3ULEB

Structure of bos taurus arp2/3 complex with bound inhibitor ck-869 and atp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
351
structure length
236
Chain Sequence
b'CDNGTGFVLLTEPPMAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRHMVFLGGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
rcsb
molecule tags Structural protein
total genus 65
structure length 236
sequence length 351
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3uleB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3uleB02
3VGMA 3O5BA 5KPTA 4K25A 4KBOA 3WQUA 3C7NA 3L4IA 2E8AA 4FWNA 4BR4A 4CBUA 2IVOA 3ENHA 3WEEB 2FSKA 1S22A 5LJVA 3IDHA 1KAXA 4XEIA 4ISGA 2GUPA 5AFUA 1QHAA 4BC2A 5TKYA 1RFQA 3KVGA 3GE1A 3EN9A 3VOVA 3LM2A 3ZEUA 3O4WA 3D2EB 3UE5A 1QZ5A 1SQKA 5BRHA 3RSEB 4WQ5C 3VETA 3UKRA 1K8KA 3VGKA 5LY3A 2FSNA 2E2NA 1P8ZA 2GWKA 3VEVA 3H45C 3G25A 3SMPA 1CZAN 1ZBSA 3WXJA 2UYTA 2I7NA 2YJEA 2QWRA 3ATUA 2ASPA 3O1WA 5AQHA 4BRFA 4MO4A 5AQQA 3L0QA 2F9WA 3R6MA 2Q2RA 5FPDA 4H0XB 3WUHA 3EZWA 2D0OA 2V7YA 3U8XA 4IWVA 4QS8A 2E2OA 4FWLA 4LC9B 4BC3A 1NGAA 3CJBA 2A5XA 1QQMA 4H0TB 1MA9B 2KHOA 2QWMA 3S41A 3JS6A 4BRMA 3SK3A 4CZJA 3O1BA 4EFHA 2QM1A 2DPNA 1NGHA 4BQLA 3H1VX 4FWSA 5AQKA 5I9EB 5AZIA 5AQYA 2QWLA 3LL3A 2Q1NA 2P9NB 1TUYA 2A3ZA 4XH4A 1TYQA 4E1JA 3U4LA 3SLCA 4RCHA 3I8BA 4QS9A 2E2QA 2FF6A 3MK6A 3ZX2A 2Q31A 2V52B 4F9OA 4FWKA 5AQJA 1BO5O 2QWPA 5BN9A 3VGLA 3VEXA 3CJ1A 1X3MA 4A62A 4BRPA 4O5FA 4CI6A 2P9LB 3EKSA 3EO3A 1QQNA 2QWNA 3ID8A 2CGJA 4BC5A 4YDUC 1LOTB 3DXKB 1BWFO 2YCHA 3GL1A 3ENOA 1BDGA 4H5WA 3H1QA 4B9QA 5ADXA 1NMDA 3WQTA 1YAGA 3MCPA 4AM7A 4A61A 3AY9A 4CZIA 3FZMA 4YDUA 2F9TA 2P9PA 3ZETB 1YVNA 4H5RA 5AQLA 3VEWA 1D4XA 3CJ9A 1NLVA 3QBXA 2P9PB 3H3OB 4H5TA 4JHDB 3GBTA 4BROA 5JLHA 3O6WA 2ASMA 2Q0RA 2V51B 3SMSA 3VEOA 4WYBA 3WXLA 5JMVA 4I6MB 2A42A 2CH6A 1H1VA 5KPZA 3MDQA 1C0FA 1DEJA 2IVPA 3CJAA 4H5VA 1ATRA 4BR2A 1GLCG 3MN7A 1XC3A 2AA4A 4JN4A 1U2VB 5EXWA 3WEEA 3M1FA 4M7XA 5JLFA 2E20A 3O08A 3UKUB 5KQDA 4FWPA 4JAXA 4K42A 2P9SB 3C0BA 3WXIA 2J4RA 3BP8A 1R59O 4L3QA 3IUCA 4BVPA 3VF4A 3CETA 4J8FA 3SJHA 4A2AA 3WXKA 4BR5A 1JCFA 3D2EA 1XQSC 2HF3A 3RSEA 1WOQA 2YHXA 5E84A 5E26A 3HI0A 5AFUH 5JICA 4B1VA 1BUPA 2P9KB 4IXCA 5BN8A 2H3GX 4BC4A 3A5LC 3MMVA 3DAWA 2BUPA 3W3DA 4PKHA 3CQXA 3FLCO 3H6EA 4WQ5A 4H5NA 4QS7A 4CZGA 5FPMA 4BRAA 4XH5A 4PKIA 4BR0A 4H0OA 3QFUA 3AARA 4MO5A 1HKBA 3CQYA 2GEMA 3O8MA 5AQMA 5BR9A 3D2FB 4BRNA 1ZXOA 3A8YA 4PL8A 1V4SA 4BRKA 2I7PA 3WT0A 3FZHA 4BVOA 5AQOA 4MLHA 3GOIA 1SZ2A 2D0PA 5AQGA 3BF3A 5AZJB 3U9ZA 4WQ4C 5AQVA 4BRDA 3HBTA 2P9NA 3LDLA 4Y0WA 5AQIA 1JCEA 3ZX0A 3M3ZA 5BPNA 2E1ZA 1BA1A 4WQ4A 4CZLA 2GELA 1BOTO 3VEYA 3F9MA 1HPMA 1NGFA 1HUXA 4FOEA 4JD2B 3TPQA 1J6ZA 5KQ8A 4DB3A 5EOYA 2NRHA 1BG3A 1RGIA 4FWOA 3FE1A 2Q0UA 3M6GA 1MWKA 1T44A 2QXLA 2AP1A 3DXMB 3CERA 3QICA 2P9LA 1KAZA 1DKGD 4FWMA 2Q97A 5EVZA 5AQUA 2FF3B 3H3NO 3DXKA 1EQYA 4CZFA 2HOEA 3R9PA 5AQTA 4JNEA 4BRIA 4FPAA 2ZWHA 5AR0A 1Q18A 1Z6RA 2EWSA 4HTLA 3EKUA 2FSJA 5KPRA 1HJOA 1G99A 3ZETA 2HF4A 2VWBA 1GLLO 4CZHA 3QB0A 2D4WA 4K41A 4DCHA 4IJNA 3TU5A 4RWTA 4B1YB 1NGCA 2A40A 2NZTA 4FSVA 5EX5A 4BGBA 4JHDA 1Z05A 4BRLA 2PBDA 2WUSA 3A0IX 5AQXA 5ADXH 3LDQA 2E2PA 1NGDA 1QZ6A 4FWRA 4I6MA 3VF2A 3LDPA 3OHRA 2ZGZA 5BRFA 1C0GA 3HSCA 2ZF5O 2P9UB 3VERA 5BPMA 2CH5A 3AAQA 1KXPA 2A6AA 1NGJA 1U2VA 3ULEB 3B8AX 3HTVA 4AM6A 1LCUA 1U6ZA 3UKUA 1OKJA 2P9SA 4GNIA 4IJAA 1JCGA 1MWMA 3VENA 3P4IA 2D1KA 4DHYA 4H0VB 4CZEA 3BEXA 4IO8A 3FR0A 3L6QA 4K43A 1NWKA 2YHYA 5ELZA 4GY2B 4CZMA 1XUPO 3O80A 4FOIA 2P9KA 4H03B 2CGLA 4BRHA 5BREA 4CZKA 1YUWA 4EHTA 2P9IA 4B1UB 4PL7A 2GWJA 3LDOA 4O8KA 5AQPA 3C7NB 5AQFA 3J8AA 2P9IB 4BGAA 3FZLA 5F2RA 4ISEA 1GLFO 3JXUA 4H0PA 4H0YB 3CI5A 4MLEA 3D2FA 4ISFA 5F1XA 4IZ9A 1NBWA 1S3XA 4CD1A 4CJ7A 4Z94A 4CBXA 1GLDG 3VPZA 3MN5A 3ZEUB 4EHUA 2IVNA 3AAPA 3QFPA 5BPLA 5FPEA 2W40A 4NO7A 4PKGA 3ATVA 5FPNA 2FLOA 3UKRB 1K8KB 5AZJA 1NGEA 1HKGA 2QWQA 2GTDA 3FGUA 4BG8A 3CJ7A 4BG9A 3MN9A 2QW9A 1NGGA 5AQNA 2CGKA 5AQRA 1GLBG 2PAVA 3VF6A 3I33A 4JD2A 4BRGA 1X9JA 3HM8A 3MN6A 3H46O 2E1YA 1E4GT 3KHYA 4BQZA 4B1WB 3BUZB 1GLEG 1GLAG 1Y64A 3DXMA 2E88A 3U9DA 4BR7A 2HMPA 4M63C 4RTFD 3LM9A 1BU6O 1ATSA 4M7YA 4EAHD 2Q36A 4FWQA 4BREA 3A5OC 1HLUA 1E4FT 1NGBA 3IFRA 5B8HA 1ESVA 4BRQA 3W0LA 3CIPA 5BRDA 3FZKA 3A5NC 2BTFA 5LJWA 1HKCA 2ASOA 5CE3A 3A5MC 1MDUB 5AZIB 3CJCA 3FZFA 4FO0A 2VYPA 2YJFA 4C23A 3EL2A 3GG4A 3KZBA 3FFKB 3QBWA 5EY4A 2A41A 2OANA 2YHWA 3VESA 1TYQB 3ZX3A 3GDQA 3VEZA 2W41A 4FPBA 2FXUA 4HWIA 1QQOA 1TUUA 1T6DA 1IG8A 1X3NA 4BR9A 2ITMA 2V7ZA 2P9UA 1ZC6A 2YI1A 1IJJA 2IIRA 3HZ6A 5AQSA 3ULEA 1HX1A 1YXQA 3DWLA 3LDNA 4CD3A 3IMXA 1NGIA 4B1XB 3DJCA 1WUAA 4B1ZA 5F0XA 1SAZA 4NB4A 3CHWA 1NM1A 3UB5A 1GLJO 4DQ8A 2VCPA 4EIAA 2NLXA 1RDWX 4A2BA 1BA0A 3D7EO 5AQWA 3R8EA 1KAYA 2QWOA 4FL9A 4BRCA 3QMLA 4XH1A 4CBWA 1ATNA 3QDKA 1DGKN 5AQZA 3BF1A 1T6CA 1V4TA 2ZGYA
chains in the Genus database with same CATH superfamily
3J81O 3RMDA 3O5BA 2XRIA 1LW2A 4O55A 2E8AA 3AO3A 3OYDA 4DWIA 1KLNA 4DU3A 4KHPK 4JRQA 1KCFA 4PQUA 4XEIA 1U45A 4OLAA 3L3VA 3CQ8A 4CFDA 4NYFA 4AHRA 3CCQN 2HMIA 3VQPA 1MU2A 5HLFA 3C6AA 3KVGA 3F2KA 3ZEUA 1A5WA 3O4WA 3D2EB 2XY5A 4CIGA 1TK5A 2VQEK 1TK8A 1EETA 1P8ZA 3SYZA 5HRRA 3G25A 1KC8O 3MECA 3NH2A 1FKOA 2D0AA 1B9DA 2I7NA 2OTJN 2ASPA 1VQPN 2F9WA 3S5TA 3DYAA 3THYA 2IAJA 1VQLN 3ZSVA 4FVMA 4JI5K 3KLEA 4BDZA 3QEVA 4QS8A 3CCMN 4LC9B 4BC3A 1C1CA 3CJBA 1J54A 2A5XA 1SKWA 1WSJA 1KVAA 1NJIO 3O1BA 1VSFA 2QM1A 3TSPA 2DPNA 1N33K 5I9EB 4FM2A 3LL3A 2P9NB 4L8RB 1C1AA 3O3GA 4IG0A 1DTQA 3U4LA 4RCHA 2FF6A 1JXBA 3CXCM 3OYEA 4CFAA 2PY5A 2V52B 5BN9A 4BRPA 4C8OA 3V4IA 3H08A 3MWTA 5KRTA 4O5FA 1KVCA 4CI6A 4FLXA 4RW6A 3ID8A 2E4LA 4DV1K 2KZMA 4BC5A 4GW6A 4DF8A 4DV0K 4GKJK 3O9RA 3ENOA 3MEDA 4YOVA 5ADXA 2IDOA 3WQTA 2GV9A 4A61A 1HQEA 5C15A 4DSIA 4DTJA 3SPZA 4CEAA 1ZBLA 1IBKK 2R7YA 1OVYA 1U04A 2YNFA 1QVGM 3SQ1A 4IDKA 3HL8A 4BROA 5JLHA 1WSIA 3V9ZA 2HNZA 2KFZA 2Q0RA 4DV2K 3CCVN 3SMSA 4WYBA 2D0BA 3LP3A 4AHCA 3O9SA 1H1VA 4M3UA 3QEIA 4PWDA 1CZBA 4H4MA 1XC3A 4JN4A 3WEEA 3P39A 3VQ4A 3CCRN 1LAWA 5JLFA 4GKKK 3O08A 4B8AB 1L3TA 4LH4A 4K42A 3NFAA 2A1RA 3PO4A 5HBMA 5C24A 3WXIA 2NRWA 1D8YA 3SJHA 1FK9A 4EP4A 4MDAA 1K73O 5C0YA 2YNIA 4E0DA 5KI6A 1XQSC 1WSHA 4A57A 4DV6K 4KH5A 2X6SA 2YHXA 2IS3A 4AILC 4B08A 1M1KO 4CGIA 5M1OA 3PY8A 1BUPA 4DFPA 3LAMA 4WFBL 2H3GX 3A5LC 3DAWA 3ZSYA 2NRXA 3FLCO 4WQ5A 4ELVA 2OYQA 5FPMA 1SKRA 3S3OA 3QFUA 1LV5A 4E7JA 4MO5A 1NKBA 4ID5A 5JVHL 1T3VA 3C94A 4BRNA 3QETA 1IKYA 3T1HK 4WE1A 3TTDA 4PL8A 4J2AA 4A5AA 4WCEL 1U47A 3WT0A 3M5RA 3TSQA 3TR8A 3NAEA 1QVFM 2KTQA 3EE8A 3K9JA 2NRRA 5AQGA 3VQCA 3OYJA 4CF1A 1S1WA 4BRDA 3O4NA 5AQIA 4TSXA 4Z4IA 2KLAA 3ZX0A 1JLAA 4WQ4A 4HHTA 1NMNA 4FOEA 3TPQA 4E7IA 1T05A 4DMNA 4DB3A 1WAFA 4DSLA 4FWOA 3NF7A 2AJQA 3CERA 3K5LA 1KAZA 4DV4K 1X9MA 3PIOL 3CCEN 1UA1A 3HJFA 4JYAK 3DXKA 1IG9A 3PIPL 1TAQA 4FPAA 4BRIA 1C0MA 2ZWHA 4M3TA 1Q18A 3SQ0A 4PA1A 2HF4A 1NGCA 5JS1A 5EX5A 4CHQA 4IOAL 2PBDA 1BL3A 5AQXA 4CHYA 1NKCA 2O8DA 1QZ6A 2ZGZA 1I3AA 5KGWA 2YX6A 5BPMA 3SUQA 3AAQA 3L2VA 2QI2A 2A6AA 1YI2N 1NGJA 1U2VA 4BDYA 1RILA 4AM6A 3CC4N 3IKMA 5GADP 1JL1A 1SUQA 3OW2M 3NGYA 3AA5X 2OPPA 3NVKA 4Y1DA 4OPHA 2WC9A 2XO7A 3G0ZA 4Z4GA 4DHYA 4CZEA 4KHNA 1N5YA 1XMQK 4IEEA 1FXXA 5ELZA 4CFBA 2BGGA 4CZMA 4RW7A 4YOWA 4AF1A 3TABA 5BREA 5J2PA 4N5SA 5I3UA 4KI6A 3THWA 4M42A 4KHWA 4DSJA 3VQ9A 4EHTA 3PX4A 3EE9A 4PL7A 4DSFA 2G8IA 3G71N 2OPSA 5F2RA 4XJXA 3OYMA 2HHUA 2FC0A 4DV3K 4WFNL 4ISFA 4GV9A 2RHKA 3M8QA 3AGKA 4Z94A 1ZBFA 1XMOK 1ASVA 3VPZA 4NYNA 3V9SA 4IFVA 2IVNA 2BANA 1HR0K 1Q8IA 5FPEA 3T3FA 4CJ4A 4FJGA 1NGEA 2QWQA 4W5NA 3CJ7A 1VRTA 1KQSM 1VQKN 2CGKA 4AHVA 5JVGL 4DTUA 2PAVA 4DLEA 3MN6A 2E1YA 1DT9A 1VRUA 2UUAK 3SUPA 3KHYA 3AO4A 1GLAG 3DXMA 4KRFA 3IS9A 4BEBA 1JLFA 2HMPA 2IOCA 1T8EA 3SAFA 2O4IA 1BU6O 3CPEA 3LZJA 2ITGA 4F2SA 5HRNA 3NDKA 