3ULEB

Structure of bos taurus arp2/3 complex with bound inhibitor ck-869 and atp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
351
structure length
236
Chain Sequence
CDNGTGFVLLTEPPMAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRHMVFLGGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
rcsb
molecule tags Structural protein
total genus 65
structure length 236
sequence length 351
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3uleB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3uleB02
2YJEA 3ZEUB 1X9JA 2Q0UA 1NBWA 4BVPA 1ZC6A 3GBTA 4QS8A 2YI1A 1MDUB 2V7YA 3H1VX 3GL1A 4WYBA 2YHXA 3CI5A 4JN4A 3VPZA 1RDWX 4DCHA 5BPNA 3GE1A 4FL9A 5AQRA 5FPMA 4H0YB 3MCPA 4I6MB 1C0FA 4LC9B 1NGDA 2P9SA 3VF6A 3FFKB 3UB5A 2P9UA 1XUPO 2VWBA 2BTFA 5AZJB 3O1WA 1J6ZA 5LJVA 4XH4A 3LDQA 5AR0A 3MK6A 3AARA 2E2OA 4NB4A 4EAHD 4BRFA 4H0OA 4DQ8A 5AFUA 3QFPA 4PL7A 2A5XA 2CGJA 2ZF5O 5I9EB 4FWSA 3SK3A 3BF1A 3O6WA 3S41A 2EWSA 3EKSA 3R6MA 5BR9A 4FWOA 3M1FA 4K25A 5AQQA 3HBTA 2P9IB 3QBXA 4YDUC 3GOIA 3HTVA 3M6GA 3O1BA 2YHYA 3CJBA 5KPZA 3LDOA 3A5NC 4BC5A 3O5BA 1HX1A 3WUHA 5AQVA 1MA9B 3DXKA 1QZ6A 4BR5A 1IJJA 1K8KA 1BO5O 3U8XA 4WQ4C 2F9TA 3VF4A 3BF3A 4BRQA 4RTFD 4XH1A 1IG8A 4XEIA 3QDKA 2A40A 2J4RA 3U9DA 4XH5A 4BVOA 5ELZA 4H0VB 2P9LA 2FF6A 4H0PA 3CETA 2AP1A 4FOEA 1U2VA 3VGKA 4HTLA 3FZFA 1CZAN 4IJAA 5AQLA 3FZHA 4H5VA 1RGIA 4H5TA 2GELA 3MDQA 5AQSA 3QMLA 3KVGA 3HI0A 3M3ZA 3FZLA 3HZ6A 4BRGA 3OHRA 4BRPA 4H0TB 3B8AX 3ZX3A 5AQNA 3ATVA 5AQTA 4PKIA 5EY4A 5KQDA 3DXMA 4FPAA 4EHUA 1QQMA 3UKRB 2V52B 3A5MC 3WEEB 4CZFA 4BGAA 2FF3B 2E88A 3LL3A 4O5FA 4CZLA 1ATNA 3VF2A 2FSKA 4BGBA 1NGJA 1QHAA 3AAQA 4B1UB 3ZETB 3F9MA 5LY3A 4IJNA 5AQWA 2A6AA 1NLVA 2I7NA 4F9OA 3HSCA 4FWQA 2VCPA 2D0OA 3CJAA 2GWKA 3DWLA 3IDHA 4CBUA 5AQIA 3SLCA 5EVZA 2E20A 1T44A 4BR4A 3IFRA 3JXUA 5AQHA 2E2QA 4CZHA 4BG9A 2HOEA 2HF3A 5AQPA 4WQ5C 5B8HA 1E4GT 1H1VA 