA 4BR4A 5C0YA 4JHDA 5EY4A 4XH1A 3KWIA 4CZKA 5F0XA 1BOTO 2P9NB 2W41A 3GL1A 4H0VB 3BUZB 2Q31A 3AGKA 3ZEUB 3EE9A 4DB3A 5ELZA 4PKHA 3G4SN 4M63C 3CETA 3M1FA 1VQ4N 1KAZA 2YHXA 3D2FA 5HOOA 1SQKA 1X9JA 3UB5A 4BC4A 1JJ2M 1GLEG 4BRNA 1YUWA 3H6EA 2RE2A 5DM7L 3MMVA 3FR0A 3D2FB 1T6DA 5BN8A 4I6MB 3EL2A 1BA0A 3ZEUA 4BGAA 2E1YA 2OTJN 2QXLA 3SJHA 1KXPA 1VQNN 1Y64A 2CH6A 4YOXA 3J7ZO 2Q0UA 3G6EN 4FWSA 4B1WB 4K41A 2GELA 4BR7A 3QDKA 1EO1A 4K25A 1VQ8N 4HWIA 1NLVA 3CIPA 4A57A 2HF3A 4EHUA 5CE3A 2ZJPL 1ZXOA 5ADXH 3KVGA 4KH4A 5KQDA 3ZX2A 1E4GT 1MWMA 4BRDA 5BPNA 1RDUA 2P9SB 5MLCQ 2E1ZA 2FSJA 3MN6A 5AFUH 3CCRN 3P4IA 4BR2A 5HL7L 1BG3A 3O6WA 3OBWA 4DKWA 4JKAA 5DM6L 2ZWHA 2OTLN 3OBYA 3D7EO 3DXKB 2D0OA 5AQIA 4YOWA 3SLCA 2YJEA 1GLFO 4BVOA 4BRIA 5LJVA 2VCPA 1HKGA 1NGAA 5AQFA 5AQQA 4GV9A 4A2AA 3P38A 3EN9A 3WEEB 3D2EA 1TUUA 2P9UA 3P39A 2D4WA 1XQSC 3ENHA 1NGHA 1QHAA 5KPZA 3EKUA 1Q7YO 4KBOA 2AA4A 4L3QA 3K9KA 1T44A 1HLUA 3P31A 4WQ4A 2P9IB 1KAXA 3N4QA 5AQXA 1P8ZA 2ZGZA 1CZAN 4H5TA 4BRAA 1W97L 1U2VA 4H5RA 5M1QA 1YJ9N 3WXIA 5C2DA 3CHWA 3MX2A 3HOSA 1TUYA 4K42A 4PKIA 3EZWA 4WCEL 3CCLN 3K9JA 2HF4A 1KAYA 3H1QA 5AQGA 4H0PA 3ZETA 1P90A 4YDUC 1KQSM 3R8EA 3VERA 4FWMA 3VF4A 2Q97A 3R1XA 4YOUA 3O5BA 1RDWX 4BRHA 4BQZA 2AP1A 4NO7A 5GAHP 3BF1A 3FZMA 4R79A 2YJFA 3MX5A 5C15A 3CC2N 3VEOA 3ZYYX 4FL9A 2P9LA 3F5TA 1QQOA 2PFUA 3EO3A 4BR9A 1XUPO 4PHTX 1E4FT 1BUPA 4YOVA 3E1YA 2YCHA 4KH6A 4WQ5C 4ILGB 4A2BA 3HBTA 3O4WA 2E2NA 2IVNA 4O8UA 4BC3A 5BRDA 1QVFM 2VGNA 3KWGA 3CCUN 2QW9A 2KKZA 3VGMA 1VQ9N 2H3GX 2BUPA 4CD3A 3HSCA 4JK9A 1H1VA 3A5NC 3G71N 1DEJA 2QWQA 4C1NI 1Z05A 4C1NK 1MWKA 2FSNA 2NRHA 2A41A 4U7BA 4WYBA 3MN7A 2GWKA 4IEEA 3CCVN 1X3NA 4CZMA 3FZFA 3I56N 3SMPA 3CJ7A 2QI2A 4H0YB 4BEBA 3O8MA 3VEXA 3RVCA 3CERA 3FFKB 2ZF5O 3WXMB 2V51B 4IOCL 3CD6N 4GNIA 1JCEA 4FOIA 3KHYA 1NGIA 2VGMA 3WQTA 2V52B 4FWNA 3C6AA 4WFAL 1VQ5N 1NWKA 3O1BA 3C65A 4OPAA 3L0QA 1GLBG 4BROA 5LJWA 3LDOA 4BQLA 1QVGM 1M90O 3W3DA 3LM9A 2NRRA 3VGKA 3NVMA 4XH5A 3O9UA 3TU5A 1DGKN 2QWMA 2RHKA 4MLHA 1YJNN 3VF2A 1TYQB 3CPEA 2V7YA 4FWLA 4A62A 4DCHA 3CJ9A 4RTFD 2C1GA 4J8FA 3UKRB 1ATRA 4JD2B 3VTIA 4GV3A 4MO5A 2E2QA 3H46O 2P9PA 3LDLA 3UKRA 4JKFA 1N8RO 2P9SA 3FLCO 5KPTA 2NZTA 1TYQA 3CPWM 2QEXN 4BR5A 1VQ6N 3CCEN 4B1VA 3U8XA 5M1NA 3VOVA 3BF3A 3HI0A 5GINA 3CJAA 5AQHA 1VQPN 5AFUA 4CZLA 1QZ6A 2NRVA 3VF6A 1NBWA 2I7PA 3A8YA 3MDQA 5E26A 3CCJN 3CJ1A 4IFEA 4ISFA 3IUCA 2ZJRL 3D2EB 3UKUB 1QZ5A 4FWOA 5TKYA 3CCSN 5M1PA 1YJWN 4IEIA 3QMLA 3T7ZA 3ATVA 4PL7A 1QQMA 4IXCA 2FF6A 1ILYA 3ZX0A 2QTDA 3QB0A 3VETA 2YHYA 1D4XA 4CZIA 3A5MC 4FWPA 4IO8A 4H5NA 4LC9B 4WF9L 1BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Z A;  5AQS A;  3LL3 A;  5AQT A;  5F2R A;  3SK3 A;  1HPM A;  3DXM A;  2Q36 A;  2P9K B;  4A61 A;  1Q18 A;  4CZJ A;  5BPM A;  2GTD A;  5EVZ A;  1BDG A;  2FXU A;  3B8A X;  1GLJ O;  4JN4 A;  4AM6 A;  4BR0 A;  3AAP A;  3AY9 A;  2A6A A;  5B8H A;  3UE5 A;  3FZH A;  5AZJ A;  2FLO A;  3GBT A;  2YI1 A;  4BRQ A;  4BRP A;  4IJA A;  1HUX A;  5KPR A;  1EQY A;  4JNE A;  5AQZ A;  1NGE A;  4XH4 A;  4H5W A;  5BN9 A;  3ID8 A;  4IZ9 A;  5EOY A;  2CGK A;  4HTL A;  2E8A A;  3WT0 A;  4EAH D;  2VWB A;  4EFH A;  3H45 C;  1NMD A;  4CBW A;  4FO0 A;  1ZBS A;  1NGD A;  2P9N A;  4B1Z A;  3FZL A;  4RCH A;  2BTF A;  2GWJ A;  3RSE A;  3WQU A;  5F1X A;  4Z94 A;  4B1U B;  5BR9 A;  3MCP A;  1C0G A;  4IWV A;  1T6C A;  2DPN A;  3HZ6 A;  1YXQ A;  5JLF A;  4BC5 A;  3BP8 A;  3H1V X;  3HTV A;  2WUS A;  3ULE B;  2ASP A;  4F9O A;  1RFQ A;  3DXK A;  3VPZ A;  2KHO A;  3L4I A;  3QBX A;  4CZH A;  4C23 A;  3CQX A;  1NM1 A;  2HOE A;  3MK6 A;  5AZI B;  2IVP A;  4H5V A;  3U9Z A;  4QS9 A;  3MN9 A;  3VEW A;  1MA9 B;  5I9E B;  3FZK A;  2E88 A;  5AQO A;  5JIC A;  3I33 A;  4K43 A;  2ASO A;  5KQ8 A;  4DHY A;  2F9W A;  3UKU A;  4BRK A;  2PBD A;  4PKG A;  4MLE A;  2QWN A;  4QS7 A;  1R59 O;  3CI5 A;  1OKJ A;  4EHT A;  2QWO A;  1ZC6 A;  4I6M A;  4GY2 B;  3DWL A;  2Q1N A;  5BRH A;  3AAR A;  3C0B A;  3J8A A;  1XC3 A;  3AAQ A;  2QWL A;  4B1Y B;  1X3M A;  4FOE A;  1Z6R A;  4H0X B;  3VEY A;  2ZGY A;  1NGC A;  4FPA A;  5BPL A;  5JMV A;  3SMS A;  5AZJ B;  2D1K A;  3GG4 A;  4FSV A;  4EIA A;  2PAV A;  3S41 A;  2CH5 A;  5AQR A;  2GEM A;  5AQP A;  4H03 B;  3GDQ A;  3VEV A;  2F9T A;  4O8K A;  1BU6 O;  2ITM A;  5FPM A;  3QFP A;  3CQY A;  4FWK A;  2UYT A;  1YAG A;  4FPB A;  3R9P A;  1LCU A;  2YHW A;  5ADX A;  1G99 A;  5AQY A;  4BVP A;  3CJC A;  1HX1 A;  2HMP A;  4CD1 A;  1ATS A;  2A40 A;  2QM1 A;  3WXK A;  1GLL O;  3H3N O;  4B9Q A;  1SAZ A;  5EX5 A;  4IJN A;  2E2P A;  3LM2 A;  3L6Q A;  3CJB A;  2FF3 B;  3FGU A;  3EKS A;  1C0F A;  4ISG A;  3G25 A;  3QBW A;  3WXJ A;  4QS8 A;  5AQV A;  3IFR A;  5FPE A;  4BG9 A;  3IMX A;  3U9D A;  1HKC A;  3VGL A;  2J4R A;  3OHR A;  4ISE A;  4NB4 A;  4BG8 A;  2I7N A;  3BEX A;  1SZ2 A;  3LDP A;  4CI6 A;  4BRE A;  3O80 A;  4M7X A;  3WUH A;  2A3Z A;  3LDN A;  3LDQ A;  3QFU A;  4CBU A;  1LOT B;  3ENO