1NGBA 3LP0A 3W0LA 3D6RA 2O4GA 3A5NC 3ZLJA 4I2QA 4DR6K 5LJWA 1HKCA 5CE3A 3QNOA 1S9GA 4M3RA 3C95A 3FZFA 2HB5A 3EL2A 3KZBA 4BWMA 4EZ6A 3DM2A 1TYQB 3C6UA 3VEZA 4FJIA 1SKSA 3MEEA 1T6DA 2ZQBA 5M1NA 2ITMA 3L4QA 2V7ZA 1ZC6A 1U48A 3OYFA 3LP1A 3THXA 3V6DA 3G10A 4NLCA 1KTQA 1YXQA 4KTWA 4CD3A 3BZKA 2X78A 4JLHA 3ZT3A 3ZT0A 4JKHA 3P1GA 4OKKA 3UIQA 3WNEA 1NM1A 1TL1A 1LWFA 2VCPA 1FW6A 1S6QA 3AO2A 1OH8A 1RDDA 4A2BA 1WBDA 1W0HA 3R8EA 3TAQA 3S3NA 1E3MA 1GOBA 1ATNA 3QDKA 4N76A 1U49A 1EO1A 3BF1A 2HHVA 3VGMA 2UXDK 4YOUA 3WQUA 1HYZA 4FWNA 3LPUA 4NXMK 4LD0A 4CK2A 4ILGB 2XY7A 4CBUA 3E9OA 2G8VA 4B9TA 4ZTFA 2FSKA 4DR7K 1S22A 1JLGA 4CJKA 1QSLA 1Y97A 2GUPA 5AFUA 3OS2A 4OPJA 4BC2A 3HPOA 5TKYA 1A5XA 1RFQA 2KQ2A 3B6OA 2HHWA 3EN9A 5FDLA 3KLFA 1J5EK 2E6LA 3KLGA 3RSEB 3I0SA 3PSIA 4WQ5C 3SCXA 3VETA 3UKRA 4U7BA 3VGKA 5LY3A 2FSNA 2E2NA 3J80O 1VK0A 4FJJA 3VEVA 1CZAN 2BDPA 3WXJA 3M8PA 2YJEA 2QWRA 3RVCA 2OCEA 3O1WA 4IFEA 3PLAA 5E41A 3E9LA 4PUOA 1N8RO 5FPDA 4HTUA 4H0XB 3WUHA 3J7AP 2D0OA 2V7YA 3E1YA 1NK4A 2QKKA 2E2OA 1SV5A 3OBWA 4CJ5A 1VHXA 3V9WA 1QQMA 1NK5A 4EP5A 3DMJA 4JKGA 4MFBA 4EFHA 2NUBA 3G4SN 2BH1A 4FWSA 2XHBA 5AZIA 2QWLA 1S9EA 4FLTA 2Q1NA 3T1AA 4X65K 1JLCA 3P5JA 5KGXA 2RPIA 1SL0A 2WTUA 4CVNE 4EZ9A 3LWLA 4GVMA 1W7AA 4F9OA 4FWKA 5AQJA 2YNGA 3VGLA 2JLEA 4CK3A 5C12A 3CJ1A 3VQ6A 3K0SA 4FLWA 4CGFA 1HNWK 4I9LA 2ZJPL 3SQ2A 4CEOA 2CGJA 5EU7A 4AHUA 4FM0A 4OGCA 1BWFO 3GL1A 1TL3A 3H1QA 5K14A 1NMDA 4FZYA 1T03A 4YDUA 3ZETB 4JI1K 4CEQA 2HBJA 5AQLA 3KJVA 3CYGA 3VEWA 3WNFA 4FLVA 3IG1A 1S6PA 4IO9L 4DR4K 4CJQA 1NLVA 1O1WA 4JHDB 3QERA 3O6WA 2ASMA 4CEDA 2VG7A 3TANA 5JS2A 2F96A 4U67L 4DQQA 5GINA 2EHGA 3RR7A 3ZYYX 4UY8O 1DEJA 4ZTJA 4CHOA 4DTXA 1BCOA 1RT3A 3CJAA 3DRPA 1ATRA 4BR2A 1TKDA 1GLCG 3AVLA 3VMFB 2W6LA 2FBYA 4M7XA 3CMEN 5KQDA 1B9FA 1ZBUA 1BQNA 2P9SB 2FBXA 2J4RA 3B6PA 1Q82O 3C6HA 1YTAA 3BP8A 1R59O 4L3QA 3IUCA 3CETA 4J8FA 4K0KK 4ID1A 5J2NA 4BR5A 3D2EA 1YJ9N 1L3UA 3RTVA 4LFBK 1BCMA 2HF3A 1NJZA 2HVIA 1NNEA 2QKBA 4PHTX 2P9KB 4IBNA 5BN8A 3O9QA 4LF7K 3NE6A 4H4OA 1OH7A 3CM5A 4IOXA 4H5NA 4CZGA 5M1KA 2VQFK 2GUIA 4BR0A 4KAZA 3CQYA 1EX4A 3OBYA 3O8MA 3JSMA 5J2MA 4HCCA 5KTQA 1WSFA 1J9AA 5CY4A 4IG3A 3CC7N 1V4SA 2I7PA 3WXMB 4BE0A 5AQOA 4G9ZA 1SZ2A 3K58A 2HHXA 2D0PA 3AVFA 1TV6A 1OH6A 3MCAB 5LMNK 3DLLL 3CC2N 1RDCA 3L3UA 4CEEA 1HYVA 2P9NA 3LDLA 3OYCA 4DTNA 5BPNA 5C42A 1J53A 1F21A 5CYMA 2F8TA 1BA1A 4CZLA 4DTPA 1NGFA 1HUXA 4JD2B 1J6ZA 1C6VA 2HNYA 1BG3A 1BQMA 3A2FA 3M6GA 1MWKA 1T44A 3NH0A 2FBVA 4M45A 3QICA 5GAGP 1JLQA 5EVZA 3AVIA 3NF6A 3SV3A 1DLOA 1RBSA 3R9PA 4JNEA 2EWSA 2QK9A 3F73A 2FSJA 4ILJA 4NCAA 1HJOA 2ZE2A 3PO5A 4BE7B 3QB0A 4IJNA 3TU5A 4B1YB 3KK1A 2A40A 2UUCK 2B4JA 3DRRA 4FSVA 1NJWA 5CHIA 4B9LA 4YORA 4N47A 4BGBA 5M1FA 3LWMA 1Q81O 1Z05A 1WNSA 3MAQA 4FCYA 1ZBHA 3TAFA 1ZYQA 4KHUA 3AGRA 4FWRA 3VF2A 2X74A 4JKAA 3SAHA 3OHRA 1IKXA 1C0GA 1N32K 1ZBIA 4FJ8A 3OVNA 3SBGA 3VERA 1XC9A 2G8HA 1YTUA 1UOCA 4RG8A 1HPZA 3F5TA 3ULEB 3ULDA 1U6ZA 4DKWA 4IJAA 3MEGA 4LF9K 4V19S 1CZ9A 3HVRA 4YNQA 2D1KA 4H0VB 4DTRA 3BEXA 5J1EA 4C8KA 1NWKA 4JKCA 4GY2B 1IV0A 4LFCK 3T69A 4FJLA 3VN5A 4DV7K 4BRHA 3TSUA 4KTQA 1XNRK 2KW4A 4DQSA 1BIUA 1JL2A 2C1GA 2P9IA 5FROA 3OJUA 4OO1J 4UQGA 3VA0A 3LDOA 4O8KA 3C7NB 3J8AA 2P9IB 4CF2A 3HOSA 4DU1A 1GLFO 4KB0A 1BI4B 3DLRA 4FJHA 3WNGA 3RR8A 4JKBA 5F1XA 4KTZA 1VQ9N 3BZCA 4IZ9A 1S3XA 4CD1A 4CBXA 3P38A 1GLDG 3SZ2A 5DM7L 4AHTA 4EHUA 3AAPA 3QFPA 4FJNA 2W40A 4NO7A 4PKGA 4GV3A 4B9NA 1RDAA 2FLOA 1K8KB 1HKGA 2GTDA 4OVLA 4BG8A 2B6AA 2QW9A 4IDHA 5FLXO 4E3SA 4C1NK 3VF6A 3I33A 4FLUA 3H46O 3KWIA 4F3OA 1E4GT 4ELUA 1GLEG 2YHBA 3RWUA 3HVTA 2O8FB 3P31A 3HP6A 2X6NA 1WB9A 2NRVA 4EAHD 4WFAL 3A5OC 1HLUA 1E4FT 3IFRA 1RTJA 1ESVA 3MWPA 3HRGA 2UXCK 1D9DA 3A5MC 4JI2K 2C1IA 3KK2A 3AVKA 3CJCA 1NJXA 4FO0A 4JV5K 1IKWA 3FFKB 4DV5K 3QBWA 5EY4A 2A41A 2OANA 3ZX3A 4KH6A 2O8EB 3TAGA 4JI6K 3J7YP 1M90O 4FPBA 2FXUA 1TUUA 3Q7BA 3SNNA 1RT6A 1X3NA 3BGRA 4DQRA 3ENBA 3KD5E 3L2RA 2YI1A 3D0PA 4RW9A 4CF0A 3HZ6A 5AQSA 4Q5VA 1HX1A 3IAYA 1X9SA 4CGDA 1NGIA 1WSEA 3SUOA 3BY5A 1NOYA 4B1XB 5HP1A 3ZT1A 1XWLA 3I0RA 4B1ZA 1C0TA 4RW8A 4GV6A 4NB4A 1ITGA 3ZSXA 3CCSN 4K8ZA 3UB5A 2O8BA 3V1RA 1VQ7N 4EIAA 2PZSA 3ASMA 1RDWX 2O8BB 5AQWA 4BRCA 4CEBA 3EYZA 2F8SA 3QMLA 3LZIA 3SJJA 1FJGK 3SPYA 2EX3A 5AQZA 2E5LK 3NH1A 3LPTA 5BR9A 3OYHA 2ZGYA 1JLEA 2HHHK 5KRSA 3L4IA 4BR4A 2IVOA 3ENHA 3ITHA 2O8CB 4HVJA 4O5BA 3S3MA 5LJVA 4KH4A 4ISGA 4BY9C 3DLHA 1NOZA 2DTUA 3VQQA 4JS4A 3MX2A 3UE5A 1SQKA 3QO9A 2KZZA 4A5BA 4JI0K 3FFIA 4F4KA 2GWKA 5C10A 1S1XA 3SMPA 4BACA 3DLKA 4YFUA 2VGMA 3DRSA 5J2QA 3LALA 3ATUA 5AQHA 2G8KA 3DLEA 2UUBK 3K5OA 1N36K 5AQQA 2VWKA 1KD1O 3L0QA 3RRHA 1W97L 3N4PA 4DR2K 3DOKA 3KKSA 3R6MA 5CZ1A 3V1QA 3EZWA 3K57A 4B3SK 3N4QA 4W5RA 4H8KA 3OYNA 2WFBA 4IWVA 3VQDA 3O3FA 3EEQA 4FWLA 3DOLA 4R5PA 1NGAA 1TKXA 2QWMA 3V9XA 3S41A 4HUGA 2P5GA 4E1NA 3TTFA 3SK3A 4HCBA 3H1VX 3LDSA 5AQKA 4CIEA 1TYQA 2HHTA 4CW7B 3I8BA 4QS9A 2E2QA 2UU9K 1RBTA 4ICLA 4OJRA 4I7FA 4CJUA 3AA2A 4B9SA 2YV0X 4BE2A 4DQPA 3VEXA 3ZCMA 2ZM6K 4RW4A 4KI4A 3U6FA 4WF9L 2P9LB 3EO3A 2QWNA 5HROA 1N34K 1G15A 1C1BA 4I9QA 5HL7L 2IC3A 1LOTB 2YCHA 3ZSQA 4KV8A 4GMJB 1L5UA 1Q9XA 2QTDA 1TK0A 4AM7A 3AO5A 3L2UA 3AY9A 1Z26A 3FZMA 3NGZA 2F9TA 4CJPA 1YVNA 4FJKA 1D4XA 3CJ9A 3CG7A 3H3OB 4H5TA 1O13A 2W6KA 3HOTA 2V51B 2JGUA 3HPHA 3VEOA 1IBLK 4DUYK 4JK8A 4I6MB 2A42A 5KPZA 1OVQA 3MDQA 3THVA 2IVPA 4H5VA 5HOOA 4JS5A 3MN7A 3LAKA 4QCLA 4FJXA 1YF5L 5EXWA 3M1FA 3UKUB 4FWPA 4JAXA 3VQ5A 1IH7A 3AVBA 4BVPA 3VF4A 1YVUA 2HHQA 4NLBA 3SV4A 1RDUA 1JCFA 3RSEA 4DUZK 1WOQA 5E84A 5E26A 3HI0A 4B1VA 4O0JA 1S72N 4CGHA 4IXCA 1HNZK 4ZHRA 1HMVA 4BC4A 1VQ5N 3W3DA 4CF8A 3OS0A 1U4BA 4B9MA 3CQXA 3KWGA 2HBMA 4ELTA 1UA0A 4XH5A 4PKIA 1K9MO 4H0OA 3MX5A 3CCLN 1HKBA 2GEMA 2Q3SA 4B3RK 1ASWA 5AQMA 3QEXA 3D2FB 1HNXK 1ZXOA 3CPWM 2YHAA 3A8YA 4KHSA 4F3TA 4KB1A 3QESA 1SL2A 3FZHA 1QSYA 3CFOA 4MLHA 4DFKA 1VQNN 2OA8A 5JENA 1BGXT 3BF3A 1JJ2M 5AZJB 4WQ4C 5AQVA 4C8NA 3TAMA 3AVNA 3HBTA 3RMAA 1BIZA 1JCEA 4YOYA 2E1ZA 4MQ3A 4OX9K 3HO1A 2GELA 3VEYA 3F9MA 1HPMA 4CE9A 3M8RA 1IKVA 3ZSZA 1WLJA 3T19A 3I55N 1I39A 1RGIA 4XIUA 4CF9A 2Q0UA 3F9KA 2QXLA 3QNNA 2AP1A 4JKEA 1DKGD 4FWMA 2Q97A 4Z4HA 2OPRA 1BISA 2HNDA 4YHHK 1EQYA 3TARA 1B92A 1T7PA 5AR0A 3EKUA 3NVMA 4QAGA 4DS5A 1KFDA 1G99A 3ZETA 4OLBA 2VWBA 2LSNA 4CZHA 3E66A 5T7BA 4RWTA 1NK6A 4M3WA 5H1SQ 3AA4A 4JHDA 3AVCA 4BRLA 2YKMA 3A0IX 1Q9YA 1LWEA 5ADXH 3AVJA 3OYIA 1TKTA 5SWMA 4B3OA 4LF4K 3LDPA 1EWQA 2ZF5O 2P9UB 2CH5A 3QEPA 3CCJN 3HK2A 1VQON 4NCGA 3DI6A 1LCUA 2G8WA 5GAEP 1WSGA 2P9SA 4GNIA 4CEZA 3KK3A 3K5NA 1JCGA 1MWMA 3VENA 1EWRA 1LWCA 4CK1A 3L8BA 3HT3A 2YHYA 4CHZA 3Q7CA 3CYMA 4FOIA 1REVA 1YIJN 2P9KA 4H03B 3KTQA 3OY9A 1W9HA 3OYBA 2XY8A 5LL6Z 1X9WA 4IOCL 1EKEA 4DS4A 4C1NI 3TWHA 4Z4CA 3T7ZA 4GVEA 2PFUA 2PYJA 5AQPA 2ETJA 4JI4K 3U3GA 4BGAA 3FZLA 4B3MK 4FM1A 1QSSA 5GIOA 2ZD1A 4H0PA 2YNHA 3CFRA 1SS6A 4E72A 3D45A 2Z1IA 3K2PA 4K8XA 1CXUA 5D3GA 3PUFA 5TKWA 3C65A 5C2DA 2P1JA 3ZT2A 3SAGA 3MN5A 3AVAA 3ZEUB 1S5JA 3E01A 5BPLA 1VSLA 3I8DA 4CEFA 3ZT4A 1NJYA 4DTMA 2HSTA 3ISNC 4FK0A 4IEIA 3JYTA 2NNWA 4BDPA 4JI7K 1NGGA 5AQNA 4F2RA 4CFCA 4JI8K 1IO2A 3O9UA 1GLBG 4CJ3A 4PY5A 1KRPA 4JD2A 1X9JA 4N41A 2WOMA 3SBTA 5I42A 4YOTA 3THYB 1KLMA 4B1WB 3BUZB 3AV9A 3QIPA 5HRSA 4BR7A 2E88A 4CJFA 1TVRA 3AO1A 1RDBA 4M63C 4RTFD 3LM9A 1KFSA 3K9KA 4M7YA 4CJTA 3LP2A 1EXQA 2W42A 1VQ8N 1D5AA 3C6TA 1LW0A 4O44A 1ILYA 3FZKA 2BTFA 2ASOA 1MDUB 5C2FA 2IGIA 4CJLA 1WN7A 1N6QA 4C23A 2VYPA 2YJFA 4C8MA 3GG4A 4FLYA 3HM9A 3GDQA 2P5OA 4OKEA 4QOZB 3CF5L 4HWIA 4CJSA 1GOAA 5GIPA 4N56A 2DY4A 3O9TA 4Z0UA 3QIOA 3ULEA 4KFBA 3VA3A 3KIOA 5DK5A 3E9PA 1QHTA 1SAZA 1K6YA 1S1UA 4E7HA 1LAVA 4E19A 1P90A 3VQ8A 2VG6A 4FJ5A 2B5JA 2W00A 1BA0A 3D7EO 2QWOA 4AQYK 4FYDA 4CBWA 1RT5A 4CERA 3PX6A 2FBTA 3PV8A 3R1XA 1BO5O 4FWQA 4DFJA 4DF4A 4OGEA 5KPTA 4K25A 4KBOA 3OYLA 3OYAA 1QQCA 