4FWRA 4B1VA 2QWLA 1V4TA 2ASMA 3LDPA 2W41A 2E2NA 3ULEB 3R8EA 4BC4A 2QM1A 3CHWA 1D4XA 1DGKN 1ATRA 1BG3A 1KAXA 3WXJA 2P9SB 5AFUH 3H45C 2Q0RA 1HPMA 3VGLA 2P9UB 4M63C 4IO8A 2HF4A 4BR2A 2Q2RA 3SMPA 1NMDA 1X3NA 4J8FA 4FSVA 2P9KB 3U4LA 4BR9A 1DKGD 2IVPA 4BRAA 1Q18A 3AAPA 3DAWA 3GG4A 4JD2A 3VEVA 4BRKA 3WXIA 3P4IA 4FWKA 3QICA 3MN6A 1NGIA 3VOVA 3MN5A 2P9NA 1YAGA 4MO5A 3C7NA 4YDUA 3ATUA 1QZ5A 4A2BA 1NGGA 4M7XA 4K42A 3EZWA 4HWIA 1BU6O 3FGUA 3I8BA 1U6ZA 5BPLA 2A41A 4CZIA 3QBWA 4JNEA 5AQYA 3DXKB 1Y64A 4QS7A 4A2AA 3VESA 1BA0A 4FWMA 3VEOA 1QQOA 1NGBA 4QS9A 2PAVA 3R9PA 4BC3A 2E2PA 1HLUA 3KHYA 4H0XB 4CZKA 5JMVA 3MN7A 4CD1A 5BRFA 1HKGA 3D2EA 1BA1A 2CGLA 3J8AA 1V4SA 5BN8A 1GLEG 1TYQA 2P9LB 4ISEA 3GDQA 1NGAA 3CJ9A 1KXPA 4BREA 3DJCA 5AQUA 2DPNA 1GLAG 3LDLA 4ISGA 1S3XA 2QWMA 3UE5A 5AZIA 2BUPA 3H46O 2Q1NA 3CQYA 2E1YA 3WQUA 3WT0A 2Q36A 3FLCO 1S22A 5F2RA 3W0LA 5EXWA 5AQFA 2OANA 4K41A 4KBOA 3VGMA 4CZEA 5F0XA 3DXMB 2FLOA 2KHOA 1GLJO 3LM2A 5TKYA 2QXLA 4B9QA 2PBDA 2QWNA 3UKUA 2QW9A 2P9PB 4Z94A 4BRDA 3C0BA 4O8KA 3MN9A 2E1ZA 4CZJA 4JHDA 5JLFA 4CZMA 2D1KA 3VEZA 3EL2A 5FPNA 2V51B 1NWKA 4RCHA 1NGFA 4IWVA 3VERA 5JICA 1R59O 4JAXA 4BRLA 4WQ5A 1XC3A 1HKCA 1RFQA 3UKRA 3VENA 3RSEA 3H1QA 4DB3A 5BPMA 3FR0A 2FSNA 3MMVA 1BUPA 5KPTA 1SQKA 4K43A 4CJ7A 2YJFA 1JCFA 4BROA 2HMPA 5ADXA 1BOTO 1SZ2A 3CJCA 3SMSA 4MO4A 5CE3A 3I33A 4FWLA 3EO3A 3ENOA 1Z6RA 1X3MA 3A8YA 4AM7A 3CIPA 2QWOA 2NLXA 5FPDA 3D2FA 2UYTA 3KZBA 1KAYA 2CH5A 4FO0A 4JD2B 5AQGA 1NGHA 4CBWA 4EIAA 2ZGYA 4CZGA 2WUSA 3HM8A 3FZKA 4B1WB 2A3ZA 2P9NB 5E84A 3ZEUA 3C7NB 2Q31A 5LJWA 1HUXA 4EFHA 1E4FT 1OKJA 5F1XA 2I7PA 2Q97A 4FOIA 3QB0A 2W40A 1HKBA 3ULEA 4GNIA 2F9WA 4EHTA 1T6CA 2QWQA 2ZWHA 2CGKA 4BG8A 1GLCG 3O80A 2NZTA 1G99A 4I6MA 5BREA 3EKUA 2FXUA 3A0IX 2V7ZA 4L3QA 5AQJA 3A5OC 4BQLA 1JCEA 1GLDG 2P9KA 5AZJA 3O08A 1K8KB 4WQ4A 4IXCA 2GWJA 2YCHA 3D2EB 3TPQA 4DHYA 5KPRA 3O4WA 1TYQB 5AQMA 1MWMA 