A;  4H0T B;  2OAN A;  3GOI A;  3QIC A;  4BGB A;  2P9P B;  5E84 A;  1NGJ A;  4JD2 A;  2A42 A;  3R6M A;  4BRF A;  2GUP A;  4FWR A;  3A5L C;  3A5O C;  3ULE A;  2ASM A;  3FE1 A;  4B1X B;  1DKG D;  1NGF A;  2CGL A;  3IDH A;  4CJ7 A;  3WXL A;  4AM7 A;  1BO5 O;  1RGI A;  3ZX3 A;  1V4T A;  2P9L B;  1IG8 A;  2Q2R A;  1IJJ A;  4RWT A;  2P9U B;  1V4S A;  3I8B A;  5AZI A;  5BRF A;  4BRL A;  3M6G A;  1WOQ A;  1U6Z A;  3GE1 A;  2A5X A;  4BRG A;  4MO4 A;  5AR0 A;  3HM8 A;  4WQ4 C;  5AQW A;  4BRM A;  1QQN A;  2IVO A;  2NLX A;  3DAW A;  3A0I X;  3W0L A;  1NGG A;  1U2V B;  5BRE A;  5LY3 A;  3TPQ A;  1GLA G;  2Q0R A;  3JXU A;  5AQM A;  3O1W A;  4E1J A;  1S3X A;  5FPD A;  3H3O B;  5JLH A;  1S22 A;  4M7Y A;  5AQN A;  2FSK A;  1ATN A;  3VEN A;  2P9I A;  4CZG A;  5EXW A;  4CZE A;  3WEE A;  1MDU B;  3JS6 A;  1GLC G;  3MN5 A;  2EWS A;  2P9K A;  3VES A;  2W40 A;  4DQ8 A;  4JAX A;  1HKB A;  4BC2 A;  3DXM B;  1BWF O;  4CZF A;  4XEI A;  4CBX A;  3C7N B;  2IIR A;  1HJO A;  3M3Z A;  4WQ5 A;  2QWP A;  1K8K A;  2D0P A;  3C7N A;  4PL8 A;  3DJC A;  3F9M A;  3ATU A;  2E20 A;  1K8K B;  4H0O A;  3VEZ A;  5AQJ A;  1ESV A;  4Y0W A;  1JCF A;  2VYP A;  2QWR A;  1NGB A;  2V7Z A;  1JCG A;  5AQU A;  5AQK A;  4O5F A;  2CGJ A;  5AQL A;  5FPN A;  3ZET B;  1GLD G;  4BRC A;  3O08 A;  3U4L A;  1YVN A;  4JHD B;  1WUA A;  2E2O A;  4FWQ A;  3RSE B;  3KZB A;  4YDU A;  4BR4 A;  4JHD A;  5EY4 A;  4XH1 A;  4CZK A;  5F0X A;  1BOT O;  2P9N B;  2W41 A;  3GL1 A;  4H0V B;  3BUZ B;  2Q31 A;  3ZEU B;  4DB3 A;  5ELZ A;  4PKH A;  4M63 C;  3CET A;  3M1F A;  1KAZ A;  2YHX A;  3D2F A;  1SQK A;  1X9J A;  3UB5 A;  4BC4 A;  1GLE G;  4BRN A;  1YUW A;  3H6E A;  3MMV A;  3FR0 A;  3D2F B;  1T6D A;  5BN8 A;  4I6M B;  3EL2 A;  1BA0 A;  3ZEU A;  4BGA A;  2E1Y A;  2QXL A;  3SJH A;  1KXP A;  1Y64 A;  2CH6 A;  2Q0U A;  4FWS A;  4B1W B;  4K41 A;  2GEL A;  4BR7 A;  3QDK A;  4K25 A;  4HWI A;  1NLV A;  3CIP A;  4EHU A;  2HF3 A;  5CE3 A;  1ZXO A;  5ADX H;  3KVG A;  5KQD A;  3ZX2 A;  1E4G T;  1MWM A;  4BRD A;  5BPN A;  2P9S B;  2E1Z A;  2FSJ A;  3MN6 A;  5AFU H;  3P4I A;  4BR2 A;  1BG3 A;  3O6W A;  2ZWH A;  3D7E O;  3DXK B;  2D0O A;  5AQI A;  3SLC A;  2YJE A;  1GLF O;  4BVO A;  4BRI A;  5LJV A;  2VCP A;  1HKG A;  1NGA A;  5AQF A;  5AQQ A;  4A2A A;  3EN9 A;  3WEE B;  3D2E A;  1TUU A;  2P9U A;  2D4W A;  1XQS C;  3ENH A;  1NGH A;  1QHA A;  5KPZ A;  3EKU A;  4KBO A;  2AA4 A;  4L3Q A;  1T44 A;  1HLU A;  4WQ4 A;  2P9I B;  1KAX A;  5AQX A;  1P8Z A;  2ZGZ A;  1CZA N;  4H5T A;  4BRA A;  1U2V A;  4H5R A;  3WXI A;  3CHW A;  1TUY A;  4K42 A;  4PKI A;  3EZW A;  2HF4 A;  1KAY A;  3H1Q A;  5AQG A;  4H0P A;  3ZET A;  4YDU C;  3R8E A;  3VER A;  4FWM A;  3VF4 A;  2Q97 A;  4BRH A;  3O5B A;  1RDW X;  4BQZ A;  2AP1 A;  4NO7 A;  3BF1 A;  3FZM A;  2YJF A;  3VEO A;  4FL9 A;  2P9L A;  1QQO A;  3EO3 A;  4BR9 A;  1XUP O;  1E4F T;  1BUP A;  2YCH A;  4WQ5 C;  4A2B A;  3HBT A;  3O4W A;  2E2N A;  2IVN A;  4BC3 A;  5BRD A;  2QW9 A;  3VGM A;  2H3G X;  2BUP A;  4CD3 A;  3HSC A;  1H1V A;  3A5N C;  1DEJ A;  2QWQ A;  1Z05 A;  1MWK A;  2FSN A;  2NRH A;  2A41 A;  4WYB A;  3MN7 A;  2GWK A;  1X3N A;  4CZM A;  3FZF A;  3SMP A;  3CJ7 A;  4H0Y B;  3O8M A;  3VEX A;  3CER A;  3FFK B;  2ZF5 O;  2V51 B;  4GNI A;  1JCE A;  4FOI A;  3KHY A;  1NGI A;  3WQT A;  2V52 B;  4FWN A;  1NWK A;  3O1B A;  3L0Q A;  1GLB G;  4BRO A;  5LJW A;  3LDO A;  4BQL A;  3W3D A;  3LM9 A;  3VGK A;  4XH5 A;  3TU5 A;  1DGK N;  2QWM A;  4MLH A;  3VF2 A;  1TYQ B;  4A62 A;  2V7Y A;  4FWL A;  4DCH A;  3CJ9 A;  4RTF D;  4J8F A;  3UKR B;  1ATR A;  4JD2 B;  4MO5 A;  2E2Q A;  3H46 O;  2P9P A;  3LDL A;  3UKR A;  2P9S A;  3FLC O;  5KPT A;  2NZT A;  1TYQ A;  4BR5 A;  4B1V A;  3U8X A;  3VOV A;  3BF3 A;  3HI0 A;  3CJA A;  5AQH A;  5AFU A;  4CZL A;  1QZ6 A;  3VF6 A;  1NBW A;  2I7P A;  3A8Y A;  3MDQ A;  5E26 A;  3CJ1 A;  4ISF A;  3IUC A;  3D2E B;  3UKU B;  1QZ5 A;  4FWO A;  5TKY A;  3QML A;  3ATV A;  4PL7 A;  1QQM A;  4IXC A;  2FF6 A;  3ZX0 A;  3QB0 A;  3VET A;  2YHY A;  1D4X A;  4CZI A;  3A5M C;  4FWP A;  4IO8 A;  4H5N A;  4LC9 B;  1BA1 A; 
#chains in the Genus database with same CATH topology
 1NK0 A;  4B9T A;  2HHT A;  2Z1J A;  2BDP A;  5F2R A;  3SK3 A;  1XNQ K;  4KTZ A;  2Q36 A;  1B92 A;  4DTO A;  3EYZ A;  5KGW A;  2GTD A;  4JI7 K;  3B8A X;  5GAD P;  3DLR A;  5B8H A;  3AAP A;  3AY9 A;  5HBM A;  1EET A;  4I7F A;  3J81 O;  5JS1 A;  3FFI A;  5AZJ A;  3DLL L;  2YI1 A;  3OJS A;  3TTC A;  4IJA A;  4IDH A;  4JNE A;  1G15 A;  2HST A;  1NGE A;  4B9N A;  2Y1J A;  3KKR A;  3AVK A;  1XWL A;  5GAE P;  5EOY A;  2O8E B;  1TVR A;  3AO3 A;  3R3L A;  3WT0 A;  4EFH A;  4ELT A;  3SQ2 A;  1NK8 A;  3HPO A;  3ZLJ A;  3TSU A;  1NGD A;  2ZE2 A;  1KLN A;  3V6D A;  1NKC A;  2NNW A;  1VAZ A;  1KTQ A;  4XJX A;  4CFB A;  3MCP A;  3CXC M;  4DR1 K;  3OW2 M;  3V1R A;  4A5A A;  3EY1 A;  2Q3S A;  3U3G A;  1YXQ A;  4JKE A;  3H1V X;  