3C7NA 2QEXN 3NGIA 2DFFA 3TI0A 3WEEB 1WBBA 3PSFA 1BI4A 3IDHA 1KAXA 1QHAA 4LSLA 3SQ4A 3MXMA 2QXFA 2GBZA 1NU0A 4B9VA 3GE1A 3VOVA 3LM2A 5M1PA 4HUEA 1QZ5A 4A59A 1VQMN 5BRHA 4M41A 3PX0A 3VQEA 4B9UA 4M3XA 1K8KA 4JK9A 2VGNA 3ZSRA 1RBVA 4O0IA 4E7KA 3ID6A 3H45C 4CCHA 5IWAK 4J2DA 1ZBSA 2HBLA 2UYTA 2G8UA 2GX9A 3VTIA 3ALYA 3OJSA 4BRFA 4MO4A 4X64K 1RT4A 2ATQA 3MXIA 2Q2RA 1XI1A 3QLHA 3U8XA 2NRTA 1D9FA 2O8FA 1HQUA 4LY7A 4H0TB 1MA9B 2KHOA 3JS6A 5BR8K 4BRMA 4O8UA 4CZJA 4CJVA 1NGHA 3CM6A 3KK7A 5CZ2A 3KKRA 4BQLA 4JRPA 1NK7A 5IT9O 5AQYA 4JI3K 1TUYA 4FK4A 2A3ZA 4XH4A 1GOCA 4E1JA 2O8EA 1HNVA 3SLCA 1NK0A 4Y1CA 3MK6A 4DG1A 3OYGA 3ZX2A 2Q31A 2A1SA 4JKDA 2QWPA 1X3MA 4A62A 4R79A 3NBPA 2WBNA 3EKSA 2P51A 4OPKA 1QQNA 1HNIA 4YDUC 4C8LA 3DXKB 4FVUA 1OH5A 1BDGA 4H5WA 4B9QA 1YAGA 3MCPA 4KKOA 3OTOK 2JWLA 2ZJRL 4CZIA 2P9PA 2D0CA 4H5RA 4KHQA 3I56N 1VAZA 4O4GA 3QBXA 2P9PB 2ZJQL 1Z25A 3GBTA 3IRXA 3V81A 2OZMA 4LF8K 2Y1JA 4DR1K 3WXLA 3AA3A 2O8DB 5JMVA 1RNHA 2CH6A 1NK9A 1TGOA 2VG5A 2WONA 1C0FA 3MXJA 4CECA 4DSEA 4Z4EA 4MDBA 1RTHA 3KD1E 2AA4A 1U2VB 2O8CA 4DLGA 2E20A 2F4VK 1RCHA 3C0BA 1NG9A 4DSKA 4W5QA 1RTDA 1C0UA 2Z1GA 1HRHA 3M8SA 3TAEA 4A2AA 4CHNA 3WXKA 1QTMA 2VWJA 1IBMK 4DU4A 5AFUH 5JICA 4CJEA 2QA4N 3EY1A 5DMRA 1S1VA 3THWB 3MMVA 5SZTA 3HXMA 3R3LA 4DTOA 2BUPA 4KREA 1EP4A 3HSTB 4PKHA 1KSPA 3QEWA 3VQ7A 3H6EA 4FK2A 4QS7A 4BRAA 2RN2A 2RF2A 3AARA 4DQIA 2RKIA 1VSKA 4LFAK 1QS4A 4AHSA 1TAUA 4YOXA 3LANA 5CYQA 4CIFA 3O4QA 4I2PA 4BRKA 3NCIA 2HHIA 4BVOA 3G6EN 1RBRA 3GOIA 1NKEA 3NHGA 1X1PA 4M3YA 4CGJA 4DR3K 4FZZA 1JKHA 4FJMA 2NRZA 3U9ZA 2Y1IA 1S1TA 4NXNK 1BHLA 4Y0WA 3V1OA 4LH5A 3M3ZA 4B8CA 3O3HA 2HHSA 2I5JA 2E6MA 1BOTO 5FRMA 1RT1A 3DLBA 4CJWA 4E89A 5KQ8A 4YY3K 3L2WA 5EOYA 3K59A 3CMAN 2NRHA 4J2EA 3VQAA 3FE1A 3DXMB 2P9LA 3SI6A 1RBUA 1UAXA 5AQUA 2FF3B 3H3NO 1JXEA 4CZFA 2HOEA 5HRPA 5AQTA 1Z6RA 3L2QA 1FKPA 4HTLA 2DFHA 5KPRA 2D5RA 3TTCA 4X62K 4AH9A 1GLLO 2D4WA 4K41A 4DCHA 1DTTA 3P83D 1YJNN 3ZSWA 2OPQA 2NZTA 5CR4A 2UXBK 5A2QO 1YITN 1YHQN 2WUSA 4G1QA 4JK7A 3LDQA 4B3TK 4M3ZA 2E2PA 1RTIA 1NGDA 1L3VA 4KHYA 1JLBA 4I6MA 2G8FA 5BRFA 3HSCA 4KPYA 4IKFA 2HBKA 1SL1A 3THXB 1KXPA 3B8AX 3HTVA 3RRGA 3UKUA 1VQ6N 4X66K 2KKZA 1OKJA 1CXQA 4LSNA 1VSDA 4FXDA 3P4IA 3OYKA 2YKNA 4IO8A 3FR0A 3L6QA 3V9UA 1A5VA 4K43A 3CFPA 3VQBA 3OS1A 3RMBA 4W5OA 3K5MA 3SUNA 4E7LA 3JAMO 1NK8A 1W2BM 1XUPO 3O80A 1ASUA 3AVHA 5MLCQ 2CGLA 3NMUA 4DR5K 3AVGA 3NF9A 4LF5K 4CZKA 1XHXA 1YUWA 1HYSA 4B1UB 4ILHA 1J5OA 4W5TA 3J7ZO 1UWBA 2GWJA 1VSHA 5AQFA 4BE1A 5M1QA 4IFYA 4ISEA 3HYFA 3JXUA 4Q0BA 4H0YB 3CI5A 4MLEA 3D2FA 4CESA 1NBWA 4JKFA 4CJ7A 2OTLN 2OZSA 1R0AA 1RT2A 2HW3A 4F8RA 4FW2A 3BDPA 1Q7YO 4DFMA 3ATVA 5FPNA 3UKRB 5AZJA 5GAHP 3FGUA 4BG9A 3MN9A 1HJRA 4E1MA 5AQRA 1YT3A 4BRGA 3KLHA 3HM8A 3TAPA 1VSIA 4CGGA 1VQ4N 1I94K 4DTSA 1L3SA 2JWKA 4BQZA 1Y64A 4KO0A 3U9DA 3RMCA 2PYLA 4J2BA 1ATSA 2Q36A 4FW1A 4BREA 3CCUN 1WAJA 5B8HA 1CLQA 4BRQA 3CIPA 1VSMA 5BRDA 3HPGA 4CHPA 4JKGB 1YJWN 2RE2A 1K8AO 3QINA 4FJ7A 5AJ3K 3U3YA 2BE2A 5AZIB 2Z1JA 1XNQK 2HVHA 5DM6L 4NCBA 3VTHA 3VESA 2YHWA 2DFEA 3NF8A 1KVBA 4FZXC 2W41A 3ZSOA 3HP9A 1XHZA 4LF6K 5FRNA 1QQOA 4CJRA 4HUFA 3CD6N 1IG8A 4BR9A 2F7TA 2P9UA 1Q86O 5LMUK 1IJJA 2IIRA 3OA9A 3WNHA 5C25A 3DWLA 3LDNA 3IMXA 4OKJA 4OPAA 3DJCA 1QE1A 1WUAA 5F0XA 3DLGA 3S9HA 1VSEA 4BWJA 4FLZA 4Z4FA 2Z1HA 3CHWA 1VSJA 4JEPA 1GLJO 4DQ8A 2NLXA 4BECA 1TKZA 1KAYA 4FJ9A 4FL9A 2KFNA 3KLIA 4XH1A 3T1YK 1RT7A 3AVMA 3EZ5A 2XY6A 1DGKN 1T6CA 1V4TA
chains in the Genus database with same CATH topology
3VGMA 3O5BA 5KPTA 4K25A 4KBOA 4YOUA 3WQUA 3C7NA 3L4IA 2E8AA 2QEXN 4FWNA 4ILGB 4BR4A 4CBUA 2IVOA 3E9OA 3ENHA 3WEEB 2FSKA 1S22A 5LJVA 4KH4A 3IDHA 1KAXA 4XEIA 4ISGA 2GUPA 5AFUA 1QHAA 4BY9C 4BC2A 3CCQN 5TKYA 1RFQA 3C6AA 3KVGA 3GE1A 3EN9A 3F2KA 3LM2A 3MX2A 3VOVA 3ZEUA 5M1PA 3O4WA 3D2EB 3UE5A 1QZ5A 1SQKA 4A59A 1VQMN 5BRHA 3RSEB 4WQ5C 4A5BA 3VETA 3UKRA 4U7BA 1K8KA 4JK9A 2VGNA 3VGKA 5LY3A 2FSNA 2E2NA 1P8ZA 3ID6A 2GWKA 3VEVA 3H45C 5C10A 3G25A 1KC8O 3SMPA 1CZAN 1ZBSA 2HBLA 3WXJA 2UYTA 2VGMA 2I7NA 2YJEA 2OTJN 2QWRA 3ATUA 2GX9A 3RVCA 3VTIA 2ASPA 4IFEA 3O1WA 5AQHA 3PLAA 4BRFA 4MO4A 3E9LA 5AQQA 1KD1O 3L0QA 1VQPN 1W97L 2F9WA 3N4PA 1N8RO 3R6MA 2Q2RA 5FPDA 4H0XB 3WUHA 3EZWA 2D0OA 2V7YA 1VQLN 3N4QA 3U8XA 3E1YA 2NRTA 2WFBA 4IWVA 4QS8A 2E2OA 3CCMN 4FWLA 3OBWA 4LC9B 4BC3A 1NGAA 3CJBA 2A5XA 1QQMA 4H0TB 1MA9B 2KHOA 2QWMA 3S41A 3JS6A 4BRMA 3TTFA 4O8UA 4JKGA 3SK3A 4CZJA 3O1BA 3TSPA 2QM1A 4EFHA 1NJIO 2DPNA 1NGHA 3G4SN 4BQLA 2BH1A 3H1VX 3KK7A 4FWSA 5AQKA 5I9EB 5AZIA 5AQYA 2QWLA 3LL3A 2Q1NA 2P9NB 1TUYA 2A3ZA 4XH4A 1TYQA 4E1JA 3U4LA 3SLCA 4RCHA 3I8BA 4QS9A 2E2QA 2FF6A 3CXCM 3MK6A 3ZX2A 2Q31A 2V52B 4F9OA 4FWKA 4JKDA 5AQJA 1BO5O 2QWPA 5BN9A 3VGLA 3VEXA 3CJ1A 1X3MA 4A62A 4BRPA 5C12A 3MWTA 4O5FA 4R79A 4WF9L 4CI6A 2P9LB 2WBNA 3EKSA 2ZJPL 3EO3A 1QQNA 2QWNA 3ID8A 2CGJA 5HL7L 4BC5A 4YDUC 1LOTB 3DXKB 1BWFO 4FVUA 2YCHA 3GL1A 3O9RA 3ENOA 1BDGA 4YOVA 4H5WA 3H1QA 4B9QA 5ADXA 1NMDA 2QTDA 1YAGA 3MCPA 3WQTA 4A61A 4AM7A 2JWLA 2ZJRL 3AY9A 5C15A 4CZIA 3FZMA 4YDUA 2F9TA 2P9PA 3ZETB 1YVNA 4H5RA 2HBJA 5AQLA 1OVYA 3I56N 3VEWA 1VAZA 4IO9L 1QVGM 1D4XA 3CJ9A 1NLVA 3QBXA 2P9PB 2ZJQL 3H3OB 4H5TA 4JHDB 3GBTA 4BROA 5JLHA 1O13A 3O6WA 2ASMA 3HOTA 2Q0RA 2V51B 3CCVN 3SMSA 3VEOA 4WYBA 3WXLA 5JMVA 4JK8A 4I6MB 3O9SA 4U67L 2A42A 2CH6A 5GINA 1H1VA 3ZYYX 5KPZA 3MDQA 1C0FA 4UY8O 1DEJA 2IVPA 3CJAA 4H5VA 5HOOA 1ATRA 4MDBA 4BR2A 1GLCG 3MN7A 3VMFB 1YF5L 1XC3A 2AA4A 4JN4A 1U2VB 3P39A 5EXWA 3WEEA 3CCRN 3M1FA 4M7XA 5JLFA 3CMEN 2E20A 3O08A 3UKUB 5KQDA 4FWPA 4JAXA 4K42A 2P9SB 3C0BA 3WXIA 2J4RA 1Q82O 2NRWA 3BP8A 3C6HA 1R59O 4L3QA 3IUCA 4BVPA 3VF4A 3CETA 4J8FA 3SJHA 4A2AA 4NLBA 3WXKA 4MDAA 1K73O 1RDUA 4BR5A 1JCFA 3D2EA 1YJ9N 5C0YA 1XQSC 2HF3A 3RSEA 4A57A 4KH5A 1WOQA 2YHXA 5E84A 5E26A 1M1KO 3HI0A 5AFUH 5M1OA 4B1VA 5JICA 1S72N 1BUPA 2P9KB 4PHTX 2QA4N 4IXCA 4WFBL 5BN8A 2H3GX 4BC4A 3A5LC 3O9QA 1VQ5N 3MMVA 3DAWA 3R3LA 2BUPA 3W3DA 2NRXA 4PKHA 3CQXA 3FLCO 3KWGA 4IOXA 3H6EA 2HBMA 4WQ5A 4H5NA 4QS7A 4CZGA 5FPMA 4BRAA 5M1KA 4XH5A 4PKIA 1K9MO 4BR0A 4H0OA 3MX5A 3QFUA 3AARA 3CCLN 4MO5A 1HKBA 5JVHL 3CQYA 2GEMA 3OBYA 3O8MA 5AQMA 5BR9A 3D2FB 1T3VA 4BRNA 1ZXOA 3CPWM 3A8YA 4YOXA 3TTDA 4PL8A 3CC7N 1V4SA 4A5AA 4BRKA 4WCEL 2I7PA 3WT0A 3WXMB 3FZHA 4BVOA 3M5RA 4MLHA 5AQOA 3G6EN 1VQNN 4G9ZA 3GOIA 1SZ2A 3TSQA 2D0PA 3MCAB 1QVFM 3DLLL 3CC2N 3EE8A 3K9JA 2NRRA 5AQGA 3BF3A 2NRZA 1JJ2M 5AZJB 3U9ZA 4WQ4C 5AQVA 4BRDA 3HBTA 2P9NA 3LDLA 4Y0WA 5AQIA 1JCEA 2KLAA 3ZX0A 3M3ZA 5BPNA 4YOYA 2E1ZA 1BA1A 4WQ4A 4CZLA 2GELA 1BOTO 3VEYA 3F9MA 1HPMA 1NGFA 1HUXA 4FOEA 4JD2B 3TPQA 1J6ZA 5KQ8A 4DB3A 5EOYA 3CMAN 3I55N 2NRHA 1BG3A 1RGIA 4FWOA 3FE1A 2Q0UA 3M6GA 1MWKA 1T44A 2QXLA 2AP1A 3DXMB 3CERA 4JKEA 3QICA 2P9LA 5GAGP 1KAZA 1DKGD 4FWMA 3CCEN 2Q97A 5EVZA 5AQUA 2FF3B 3PIOL 3H3NO 3DXKA 1EQYA 4CZFA 2HOEA 3R9PA 5AQTA 3PIPL 4JNEA 4BRIA 4FPAA 2ZWHA 5AR0A 1Q18A 1Z6RA 2EWSA 4HTLA 3EKUA 2FSJA 3NVMA 4ILJA 5KPRA 1HJOA 3TTCA 1G99A 3ZETA 2HF4A 2VWBA 4BE7B 1GLLO 4CZHA 3E66A 3QB0A 2D4WA 4K41A 4DCHA 4IJNA 3TU5A 4RWTA 4B1YB 1YJNN 1NGCA 2A40A 5H1SQ 2NZTA 4FSVA 5CHIA 5EX5A 4YORA 5CR4A 4JHDA 4BGBA 5M1FA 1YITN 1Q81O 4IOAL 1Z05A 4BRLA 1YHQN 2PBDA 2WUSA 3A0IX 4JK7A 5AQXA 5ADXH 3LDQA 2E2PA 1NGDA 3AGRA 1QZ6A 4FWRA 4I6MA 4JKAA 3VF2A 3SAHA 3LDPA 3OHRA 2ZGZA 5BRFA 1C0GA 3HSCA 3SBGA 2ZF5O 2P9UB 3VERA 2YX6A 5BPMA 2HBKA 2CH5A 3AAQA 1KXPA 3CCJN 2QI2A 2A6AA 1YI2N 1NGJA 1U2VA 3F5TA 3ULEB 1VQON 3B8AX 3HTVA 4AM6A 3CC4N 3IKMA 1LCUA 1U6ZA 3UKUA 5GADP 3OW2M 4DKWA 1VQ6N 5GAEP 2KKZA 1OKJA 2P9SA 4GNIA 4IJAA 3NVKA 1JCGA 2WC9A 4OPHA 1MWMA 3VENA 3P4IA 2D1KA 4DHYA 4H0VB 4CZEA 3BEXA 4IO8A 3FR0A 3L6QA 4K43A 1NWKA 4IEEA 4JKCA 2YHYA 5ELZA 4GY2B 3Q7CA 4CZMA 4YOWA 4AF1A 1W2BM 1XUPO 3O80A 3T69A 4FOIA 1YIJN 2P9KA 3NMUA 4H03B 2CGLA 4BRHA 5MLCQ 3TSUA 5BREA 4CZKA 1YUWA 4IOCL 4EHTA 