1HJOA 5BRDA 4B1XB 1MWKA 1TUYA 3WXKA 4BR7A 3ZX2A 1NM1A 5BN9A 1WUAA 2IIRA 3SJHA 3WXLA 1TUUA 5EOYA 3VEXA 3A5LC 2P9IA 2GTDA 4FWPA 4H5WA 4NO7A 3O8MA 3TU5A 4AM6A 4BRHA 1U2VB 4CD3A 5AZIB 1WOQA 1LOTB 2GEMA 4BRNA 3VETA 3FE1A 1QQNA 2QWPA 3W3DA 4RWTA 2A42A 4M7YA 3WQTA 3G25A 2D0PA 3QFUA 2D4WA 4C23A 2ITMA 4B1ZA 1Z05A 3BUZB 5AQXA 5AQOA 2H3GX 2FSJA 3IMXA 3L0QA 5EX5A 3VEYA 3D7EO 1T6DA 3UKUB 2YHWA 4CBXA 3FZMA 3LDNA 5JLHA 2GUPA 1GLFO 1BDGA 4BC2A 3BEXA 4JHDB 3L4IA 4IZ9A 4A62A 5FPEA 3JS6A 1ATSA 1XQSC 2ASPA 3ENHA 1DEJA 1P8ZA 5KQ8A 3ZX0A 4CI6A 3H6EA 1SAZA 1NGCA 2NRHA 4H5NA 3ID8A 4A61A 4Y0WA 1BWFO 2ASOA 4H5RA 4B1YB 5BRHA 3CERA 3H3OB 3VEWA 2AA4A 1ZXOA 3H3NO 1EQYA 3L6QA 1GLLO 1YVNA 3CJ1A 3LM9A 3IUCA 4PL8A 4BRMA 5AQKA 3RSEB 1C0GA 1ESVA 5ADXH 4FWNA 4GY2B 1NGEA 3WEEA 4E1JA 2P9PA 2VYPA 4PKHA 1LCUA 4BRCA 4BR0A 3EN9A 4PKGA 3AY9A 2E8AA 4BQZA 5AQZA 2IVOA 4H03B 5E26A 2CH6A 4BRIA 1ZBSA 1YXQA 3ZETA 3CQXA 2IVNA 3U9ZA 3D2FB 1JCGA 3BP8A 2QWRA 4FPBA 1GLBG 1KAZA 4MLEA 2ZGZA 4MLHA 3CJ7A 4ISFA 1YUWA
chains in the Genus database with same CATH superfamily
2YJEA 4PY5A 2BDPA 1NOZA 5GAGP 1RTDA 4CJRA 1TV6A 1O1WA 1JL2A 3D0PA 2Q0UA 4BVPA 1SKSA 1K6YA 2YI1A 5M1OA 3H1VX 4JLHA 4WYBA 2YHXA 3CI5A 3VPZA 3P83D 4ELUA 4DSJA 4NCAA 1LWEA 3LDSA 4YNQA 5M1FA 1VQ7N 4KFBA 4EP5A 2P9SA 1SL2A 4CF0A 3UB5A 1NOYA 1XUPO 2VWBA 3TSUA 3NVKA 3T3FA 4XH4A 1E3MA 4B9VA 3MK6A 4F2SA 2E2OA 4H0OA 2CGJA 5I9EB 3O6WA 2G8VA 4GMJB 4CFBA 3R6MA 1ILYA 3FFIA 5AQQA 4IOCL 4CJVA 4FJKA 3QBXA 4YDUC 2NNWA 2ZQBA 4J2AA 3GOIA 3HTVA 2HHQA 5HP1A 4LF4K 3ZSYA 4Z4HA 3OTOK 4FLZA 3QIOA 3J80O 1HX1A 5AQVA 3PV8A 4C8NA 4K8ZA 4CJQA 1QZ6A 1K8KA 1KRPA 3BF3A 4BRQA 1VSEA 2I5JA 4XEIA 3O3FA 3VQDA 2J4RA 5ELZA 4EZ6A 3CMAN 3ID6A 1TK5A 1DTTA 2RHKA 4AILC 4OLBA 2QK9A 4E7LA 1DTQA 4FOEA 1U2VA 3G10A 5AQLA 1RGIA 2PFUA 2RN2A 2GELA 2C1IA 1UA1A 5AQSA 3QMLA 3KVGA 4F3OA 4BRPA 3ZX3A 5AQNA 1HYVA 3ATVA 3LP2A 4FJ5A 3QERA 