3I8D A;  3ULE B;  3BZK A;  3L4Q A;  2F8T A;  1RFQ A;  4CZH A;  2HBL A;  4QCL A;  1NM1 A;  4XIU A;  1SV5 A;  4CEQ A;  5AZI B;  3SPZ A;  1IBK K;  4H5V A;  3U9Z A;  4FW1 A;  3VEW A;  4BWM A;  1RT2 A;  1QHT A;  4HTU A;  1KLM A;  3PIO L;  3I33 A;  3QLH A;  4M3Z A;  3OYM A;  2PBD A;  3AO2 A;  4IG0 A;  4LH5 A;  4MLE A;  2QWN A;  3QIN A;  4BY9 C;  3E9O A;  1R59 O;  4W5O A;  5HRN A;  4DFP A;  2QWO A;  1ZC6 A;  1GOA A;  3OYD A;  5BRH A;  1UAX A;  4FZZ A;  3SUQ A;  1REV A;  2O8D B;  3J8A A;  1XC3 A;  3AAQ A;  1X3M A;  4FOE A;  3TAB A;  3C6H A;  3U6F A;  4JKG B;  2YX6 A;  2F4V K;  1S6P A;  2O8F B;  3GG4 A;  2PAV A;  5AQR A;  4AQY K;  4BAC A;  3GDQ A;  2F9T A;  3J7A P;  4DG1 A;  4OKJ A;  3NF7 A;  5FPM A;  4GKK K;  1S9E A;  4CJK A;  3CC4 N;  1Z25 A;  2ZD1 A;  3QFP A;  3V9Z A;  2UYT A;  4FPB A;  3BGR A;  2WC9 A;  1LCU A;  1RTH A;  3L3V A;  1G99 A;  5AQY A;  2G8W A;  2W00 A;  3LAM A;  1O1W A;  2HMP A;  2QM1 A;  2FC0 A;  3DYA A;  3WXK A;  3H3N O;  1JL1 A;  4DS4 A;  1Q9Y A;  1T7P A;  2QA4 N;  3FGU A;  3NFA A;  1T05 A;  4ISG A;  3G25 A;  4B8C A;  2Z1I A;  1J53 A;  2HHH K;  3QBW A;  3HRG A;  4HUE A;  4QS8 A;  1QSY A;  3IMX A;  1HKC A;  3VGL A;  3SPY A;  4BE2 A;  1HPZ A;  4ZTJ A;  2JWK A;  3RRH A;  2I7N A;  3TSQ A;  3OY9 A;  4CI6 A;  4FK4 A;  2E4L A;  2IDO A;  3M5R A;  3T3F A;  3SQ4 A;  4CBU A;  2P9P B;  1GOC A;  1RDA A;  2A42 A;  4BRF A;  1VHX A;  3THX A;  1DKG D;  3T19 A;  2ATQ A;  4DR7 K;  5C25 A;  1FJG K;  5GIP A;  4KHN A;  4CK1 A;  2JWL A;  4AM7 A;  5D3G A;  4I2P A;  2UXC K;  1QE1 A;  1V4T A;  1IG8 A;  2G8H A;  1V4S A;  3CCQ N;  1WOQ A;  4JK7 A;  4OPK A;  1U6Z A;  4FJ5 A;  2NRT A;  4MO4 A;  3THY A;  4WQ4 C;  3O9S A;  5AQW A;  2NLX A;  1X9W A;  4DSL A;  4YY3 K;  3A0I X;  1NGG A;  4CF2 A;  4J2E A;  3VTH A;  3TPQ A;  1X1P A;  5AQM A;  4KI6 A;  1W2B M;  1Q82 O;  3PLA A;  5FPD A;  3H3O B;  5AQN A;  1RBR A;  1NK4 A;  4CZG A;  1M1K O;  3B6O A;  4CZE A;  3WEE A;  4FM1 A;  1RBU A;  4FCY A;  1MDU B;  3JS6 A;  2EWS A;  3VES A;  3SBG A;  4EZ6 A;  4BC2 A;  1BWF O;  3AVF A;  1B9D A;  2YHB A;  4O0J A;  3OYI A;  4CGH A;  1BCM A;  1VQO N;  2O8C B;  2YNI A;  4WQ5 A;  2DFE A;  2DFH A;  5SZT A;  4F4K A;  3C7N A;  4DV6 K;  3ATU A;  4M3X A;  2OPS A;  3QEV A;  2XY7 A;  1BIZ A;  3LP0 A;  3H08 A;  3HP9 A;  4ILJ A;  4B3T K;  1TKZ A;  5AQU A;  4O5F A;  1YTA A;  1HNI A;  4EP4 A;  3U4L A;  4DU1 A;  4RW6 A;  1YVN A;  1WUA A;  3VQE A;  4B3M K;  4FLY A;  4JKB A;  1L5U A;  1YIJ N;  3SZ2 A;  4OKK A;  3RSE B;  4C8O A;  4JHD A;  3AVN A;  1LWE A;  3KWI A;  4M3T A;  5BR8 K;  2W41 A;  2Q31 A;  4GVM A;  1RT4 A;  4UQG A;  5HOO A;  1X9J A;  4BC4 A;  1JJ2 M;  4B9U A;  4OX9 K;  3THW B;  1FW6 A;  1GOB A;  2RE2 A;  5DM7 L;  3D2F B;  1RT7 A;  3DRS A;  1SL2 A;  1BA0 A;  2B6A A;  4PUO A;  1BGX T;  2X6S A;  4FWS A;  4B1W B;  4E1M A;  1D5A A;  2GEL A;  4BR7 A;  4K25 A;  4HWI A;  3CIP A;  4CES A;  3MEG A;  3DLG A;  1C1A A;  4CEA A;  3ZX2 A;  3S3O A;  1MWM A;  5MLC Q;  4CIG A;  2E1Z A;  5AFU H;  4CJP A;  4CEE A;  3P4I A;  4X62 K;  1NMN A;  2XRI A;  4JV5 K;  1WAF A;  3CFP A;  5FLX O;  4YOW A;  3SLC A;  1SKR A;  1HKG A;  3C6T A;  1LAV A;  3RTV A;  2ITG A;  1NJX A;  3EKU A;  4L3Q A;  3K9K A;  3KJV A;  3OYN A;  1P8Z A;  3V4I A;  1HQU A;  3MX2 A;  2WTU A;  3EZW A;  4JRP A;  3HJF A;  3L3U A;  1C0U A;  3L8B A;  1KQS M;  3VER A;  4M41 A;  4FWM A;  2UXD K;  2DY4 A;  1Z26 A;  1NOZ A;  3O5B A;  4BQZ A;  2AP1 A;  3MX5 A;  1KSP A;  3VEO A;  3KIO A;  1RBS A;  3PSI A;  4KHW A;  1J9A A;  1NKE A;  3K2P A;  1RT1 A;  4ILG B;  4PA1 A;  4B8A B;  4BDY A;  1U49 A;  3HBT A;  2JGU A;  3O4W A;  4O8U A;  3KD1 E;  4LSN A;  3ZT2 A;  4CD3 A;  3HSC A;  4JK9 A;  1HNX K;  4K0K K;  3A5N C;  3G71 N;  4X66 K;  1A5V A;  4WYB A;  3MN7 A;  3CCV N;  4IEE A;  1JLE A;  1X3N A;  3J7Y P;  3M8R A;  3CJ7 A;  2QI2 A;  1R0A A;  3O8M A;  3CER A;  3QES A;  2ZF5 O;  1SKW A;  2V51 B;  5KRS A;  4GNI A;  1SL0 A;  1NGI A;  4DTR A;  2V52 B;  4CF8 A;  4IDK A;  1QVG M;  3W3D A;  2NRR A;  3VGK A;  1XMO K;  2HHX A;  3NVM A;  3O9U A;  2QWM A;  4RG8 A;  2RHK A;  1J5E K;  4A62 A;  4DCH A;  4QAG A;  3OYA A;  2C1G A;  4JD2 B;  2E2Q A;  5IWA K;  4JKF A;  1VSK A;  2GV9 A;  4J2D A;  2JLE A;  1JLB A;  3AVC A;  3U8X A;  2O8D A;  2HHV A;  4OVL A;  4H8K A;  1EKE A;  1BQN A;  2G8K A;  1XI1 A;  3VF6 A;  1KVB A;  3CJ1 A;  4ISF A;  1QTM A;  4LF8 K;  3SJJ A;  3D2E B;  3NGI A;  4FWO A;  5TKY A;  5M1P A;  3E01 A;  3QML A;  3DMJ A;  4PL7 A;  2FF6 A;  3ZX0 A;  2QTD A;  2IAJ A;  1RT6 A;  1SUQ A;  4IO8 A;  4KHQ A;  4N41 A;  2O8C A;  4TSX A;  5AQT A;  5CY4 A;  1HPM A;  3ID6 A;  5LL6 Z;  4LFC K;  4IFV A;  2YNF A;  4MDA A;  3ZCM A;  4CZJ A;  5BPM A;  5EVZ A;  3WNF A;  1WB9 A;  3IG1 A;  4BR0 A;  1K73 O;  3AO1 A;  4C8K A;  4BRP A;  4W5Q A;  1HUX A;  1EQY A;  3WNG A;  3QIO A;  5JS2 A;  4E72 A;  3KLI A;  3QEX A;  5BN9 A;  1XNR K;  3T1H K;  4AHR A;  2VWB A;  2HBJ A;  4DR6 K;  3QEW