2C1GA 2P9IA 4B1UB 4C1NI 4ILHA 3EE9A 4PL7A 3J7ZO 3T7ZA 4GVEA 4OO1J 2PFUA 2GWJA 3LDOA 3G71N 4O8KA 5AQPA 3C7NB 5AQFA 3J8AA 2P9IB 5M1QA 4BGAA 3FZLA 5F2RA 3HOSA 4XJXA 4ISEA 1GLFO 5GIOA 3JXUA 4H0PA 4H0YB 3CI5A 1SS6A 4MLEA 4WFNL 3D2FA 4ISFA 4JKBA 2RHKA 5F1XA 3AGKA 1VQ9N 4IZ9A 1NBWA 1S3XA 4JKFA 5TKWA 4CD1A 4CJ7A 4Z94A 2OTLN 4CBXA 3C65A 3P38A 1GLDG 5C2DA 3VPZA 3SAGA 5DM7L 3MN5A 3ZEUB 4EHUA 2IVNA 1Q7YO 3AAPA 3QFPA 5BPLA 5FPEA 2W40A 4NO7A 4PKGA 4GV3A 3ATVA 5FPNA 2FLOA 3UKRB 1K8KB 5AZJA 5GAHP 1NGEA 1HKGA 2HSTA 2QWQA 2GTDA 4IEIA 3FGUA 2NNWA 3CJ7A 4BG8A 4BG9A 3MN9A 2QW9A 1NGGA 5AQNA 4IDHA 1KQSM 1VQKN 2CGKA 3O9UA 5AQRA 1GLBG 5JVGL 4C1NK 2PAVA 3VF6A 3I33A 4JD2A 4BRGA 1X9JA 3HM8A 3MN6A 3H46O 2E1YA 1DT9A 1VQ4N 3SBTA 3KWIA 4YOTA 1E4GT 3KHYA 2JWKA 4BQZA 4B1WB 3BUZB 1GLEG 1GLAG 1Y64A 3DXMA 2E88A 3U9DA 4BR7A 4BEBA 2HMPA 3P31A 3SAFA 4M63C 4RTFD 3LM9A 1BU6O 3CPEA 1ATSA 2NRVA 3K9KA 4M7YA 4EAHD 2Q36A 4FWQA 4BREA 4WFAL 3CCUN 3A5OC 1HLUA 1E4FT 1NGBA 3IFRA 5B8HA 1ESVA 4BRQA 1VQ8N 3MWPA 3W0LA 3HRGA 3CIPA 3D6RA 1ILYA 5BRDA 3FZKA 3A5NC 4JKGB 1YJWN 2RE2A 2BTFA 1K8AO 5LJWA 1HKCA 2ASOA 5CE3A 3A5MC 1MDUB 5C2FA 2C1IA 5AZIB 3CJCA 3FZFA 4FO0A 2VYPA 2YJFA 4C23A 5DM6L 3EL2A 3GG4A 3KZBA 3VTHA 3FFKB 3QBWA 5EY4A 2A41A 2OANA 2YHWA 3VESA 1TYQB 3ZX3A 3GDQA 4KH6A 3VEZA 2W41A 1M90O 4FPBA 2FXUA 3CF5L 4HWIA 1QQOA 3CD6N 1TUUA 3Q7BA 1T6DA 1IG8A 1X3NA 4BR9A 5GIPA 5M1NA 2ITMA 3L4QA 3ENBA 2F7TA 2P9UA 2V7ZA 3O9TA 1ZC6A 4GV9A 1Q86O 2YI1A 1IJJA 2IIRA 3HZ6A 3OA9A 4NLCA 5AQSA 3ULEA 1HX1A 1YXQA 3DWLA 3LDNA 4CD3A 3IMXA 1NGIA 4OPAA 4B1XB 3DJCA 1WUAA 4B1ZA 5F0XA 4GV6A 3E9PA 1SAZA 4JKHA 4NB4A 3CHWA 1NM1A 1P90A 3CCSN 3UB5A 4JEPA 1GLJO 4DQ8A 2VCPA 1VQ7N 4EIAA 2NLXA 4BECA 2W00A 1RDWX 4A2BA 1BA0A 3D7EO 5AQWA 3R8EA 1KAYA 2QWOA 4FL9A 4BRCA 3QMLA 4XH1A 4CBWA 1ATNA 3QDKA 1DGKN 5AQZA 1EO1A 3R1XA 3BF1A 1T6CA 1V4TA 2ZGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGM A;  3O5B A;  5KPT A;  4K25 A;  4KBO A;  3WQU A;  3C7N A;  3L4I A;  2E8A A;  4FWN A;  4BR4 A;  4CBU A;  2IVO A;  3ENH A;  3WEE B;  2FSK A;  1S22 A;  5LJV A;  3IDH A;  1KAX A;  4XEI A;  4ISG A;  2GUP A;  5AFU A;  1QHA A;  4BC2 A;  5TKY A;  1RFQ A;  3KVG A;  3GE1 A;  3EN9 A;  3VOV A;  3LM2 A;  3ZEU A;  3O4W A;  3D2E B;  3UE5 A;  1QZ5 A;  1SQK A;  5BRH A;  3RSE B;  4WQ5 C;  3VET A;  3UKR A;  1K8K A;  3VGK A;  5LY3 A;  2FSN A;  2E2N A;  1P8Z A;  2GWK A;  3VEV A;  3H45 C;  3G25 A;  3SMP A;  1CZA N;  1ZBS A;  3WXJ A;  2UYT A;  2I7N A;  2YJE A;  2QWR A;  3ATU A;  2ASP A;  3O1W A;  5AQH A;  4BRF A;  4MO4 A;  5AQQ A;  3L0Q A;  2F9W A;  3R6M A;  2Q2R A;  5FPD A;  4H0X B;  3WUH A;  3EZW A;  2D0O A;  2V7Y A;  3U8X A;  4IWV A;  4QS8 A;  2E2O A;  4FWL A;  4LC9 B;  4BC3 A;  1NGA A;  3CJB A;  2A5X A;  1QQM A;  4H0T B;  1MA9 B;  2KHO A;  2QWM A;  3S41 A;  3JS6 A;  4BRM A;  3SK3 A;  4CZJ A;  3O1B A;  4EFH A;  2QM1 A;  2DPN A;  1NGH A;  4BQL A;  3H1V X;  4FWS A;  5AQK A;  5I9E B;  5AZI A;  5AQY A;  2QWL A;  3LL3 A;  2Q1N A;  2P9N B;  1TUY A;  2A3Z A;  4XH4 A;  1TYQ A;  4E1J A;  3U4L A;  3SLC A;  4RCH A;  3I8B A;  4QS9 A;  2E2Q A;  2FF6 A;  3MK6 A;  3ZX2 A;  2Q31 A;  2V52 B;  4F9O A;  4FWK A;  5AQJ A;  1BO5 O;  2QWP A;  5BN9 A;  3VGL A;  3VEX A;  3CJ1 A;  1X3M A;  4A62 A;  4BRP A;  4O5F A;  4CI6 A;  2P9L B;  3EKS A;  3EO3 A;  1QQN A;  2QWN A;  3ID8 A;  2CGJ A;  4BC5 A;  4YDU C;  1LOT B;  3DXK B;  1BWF O;  2YCH A;  3GL1 A;  3ENO A;  1BDG A;  4H5W A;  3H1Q A;  4B9Q A;  5ADX A;  1NMD A;  3WQT A;  1YAG A;  3MCP A;  4AM7 A;  4A61 A;  3AY9 A;  4CZI A;  3FZM A;  4YDU A;  2F9T A;  2P9P A;  3ZET B;  1YVN A;  4H5R A;  5AQL A;  3VEW A;  1D4X A;  3CJ9 A;  1NLV A;  3QBX A;  2P9P B;  3H3O B;  4H5T A;  4JHD B;  3GBT A;  4BRO A;  5JLH A;  3O6W A;  2ASM A;  2Q0R A;  2V51 B;  3SMS A;  3VEO A;  4WYB A;  3WXL A;  5JMV A;  4I6M B;  2A42 A;  2CH6 A;  1H1V A;  5KPZ A;  3MDQ A;  1C0F A;  1DEJ A;  2IVP A;  3CJA A;  4H5V A;  1ATR A;  4BR2 A;  1GLC G;  3MN7 A;  1XC3 A;  2AA4 A;  4JN4 A;  1U2V B;  5EXW A;  3WEE A;  3M1F A;  4M7X A;  5JLF A;  2E20 A;  3O08 A;  3UKU B;  5KQD A;  4FWP A;  4JAX A;  4K42 A;  2P9S B;  3C0B A;  3WXI A;  2J4R A;  3BP8 A;  1R59 O;  4L3Q A;  3IUC A;  4BVP A;  3VF4 A;  3CET A;  4J8F A;  3SJH A;  4A2A A;  3WXK A;  4BR5 A;  1JCF A;  3D2E A;  1XQS C;  2HF3 A;  3RSE A;  1WOQ A;  2YHX A;  5E84 A;  5E26 A;  3HI0 A;  5AFU H;  5JIC A;  4B1V A;  1BUP A;  2P9K B;  4IXC A;  5BN8 A;  2H3G X;  4BC4 A;  3A5L C;  3MMV A;  3DAW A;  2BUP A;  3W3D A;  4PKH A;  3CQX A;  3FLC O;  3H6E A;  4WQ5 A;  4H5N A;  4QS7 A;  4CZG A;  5FPM A;  4BRA A;  4XH5 A;  4PKI A;  4BR0 A;  4H0O A;  3QFU A;  3AAR A;  4MO5 A;  1HKB A;  3CQY A;  2GEM A;  3O8M A;  5AQM A;  5BR9 A;  3D2F B;  4BRN A;  1ZXO A;  3A8Y A;  4PL8 A;  1V4S A;  4BRK A;  2I7P A;  3WT0 A;  3FZH A;  4BVO A;  5AQO A;  4MLH A;  3GOI A;  1SZ2 A;  2D0P A;  5AQG A;  3BF3 A;  5AZJ B;  3U9Z A;  4WQ4 C;  5AQV A;  4BRD A;  3HBT A;  2P9N A;  3LDL A;  4Y0W A;  5AQI A;  1JCE A;  3ZX0 A;  3M3Z A;  5BPN A;  2E1Z A;  1BA1 A;  4WQ4 A;  4CZL A;  2GEL A;  1BOT O;  3VEY A;  3F9M A;  1HPM A;  1NGF A;  1HUX A;  4FOE A;  4JD2 B;  3TPQ A;  1J6Z A;  5KQ8 A;  4DB3 A;  5EOY A;  2NRH A;  1BG3 A;  1RGI A;  4FWO A;  3FE1 A;  2Q0U A;  3M6G A;  1MWK A;  1T44 A;  2QXL A;  2AP1 A;  3DXM B;  3CER A;  3QIC A;  2P9L A;  1KAZ A;  1DKG D;  4FWM A;  2Q97 A;  5EVZ A;  5AQU A;  2FF3 B;  3H3N O;  3DXK A;  1EQY A;  4CZF A;  2HOE A;  3R9P A;  5AQT A;  4JNE A;  4BRI A;  4FPA A;  2ZWH A;  5AR0 A;  1Q18 A;  1Z6R A;  2EWS A;  4HTL A;  3EKU A;  2FSJ A;  5KPR A;  1HJO A;  1G99 A;  3ZET A;  2HF4 A;  2VWB A;  1GLL O;  4CZH A;  3QB0 A;  2D4W A;  4K41 A;  4DCH A;  4IJN A;  3TU5 A;  4RWT A;  4B1Y B;  1NGC A;  2A40 A;  2NZT A;  4FSV A;  5EX5 A;  4BGB A;  4JHD A;  1Z05 A;  4BRL A;  2PBD A;  2WUS A;  3A0I X;  5AQX A;  5ADX H;  3LDQ A;  2E2P A;  1NGD A;  1QZ6 A;  4FWR A;  4I6M A;  3VF2 A;  3LDP A;  3OHR A;  2ZGZ A;  5BRF A;  1C0G A;  3HSC A;  2ZF5 O;  2P9U B;  3VER A;  5BPM A;  2CH5 A;  3AAQ A;  1KXP A;  2A6A A;  1NGJ A;  1U2V A;  3ULE B;  3B8A X;  3HTV A;  4AM6 A;  1LCU A;  1U6Z A;  3UKU A;  1OKJ A;  2P9S A;  4GNI A;  4IJA A;  1JCG A;  1MWM A;  3VEN A;  3P4I A;  2D1K A;  4DHY A;  4H0V B;  4CZE A;  3BEX A;  4IO8 A;  3FR0 A;  3L6Q A;  4K43 A;  1NWK A;  2YHY A;  5ELZ A;  4GY2 B;  4CZM A;  1XUP O;  3O80 A;  4FOI A;  2P9K A;  4H03 B;  2CGL A;  4BRH A;  5BRE A;  4CZK A;  1YUW A;  4EHT A;  2P9I A;  4B1U B;  4PL7 A;  2GWJ A;  3LDO A;  4O8K A;  5AQP A;  3C7N B;  5AQF A;  3J8A A;  2P9I B;  4BGA A;  3FZL A;  5F2R A;  4ISE A;  1GLF O;  3JXU A;  4H0P A;  4H0Y B;  3CI5 A;  4MLE A;  3D2F A;  4ISF A;  5F1X A;  4IZ9 A;  1NBW A;  1S3X A;  4CD1 A;  4CJ7 A;  4Z94 A;  4CBX A;  1GLD G;  3VPZ A;  3MN5 A;  3ZEU B;  4EHU A;  2IVN A;  3AAP A;  3QFP A;  5BPL A;  5FPE A;  2W40 A;  4NO7 A;  4PKG A;  3ATV A;  5FPN A;  2FLO A;  3UKR B;  1K8K B;  5AZJ A;  1NGE A;  1HKG A;  2QWQ A;  2GTD A;  3FGU A;  4BG8 A;  3CJ7 A;  4BG9 A;  3MN9 A;  2QW9 A;  1NGG A;  5AQN A;  2CGK A;  5AQR A;  1GLB G;  2PAV A;  3VF6 A;  3I33 A;  4JD2 A;  4BRG A;  1X9J A;  3HM8 A;  3MN6 A;  3H46 O;  2E1Y A;  1E4G T;  3KHY A;  4BQZ A;  4B1W B;  3BUZ B;  1GLE G;  1GLA G;  1Y64 A;  3DXM A;  2E88 A;  3U9D A;  4BR7 A;  2HMP A;  4M63 C;  4RTF D;  3LM9 A;  1BU6 O;  1ATS A;  4M7Y A;  4EAH D;  2Q36 A;  4FWQ A;  4BRE A;  3A5O C;  1HLU A;  1E4F T;  1NGB A;  3IFR A;  5B8H A;  1ESV A;  4BRQ A;  3W0L A;  3CIP A;  5BRD A;  3FZK A;  3A5N C;  2BTF A;  5LJW A;  1HKC A;  2ASO A;  5CE3 A;  3A5M C;  1MDU B;  5AZI B;  3CJC A;  3FZF A;  4FO0 A;  2VYP A;  2YJF A;  4C23 A;  3EL2 A;  3GG4 A;  3KZB A;  3FFK B;  3QBW A;  5EY4 A;  2A41 A;  2OAN A;  2YHW A;  3VES A;  1TYQ B;  3ZX3 A;  3GDQ A;  3VEZ A;  2W41 A;  4FPB A;  2FXU A;  4HWI A;  1QQO A;  1TUU A;  1T6D A;  1IG8 A;  1X3N A;  4BR9 A;  2ITM A;  2V7Z A;  2P9U A;  1ZC6 A;  2YI1 A;  1IJJ A;  2IIR A;  3HZ6 A;  5AQS A;  3ULE A;  1HX1 A;  1YXQ A;  3DWL A;  3LDN A;  4CD3 A;  3IMX A;  1NGI A;  4B1X B;  3DJC A;  1WUA A;  4B1Z A;  5F0X A;  1SAZ A;  4NB4 A;  3CHW A;  1NM1 A;  3UB5 A;  1GLJ O;  4DQ8 A;  2VCP A;  4EIA A;  2NLX A;  1RDW X;  4A2B A;  1BA0 A;  3D7E O;  5AQW A;  3R8E A;  1KAY A;  2QWO A;  4FL9 A;  4BRC A;  3QML A;  4XH1 A;  4CBW A;  1ATN A;  3QDK A;  1DGK N;  5AQZ A;  3BF1 A;  1T6C A;  1V4T A;  2ZGY A; 