1WSGA 2NRXA 3TSPA 5KQDA 3RMDA 3CPEA 1BGXT 3WEEB 4CZFA 4TSXA 4BGAA 4KREA 3L8BA 2PYJA 3JSMA 3HVRA 3LL3A 4O5FA 4KTWA 1ATNA 4HVJA 4DFJA 5HRNA 1WN7A 4B1UB 4CHOA 3ZT1A 5AQWA 5CYQA 1ZYQA 4GV9A 1NLVA 1U48A 3ZT2A 3KJVA 4FWQA 4DR6K 2VCPA 4A5AA 1WSHA 2G8HA 4CBUA 4M3ZA 4DTJA 4X65K 1A5VA 4OGCA 3OY9A 3CCEN 1IKWA 2E4LA 4B9UA 1H1VA 3CG7A 1HQEA 4UQGA 2ASMA 3G71N 3VQQA 1IKYA 3R8EA 3KTQA 4U67L 2KLAA 4LSNA 3AO3A 2P9UB 4A59A 4CJWA 4OGEA 4CERA 4IO8A 5BR8K 3QETA 1LW0A 4KH6A 1X3NA 1T7PA 4FSVA 3TAGA 2IAJA 4O0JA 1FKPA 4BDZA 2IGIA 4OVLA 4BRAA 3AAPA 3MEEA 3DAWA 1RTHA 3VEVA 3CQ8A 3WXIA 3P4IA 4YOWA 5GIPA 3P1GA 4KB0A 4YDUA 3CCQN 3ATUA 4CCHA 4CIEA 3AA4A 3OYGA 1W7AA 4K42A 4FJGA 3EZWA 4DF4A 4HWIA 2E6LA 4JKDA 4OPKA 3QBWA 4QS7A 4A2AA 3Q7CA 3F9KA 3SBGA 2RPIA 3ZSVA 1U49A 1TKTA 4DF8A 3O3GA 3KHYA 2BH1A 4H0XB 5JMVA 4NXNK 1U4BA 4CD1A 4FYDA 3HSTB 2CGLA 3J8AA 4R79A 4ISEA 4CF9A 3GDQA 4JKFA 5C2DA 1NGAA 2WC9A 4LD0A 4DSKA 1U47A 2VG6A 4BREA 3DJCA 5AQUA 4OKEA 1GLAG 3ITHA 4BWMA 5AZIA 2P5GA 3CQYA 5CY4A 2ZJQL 3THXB 3NGYA 5HROA 3P31A 5EXWA 4ICLA 4KBOA 2B4JA 2FLOA 3F73A 2Z1JA 4DFKA 2QXLA 4R5PA 2PBDA 2QW9A 2UUCK 4DQSA 2XY5A 4BRDA 1W97L 4O8KA 2E1ZA 2HNDA 4JHDA 4CGHA 4CZMA 5IWAK 3C65A 1N5YA 2V51B 3F5TA 4OKKA 4DR2K 3M8SA 5JICA 4LY7A 4C1NK 1R0AA 4DTSA 3QESA 3KKRA 4DSIA 4HUFA 1KLMA 4GV6A 1BQMA 3IG1A 3H1QA 4DB3A 3HT3A 5KPTA 1XI1A 3T1YK 1T8EA 1HNVA 4Q0BA 4KH5A 4AQYK 1WSJA 3AVKA 1BOTO 3MECA 1KVBA 3V1OA 3HXMA 1HPZA 1RDCA 4FWLA 1ASUA 1Z6RA 3I0RA 4M41A 2NLXA 3TWHA 1RDAA 1IKXA 4KI4A 1NNEA 2UYTA 2G8UA 4W5RA 4JD2B 5KRTA 3L4QA 4CBWA 2NUBA 4CZGA 3V81A 4FJLA 2O8BA 2VQFK 3HM8A 4B1WB 5E84A 3ZEUA 4EFHA 1YITN 1RCHA 4I9LA 4FOIA 5EU7A 1HKBA 1EXQA 4DG1A 2A1RA 4CGFA 3N4QA 1N36K 2O8FA 4EHTA 3MWTA 1FW6A 2CGKA 4DTUA 1GLCG 2XO7A 1S1UA 5BREA 3A5OC 2FBTA 2HBJA 1TVRA 1HRHA 4CEFA 3D2EB 1TYQB 2VGMA 3OYHA 3KLFA 4B1XB 1S1WA 1MWKA 1NG9A 3QEVA 3VQBA 3NE6A 3WXKA 4YY3K 1NM1A 1J5EK 