A;  4FO0 A;  3LWL A;  3SQ1 A;  1YTU A;  1I39 A;  2LSN A;  3B6P A;  4B1Z A;  4HCC A;  4Z4E A;  2BAN A;  4CJ3 A;  5FDL A;  3NH1 A;  4RCH A;  3WQU A;  1OVQ A;  3K5L A;  3OS2 A;  2PZS A;  3BY5 A;  4CVN E;  4X64 K;  3OYK A;  4GV6 A;  2DPN A;  4ILH A;  3HZ6 A;  3DRP A;  1U48 A;  4BC5 A;  1OVY A;  2WUS A;  4KFB A;  4CJS A;  2DFF A;  3S3N A;  3DXK A;  3F2K A;  3L4I A;  3QBX A;  1JL2 A;  3RR8 A;  5TKW A;  1D8Y A;  4C23 A;  2HVH A;  3CQX A;  4YNQ A;  2GX9 A;  2IVP A;  4QS9 A;  3THW A;  4ID5 A;  3MN9 A;  2X74 A;  1Q9X A;  5I9E B;  3PO5 A;  3FZK A;  4M3R A;  2E88 A;  4KI4 A;  2FBT A;  1ZBL A;  3MEE A;  4K43 A;  3VQC A;  2ASO A;  2A1S A;  5KQ8 A;  1N5Y A;  1N34 K;  2G8V A;  2PYL A;  3G10 A;  1HMV A;  4PKG A;  4QS7 A;  2HHW A;  4FM0 A;  4KKO A;  2P5G A;  1WN7 A;  4I6M A;  4Y1D A;  3CQ8 A;  2Q1N A;  2OZS A;  4B1Y B;  4CHP A;  4HUF A;  4CGG A;  1OH6 A;  4M3W A;  1NGC A;  5BPL A;  1RNH A;  2WBN A;  3SMS A;  4B08 A;  1KCF A;  2D1K A;  1TKX A;  2BH1 A;  4N47 A;  2R7Y A;  4FK0 A;  3SV4 A;  3S9H A;  3CFR A;  1S72 N;  2CH5 A;  2GEM A;  3CFO A;  3IKM A;  4BE1 A;  1IKY A;  3CJC A;  4DQQ A;  1ATS A;  2A40 A;  2RN2 A;  5EX5 A;  4IJN A;  3SAG A;  2XHB A;  4DV4 K;  4F2R A;  1EXQ A;  1C0F A;  5C12 A;  1BCO A;  4DV5 K;  1IBL K;  2HMI A;  5CHI A;  5AQV A;  3IFR A;  4DQI A;  3NF8 A;  1JLF A;  1NU0 A;  5FPE A;  1KVC A;  3TAN A;  1OH5 A;  4FZX C;  3U9D A;  3OHR A;  4IO9 L;  2HBK A;  4OO1 J;  4KTW A;  4BE0 A;  4CJF A;  4BG8 A;  5E41 A;  3O80 A;  4M7X A;  3QFU A;  4HCB A;  4EZ9 A;  4IG3 A;  3ENO A;  4H0T B;  1K8A O;  4GVE A;  3QIC A;  4KB1 A;  2F96 A;  4NLB A;  5GAG P;  5E84 A;  1NGJ A;  2I5J A;  4CFC A;  3OYG A;  3AV9 A;  4NCG A;  1LW2 A;  3ZSV A;  1NK7 A;  3ULE A;  3VMF B;  2ASM A;  2O4I A;  4ELU A;  1NGF A;  1A5X A;  3K5M A;  3BDP A;  2CGL A;  3IDH A;  3VQP A;  3WNH A;  4AHU A;  1DT9 A;  3WXL A;  3NAE A;  1KC8 O;  5AJ3 K;  1S9G A;  3ZX3 A;  4G9Z A;  3V1O A;  2P9L B;  1IJJ A;  1JXB A;  3E66 A;  2UXB K;  3MCA B;  3GE1 A;  4C8N A;  2B4J A;  2A5X A;  4BRG A;  3HM8 A;  3T69 A;  4O0I A;  1WSE A;  3KK2 A;  4RW7 A;  3DAW A;  3W0L A;  4DTX A;  1GLA G;  4A5B A;  3JXU A;  1S3X A;  2P9I A;  4KRE A;  4ZTF A;  1CZB A;  5M1K A;  4M3Y A;  4CEF A;  1D9D A;  3MN5 A;  3AVL A;  1HKB A;  3QNN A;  4YFU A;  1HYZ A;  3PSF A;  4XEI A;  3MWT A;  3LAL A;  1U4B A;  2GBZ A;  1BHL A;  2ETJ A;  4FJX A;  3DJC A;  4IOA L;  2E20 A;  1KRP A;  4H0O A;  3TAP A;  4FJI A;  4E7K A;  4Y0W A;  2W6L A;  1L3U A;  2QWR A;  4DTM A;  4KO0 A;  1NGB A;  1JCG A;  1ASU A;  5AQK A;  4CGF A;  2NRZ A;  5AQL A;  3M8S A;  1GLD G;  4YOY A;  4B9V A;  4AHC A;  4JHD B;  1YF5 L;  2E2O A;  1TL3 A;  1T03 A;  4KV8 A;  4DFM A;  4DF4 A;  3ITH A;  3TAR A;  4YDU A;  3LAK A;  1WSJ A;  4XH1 A;  5FRN A;  2IS3 A;  2G8F A;  3O3G A;  1JLQ A;  4CE9 A;  3ZEU B;  5ELZ A;  4PKH A;  1BQM A;  4M63 C;  3CET A;  3UB5 A;  3RMA A;  1YUW A;  3FR0 A;  2B5J A;  5C24 A;  4M3U A;  3EL2 A;  1Q8I A;  3ZEU A;  2OTJ N;  3ASM A;  3SJH A;  2XY8 A;  3LWM A;  2YNH A;  4DSK A;  5EU7 A;  1VQ8 N;  1NLV A;  4EHU A;  5CE3 A;  2HF3 A;  3KVG A;  4KH4 A;  3C6U A;  3TR8 A;  5KQD A;  4DSJ A;  1IKW A;  4CIF A;  1FXX A;  2P9S B;  1VSJ A;  3VQD A;  3MN6 A;  3DRR A;  1BG3 A;  3QIP A;  5DM6 L;  4DKW A;  3MEC A;  1U45 A;  2QKB A;  1L3V A;  3OBY A;  5AQI A;  3KKS A;  2YJE A;  5LJV A;  4O44 A;  4CJU A;  2VCP A;  4OGC A;  1NGA A;  5AQF A;  5AQQ A;  1IG9 A;  4GV9 A;  3ZSZ A;  3D2E A;  1TUU A;  3P39 A;  1XQS C;  2XY5 A;  4KBO A;  4OLB A;  1KVA A;  2D5R A;  5FRO A;  3P31 A;  4WQ4 A;  2P9I B;  1KAX A;  4H5T A;  1U2V A;  4H5R A;  4RW4 A;  5M1Q A;  1YJ9 N;  3WXI A;  5C2D A;  4DFJ A;  4CER A;  3HOS A;  4DV0 K;  1IV0 A;  4DTP A;  4DR5 K;  3K9J A;  4H0P A;  4YDU C;  4ICL A;  3I55 N;  4YOU A;  3R1X A;  4BRH A;  2VQF K;  3AVG A;  5C15 A;  4V19 S;  4L8R B;  4J2A A;  2PFU A;  4BR9 A;  4PHT X;  1E4F T;  1BUP A;  4FLT A;  3LPU A;  2OCE A;  5LMN K;  1HJR A;  3HXM A;  4DU4 A;  2D0C A;  4CEZ A;  5BRD A;  2QW9 A;  3O4Q A;  3OYL A;  1TK8 A;  3L2R A;  5DK5 A;  5IT9 O;  2QWQ A;  1Z05 A;  4CIE A;  4CHN A;  2NRH A;  3LAN A;  4IBN A;  1JXE A;  3SCX A;  1WLJ A;  3SMP A;  2HHS A;  3TWH A;  3RVC A;  1ZBF A;  3DI6 A;  4IOC L;  2PYJ A;  1WBB A;  4DMN A;  4FWN A;  3C6A A;  1NWK A;  4FJ7 A;  4CF9 A;  4DU3 A;  3TAF A;  1GLB G;  5LJW A;  4FLW A;  4OJR A;  1I3A A;  3LM9 A;  1KFS A;  4XH5 A;  4CJW A;  1DGK N;  3O3F A;  1TYQ B;  1DLO A;  4CFD A;  1ATR A;  4GV3 A;  3O4N A;  3NE6 A;  1N8R O;  2P9S A;  3FLC O;  5KPT A;  1TYQ A;  3AVJ A;  3PV8 A;  3ZT1 A;  1VQ6 N;  3CCE N;  4JS4 A;  1DTT A;  1WSI A;  4BWJ A;  5CYQ A;  1C1C A;  5AQH A;  4DV3 K;  1T8E A;  1QZ6 A;  4I2Q A;  4IFE A;  2ZJR L;  1BI4 A;  2RKI A;  3UKU B;  1VRT A;  3K5N A;  1YJW N;  3K5O A;  2W6K A;  3PO4 A;  4IXC A;  2X78 A;  3VET A;  3L2W A;  4DR4 K;  4FXD A;  1S1X A;  3TAQ A;  1RT3 A;  1W7A A;  5AQS A;  3S3M A;  1C0M A;  4NCA A;  1HYV A;  4DLG A;  