#chains in the Genus database with same CATH topology
 3J81 O;  3RMD A;  3O5B A;  2XRI A;  1LW2 A;  4O55 A;  2E8A A;  3AO3 A;  3OYD A;  4DWI A;  1KLN A;  4DU3 A;  4KHP K;  4JRQ A;  1KCF A;  4PQU A;  4XEI A;  1U45 A;  4OLA A;  3L3V A;  3CQ8 A;  4CFD A;  4NYF A;  4AHR A;  3CCQ N;  2HMI A;  3VQP A;  1MU2 A;  5HLF A;  3C6A A;  3KVG A;  3F2K A;  3ZEU A;  1A5W A;  3O4W A;  3D2E B;  2XY5 A;  4CIG A;  1TK5 A;  2VQE K;  1TK8 A;  1EET A;  1P8Z A;  3SYZ A;  5HRR A;  3G25 A;  1KC8 O;  3MEC A;  3NH2 A;  1FKO A;  2D0A A;  1B9D A;  2I7N A;  2OTJ N;  2ASP A;  1VQP N;  2F9W A;  3S5T A;  3DYA A;  3THY A;  2IAJ A;  1VQL N;  3ZSV A;  4FVM A;  4JI5 K;  3KLE A;  4BDZ A;  3QEV A;  4QS8 A;  3CCM N;  4LC9 B;  4BC3 A;  1C1C A;  3CJB A;  1J54 A;  2A5X A;  1SKW A;  1WSJ A;  1KVA A;  1NJI O;  3O1B A;  1VSF A;  2QM1 A;  3TSP A;  2DPN A;  1N33 K;  5I9E B;  4FM2 A;  3LL3 A;  2P9N B;  4L8R B;  1C1A A;  3O3G A;  4IG0 A;  1DTQ A;  3U4L A;  4RCH A;  2FF6 A;  1JXB A;  3CXC M;  3OYE A;  4CFA A;  2PY5 A;  2V52 B;  5BN9 A;  4BRP A;  4C8O A;  3V4I A;  3H08 A;  3MWT A;  5KRT A;  4O5F A;  1KVC A;  4CI6 A;  4FLX A;  4RW6 A;  3ID8 A;  2E4L A;  4DV1 K;  2KZM A;  4BC5 A;  4GW6 A;  4DF8 A;  4DV0 K;  4GKJ K;  3O9R A;  3ENO A;  3MED A;  4YOV A;  5ADX A;  2IDO A;  3WQT A;  2GV9 A;  4A61 A;  1HQE A;  5C15 A;  4DSI A;  4DTJ A;  3SPZ A;  4CEA A;  1ZBL A;  1IBK K;  2R7Y A;  1OVY A;  1U04 A;  2YNF A;  1QVG M;  3SQ1 A;  4IDK A;  3HL8 A;  4BRO A;  5JLH A;  1WSI A;  3V9Z A;  2HNZ A;  2KFZ A;  2Q0R A;  4DV2 K;  3CCV N;  3SMS A;  4WYB A;  2D0B A;  3LP3 A;  4AHC A;  3O9S A;  1H1V A;  4M3U A;  3QEI A;  4PWD A;  1CZB A;  4H4M A;  1XC3 A;  4JN4 A;  3WEE A;  3P39 A;  3VQ4 A;  3CCR N;  1LAW A;  5JLF A;  4GKK K;  3O08 A;  4B8A B;  1L3T A;  4LH4 A;  4K42 A;  3NFA A;  2A1R A;  3PO4 A;  5HBM A;  5C24 A;  3WXI A;  2NRW A;  1D8Y A;  3SJH A;  1FK9 A;  4EP4 A;  4MDA A;  1K73 O;  5C0Y A;  2YNI A;  4E0D A;  5KI6 A;  1XQS C;  1WSH A;  4A57 A;  4DV6 K;  4KH5 A;  2X6S A;  2YHX A;  2IS3 A;  4AIL C;  4B08 A;  1M1K O;  4CGI A;  5M1O A;  3PY8 A;  1BUP A;  4DFP A;  3LAM A;  4WFB L;  2H3G X;  3A5L C;  3DAW A;  3ZSY A;  2NRX A;  3FLC O;  4WQ5 A;  4ELV A;  2OYQ A;  5FPM A;  1SKR A;  3S3O A;  3QFU A;  1LV5 A;  4E7J A;  4MO5 A;  1NKB A;  4ID5 A;  5JVH L;  1T3V A;  3C94 A;  4BRN A;  3QET A;  1IKY A;  3T1H K;  4WE1 A;  3TTD A;  4PL8 A;  4J2A A;  4A5A A;  4WCE L;  1U47 A;  3WT0 A;  3M5R A;  3TSQ A;  3TR8 A;  3NAE A;  1QVF M;  2KTQ A;  3EE8 A;  3K9J A;  2NRR A;  5AQG A;  3VQC A;  3OYJ A;  4CF1 A;  1S1W A;  4BRD A;  3O4N A;  5AQI A;  4TSX A;  4Z4I A;  2KLA A;  3ZX0 A;  1JLA A;  4WQ4 A;  4HHT A;  1NMN A;  4FOE A;  3TPQ A;  4E7I A;  1T05 A;  4DMN A;  4DB3 A;  1WAF A;  4DSL A;  4FWO A;  3NF7 A;  2AJQ A;  3CER A;  3K5L A;  1KAZ A;  4DV4 K;  1X9M A;  3PIO L;  3CCE N;  1UA1 A;  3HJF A;  4JYA K;  3DXK A;  1IG9 A;  3PIP L;  1TAQ A;  4FPA A;  4BRI A;  1C0M A;  2ZWH A;  4M3T A;  1Q18 A;  3SQ0 A;  4PA1 A;  2HF4 A;  1NGC A;  5JS1 A;  5EX5 A;  4CHQ A;  4IOA L;  2PBD A;  1BL3 A;  5AQX A;  4CHY A;  1NKC A;  2O8D A;  1QZ6 A;  2ZGZ A;  1I3A A;  5KGW A;  2YX6 A;  5BPM A;  3SUQ A;  3AAQ A;  3L2V A;  2QI2 A;  2A6A A;  1YI2 N;  1NGJ A;  1U2V A;  4BDY A;  1RIL A;  4AM6 A;  3CC4 N;  3IKM A;  5GAD P;  1JL1 A;  1SUQ A;  3OW2 M;  3NGY A;  3AA5 X;  2OPP A;  3NVK A;  4Y1D A;  4OPH A;  2WC9 A;  2XO7 A;  3G0Z A;  4Z4G A;  4DHY A;  4CZE A;  4KHN A;  1N5Y A;  1XMQ K;  4IEE A;  1FXX A;  5ELZ A;  4CFB A;  2BGG A;  4CZM A;  4RW7 A;  4YOW A;  4AF1 A;  3TAB A;  5BRE A;  5J2P A;  4N5S A;  5I3U A;  4KI6 A;  3THW A;  4M42 A;  4KHW A;  4DSJ A;  3VQ9 A;  4EHT A;  3PX4 A;  3EE9 A;  4PL7 A;  4DSF A;  2G8I A;  3G71 N;  2OPS A;  5F2R A;  4XJX A;  3OYM A;  2HHU A;  2FC0 A;  4DV3 K;  4WFN L;  4ISF A;  4GV9 A;  2RHK A;  3M8Q A;  3AGK A;  4Z94 A;  1ZBF A;  1XMO K;  1ASV A;  3VPZ A;  4NYN A;  3V9S A;  4IFV A;  2IVN A;  2BAN A;  1HR0 K;  1Q8I A;  5FPE A;  3T3F A;  4CJ4 A;  4FJG A;  1NGE A;  2QWQ A;  4W5N A;  3CJ7 A;  1VRT A;  1KQS M;  1VQK N;  2CGK A;  4AHV A;  5JVG L;  4DTU A;  2PAV A;  4DLE A;  3MN6 A;  2E1Y A;  1DT9 A;  1VRU A;  2UUA K;  3SUP A;  3KHY A;  3AO4 A;  1GLA G;  3DXM A;  4KRF A;  3IS9 A;  4BEB A;  1JLF A;  2HMP A;  2IOC A;  1T8E A;  3SAF A;  2O4I A;  1BU6 O;  3CPE A;  3LZJ A;  2ITG A;  4F2S A;  5HRN A;  3NDK A;  1NGB A;  3LP0 A;  3W0L A;  3D6R A;  2O4G A;  3A5N C;  3ZLJ A;  4I2Q A;  4DR6 K;  5LJW A;  1HKC A;  5CE3 A;  3QNO A;  1S9G A;  4M3R A;  3C95 A;  3FZF A;  2HB5 A;  3EL2 A;  3KZB A;  4BWM A;  4EZ6 A;  3DM2 A;  1TYQ B;  3C6U A;  3VEZ A;  4FJI A;  1SKS A;  3MEE A;  1T6D A;  2ZQB A;  5M1N A;  2ITM A;  3L4Q A;  2V7Z A;  1ZC6 A;  1U48 A;  3OYF A;  3LP1 A;  3THX A;  3V6D A;  3G10 A;  4NLC A;  1KTQ A;  1YXQ A;  4KTW A;  4CD3 A;  3BZK A;  2X78 A;  4JLH A;  3ZT3 A;  3ZT0 A;  4JKH A;  3P1G A;  4OKK A;  3UIQ A;  3WNE A;  1NM1 A;  1TL1 A;  1LWF A;  2VCP A;  1FW6 A;  1S6Q A;  3AO2 A;  1OH8 A;  1RDD A;  4A2B A;  1WBD A;  1W0H A;  3R8E A;  3TAQ A;  3S3N A;  1E3M A;  1GOB A;  1ATN A;  3QDK A;  4N76 A;  1U49 A;  1EO1 A;  3BF1 A;  2HHV A;  3VGM A;  2UXD K;  4YOU A;  3WQU A;  1HYZ A;  4FWN A;  3LPU A;  4NXM K;  4LD0 A;  4CK2 A;  4ILG B;  2XY7 A;  4CBU A;  3E9O A;  2G8V A;  4B9T A;  4ZTF A;  2FSK A;  4DR7 K;  1S22 A;  1JLG A;  4CJK A;  1QSL A;  1Y97 A;  2GUP A;  5AFU A;  3OS2 A;  4OPJ A;  4BC2 A;  3HPO A;  5TKY A;  1A5X A;  1RFQ A;  2KQ2 A;  3B6O A;  2HHW A;  3EN9 A;  5FDL A;  3KLF A;  1J5E K;  2E6L A;  3KLG A;  3RSE B;  3I0S A;  3PSI A;  4WQ5 C;  3SCX A;  3VET A;  3UKR A;  4U7B A;  3VGK A;  5LY3 A;  2FSN A;  2E2N A;  3J80 O;  1VK0 A;  4FJJ A;  3VEV A;  1CZA N;  2BDP A;  3WXJ A;  3M8P A;  2YJE A;  2QWR A;  3RVC A;  2OCE A;  3O1W A;  4IFE A;  3PLA A;  5E41 A;  3E9L A;  4PUO A;  1N8R O;  5FPD A;  4HTU A;  4H0X B;  3WUH A;  3J7A P;  2D0O A;  2V7Y A;  3E1Y A;  1NK4 A;  2QKK A;  2E2O A;  1SV5 A;  3OBW A;  4CJ5 A;  1VHX A;  3V9W A;  1QQM A;  1NK5 A;  4EP5 A;  3DMJ A;  4JKG A;  4MFB A;  4EFH A;  2NUB A;  3G4S N;  2BH1 A;  4FWS A;  2XHB A;  5AZI A;  2QWL A;  1S9E A;  4FLT A;  2Q1N A;  3T1A A;  4X65 K;  1JLC A;  3P5J A;  5KGX A;  2RPI A;  1SL0 A;  2WTU A;  4CVN E;  4EZ9 A;  3LWL A;  4GVM A;  1W7A A;  4F9O A;  4FWK A;  5AQJ A;  2YNG A;  3VGL A;  2JLE A;  4CK3 A;  5C12 A;  3CJ1 A;  3VQ6 A;  3K0S A;  4FLW A;  4CGF A;  1HNW K;  4I9L A;  2ZJP L;  3SQ2 A;  4CEO A;  2CGJ A;  5EU7 A;  4AHU A;  4FM0 A;  4OGC A;  1BWF O;  3GL1 A;  1TL3 A;  3H1Q A;  5K14 A;  1NMD A;  4FZY A;  1T03 A;  4YDU A;  3ZET B;  4JI1 K;  4CEQ A;  2HBJ A;  5AQL A;  3KJV A;  3CYG A;  3VEW A;  3WNF A;  4FLV A;  3IG1 A;  1S6P A;  4IO9 L;  4DR4 K;  4CJQ A;  1NLV A;  1O1W A;  4JHD B;  3QER A;  3O6W A;  2ASM A;  4CED A;  2VG7 A;  3TAN A;  5JS2 A;  2F96 A;  4U67 L;  4DQQ A;  5GIN A;  2EHG A;  3RR7 A;  3ZYY X;  4UY8 O;  1DEJ A;  4ZTJ A;  4CHO A;  4DTX A;  1BCO A;  1RT3 A;  3CJA A;  3DRP A;  1ATR A;  4BR2 A;  1TKD A;  1GLC G;  3AVL A;  3VMF B;  2W6L A;  2FBY A;  4M7X A;  3CME N;  5KQD A;  1B9F A;  1ZBU A;  1BQN A;  2P9S B;  2FBX A;  2J4R A;  3B6P A;  1Q82 O;  3C6H A;  1YTA A;  3BP8 A;  1R59 O;  4L3Q A;  3IUC A;  3CET A;  