4DS4A 1VQ8N 3ZLJA 3SJHA 1WUAA 3O4NA 4YOUA 1Q8IA 2P9IA 3AVJA 4H5WA 2Z1HA 5CZ1A 2GEMA 3KD5E 3FE1A 4DTXA 4HUEA 2D4WA 4C23A 3NF9A 3DYAA 5AQXA 2H3GX 3NBPA 4E19A 1NJXA 3D7EO 4EZ9A 2HBLA 4O44A 3LDNA 2KKZA 3MAQA 1VQ9N 1XC9A 4BC2A 3BEXA 3AA2A 3L4IA 4IZ9A 5LMUK 3KD1E 5H1SQ 3RRHA 1VSFA 4CFDA 1DEJA 4BDYA 2AJQA 4DR4K 4ZHRA 5GAHP 1UAXA 3H6EA 1RTIA 1NGCA 2NRHA 3TARA 1VAZA 4BECA 1GOAA 4O5BA 3OA9A 2ZE2A 1ZXOA 2NRVA 1EQYA 4PL8A 4BRMA 5AQKA 1C0GA 1QHTA 1EP4A 2KZZA 3ZT0A 4GY2B 1WBDA 4E1JA 4RW7A 1TK0A 2VYPA 4PKHA 4BRCA 1LCUA 3L2RA 1ZBFA 2F7TA 4E89A 1NK9A 3AY9A 4J2EA 2GUIA 1NJZA 1B9FA 3CYGA 4CK1A 1ZBLA 1ZBSA 1OH6A 3ZETA 1RDUA 1KCFA 1W0HA 4DFPA 4E7HA 1S9GA 3JYTA 4N41A 3EEQA 3S3NA 4FPBA 1GLBG 4B9SA 4MLHA 5A2QO 3ZSQA 4ISFA 3VMFB 4C8MA 3AO5A 3QIPA 2OPSA 1G15A 1ZC6A 4DV0K 4QS8A 4KHSA 5GIOA 3O9UA 5FPMA 2KTQA 4H0YB 3AVMA 4I6MB 1TL1A 4LC9B 3VF6A 4KHNA 4V19S 3SJJA 3LPTA 3PSIA 2BTFA 1RBTA 4FK2A 4ELTA 5HBMA 3J7ZO 5LJVA 4AHUA 4FVMA 1JKHA 3QFPA 1SS6A 3SK3A 1BHLA 1B9DA 4NYNA 1JXBA 4BE2A 3PIPL 4FWOA 3S5TA 4K25A 3HBTA 4BE1A 4JI3K 3K5OA 3CJBA 5KPZA 3LDOA 4E7IA 3MWPA 4Y1DA 4BC5A 4CHNA 2UXDK 5GINA 1SUQA 4QCLA 1HR0K 3DXKA 3HOTA 1A5XA 1BI4A 4KHWA 1YIJN 3OYLA 1C0TA 5CHIA 4XH1A 2Y1IA 2YKNA 4LF5K 3N4PA 3RTVA 5FDLA 4NXMK 4IG0A 4DV2K 4XH5A 2QEXN 4E1NA 2P9LA 1IKVA 1RT6A 3CM5A 4ELVA 4LFAK 3BY5A 2AP1A 2XHBA 1JL1A 3AO1A 1T3VA 3AV9A 2O8EB 4EP4A 1NU0A 3FZHA 4H5VA 4H5TA 3V4IA 3OBWA 3CXCM 4DQIA 2Q3SA 4B8AB 4BRGA 2HHSA 3E66A 4JI1K 3CCVN 3UKRB 3B6PA 4GV3A 2FF3B 1VSKA 4JI4K 4CK3A 5M1KA 2FSKA 4BGBA 1NGJA 2OPRA 4RW8A 4KTZA 5LY3A 3CM6A 1TKZA 2QXFA 4DR3K 3K9KA 1D9FA 4M42A 3CJAA 5JS1A 3RVCA 1NK5A 3IDHA 5AQIA 3SLCA 5EVZA 4BR4A 1XHZA 5AQHA 4X64K 3G4SN 2E2QA 4BG9A 4HUGA 2HF3A 5AQPA 3S9HA 5B8HA 1E4GT 4FWRA 1J53A 4B1VA 1S6PA 2QWLA 1V4TA 3CPWM 3LDPA 3DLBA 2W41A 2E2NA 1CXQA 1HNXK 3THYA 1IBMK 3QEXA 2Q0RA 1C1CA 3AVCA 4PQUA 4DV3K 3V1RA 2HF4A 2Q2RA 4RW4A 4KHUA 