5KTQ A;  4CJQ A;  3SV3 A;  4F3T A;  2VG6 A;  4CEO A;  1Q18 A;  4DWI A;  4I9L A;  1TAU A;  1GLJ O;  4B9M A;  4CHO A;  4AM6 A;  4CEC A;  4CK3 A;  3UE5 A;  3FZH A;  1UOC A;  3DLH A;  3GBT A;  5KPR A;  4CED A;  4JKC A;  4JRQ A;  5AQZ A;  3G0Z A;  4XH4 A;  4H5W A;  2EX3 A;  2CGK A;  4HTL A;  4PQU A;  1TK5 A;  4EAH D;  4DV7 K;  1NMD A;  1YIT N;  3ALY A;  4CHY A;  4CF1 A;  2BTF A;  2GWJ A;  3RSE A;  4U67 L;  5F1X A;  1ZBU A;  4Z94 A;  5BR9 A;  2UUC K;  1C0G A;  4IWV A;  1ZBH A;  4IOX A;  5SWM A;  2VQE K;  2ASP A;  5KRT A;  4FJM A;  2KHO A;  3SUP A;  2VWK A;  1UWB A;  3MK6 A;  4F3O A;  1C1B A;  1TGO A;  1B9F A;  2YKM A;  2ZJQ L;  1MA9 B;  2VG5 A;  3M8P A;  3IRX A;  5JIC A;  1N36 K;  4CJE A;  1UA1 A;  1XMQ K;  4H4O A;  2F9W A;  4FYD A;  4BRK A;  1S5J A;  4N56 A;  1BL3 A;  4JKG A;  1YI2 N;  1WNS A;  1OKJ A;  1K6Y A;  3V9U A;  2HW3 A;  3NDK A;  4GY2 B;  1MU2 A;  2D0A A;  4JI1 K;  1Z6R A;  4H0X B;  4AF1 A;  5T7B A;  4CW7 B;  1NKB A;  4X65 K;  4Z0U A;  3HVT A;  2ZGY A;  4OPH A;  2HHQ A;  2C1I A;  3KK7 A;  5JMV A;  5I42 A;  4ZHR A;  2KW4 A;  4FSV A;  4EIA A;  1HNZ K;  5AQP A;  3O9T A;  3ENB A;  1BU6 O;  4JI2 K;  2ITM A;  4HUG A;  1NJZ A;  2WFB A;  4JEP A;  3RMC A;  4DQP A;  4BE7 B;  3ZSW A;  4WFB L;  2HB5 A;  4DS5 A;  4FM2 A;  2YHW A;  4BVP A;  2NUB A;  1HX1 A;  1GLL O;  4Z4C A;  1SAZ A;  4DTS A;  4M42 A;  3SQ0 A;  2E2P A;  1VSL A;  4CGD A;  1VQK N;  3MWP A;  4DSI A;  1SS6 A;  1O13 A;  3WXJ A;  3UIQ A;  4W5N A;  3SBT A;  4MDB A;  3ZSR A;  2J4R A;  3ZT4 A;  1SZ2 A;  2F7T A;  2KLA A;  3LDP A;  5J2N A;  1NK9 A;  3Q7B A;  2IC3 A;  4J2B A;  3V9X A;  2BGG A;  3KLE A;  2A3Z A;  3LDN A;  3LDQ A;  4FJK A;  1LOT B;  3HVR A;  4ELV A;  2QKK A;  4JD2 A;  3R6M A;  4KHS A;  3NH0 A;  3D6R A;  3FE1 A;  3TAM A;  3EEQ A;  4OGE A;  2Z1G A;  3AA4 A;  4EP5 A;  4CJ7 A;  4FJ9 A;  3E9L A;  4LFB K;  1NNE A;  1BO5 O;  3SYZ A;  4FJL A;  1RGI A;  1XHZ A;  4BEC A;  1TK0 A;  2P9U B;  3I8B A;  4Q5V A;  3AVB A;  4LH4 A;  1HQE A;  5AR0 A;  4M45 A;  5A2Q O;  5CZ2 A;  1U2V B;  5BRE A;  3D45 A;  4DV2 K;  3QEP A;  4CHZ A;  4JKH A;  3O3H A;  3HST B;  3IS9 A;  4E1J A;  3OS1 A;  5JLH A;  1RDB A;  1S22 A;  4M7Y A;  4YOR A;  3PX4 A;  1NOY A;  4JKD A;  4K8Z A;  4E3S A;  1ATN A;  3VEN A;  2F8S A;  1JLC A;  4GKJ K;  2A1R A;  5CR4 A;  1I94 K;  4DQ8 A;  2P9K A;  2W40 A;  4JAX A;  1K9M O;  3CF5 L;  2QK9 A;  3DXM B;  4CZF A;  3RMD A;  1A5W A;  3KD5 E;  5HRS A;  3SAF A;  5C10 A;  2OZM A;  4BDZ A;  4A59 A;  3C7N B;  4UY8 O;  3M3Z A;  2QWP A;  1K8K A;  3KLF A;  4Z4H A;  3O9R A;  2UUA K;  3F9K A;  5AQJ A;  3CC7 N;  1ESV A;  4KPY A;  3AO4 A;  3HK2 A;  4B3O A;  3JYT A;  3EE8 A;  2HVI A;  2V7Z A;  3V1Q A;  3ZET B;  2HBM A;  3HP6 A;  4BRC A;  4JLH A;  3O08 A;  1HNV A;  3HPG A;  4FWQ A;  3NGY A;  2X6N A;  4E0D A;  4CZK A;  4W5T A;  5F0X A;  1BOT O;  1WAJ A;  4DB3 A;  4DUY K;  3G4S N;  4FLX A;  1KAZ A;  2YHX A;  3D2F A;  2P51 A;  1SQK A;  3J80 O;  2O8E A;  3ZSX A;  4BRN A;  3H6E A;  3MMV A;  3NGZ A;  4I6M B;  4DSF A;  2E6L A;  2YV0 X;  2E1Y A;  2QXL A;  2HNY A;  2CH6 A;  3DLK A;  4LSL A;  3J7Z O;  3VQ4 A;  1U47 A;  3ZT0 A;  4A57 A;  3AA3 A;  2WOM A;  5ADX H;  3NCI A;  3AVM A;  1RDU A;  5HLF A;  3F73 A;  2FSJ A;  3CCR N;  4E89 A;  3M8Q A;  3MXM A;  5HL7 L;  3O6W A;  3ZSO A;  4CJ4 A;  3K57 A;  1VSF A;  2OTL N;  4FLV A;  4FK2 A;  3D7E O;  3DXK B;  2D0O A;  1L3S A;  4IKF A;  1W9H A;  3AVI A;  1GLF O;  4BVO A;  1CXQ A;  4R5P A;  4A2A A;  3P38 A;  3HYF A;  3I0S A;  4K8X A;  1QHA A;  1Q7Y O;  4KB0 A;  2AA4 A;  1HLU A;  4CEB A;  3L2U A;  2G8U A;  4O5B A;  3N4Q A;  5AQX A;  1CZA N;  1JKH A;  4BRA A;  3OVN A;  4FJJ A;  4FJN A;  3ULD A;  4K42 A;  4PKI A;  4WCE L;  3CCL N;  2QXF A;  4KHY A;  1P90 A;  3R8E A;  3VF4 A;  1LAW A;  3FZM A;  4FJ8 A;  2YJF A;  3CC2 N;  2EHG A;  4FLZ A;  1TAQ A;  3ZYY X;  2P9L A;  5CYM A;  3EO3 A;  1XUP O;  3LPT A;  2GUI A;  4HHT A;  4DFK A;  2IGI A;  4KH6 A;  1SKS A;  3KLG A;  3VQ8 A;  4CJV A;  3AA5 X;  4KRF A;  4BC3 A;  2XY6 A;  2VGN A;  3KWG A;  2KKZ A;  2H3G X;  1ZBI A;  4E19 A;  1X9M A;  3OYH A;  4LF7 K;  4OPJ A;  1DEJ A;  3MED A;  4U7B A;  5HRP A;  2A41 A;  2GWK A;  2YKN A;  1NJY A;  2BE2 A;  4CZM A;  1SL1 A;  4H0Y B;  5KI6 A;  4BEB A;  4OLA A;  4NXN K;  2ZQB A;  1N32 K;  3NF9 A;  3P83 D;  4FOI A;  3QEI A;  4DR3 K;  3AVH A;  4WFA L;  1RIL A;  1TKT A;  3OS0 A;  1FKO A;  4I9Q A;  4W5R A;  1TL1 A;  1LV5 A;  3QNO A;  3VA0 A;  4BRO A;  3LP3 A;  1HYS A;  3LDO A;  3DOK A;  3TU5 A;  1KFD A;  1YVU A;  5J2M A;  3VF2 A;  3CPE A;  4FWL A;  3CJ9 A;  4FLU A;  4J8F A;  3MAQ A;  2P9P A;  4BR5 A;  3TI0 A;  4CK2 A;  1NG9 A;  4B1V A;  3P5J A;  4AHV A;  4KAZ A;  2WON A;  3OTO K;  2NRV A;  3LZI A;  1NBW A;  2I7P A;  3A8Y A;  4KHU A;  3CCJ N;  3SI6 A;  3IUC A;  4FW2 A;  3OYF A;  1W0H A;  4PY5 A;  3OJU A;  3ATV A;  4FJH A;  1QQM A;  1OH7 A;  1RTI A;  4GMJ B;  4FVM A;  3CM6 A;  4DQS A;  4CZI A;  1QSL A;  