4J8F A;  4K0K K;  4ID1 A;  5J2N A;  4BR5 A;  3D2E A;  1YJ9 N;  1L3U A;  3RTV A;  4LFB K;  1BCM A;  2HF3 A;  1NJZ A;  2HVI A;  1NNE A;  2QKB A;  4PHT X;  2P9K B;  4IBN A;  5BN8 A;  3O9Q A;  4LF7 K;  3NE6 A;  4H4O A;  1OH7 A;  3CM5 A;  4IOX A;  4H5N A;  4CZG A;  5M1K A;  2VQF K;  2GUI A;  4BR0 A;  4KAZ A;  3CQY A;  1EX4 A;  3OBY A;  3O8M A;  3JSM A;  5J2M A;  4HCC A;  5KTQ A;  1WSF A;  1J9A A;  5CY4 A;  4IG3 A;  3CC7 N;  1V4S A;  2I7P A;  3WXM B;  4BE0 A;  5AQO A;  4G9Z A;  1SZ2 A;  3K58 A;  2HHX A;  2D0P A;  3AVF A;  1TV6 A;  1OH6 A;  3MCA B;  5LMN K;  3DLL L;  3CC2 N;  1RDC A;  3L3U A;  4CEE A;  1HYV A;  2P9N A;  3LDL A;  3OYC A;  4DTN A;  5BPN A;  5C42 A;  1J53 A;  1F21 A;  5CYM A;  2F8T A;  1BA1 A;  4CZL A;  4DTP A;  1NGF A;  1HUX A;  4JD2 B;  1J6Z A;  1C6V A;  2HNY A;  1BG3 A;  1BQM A;  3A2F A;  3M6G A;  1MWK A;  1T44 A;  3NH0 A;  2FBV A;  4M45 A;  3QIC A;  5GAG P;  1JLQ A;  5EVZ A;  3AVI A;  3NF6 A;  3SV3 A;  1DLO A;  1RBS A;  3R9P A;  4JNE A;  2EWS A;  2QK9 A;  3F73 A;  2FSJ A;  4ILJ A;  4NCA A;  1HJO A;  2ZE2 A;  3PO5 A;  4BE7 B;  3QB0 A;  4IJN A;  3TU5 A;  4B1Y B;  3KK1 A;  2A40 A;  2UUC K;  2B4J A;  3DRR A;  4FSV A;  1NJW A;  5CHI A;  4B9L A;  4YOR A;  4N47 A;  4BGB A;  5M1F A;  3LWM A;  1Q81 O;  1Z05 A;  1WNS A;  3MAQ A;  4FCY A;  1ZBH A;  3TAF A;  1ZYQ A;  4KHU A;  3AGR A;  4FWR A;  3VF2 A;  2X74 A;  4JKA A;  3SAH A;  3OHR A;  1IKX A;  1C0G A;  1N32 K;  1ZBI A;  4FJ8 A;  3OVN A;  3SBG A;  3VER A;  1XC9 A;  2G8H A;  1YTU A;  1UOC A;  4RG8 A;  1HPZ A;  3F5T A;  3ULE B;  3ULD A;  1U6Z A;  4DKW A;  4IJA A;  3MEG A;  4LF9 K;  4V19 S;  1CZ9 A;  3HVR A;  4YNQ A;  2D1K A;  4H0V B;  4DTR A;  3BEX A;  5J1E A;  4C8K A;  1NWK A;  4JKC A;  4GY2 B;  1IV0 A;  4LFC K;  3T69 A;  4FJL A;  3VN5 A;  4DV7 K;  4BRH A;  3TSU A;  4KTQ A;  1XNR K;  2KW4 A;  4DQS A;  1BIU A;  1JL2 A;  2C1G A;  2P9I A;  5FRO A;  3OJU A;  4OO1 J;  4UQG A;  3VA0 A;  3LDO A;  4O8K A;  3C7N B;  3J8A A;  2P9I B;  4CF2 A;  3HOS A;  4DU1 A;  1GLF O;  4KB0 A;  1BI4 B;  3DLR A;  4FJH A;  3WNG A;  3RR8 A;  4JKB A;  5F1X A;  4KTZ A;  1VQ9 N;  3BZC A;  4IZ9 A;  1S3X A;  4CD1 A;  4CBX A;  3P38 A;  1GLD G;  3SZ2 A;  5DM7 L;  4AHT A;  4EHU A;  3AAP A;  3QFP A;  4FJN A;  2W40 A;  4NO7 A;  4PKG A;  4GV3 A;  4B9N A;  1RDA A;  2FLO A;  1K8K B;  1HKG A;  2GTD A;  4OVL A;  4BG8 A;  2B6A A;  2QW9 A;  4IDH A;  5FLX O;  4E3S A;  4C1N K;  3VF6 A;  3I33 A;  4FLU A;  3H46 O;  3KWI A;  4F3O A;  1E4G T;  4ELU A;  1GLE G;  2YHB A;  3RWU A;  3HVT A;  2O8F B;  3P31 A;  3HP6 A;  2X6N A;  1WB9 A;  2NRV A;  4EAH D;  4WFA L;  3A5O C;  1HLU A;  1E4F T;  3IFR A;  1RTJ A;  1ESV A;  3MWP A;  3HRG A;  2UXC K;  1D9D A;  3A5M C;  4JI2 K;  2C1I A;  3KK2 A;  3AVK A;  3CJC A;  1NJX A;  4FO0 A;  4JV5 K;  1IKW A;  3FFK B;  4DV5 K;  3QBW A;  5EY4 A;  2A41 A;  2OAN A;  3ZX3 A;  4KH6 A;  2O8E B;  3TAG A;  4JI6 K;  3J7Y P;  1M90 O;  4FPB A;  2FXU A;  1TUU A;  3Q7B A;  3SNN A;  1RT6 A;  1X3N A;  3BGR A;  4DQR A;  3ENB A;  3KD5 E;  3L2R A;  2YI1 A;  3D0P A;  4RW9 A;  4CF0 A;  3HZ6 A;  5AQS A;  4Q5V A;  1HX1 A;  3IAY A;  1X9S A;  4CGD A;  1NGI A;  1WSE A;  3SUO A;  3BY5 A;  1NOY A;  4B1X B;  5HP1 A;  3ZT1 A;  1XWL A;  3I0R A;  4B1Z A;  1C0T A;  4RW8 A;  4GV6 A;  4NB4 A;  1ITG A;  3ZSX A;  3CCS N;  4K8Z A;  3UB5 A;  2O8B A;  3V1R A;  1VQ7 N;  4EIA A;  2PZS A;  3ASM A;  1RDW X;  2O8B B;  5AQW A;  4BRC A;  4CEB A;  3EYZ A;  2F8S A;  3QML A;  3LZI A;  3SJJ A;  1FJG K;  3SPY A;  2EX3 A;  5AQZ A;  2E5L K;  3NH1 A;  3LPT A;  5BR9 A;  3OYH A;  2ZGY A;  1JLE A;  2HHH K;  5KRS A;  3L4I A;  4BR4 A;  2IVO A;  3ENH A;  3ITH A;  2O8C B;  4HVJ A;  4O5B A;  3S3M A;  5LJV A;  4KH4 A;  4ISG A;  4BY9 C;  3DLH A;  1NOZ A;  2DTU A;  3VQQ A;  4JS4 A;  3MX2 A;  3UE5 A;  1SQK A;  3QO9 A;  2KZZ A;  4A5B A;  4JI0 K;  3FFI A;  4F4K A;  2GWK A;  5C10 A;  1S1X A;  3SMP A;  4BAC A;  3DLK A;  4YFU A;  2VGM A;  3DRS A;  5J2Q A;  3LAL A;  3ATU A;  5AQH A;  2G8K A;  3DLE A;  2UUB K;  3K5O A;  1N36 K;  5AQQ A;  2VWK A;  1KD1 O;  3L0Q A;  3RRH A;  1W97 L;  3N4P A;  4DR2 K;  3DOK A;  3KKS A;  3R6M A;  5CZ1 A;  3V1Q A;  3EZW A;  3K57 A;  4B3S K;  3N4Q A;  4W5R A;  4H8K A;  3OYN A;  2WFB A;  4IWV A;  3VQD A;  3O3F A;  3EEQ A;  4FWL A;  3DOL A;  4R5P A;  1NGA A;  1TKX A;  2QWM A;  3V9X A;  3S41 A;  4HUG A;  2P5G A;  4E1N A;  3TTF A;  3SK3 A;  4HCB A;  3H1V X;  3LDS A;  5AQK A;  4CIE A;  1TYQ A;  2HHT A;  4CW7 B;  3I8B A;  4QS9 A;  2E2Q A;  2UU9 K;  1RBT A;  4ICL A;  4OJR A;  4I7F A;  4CJU A;  3AA2 A;  4B9S A;  2YV0 X;  4BE2 A;  4DQP A;  3VEX A;  3ZCM A;  2ZM6 K;  4RW4 A;  4KI4 A;  3U6F A;  4WF9 L;  2P9L B;  3EO3 A;  2QWN A;  5HRO A;  1N34 K;  1G15 A;  1C1B A;  4I9Q A;  5HL7 L;  2IC3 A;  1LOT B;  2YCH A;  3ZSQ A;  4KV8 A;  4GMJ B;  1L5U A;  1Q9X A;  2QTD A;  1TK0 A;  4AM7 A;  3AO5 A;  3L2U A;  3AY9 A;  1Z26 A;  3FZM A;  3NGZ A;  2F9T A;  4CJP A;  1YVN A;  4FJK A;  1D4X A;  3CJ9 A;  3CG7 A;  3H3O B;  4H5T A;  1O13 A;  2W6K A;  3HOT A;  2V51 B;  2JGU A;  3HPH A;  3VEO A;  1IBL K;  4DUY K;  4JK8 A;  4I6M B;  2A42 A;  5KPZ A;  1OVQ A;  3MDQ A;  3THV A;  2IVP A;  4H5V A;  5HOO A;  4JS5 A;  3MN7 A;  3LAK A;  4QCL A;  4FJX A;  1YF5 L;  5EXW A;  3M1F A;  3UKU B;  4FWP A;  4JAX A;  3VQ5 A;  1IH7 A;  3AVB A;  4BVP A;  3VF4 A;  1YVU A;  2HHQ A;  4NLB A;  3SV4 A;  1RDU A;  1JCF A;  3RSE A;  4DUZ K;  1WOQ A;  5E84 A;  5E26 A;  3HI0 A;  4B1V A;  4O0J A;  1S72 N;  4CGH A;  4IXC A;  1HNZ K;  4ZHR A;  1HMV A;  4BC4 A;  1VQ5 N;  3W3D A;  4CF8 A;  3OS0 A;  1U4B A;  4B9M A;  3CQX A;  3KWG A;  2HBM A;  4ELT A;  1UA0 A;  4XH5 A;  4PKI A;  1K9M O;  4H0O A;  3MX5 A;  3CCL N;  1HKB A;  2GEM A;  2Q3S A;  4B3R K;  1ASW A;  5AQM A;  3QEX A;  3D2F B;  1HNX K;  1ZXO A;  3CPW M;  2YHA A;  3A8Y A;  4KHS A;  4F3T A;  4KB1 A;  3QES A;  1SL2 A;  3FZH A;  1QSY A;  3CFO A;  4MLH A;  4DFK A;  1VQN N;  2OA8 A;  5JEN A;  1BGX T;  3BF3 A;  1JJ2 M;  5AZJ B;  4WQ4 C;  5AQV A;  4C8N A;  3TAM A;  3AVN A;  3HBT A;  3RMA A;  1BIZ A;  1JCE A;  4YOY A;  2E1Z A;  4MQ3 A;  4OX9 K;  3HO1 A;  2GEL A;  3VEY A;  3F9M A;  1HPM A;  4CE9 A;  3M8R A;  1IKV A;  3ZSZ A;  1WLJ A;  3T19 A;  3I55 N;  1I39 A;  1RGI A;  4XIU A;  4CF9 A;  2Q0U A;  3F9K A;  2QXL A;  3QNN A;  2AP1 A;  4JKE A;  1DKG D;  4FWM A;  2Q97 A;  4Z4H A;  2OPR A;  1BIS A;  2HND A;  4YHH K;  1EQY A;  3TAR A;  1B92 A;  1T7P A;  5AR0 A;  3EKU A;  3NVM A;  4QAG A;  4DS5 A;  1KFD A;  1G99 A;  3ZET A;  4OLB A;  2VWB A;  2LSN A;  4CZH A;  3E66 A;  5T7B A;  4RWT A;  1NK6 A;  4M3W A;  5H1S Q;  3AA4 A;  4JHD A;  3AVC A;  4BRL A;  2YKM A;  3A0I X;  1Q9Y A;  1LWE A;  5ADX H;  3AVJ A;  3OYI A;  1TKT A;  5SWM A;  4B3O A;  4LF4 K;  3LDP A;  1EWQ A;  2ZF5 O;  2P9U B;  2CH5 A;  3QEP A;  3CCJ N;  3HK2 A;  1VQO N;  4NCG A;  3DI6 A;  1LCU A;  2G8W A;  5GAE P;  1WSG A;  2P9S A;  4GNI A;  4CEZ A;  3KK3 A;  3K5N A;  1JCG A;  1MWM A;  3VEN A;  1EWR A;  1LWC A;  4CK1 A;  3L8B A;  3HT3 A;  2YHY A;  4CHZ A;  3Q7C A;  3CYM A;  4FOI A;  1REV A;  1YIJ N;  2P9K A;  4H03 B;  3KTQ A;  3OY9 A;  1W9H A;  3OYB A;  2XY8 A;  5LL6 Z;  1X9W A;  4IOC L;  1EKE A;  4DS4 A;  4C1N I;  3TWH A;  4Z4C A;  3T7Z A;  4GVE A;  2PFU A;  2PYJ A;  5AQP A;  2ETJ A;  4JI4 K;  3U3G A;  4BGA A;  3FZL A;  4B3M K;  4FM1 A;  1QSS A;  5GIO A;  2ZD1 A;  4H0P A;  2YNH A;  3CFR A;  1SS6 A;  4E72 A;  3D45 A;  2Z1I A;  3K2P A;  4K8X A;  1CXU A;  5D3G A;  3PUF A;  5TKW A;  3C65 A;  5C2D A;  2P1J A;  3ZT2 A;  3SAG A;  3MN5 A;  3AVA A;  3ZEU B;  1S5J A;  3E01 A;  5BPL A;  1VSL A;  3I8D A;  4CEF A;  3ZT4 A;  1NJY A;  4DTM A;  2HST A;  3ISN C;  4FK0 A;  4IEI A;  3JYT A;  2NNW A;  4BDP A;  4JI7 K;  1NGG A;  5AQN A;  4F2R A;  4CFC A;  4JI8 K;  1IO2 A;  