2P5O A;  4FWP A;  4LC9 B;  4WF9 L;  1BA1 A;  1IBM K;  4E7H A;  4LY7 A;  1J6Z A;  3LL3 A;  3ZSQ A;  3VQ5 A;  3DXM A;  3RRG A;  4DR2 K;  2P9K B;  1KD1 O;  4A61 A;  4FVU A;  4NLC A;  3VQ6 A;  4HVJ A;  1L3T A;  1BDG A;  2FXU A;  2XO7 A;  1VSM A;  4JN4 A;  3KLH A;  1ASV A;  4DTU A;  2A6A A;  2O8F A;  2FLO A;  4BRQ A;  4JYA K;  4AH9 A;  4IFY A;  4CJT A;  2G8I A;  1JLG A;  3PUF A;  3HOT A;  1VK0 A;  2OPP A;  3ID8 A;  1S6Q A;  4IZ9 A;  4WE1 A;  2E8A A;  4CJR A;  3H45 C;  1CLQ A;  3N4P A;  3HL8 A;  4CBW A;  3JAM O;  1VQM N;  1ZBS A;  3PY8 A;  4C8M A;  2P9N A;  3U3Y A;  3HT3 A;  3FZL A;  5C2F A;  4B1U B;  3RMB A;  3CCM N;  1T3V A;  1T6C A;  2KZZ A;  5JLF A;  1X9S A;  3BP8 A;  3HTV A;  4CGJ A;  1EX4 A;  4F9O A;  4LF9 K;  2O8B B;  3VPZ A;  1VQ7 N;  4CJ5 A;  2HOE A;  4MQ3 A;  4DF8 A;  4DLE A;  2AJQ A;  3OA9 A;  2OPQ A;  3K58 A;  1CZ9 A;  4YHH K;  2OYQ A;  5AQO A;  4B9S A;  1Q81 O;  1N33 K;  4DHY A;  1J5O A;  3OYC A;  3UKU A;  1BI4 B;  3THX B;  3CI5 A;  4YOT A;  2KQ2 A;  4EHT A;  5CZ1 A;  4BDP A;  3DWL A;  4GW6 A;  2HHI A;  3AAR A;  3C0B A;  4H4M A;  2E5L K;  1QSS A;  2QWL A;  4E7J A;  4E7L A;  1HR0 K;  4Y1C A;  2FBX A;  2E6M A;  3OYB A;  2P1J A;  3VEY A;  2KFZ A;  3HO1 A;  2FBY A;  3SUO A;  1IO2 A;  1BIU A;  4FPA A;  5AZJ B;  1Y97 A;  1XHX A;  4JI6 K;  1VRU A;  3S41 A;  5HRR A;  2ZM6 K;  4H03 B;  3VEV A;  4O8K A;  2D0B A;  1C6V A;  1HRH A;  1Q86 O;  3CQY A;  4FWK A;  1YHQ N;  3SNN A;  1YAG A;  3R9P A;  3LDS A;  4B9L A;  5ADX A;  5I3U A;  4DV1 K;  2RF2 A;  4CD1 A;  4B9Q A;  3NF6 A;  4N76 A;  3LM2 A;  5DMR A;  3L6Q A;  4AIL C;  1RDC A;  3NVK A;  3TAE A;  3CJB A;  2FF3 B;  3BZC A;  3EKS A;  2NRW A;  4C8L A;  4AHS A;  3CG7 A;  3LZJ A;  3E9P A;  4BG9 A;  3TSP A;  4NYF A;  3CMA N;  3THV A;  4ISE A;  4NB4 A;  3BEX A;  2NRX A;  4BRE A;  2OPR A;  3WUH A;  4QOZ B;  3ZSY A;  4KTQ A;  5GIO A;  2OAN A;  3GOI A;  4Z4I A;  4BGB A;  4LFA K;  4LD0 A;  1RTJ A;  4DTJ A;  2GUP A;  4FWR A;  4CF0 A;  3A5L C;  3A5O C;  5JVG L;  4B1X B;  3NMU A;  4G1Q A;  2HND A;  2Z1H A;  3EZ5 A;  4WFN L;  3OYJ A;  4F8R A;  5H1S Q;  4DSE A;  2KZM A;  3TTD A;  1NJI O;  4CHQ A;  2Q2R A;  4LF6 K;  3A2F A;  4RWT A;  5BRF A;  5AZI A;  3VQQ A;  1QS4 A;  4BRL A;  3M6G A;  3D0P A;  3I0R A;  1VQL N;  1LWF A;  4RW9 A;  3SAH A;  4BRM A;  1QQN A;  2IVO A;  4E7I A;  3PIP L;  4B3S K;  5LY3 A;  4KH5 A;  3T1A A;  3DM2 A;  1EP4 A;  2Q0R A;  3IAY A;  3ZT3 A;  3O1W A;  1VSI A;  1RBV A;  1S1U A;  2FSK A;  1IKX A;  1ZYQ A;  2O4G A;  1FK9 A;  5EXW A;  3AGR A;  5K14 A;  5M1O A;  4JK8 A;  3QER A;  1GLC G;  3O9Q A;  3SUN A;  1U04 A;  1BIS A;  5FRM A;  4CBX A;  4CFA A;  2IIR A;  1HJO A;  4JI5 K;  2KFN A;  2D0P A;  4PL8 A;  3F9M A;  1D9F A;  1K8K B;  1LWC A;  3TTF A;  1ITG A;  3VEZ A;  5JEN A;  3RWU A;  1JCF A;  2VYP A;  3V81 A;  2O8B A;  3CYG A;  1NJW A;  3Q7C A;  1ASW A;  2CGJ A;  5FPN A;  5JVH L;  4AHT A;  1YT3 A;  5M1F A;  1RTD A;  3CME N;  1RBT A;  1VSH A;  1VSD A;  4BR4 A;  3KZB A;  5C0Y A;  3MXI A;  5EY4 A;  1F21 A;  5HP1 A;  2P9N B;  3GL1 A;  4H0V B;  3BUZ B;  3AGK A;  3EE9 A;  3LP1 A;  3M1F A;  1VQ4 N;  4FZY A;  5J2Q A;  1GLE G;  4MFB A;  5LMU K;  1T6D A;  5BN8 A;  4JI4 K;  3VQB A;  4ID1 A;  4BGA A;  1KXP A;  2YHA A;  1VQN N;  1Y64 A;  4YOX A;  2Q0U A;  3G6E N;  4NXM K;  3K59 A;  4K41 A;  1EO1 A;  3QDK A;  3C94 A;  2UUB K;  2ZJP L;  1RCH A;  1ZXO A;  5HRO A;  1E4G T;  4BRD A;  3T1Y K;  5BPN A;  3PX6 A;  4Z4G A;  2VWJ A;  2KTQ A;  1J54 A;  3QET A;  3ISN C;  4DTN A;  4N5S A;  1NK5 A;  5KGX A;  4BR2 A;  1WSH A;  1RT5 A;  1HNW K;  3OBW A;  4F2S A;  1FKP A;  4JKA A;  3DLE A;  2ZWH A;  4JI0 K;  3L2Q A;  3P1G A;  3V9S A;  4CJL A;  3LP2 A;  3CM5 A;  4BRI A;  3KTQ A;  2VG7 A;  3EN9 A;  3WEE B;  2P9U A;  2D4W A;  1WSG A;  3VN5 A;  3ENH A;  2UU9 K;  5J1E A;  1NGH A;  5KPZ A;  1N6Q A;  3S5T A;  1T44 A;  4FJG A;  3K0S A;  4Q0B A;  2ZGZ A;  1W97 L;  1C0T A;  3HPH A;  3WNE A;  3CHW A;  1TUY A;  1EWQ A;  3THY B;  1XC9 A;  1KAY A;  2HF4 A;  3H1Q A;  5AQG A;  3ZET A;  3VA3 A;  1WBD A;  1VSE A;  2Q97 A;  1RDW X;  5GAH P;  4NO7 A;  1S1V A;  3BF1 A;  3VQ9 A;  4R79 A;  4FL9 A;  3F5T A;  1QQO A;  4PWD A;  3C95 A;  2RPI A;  4YOV A;  3E1Y A;  2YCH A;  4RW8 A;  4WQ5 C;  4A2B A;  4OKE A;  1IKV A;  3MXJ A;  1WSF A;  1IH7 A;  3HM9 A;  2E2N A;  2IVN A;  1QVF M;  3CCU N;  1VQ9 N;  3VGM A;  1LW0 A;  3NHG A;  2HHU A;  2BUP A;  3CYM A;  1H1V A;  2IOC A;  4C1N I;  4C1N K;  1MWK A;  2FSN A;  2PY5 A;  4CGI A;  4O55 A;  4KHP K;  1S1T A;  2YNG A;  3FZF A;  3I56 N;  1E3M A;  3VEX A;  3KK3 A;  3AVA A;  3FFK B;  3WXM B;  3CD6 N;  1JCE A;  3KHY A;  2VGM A;  4O4G A;  3WQT A;  1NK6 A;  4Z4F A;  1VQ5 N;  3O1B A;  3VQ7 A;  3C65 A;  2DTU A;  1QQC A;  1DTQ A;  3AO5 A;  2Y1I A;  4OPA A;  3L0Q A;  3JSM A;  1TKD A;  1TV6 A;  4BQL A;  3QO9 A;  1M90 O;  3L2V A;  3TAG A;  1EWR A;  4DQR A;  3PX0 A;  4CCH A;  4DUZ K;  1S1W A;  4MLH A;  1YJN N;  5C42 A;  2HNZ A;  2V7Y A;  2OA8 A;  4RTF D;  1UA0 A;  3UKR B;  3VTI A;  3DLB A;  4MO5 A;  3H46 O;  3VQA A;  5J2P A;  3LDL A;  3UKR A;  4JI3 K;  2NZT A;  3CPW M;  3NBP A;  2QEX N;  4NCB A;  3KK1 A;  3DOL A;  5M1N A;  1JLA A;  4B3R K;  3VOV A;  3AA2 A;  3BF3 A;  3HI0 A;  5GIN A;  3CJA A;  1VQP N;  5AFU A;  4CZL A;  1RDD A;  4E1N A;  2FBV A;  3NH2 A;  3MDQ A;  5E26 A;  3V9W A;  1QZ5 A;  3CCS N;  3RR7 A;  4JS5 A;  4IEI A;  3T7Z A;  2W42 A;  1ILY A;  3QB0 A;  4NYN A;  1CXU A;  4LF5 K;  4LF4 K;  2YHY A;  1D4X A;  4JI8 K;  3OYE A;  1OH8 A;  3A5M C;  4H5N A; 
#chains in the Genus database with same CATH homology
 1J6Z A;  5AQS A;  3LL3 A;  5AQT A;  5F2R A;  3SK3 A;  1HPM A;  3ID6 A;  3DXM A;  2Q36 A;  2P9K B;  1KD1 O;  4A61 A;  4FVU A;  4NLC A;  4MDA A;  1Q18 A;  4CZJ A;  5BPM A;  2GTD A;  5EVZ A;  1BDG A;  2FXU A;  3B8A X;  5GAD P;  1GLJ O;  4JN4 A;  4AM6 A;  4BR0 A;  3AAP A;  3AY9 A;  2A6A A;  5B8H A;  3UE5 A;  1K73 O;  3FZH A;  5AZJ A;  2FLO A;  3DLL L;  3GBT A;  2YI1 A;  4BRQ A;  4BRP A;  3TTC A;  4IJA A;  1HUX A;  5KPR A;  1EQY A;  4IDH A;  4JKC A;  4JNE A;  2HST A;  5AQZ A;  1NGE A;  3HOT A;  4XH4 A;  4H5W A;  5BN9 A;  3ID8 A;  5GAE P;  4IZ9 A;  5EOY A;  2CGK A;  4HTL A;  3R3L A;  2E8A A;  3WT0 A;  4EAH D;  2VWB A;  4EFH A;  3H45 C;  2HBJ A;  1NMD A;  3N4P A;  4CBW A;  4FO0 A;  1YIT N;  1VQM N;  3TSU A;  1ZBS A;  1NGD A;  2P9N A;  4B1Z A;  3FZL A;  2NNW A;  1VAZ A;  4RCH A;  2BTF A;  2GWJ A;  5C2F A;  3RSE A;  4U67 L;  3WQU A;  4XJX A;  5F1X A;  4Z94 A;  4B1U B;  5BR9 A;  3MCP A;  3CXC M;  3CCM N;  3OW2 M;  1C0G A;  1T3V A;  4IWV A;  4GV6 A;  1T6C A;  2DPN A;  4IOX A;  4A5A A;  4ILH A;  3HZ6 A;  1YXQ A;  4JKE A;  5JLF A;  4BC5 A;  3BP8 A;  3H1V X;  3HTV A;  1OVY A;  2WUS A;  3ULE B;  3L4Q A;  2ASP A;  4F9O A;  1RFQ A;  3DXK A;  3VPZ A;  2KHO A;  2HBL A;  3F2K A;  3L4I A;  3QBX A;  4CZH A;  1VQ7 N;  5TKW A;  4C23 A;  3CQX A;  1NM1 A;  2HOE A;  3MK6 A;  2GX9 A;  5AZI B;  2IVP A;  3OA9 A;  4H5V A;  4QS9 A;  3U9Z A;  3MN9 A;  3VEW A;  2ZJQ L;  1MA9 B;  5I9E B;  3FZK A;  2E88 A;  5AQO A;  5JIC A;  3PIO L;  3I33 A;  4K43 A;  2ASO A;  5KQ8 A;  1Q81 O;  4DHY A;  2F9W A;  3UKU A;  4BRK A;  2PBD A;  4PKG A;  4MLE A;  2QWN A;  4QS7 A;  4BY9 C;  3E9O A;  4JKG A;  1YI2 N;  3I55 N;  1R59 O;  3CI5 A;  1OKJ A;  4YOT A;  4EHT A;  2QWO A;  1ZC6 A;  4I6M A;  4GY2 B;  3DWL A;  2Q1N A;  5BRH A;  3AAR A;  3C0B A;  3J8A A;  1XC3 A;  3AAQ A;  2QWL A;  4B1Y B;  1X3M A;  4FOE A;  1Z6R A;  3C6H A;  4H0X B;  4AF1 A;  3VEY A;  4JKG B;  2ZGY A;  4OPH A;  2YX6 A;  1NGC A;  2C1I A;  4FPA A;  3KK7 A;  5BPL A;  2WBN A;  3SMS A;  5JMV A;  5AZJ B;  2D1K A;  2BH1 A;  3GG4 A;  4FSV A;  4EIA A;  2PAV A;  1S72 N;  3S41 A;  2CH5 A;  5AQR A;  2GEM A;  5AQP A;  3O9T A;  3GDQ A;  4H03 B;  3ENB A;  3VEV A;  2F9T A;  4O8K A;  1BU6 O;  2ITM A;  5FPM A;  2WFB A;  3IKM A;  1Q86 O;  3CC4 N;  4JEP A;  3QFP A;  3CQY A;  4FWK A;  1YHQ N;  2UYT A;  4BE7 B;  1YAG A;  4WFB L;  4FPB A;  3R9P A;  2WC9 A;  1LCU A;  2YHW A;  5ADX A;  1G99 A;  5AQY A;  4BVP A;  2W00 A;  3CJC A;  1HX1 A;  2HMP A;  4CD1 A;  1ATS A;  2A40 A;  2QM1 A;  3WXK A;  1GLL O;  3H3N O;  4B9Q A;  1SAZ A;  5EX5 A;  4IJN A;  2E2P A;  3LM2 A;  3SAG A;  3L6Q A;  3NVK A;  1VQK N;  3CJB A;  3MWP A;  2QA4 N;  2FF3 B;  3FGU A;  3EKS A;  1C0F A;  5C12 A;  1SS6 A;  2NRW A;  3G25 A;  1O13 A;  4ISG A;  5CHI A;  3QBW A;  3HRG A;  3WXJ A;  4QS8 A;  5AQV A;  3SBT A;  3E9P A;  4MDB A;  3IFR A;  5FPE A;  4BG9 A;  3IMX A;  3U9D A;  1HKC A;  3TSP A;  2J4R A;  3OHR A;  3VGL A;  2HBK A;  4IO9 L;  4OO1 J;  3CMA N;  4ISE A;  4NB4 A;  2JWK A;  4BG8 A;  2I7N A;  3BEX A;  1SZ2 A;  2F7T A;  2KLA A;  3LDP A;  3TSQ A;  4CI6 A;  2NRX A;  3Q7B A;  4BRE A;  3O80 A;  4M7X A;  3WUH A;  3M5R A;  2A3Z A;  3LDN A;  3LDQ A;  3QFU A;  4CBU A;  1LOT B;  3ENO A;  4H0T B;  5GIO A;  1K8A O;  2OAN A;  3GOI A;  4GVE A;  3QIC A;  4NLB A;  4BGB A;  2P9P B;  5GAG P;  5E84 A;  1NGJ A;  4JD2 A;  2A42 A;  3R6M A;  4BRF A;  2GUP A;  4FWR A;  3A5L C;  3A5O C;  3ULE A;  3D6R A;  2ASM A;  3FE1 A;  3VMF B;  1DKG D;  1NGF A;  4B1X B;  5JVG L;  3NMU A;  2CGL A;  3IDH A;  4WFN L;  5GIP A;  1DT9 A;  4CJ7 A;  3WXL A;  5H1S Q;  3E9L A;  2JWL A;  4AM7 A;  1KC8 O;  3TTD A;  1BO5 O;  1NJI O;  1RGI A;  3ZX3 A;  1V4T A;  4G9Z A;  2P9L B;  1IG8 A;  2Q2R A;  1IJJ A;  4BEC A;  4RWT A;  2P9U B;  1V4S A;  3I8B A;  5AZI A;  5BRF A;  3CCQ N;  4BRL A;  3M6G A;  1WOQ A;  4JK7 A;  3E66 A;  3MCA B;  1VQL N;  1U6Z A;  3GE1 A;  2A5X A;  2NRT A;  4BRG A;  4MO4 A;  5AR0 A;  3HM8 A;  3T69 A;  3SAH A;  4WQ4 C;  3O9S A;  5AQW A;  4BRM A;  1QQN A;  2IVO A;  2NLX A;  3DAW A;  3PIP L;  3A0I X;  3W0L A;  1NGG A;  1U2V B;  5BRE A;  5LY3 A;  3VTH A;  4KH5 A;  1GLA G;  3TPQ A;  2Q0R A;  4A5B A;  3JXU A;  4JKH A;  5AQM A;  3O1W A;  1W2B M;  1Q82 O;  4E1J A;  1S3X A;  5FPD A;  3PLA A;  3H3O B;  5JLH A;  4YOR A;  