3O9U A;  1GLB G;  4CJ3 A;  4PY5 A;  1KRP A;  4JD2 A;  1X9J A;  4N41 A;  2WOM A;  3SBT A;  5I42 A;  4YOT A;  3THY B;  1KLM A;  4B1W B;  3BUZ B;  3AV9 A;  3QIP A;  5HRS A;  4BR7 A;  2E88 A;  4CJF A;  1TVR A;  3AO1 A;  1RDB A;  4M63 C;  4RTF D;  3LM9 A;  1KFS A;  3K9K A;  4M7Y A;  4CJT A;  3LP2 A;  1EXQ A;  2W42 A;  1VQ8 N;  1D5A A;  3C6T A;  1LW0 A;  4O44 A;  1ILY A;  3FZK A;  2BTF A;  2ASO A;  1MDU B;  5C2F A;  2IGI A;  4CJL A;  1WN7 A;  1N6Q A;  4C23 A;  2VYP A;  2YJF A;  4C8M A;  3GG4 A;  4FLY A;  3HM9 A;  3GDQ A;  2P5O A;  4OKE A;  4QOZ B;  3CF5 L;  4HWI A;  4CJS A;  1GOA A;  5GIP A;  4N56 A;  2DY4 A;  3O9T A;  4Z0U A;  3QIO A;  3ULE A;  4KFB A;  3VA3 A;  3KIO A;  5DK5 A;  3E9P A;  1QHT A;  1SAZ A;  1K6Y A;  1S1U A;  4E7H A;  1LAV A;  4E19 A;  1P90 A;  3VQ8 A;  2VG6 A;  4FJ5 A;  2B5J A;  2W00 A;  1BA0 A;  3D7E O;  2QWO A;  4AQY K;  4FYD A;  4CBW A;  1RT5 A;  4CER A;  3PX6 A;  2FBT A;  3PV8 A;  3R1X A;  1BO5 O;  4FWQ A;  4DFJ A;  4DF4 A;  4OGE A;  5KPT A;  4K25 A;  4KBO A;  3OYL A;  3OYA A;  1QQC A;  3C7N A;  2QEX N;  3NGI A;  2DFF A;  3TI0 A;  3WEE B;  1WBB A;  3PSF A;  1BI4 A;  3IDH A;  1KAX A;  1QHA A;  4LSL A;  3SQ4 A;  3MXM A;  2QXF A;  2GBZ A;  1NU0 A;  4B9V A;  3GE1 A;  3VOV A;  3LM2 A;  5M1P A;  4HUE A;  1QZ5 A;  4A59 A;  1VQM N;  5BRH A;  4M41 A;  3PX0 A;  3VQE A;  4B9U A;  4M3X A;  1K8K A;  4JK9 A;  2VGN A;  3ZSR A;  1RBV A;  4O0I A;  4E7K A;  3ID6 A;  3H45 C;  4CCH A;  5IWA K;  4J2D A;  1ZBS A;  2HBL A;  2UYT A;  2G8U A;  2GX9 A;  3VTI A;  3ALY A;  3OJS A;  4BRF A;  4MO4 A;  4X64 K;  1RT4 A;  2ATQ A;  3MXI A;  2Q2R A;  1XI1 A;  3QLH A;  3U8X A;  2NRT A;  1D9F A;  2O8F A;  1HQU A;  4LY7 A;  4H0T B;  1MA9 B;  2KHO A;  3JS6 A;  5BR8 K;  4BRM A;  4O8U A;  4CZJ A;  4CJV A;  1NGH A;  3CM6 A;  3KK7 A;  5CZ2 A;  3KKR A;  4BQL A;  4JRP A;  1NK7 A;  5IT9 O;  5AQY A;  4JI3 K;  1TUY A;  4FK4 A;  2A3Z A;  4XH4 A;  1GOC A;  4E1J A;  2O8E A;  1HNV A;  3SLC A;  1NK0 A;  4Y1C A;  3MK6 A;  4DG1 A;  3OYG A;  3ZX2 A;  2Q31 A;  2A1S A;  4JKD A;  2QWP A;  1X3M A;  4A62 A;  4R79 A;  3NBP A;  2WBN A;  3EKS A;  2P51 A;  4OPK A;  1QQN A;  1HNI A;  4YDU C;  4C8L A;  3DXK B;  4FVU A;  1OH5 A;  1BDG A;  4H5W A;  4B9Q A;  1YAG A;  3MCP A;  4KKO A;  3OTO K;  2JWL A;  2ZJR L;  4CZI A;  2P9P A;  2D0C A;  4H5R A;  4KHQ A;  3I56 N;  1VAZ A;  4O4G A;  3QBX A;  2P9P B;  2ZJQ L;  1Z25 A;  3GBT A;  3IRX A;  3V81 A;  2OZM A;  4LF8 K;  2Y1J A;  4DR1 K;  3WXL A;  3AA3 A;  2O8D B;  5JMV A;  1RNH A;  2CH6 A;  1NK9 A;  1TGO A;  2VG5 A;  2WON A;  1C0F A;  3MXJ A;  4CEC A;  4DSE A;  4Z4E A;  4MDB A;  1RTH A;  3KD1 E;  2AA4 A;  1U2V B;  2O8C A;  4DLG A;  2E20 A;  2F4V K;  1RCH A;  3C0B A;  1NG9 A;  4DSK A;  4W5Q A;  1RTD A;  1C0U A;  2Z1G A;  1HRH A;  3M8S A;  3TAE A;  4A2A A;  4CHN A;  3WXK A;  1QTM A;  2VWJ A;  1IBM K;  4DU4 A;  5AFU H;  5JIC A;  4CJE A;  2QA4 N;  3EY1 A;  5DMR A;  1S1V A;  3THW B;  3MMV A;  5SZT A;  3HXM A;  3R3L A;  4DTO A;  2BUP A;  4KRE A;  1EP4 A;  3HST B;  4PKH A;  1KSP A;  3QEW A;  3VQ7 A;  3H6E A;  4FK2 A;  4QS7 A;  4BRA A;  2RN2 A;  2RF2 A;  3AAR A;  4DQI A;  2RKI A;  1VSK A;  4LFA K;  1QS4 A;  4AHS A;  1TAU A;  4YOX A;  3LAN A;  5CYQ A;  4CIF A;  3O4Q A;  4I2P A;  4BRK A;  3NCI A;  2HHI A;  4BVO A;  3G6E N;  1RBR A;  3GOI A;  1NKE A;  3NHG A;  1X1P A;  4M3Y A;  4CGJ A;  4DR3 K;  4FZZ A;  1JKH A;  4FJM A;  2NRZ A;  3U9Z A;  2Y1I A;  1S1T A;  4NXN K;  1BHL A;  4Y0W A;  3V1O A;  4LH5 A;  3M3Z A;  4B8C A;  3O3H A;  2HHS A;  2I5J A;  2E6M A;  1BOT O;  5FRM A;  1RT1 A;  3DLB A;  4CJW A;  4E89 A;  5KQ8 A;  4YY3 K;  3L2W A;  5EOY A;  3K59 A;  3CMA N;  2NRH A;  4J2E A;  3VQA A;  3FE1 A;  3DXM B;  2P9L A;  3SI6 A;  1RBU A;  1UAX A;  5AQU A;  2FF3 B;  3H3N O;  1JXE A;  4CZF A;  2HOE A;  5HRP A;  5AQT A;  1Z6R A;  3L2Q A;  1FKP A;  4HTL A;  2DFH A;  5KPR A;  2D5R A;  3TTC A;  4X62 K;  4AH9 A;  1GLL O;  2D4W A;  4K41 A;  4DCH A;  1DTT A;  3P83 D;  1YJN N;  3ZSW A;  2OPQ A;  2NZT A;  5CR4 A;  2UXB K;  5A2Q O;  1YIT N;  1YHQ N;  2WUS A;  4G1Q A;  4JK7 A;  3LDQ A;  4B3T K;  4M3Z A;  2E2P A;  1RTI A;  1NGD A;  1L3V A;  4KHY A;  1JLB A;  4I6M A;  2G8F A;  5BRF A;  3HSC A;  4KPY A;  4IKF A;  2HBK A;  1SL1 A;  3THX B;  1KXP A;  3B8A X;  3HTV A;  3RRG A;  3UKU A;  1VQ6 N;  4X66 K;  2KKZ A;  1OKJ A;  1CXQ A;  4LSN A;  1VSD A;  4FXD A;  3P4I A;  3OYK A;  2YKN A;  4IO8 A;  3FR0 A;  3L6Q A;  3V9U A;  1A5V A;  4K43 A;  3CFP A;  3VQB A;  3OS1 A;  3RMB A;  4W5O A;  3K5M A;  3SUN A;  4E7L A;  3JAM O;  1NK8 A;  1W2B M;  1XUP O;  3O80 A;  1ASU A;  3AVH A;  5MLC Q;  2CGL A;  3NMU A;  4DR5 K;  3AVG A;  3NF9 A;  4LF5 K;  4CZK A;  1XHX A;  1YUW A;  1HYS A;  4B1U B;  4ILH A;  1J5O A;  4W5T A;  3J7Z O;  1UWB A;  2GWJ A;  1VSH A;  5AQF A;  4BE1 A;  5M1Q A;  4IFY A;  4ISE A;  3HYF A;  3JXU A;  4Q0B A;  4H0Y B;  3CI5 A;  4MLE A;  3D2F A;  4CES A;  1NBW A;  4JKF A;  4CJ7 A;  2OTL N;  2OZS A;  1R0A A;  1RT2 A;  2HW3 A;  4F8R A;  4FW2 A;  3BDP A;  1Q7Y O;  4DFM A;  3ATV A;  5FPN A;  3UKR B;  5AZJ A;  5GAH P;  3FGU A;  4BG9 A;  3MN9 A;  1HJR A;  4E1M A;  5AQR A;  1YT3 A;  4BRG A;  3KLH A;  3HM8 A;  3TAP A;  1VSI A;  4CGG A;  1VQ4 N;  1I94 K;  4DTS A;  1L3S A;  2JWK A;  4BQZ A;  1Y64 A;  4KO0 A;  3U9D A;  3RMC A;  2PYL A;  4J2B A;  1ATS A;  2Q36 A;  4FW1 A;  4BRE A;  3CCU N;  1WAJ A;  5B8H A;  1CLQ A;  4BRQ A;  3CIP A;  1VSM A;  5BRD A;  3HPG A;  4CHP A;  4JKG B;  1YJW N;  2RE2 A;  1K8A O;  3QIN A;  4FJ7 A;  5AJ3 K;  3U3Y A;  2BE2 A;  5AZI B;  2Z1J A;  1XNQ K;  2HVH A;  5DM6 L;  4NCB A;  3VTH A;  3VES A;  2YHW A;  2DFE A;  3NF8 A;  1KVB A;  4FZX C;  2W41 A;  3ZSO A;  3HP9 A;  1XHZ A;  4LF6 K;  5FRN A;  1QQO A;  4CJR A;  4HUF A;  3CD6 N;  1IG8 A;  4BR9 A;  2F7T A;  2P9U A;  1Q86 O;  5LMU K;  1IJJ A;  2IIR A;  3OA9 A;  3WNH A;  5C25 A;  3DWL A;  3LDN A;  3IMX A;  4OKJ A;  4OPA A;  3DJC A;  1QE1 A;  1WUA A;  5F0X A;  3DLG A;  3S9H A;  1VSE A;  4BWJ A;  4FLZ A;  4Z4F A;  2Z1H A;  3CHW A;  1VSJ A;  4JEP A;  1GLJ O;  4DQ8 A;  2NLX A;  4BEC A;  1TKZ A;  1KAY A;  4FJ9 A;  4FL9 A;  2KFN A;  3KLI A;  4XH1 A;  3T1Y K;  1RT7 A;  3AVM A;  3EZ5 A;  2XY6 A;  1DGK N;  1T6C A;  1V4T A; 
#chains in the Genus database with same CATH homology
 3VGM A;  3O5B A;  5KPT A;  4K25 A;  4KBO A;  4YOU A;  3WQU A;  3C7N A;  3L4I A;  2E8A A;  2QEX N;  4FWN A;  4ILG B;  4BR4 A;  4CBU A;  2IVO A;  3E9O A;  3ENH A;  3WEE B;  2FSK A;  1S22 A;  5LJV A;  4KH4 A;  3IDH A;  1KAX A;  4XEI A;  4ISG A;  2GUP A;  5AFU A;  1QHA A;  4BY9 C;  4BC2 A;  3CCQ N;  5TKY A;  1RFQ A;  3C6A A;  3KVG A;  3GE1 A;  3EN9 A;  3F2K A;  3LM2 A;  3MX2 A;  3VOV A;  3ZEU A;  5M1P A;  3O4W A;  3D2E B;  3UE5 A;  1QZ5 A;  1SQK A;  4A59 A;  1VQM N;  5BRH A;  3RSE B;  4WQ5 C;  4A5B A;  3VET A;  3UKR A;  4U7B A;  1K8K A;  4JK9 A;  2VGN A;  3VGK A;  5LY3 A;  2FSN A;  2E2N A;  1P8Z A;  3ID6 A;  2GWK A;  3VEV A;  3H45 C;  5C10 A;  3G25 A;  1KC8 O;  3SMP A;  1CZA N;  1ZBS A;  2HBL A;  3WXJ A;  2UYT A;  2VGM A;  2I7N A;  2YJE A;  2OTJ N;  2QWR A;  3ATU A;  2GX9 A;  3RVC A;  3VTI A;  2ASP A;  4IFE A;  3O1W A;  5AQH A;  3PLA A;  4BRF A;  4MO4 A;  3E9L A;  5AQQ A;  1KD1 O;  3L0Q A;  1VQP N;  1W97 L;  2F9W A;  3N4P A;  1N8R O;  3R6M A;  2Q2R A;  5FPD A;  4H0X B;  3WUH A;  3EZW A;  2D0O A;  2V7Y A;  1VQL N;  3N4Q A;  3U8X A;  3E1Y A;  2NRT A;  2WFB A;  4IWV A;  4QS8 A;  2E2O A;  3CCM N;  4FWL A;  3OBW A;  4LC9 B;  4BC3 A;  1NGA A;  3CJB A;  2A5X A;  1QQM A;  4H0T B;  1MA9 B;  2KHO A;  2QWM A;  3S41 A;  3JS6 A;  4BRM A;  3TTF A;  4O8U A;  4JKG A;  3SK3 A;  4CZJ A;  3O1B A;  3TSP A;  2QM1 A;  4EFH A;  1NJI O;  2DPN A;  1NGH A;  3G4S N;  4BQL A;  2BH1 A;  3H1V X;  3KK7 A;  4FWS A;  5AQK A;  5I9E B;  5AZI A;  5AQY A;  2QWL A;  3LL3 A;  2Q1N A;  2P9N B;  1TUY A;  2A3Z A;  4XH4 A;  1TYQ A;  4E1J A;  3U4L A;  3SLC A;  4RCH A;  3I8B A;  4QS9 A;  2E2Q A;  2FF6 A;  3CXC M;  3MK6 A;  3ZX2 A;  2Q31 A;  2V52 B;  4F9O A;  4FWK A;  4JKD A;  5AQJ A;  1BO5 O;  2QWP A;  5BN9 A;  3VGL A;  3VEX A;  3CJ1 A;  1X3M A;  4A62 A;  4BRP A;  5C12 A;  3MWT A;  4O5F A;  4R79 A;  4WF9 L;  4CI6 A;  2P9L B;  2WBN A;  3EKS A;  2ZJP L;  3EO3 A;  1QQN A;  2QWN A;  3ID8 A;  2CGJ A;  5HL7 L;  4BC5 A;  4YDU C;  1LOT B;  3DXK B;  1BWF O;  4FVU A;  2YCH A;  3GL1 A;  3O9R A;  3ENO A;  1BDG A;  4YOV A;  4H5W A;  3H1Q A;  4B9Q A;  5ADX A;  1NMD A;  2QTD A;  1YAG A;  3MCP A;  3WQT A;  4A61 A;  4AM7 A;  2JWL A;  2ZJR L;  3AY9 A;  5C15 A;  4CZI A;  3FZM A;  4YDU A;  2F9T A;  2P9P A;  3ZET B;  1YVN A;  4H5R A;  2HBJ A;  5AQL A;  1OVY A;  3I56 N;  3VEW A;  1VAZ A;  4IO9 L;  1QVG M;  1D4X A;  3CJ9 A;  1NLV A;  3QBX A;  2P9P B;  2ZJQ L;  3H3O B;  4H5T A;  4JHD B;  3GBT A;  4BRO A;  5JLH A;  1O13 A;  3O6W A;  2ASM A;  3HOT A;  2Q0R A;  2V51 B;  3CCV N;  3SMS A;  3VEO A;  4WYB A;  3WXL A;  5JMV A;  4JK8 A;  4I6M B;  3O9S A;  4U67 L;  2A42 A;  2CH6 A;  5GIN A;  1H1V A;  3ZYY X;  5KPZ A;  3MDQ A;  1C0F A;  4UY8 O;  1DEJ A;  2IVP A;  3CJA A;  4H5V A;  5HOO A;  1ATR A;  4MDB A;  4BR2 A;  1GLC G;  3MN7 A;  3VMF B;  1YF5 L;  1XC3 A;  2AA4 A;  4JN4 A;  1U2V B;  3P39 A;  5EXW A;  3WEE A;  3CCR N;  3M1F A;  4M7X A;  5JLF A;  3CME N;  2E20 A;  3O08 A;  3UKU B;  5KQD A;  4FWP A;  4JAX A;  4K42 A;  2P9S B;  3C0B A;  3WXI A;  2J4R A;  1Q82 O;  2NRW A;  3BP8 A;  3C6H A;  1R59 O;  4L3Q A;  3IUC A;  4BVP A;  3VF4 A;  3CET A;  4J8F A;  3SJH A;  4A2A A;  4NLB A;  3WXK A;  4MDA A;  1K73 O;  1RDU A;  4BR5 A;  1JCF A;  3D2E A;  1YJ9 N;  5C0Y A;  1XQS C;  2HF3 A;  3RSE A;  4A57 A;  4KH5 A;  1WOQ A;  2YHX A;  5E84 A;  5E26 A;  1M1K O;  3HI0 A;  5AFU H;  5M1O A;  4B1V A;  5JIC A;  1S72 N;  1BUP A;  2P9K B;  4PHT X;  2QA4 N;  4IXC A;  4WFB L;  5BN8 A;  2H3G X;  4BC4 A;  3A5L C;  3O9Q A;  1VQ5 N;  3MMV A;  3DAW A;  3R3L A;  2BUP A;  3W3D A;  2NRX A;  4PKH A;  3CQX A;  3FLC O;  3KWG A;  4IOX A;  3H6E A;  2HBM A;  4WQ5 A;  4H5N A;  4QS7 A;  4CZG A;  5FPM A;  4BRA A;  5M1K A;  4XH5 A;  4PKI A;  1K9M O;  4BR0 A;  4H0O A;  3MX5 A;  3QFU A;  3AAR A;  3CCL N;  4MO5 A;  1HKB A;  5JVH L;  3CQY A;  2GEM A;  3OBY A;  3O8M A;  5AQM A;  5BR9 A;  3D2F B;  1T3V A;  4BRN A;  1ZXO A;  3CPW M;  3A8Y A;  4YOX A;  3TTD A;  4PL8 A;  3CC7 N;  1V4S A;  4A5A A;  4BRK A;  4WCE L;  2I7P A;  3WT0 A;  3WXM B;  3FZH A;  4BVO A;  3M5R A;  4MLH A;  5AQO A;  3G6E N;  1VQN N;  4G9Z A;  3GOI A;  1SZ2 A;  3TSQ A;  2D0P A;  3MCA B;  1QVF M;  3DLL L;  3CC2 N;  3EE8 A;  3K9J A;  2NRR A;  5AQG A;  3BF3 A;  2NRZ A;  1JJ2 M;  5AZJ B;  3U9Z A;  4WQ4 C;  5AQV A;  4BRD A;  3HBT A;  2P9N A;  3LDL A;  4Y0W A;  5AQI A;  1JCE A;  2KLA A;  3ZX0 A;  3M3Z A;  5BPN A;  4YOY A;  2E1Z A;  1BA1 A;  4WQ4 A;  4CZL A;  2GEL A;  1BOT O;  3VEY A;  3F9M A;  1HPM A;  1NGF A;  1HUX A;  4FOE A;  4JD2 B;  3TPQ A;  1J6Z A;  5KQ8 A;  4DB3 A;  5EOY A;  3CMA N;  3I55 N;  2NRH A;  1BG3 A;  1RGI A;  4FWO A;  3FE1 A;  2Q0U A;  3M6G A;  1MWK A;  1T44 A;  2QXL A;  2AP1 A;  3DXM B;  3CER A;  4JKE A;  3QIC A;  2P9L A;  5GAG P;  1KAZ A;  1DKG D;  4FWM A;  3CCE N;  2Q97 A;  5EVZ A;  5AQU A;  2FF3 B;  3PIO L;  3H3N O;  3DXK A;  1EQY A;  4CZF A;  2HOE A;  3R9P A;  5AQT A;  3PIP L;  4JNE A;  4BRI A;  4FPA A;  2ZWH A;  5AR0 A;  1Q18 A;  1Z6R A;  2EWS A;  4HTL A;  3EKU A;  2FSJ A;  3NVM A;  4ILJ A;  5KPR A;  1HJO A;  3TTC A;  1G99 A;  3ZET A;  2HF4 A;  2VWB A;  4BE7 B;  1GLL O;  4CZH A;  3E66 A;  3QB0 A;  2D4W A;  4K41 A;  4DCH A;  4IJN A;  3TU5 A;  4RWT A;  4B1Y B;  1YJN N;  1NGC A;  2A40 A;  5H1S Q;  2NZT A;  4FSV A;  5CHI A;  5EX5 A;  4YOR A;  5CR4 A;  4JHD A;  4BGB A;  5M1F A;  1YIT N;  1Q81 O;  4IOA L;  1Z05 A;  4BRL A;  1YHQ N;  2PBD A;  2WUS A;  3A0I X;  4JK7 A;  5AQX A;  5ADX H;  3LDQ A;  2E2P A;  1NGD A;  3AGR A;  1QZ6 A;  4FWR A;  4I6M A;  4JKA A;  3VF2 A;  3SAH A;  3LDP A;  3OHR A;  2ZGZ A;  5BRF A;  1C0G A;  3HSC A;  3SBG A;  2ZF5 O;  2P9U B;  3VER A;  2YX6 A;  5BPM A;  2HBK A;  2CH5 A;  3AAQ A;  1KXP A;  3CCJ N;  2QI2 A;  2A6A A;  1YI2 N;  1NGJ A;  1U2V A;  3F5T A;  3ULE B;  1VQO N;  3B8A X;  3HTV A;  4AM6 A;  3CC4 N;  3IKM A;  1LCU A;  1U6Z A;  3UKU A;  5GAD P;  3OW2 M;  4DKW A;  1VQ6 N;  5GAE P;  2KKZ A;  1OKJ A;  2P9S A;  4GNI A;  4IJA A;  3NVK A;  1JCG A;  2WC9 A;  4OPH A;  1MWM A;  3VEN A;  3P4I A;  2D1K A;  4DHY A;  4H0V B;  4CZE A;  3BEX A;  4IO8 A;  3FR0 A;  3L6Q A;  4K43 A;  1NWK A;  4IEE A;  4JKC A;  2YHY A;  5ELZ A;  4GY2 B;  3Q7C A;  4CZM A;  4YOW A;  4AF1 A;  1W2B M;  1XUP O;  3O80 A;  3T69 A;  4FOI A;  1YIJ N;  2P9K A;  3NMU A;  4H03 B;  2CGL A;  4BRH A;  5MLC Q;  3TSU A;  5BRE A;  4CZK A;  1YUW A;  4IOC L;  4EHT A;  2C1G A;  2P9I A;  4B1U B;  4C1N I;  4ILH A;  3EE9 A;  4PL7 A;  3J7Z O;  3T7Z A;  4GVE A;  4OO1 J;  2PFU A;  2GWJ A;  3LDO A;  3G71 N;  4O8K A;  5AQP A;  3C7N B;  5AQF A;  3J8A A;  2P9I B;  5M1Q A;  4BGA A;  3FZL A;  5F2R A;  3HOS A;  4XJX A;  4ISE A;  1GLF O;  5GIO A;  3JXU A;  4H0P A;  4H0Y B;  3CI5 A;  1SS6 A;  4MLE A;  4WFN L;  3D2F A;  4ISF A;  4JKB A;  2RHK A;  5F1X A;  3AGK A;  1VQ9 N;  4IZ9 A;  1NBW A;  1S3X A;  4JKF A;  5TKW A;  4CD1 A;  4CJ7 A;  4Z94 A;  2OTL N;  4CBX A;  3C65 A;  3P38 A;  1GLD G;  5C2D A;  3VPZ A;  3SAG A;  5DM7 L;  3MN5 A;  3ZEU B;  4EHU A;  2IVN A;  1Q7Y O;  3AAP A;  3QFP A;  5BPL A;  5FPE A;  2W40 A;  4NO7 A;  4PKG A;  4GV3 A;  3ATV A;  5FPN A;  2FLO A;  3UKR B;  1K8K B;  5AZJ A;  5GAH P;  1NGE A;  1HKG A;  2HST A;  2QWQ A;  2GTD A;  4IEI A;  3FGU A;  2NNW A;  3CJ7 A;  4BG8 A;  4BG9 A;  3MN9 A;  2QW9 A;  1NGG A;  5AQN A;  4IDH A;  1KQS M;  1VQK N;  2CGK A;  3O9U A;  5AQR A;  1GLB G;  5JVG L;  4C1N K;  2PAV A;  3VF6 A;  3I33 A;  4JD2 A;  4BRG A;  1X9J A;  3HM8 A;  3MN6 A;  3H46 O;  2E1Y A;  1DT9 A;  1VQ4 N;  3SBT A;  3KWI A;  4YOT A;  1E4G T;  3KHY A;  2JWK A;  4BQZ A;  4B1W B;  3BUZ B;  1GLE G;  1GLA G;  1Y64 A;  3DXM A;  2E88 A;  3U9D A;  4BR7 A;  4BEB A;  2HMP A;  3P31 A;  3SAF A;  4M63 C;  4RTF D;  3LM9 A;  1BU6 O;  3CPE A;  1ATS A;  2NRV A;  3K9K A;  4M7Y A;  4EAH D;  2Q36 A;  4FWQ A;  4BRE A;  4WFA L;  3CCU N;  3A5O C;  1HLU A;  1E4F T;  1NGB A;  3IFR A;  5B8H A;  1ESV A;  4BRQ A;  1VQ8 N;  3MWP A;  3W0L A;  3HRG A;  3CIP A;  3D6R A;  1ILY A;  5BRD A;  3FZK A;  3A5N C;  4JKG B;  1YJW N;  2RE2 A;  2BTF A;  1K8A O;  5LJW A;  1HKC A;  2ASO A;  5CE3 A;  3A5M C;  1MDU B;  5C2F A;  2C1I A;  5AZI B;  3CJC A;  3FZF A;  4FO0 A;  2VYP A;  2YJF A;  4C23 A;  5DM6 L;  3EL2 A;  3GG4 A;  3KZB A;  3VTH A;  3FFK B;  3QBW A;  5EY4 A;  2A41 A;  2OAN A;  2YHW A;  3VES A;  1TYQ B;  3ZX3 A;  3GDQ A;  4KH6 A;  3VEZ A;  2W41 A;  1M90 O;  4FPB A;  2FXU A;  3CF5 L;  4HWI A;  1QQO A;  3CD6 N;  1TUU A;  3Q7B A;  1T6D A;  1IG8 A;  1X3N A;  4BR9 A;  5GIP A;  5M1N A;  2ITM A;  3L4Q A;  3ENB A;  2F7T A;  2P9U A;  2V7Z A;  3O9T A;  1ZC6 A;  4GV9 A;  1Q86 O;  2YI1 A;  1IJJ A;  2IIR A;  3HZ6 A;  3OA9 A;  4NLC A;  5AQS A;  3ULE A;  1HX1 A;  1YXQ A;  3DWL A;  3LDN A;  4CD3 A;  3IMX A;  1NGI A;  4OPA A;  4B1X B;  3DJC A;  1WUA A;  4B1Z A;  5F0X A;  4GV6 A;  3E9P A;  1SAZ A;  4JKH A;  4NB4 A;  3CHW A;  1NM1 A;  1P90 A;  3CCS N;  3UB5 A;  4JEP A;  1GLJ O;  4DQ8 A;  2VCP A;  1VQ7 N;  4EIA A;  2NLX A;  4BEC A;  2W00 A;  1RDW X;  4A2B A;  1BA0 A;  3D7E O;  5AQW A;  3R8E A;  1KAY A;  2QWO A;  4FL9 A;  4BRC A;  3QML A;  4XH1 A;  4CBW A;  1ATN A;  3QDK A;  1DGK N;  5AQZ A;  1EO1 A;  3R1X A;  3BF1 A;  1T6C A;  1V4T A;  2ZGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...