1S22 A;  4M7Y A;  5AQN A;  4JKD A;  2FSK A;  1ATN A;  3VEN A;  2P9I A;  4CZG A;  5EXW A;  1M1K O;  3AGR A;  4CZE A;  5M1O A;  4JK8 A;  5CR4 A;  3WEE A;  5M1K A;  1MDU B;  3JS6 A;  1GLC G;  3MN5 A;  2EWS A;  2P9K A;  3O9Q A;  2W40 A;  3VES A;  4DQ8 A;  3SBG A;  4JAX A;  1K9M O;  1HKB A;  3CF5 L;  4BC2 A;  3DXM B;  1BWF O;  4CZF A;  3SAF A;  5C10 A;  4XEI A;  3MWT A;  4CBX A;  4A59 A;  3C7N B;  2IIR A;  1VQO N;  4UY8 O;  1HJO A;  3M3Z A;  4WQ5 A;  2QWP A;  1K8K A;  2D0P A;  3C7N A;  3O9R A;  4PL8 A;  3DJC A;  3F9M A;  3ATU A;  4IOA L;  2E20 A;  1K8K B;  3TTF A;  4H0O A;  3VEZ A;  5AQJ A;  3CC7 N;  1ESV A;  4Y0W A;  1JCF A;  2VYP A;  2QWR A;  4ILJ A;  3EE8 A;  1NGB A;  2V7Z A;  3Q7C A;  1JCG A;  5AQU A;  5AQK A;  4O5F A;  2CGJ A;  2NRZ A;  5AQL A;  5FPN A;  1GLD G;  2HBM A;  3ZET B;  4YOY A;  5JVH L;  4BRC A;  3O08 A;  3U4L A;  5M1F A;  1YVN A;  4JHD B;  1WUA A;  1YF5 L;  2E2O A;  4JKB A;  3CME N;  4FWQ A;  1YIJ N;  3RSE B;  3KZB A;  4YDU A;  4BR4 A;  5C0Y A;  4JHD A;  5EY4 A;  4XH1 A;  3KWI A;  4CZK A;  5F0X A;  1BOT O;  2P9N B;  2W41 A;  3GL1 A;  4H0V B;  3BUZ B;  2Q31 A;  3AGK A;  3ZEU B;  3EE9 A;  4DB3 A;  5ELZ A;  4PKH A;  3G4S N;  4M63 C;  3CET A;  3M1F A;  1VQ4 N;  1KAZ A;  2YHX A;  3D2F A;  5HOO A;  1SQK A;  1X9J A;  3UB5 A;  4BC4 A;  1JJ2 M;  1GLE G;  4BRN A;  1YUW A;  3H6E A;  2RE2 A;  5DM7 L;  3MMV A;  3FR0 A;  3D2F B;  1T6D A;  5BN8 A;  4I6M B;  3EL2 A;  1BA0 A;  3ZEU A;  4BGA A;  2E1Y A;  2OTJ N;  2QXL A;  3SJH A;  1KXP A;  1VQN N;  1Y64 A;  2CH6 A;  4YOX A;  3J7Z O;  2Q0U A;  3G6E N;  4FWS A;  4B1W B;  4K41 A;  2GEL A;  4BR7 A;  3QDK A;  1EO1 A;  4K25 A;  1VQ8 N;  4HWI A;  1NLV A;  3CIP A;  4A57 A;  2HF3 A;  4EHU A;  5CE3 A;  2ZJP L;  1ZXO A;  5ADX H;  3KVG A;  4KH4 A;  5KQD A;  3ZX2 A;  1E4G T;  1MWM A;  4BRD A;  5BPN A;  1RDU A;  2P9S B;  5MLC Q;  2E1Z A;  2FSJ A;  3MN6 A;  5AFU H;  3CCR N;  3P4I A;  4BR2 A;  5HL7 L;  1BG3 A;  3O6W A;  3OBW A;  4DKW A;  4JKA A;  5DM6 L;  2ZWH A;  2OTL N;  3OBY A;  3D7E O;  3DXK B;  2D0O A;  5AQI A;  4YOW A;  3SLC A;  2YJE A;  1GLF O;  4BVO A;  4BRI A;  5LJV A;  2VCP A;  1HKG A;  1NGA A;  5AQF A;  5AQQ A;  4GV9 A;  4A2A A;  3P38 A;  3EN9 A;  3WEE B;  3D2E A;  1TUU A;  2P9U A;  3P39 A;  2D4W A;  1XQS C;  3ENH A;  1NGH A;  1QHA A;  5KPZ A;  3EKU A;  1Q7Y O;  4KBO A;  2AA4 A;  4L3Q A;  3K9K A;  1T44 A;  1HLU A;  3P31 A;  4WQ4 A;  2P9I B;  1KAX A;  3N4Q A;  5AQX A;  1P8Z A;  2ZGZ A;  1CZA N;  4H5T A;  4BRA A;  1W97 L;  1U2V A;  4H5R A;  5M1Q A;  1YJ9 N;  3WXI A;  5C2D A;  3CHW A;  3MX2 A;  3HOS A;  1TUY A;  4K42 A;  4PKI A;  3EZW A;  4WCE L;  3CCL N;  3K9J A;  2HF4 A;  1KAY A;  3H1Q A;  5AQG A;  4H0P A;  3ZET A;  1P90 A;  4YDU C;  1KQS M;  3R8E A;  3VER A;  4FWM A;  3VF4 A;  2Q97 A;  3R1X A;  4YOU A;  3O5B A;  1RDW X;  4BRH A;  4BQZ A;  2AP1 A;  4NO7 A;  5GAH P;  3BF1 A;  3FZM A;  4R79 A;  2YJF A;  3MX5 A;  5C15 A;  3CC2 N;  3VEO A;  3ZYY X;  4FL9 A;  2P9L A;  3F5T A;  1QQO A;  2PFU A;  3EO3 A;  4BR9 A;  1XUP O;  4PHT X;  1E4F T;  1BUP A;  4YOV A;  3E1Y A;  2YCH A;  4KH6 A;  4WQ5 C;  4ILG B;  4A2B A;  3HBT A;  3O4W A;  2E2N A;  2IVN A;  4O8U A;  4BC3 A;  5BRD A;  1QVF M;  2VGN A;  3KWG A;  3CCU N;  2QW9 A;  2KKZ A;  3VGM A;  1VQ9 N;  2H3G X;  2BUP A;  4CD3 A;  3HSC A;  4JK9 A;  1H1V A;  3A5N C;  3G71 N;  1DEJ A;  2QWQ A;  4C1N I;  1Z05 A;  4C1N K;  1MWK A;  2FSN A;  2NRH A;  2A41 A;  4U7B A;  4WYB A;  3MN7 A;  2GWK A;  4IEE A;  3CCV N;  1X3N A;  4CZM A;  3FZF A;  3I56 N;  3SMP A;  3CJ7 A;  2QI2 A;  4H0Y B;  4BEB A;  3O8M A;  3VEX A;  3RVC A;  3CER A;  3FFK B;  2ZF5 O;  3WXM B;  2V51 B;  4IOC L;  3CD6 N;  4GNI A;  1JCE A;  4FOI A;  3KHY A;  1NGI A;  2VGM A;  3WQT A;  2V52 B;  4FWN A;  3C6A A;  4WFA L;  1VQ5 N;  1NWK A;  3O1B A;  3C65 A;  4OPA A;  3L0Q A;  1GLB G;  4BRO A;  5LJW A;  3LDO A;  4BQL A;  1QVG M;  1M90 O;  3W3D A;  3LM9 A;  2NRR A;  3VGK A;  3NVM A;  4XH5 A;  3O9U A;  3TU5 A;  1DGK N;  2QWM A;  2RHK A;  4MLH A;  1YJN N;  3VF2 A;  1TYQ B;  3CPE A;  2V7Y A;  4FWL A;  4A62 A;  4DCH A;  3CJ9 A;  4RTF D;  2C1G A;  4J8F A;  3UKR B;  1ATR A;  4JD2 B;  3VTI A;  4GV3 A;  4MO5 A;  2E2Q A;  3H46 O;  2P9P A;  3LDL A;  3UKR A;  4JKF A;  1N8R O;  2P9S A;  3FLC O;  5KPT A;  2NZT A;  1TYQ A;  3CPW M;  2QEX N;  4BR5 A;  1VQ6 N;  3CCE N;  4B1V A;  3U8X A;  5M1N A;  3VOV A;  3BF3 A;  3HI0 A;  5GIN A;  3CJA A;  5AQH A;  1VQP N;  5AFU A;  4CZL A;  1QZ6 A;  2NRV A;  3VF6 A;  1NBW A;  2I7P A;  3A8Y A;  3MDQ A;  5E26 A;  3CCJ N;  3CJ1 A;  4IFE A;  4ISF A;  3IUC A;  2ZJR L;  3D2E B;  3UKU B;  1QZ5 A;  4FWO A;  5TKY A;  3CCS N;  5M1P A;  1YJW N;  4IEI A;  3QML A;  3T7Z A;  3ATV A;  4PL7 A;  1QQM A;  4IXC A;  2FF6 A;  1ILY A;  3ZX0 A;  2QTD A;  3QB0 A;  3VET A;  2YHY A;  1D4X A;  4CZI A;  3A5M C;  4FWP A;  4IO8 A;  4H5N A;  4LC9 B;  4WF9 L;  1BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...