3VQ4A 1NMDA 2HHVA 3P38A 4J8FA 1FK9A 2P9KB 3TAEA 1X9WA 4DV5K 1DKGD 2IVPA 4PWDA 4LSLA 1Q18A 1RILA 2O4IA 4G1QA 5I3UA 4DV6K 1J5OA 3MN6A 3MN5A 2P9NA 4MO5A 3C7NA 3DLRA 3CCMN 3OJUA 1YT3A 1NGGA 2GV9A 5E41A 1BU6O 3FGUA 4Z0UA 3I8BA 1D8YA 1LWCA 4CECA 4LH4A 5BPLA 5K14A 4AHTA 3NVMA 3TR8A 3VEOA 4FLWA 1QQOA 2A1SA 3O4QA 3HYFA 2PAVA 4QS9A 1U45A 3OYEA 1BIUA 4YOXA 3LP0A 3D45A 1HNZK 3TTCA 3OS2A 1BA1A 4IG3A 5BN8A 1GLEG 2OA8A 1BISA 4FJMA 3MX2A 1VQ5N 3CJ9A 1KXPA 1N32K 2DPNA 2HVIA 1Q9YA 3O9QA 4BE0A 1EX4A 1S3XA 3G0ZA 2QWMA 4DU4A 3KK7A 4FJ8A 3V9SA 1QTMA 2Q1NA 3HM9A 3WQUA 3WT0A 5F2RA 3W0LA 3B6OA 4CJUA 5M1QA 3HPGA 1NJYA 3VGMA 3VTHA 4DUYK 3DXMB 4LFBK 2ETJA 4FCYA 2WONA 3S3OA 2KHOA 5TKYA 3I0SA 3O3HA 2P9PB 4Z94A 3L3UA 4DSFA 1RT2A 4CF8A 4CZJA 3PX0A 3QNOA 2B5JA 1VSHA 3OYCA 3VEZA 3EL2A 2NRRA 1NJWA 4RCHA 3M5RA 3TAQA 3VERA 1R59O 2HBMA 4JAXA 4BRLA 2RKIA 1WSIA 3ZYYX 3T1HK 3SZ2A 1GOCA 4DR7K 4DTPA 4OPHA 1W2BM 1RBVA 4YFUA 3UKRA 3J7AP 3KWIA 5DK5A 4LF9K 3T69A 1W9HA 1SQKA 4CJ7A 2E6MA 2YJFA 3MXJA 2HHTA 2DY4A 2KW4A 1L5UA 3S3MA 1YI2N 5J2MA 3VN5A 5CE3A 3DRRA 3SUNA 4B08A 1KFSA 3CIPA 5FPDA 3D2FA 2O8DA 1KAYA 4RW6A 5AQGA 5J2QA 2XY7A 1E4FT 1OKJA 5F1XA 3QB0A 3V9WA 1QE1A 1LV5A 1TAUA 2F9WA 3TAPA 1T6CA 2ZWHA 2G8WA 3KLIA 3OS1A 1N6QA 3OBYA 3O80A 1G99A 2Z1GA 3U3YA 2V7ZA 4IFYA 5AQJA 2P9KA 1C0UA 4DTNA 2QA4N 1IBLK 3K0SA 4IXCA 3L2WA 4YHHK 1WB9A 2P1JA 3LWMA 5DM6L 4FXDA 5DM7L 3E9OA 1KLNA 4O0IA 5DMRA 4F2RA 4BR7A 4DQRA 3ZX2A 3QINA 4C8LA 4CJPA 4KH4A 3U6FA 3WXLA 3VQAA 3K9JA 3WXMB 3A5LC 1NKEA 4NO7A 4M3RA 4CJFA 4UY8O 4CD3A 4C8KA 2D0PA 2ITMA 5SWMA 3BUZB 2FSJA 3L0QA 3TAFA 3AVHA 3VEYA 1S6QA 4JRPA 5CZ2A 3UKUB 4AHSA 2W6KA 2YHWA 4CBXA 3FZMA 2ATQA 4OX9K 2GUPA 2QI2A 1BDGA 3T7ZA 3CCLN 3G6EN 3JS6A 4W5TA 4KRFA 4IOAL 1XQSC 3ENHA 1K9MO 3KK1A 1SKRA 4LF6K 5J2NA 2HHUA 4H8KA 3K57A 2HHIA 3ZX0A 1WAFA 5C15A 3VA0A 1SAZA 4H5NA 4I7FA 2HBKA 5J2PA 3ID8A 3OYMA 4WFBL 2DTUA 2ASOA 2FBYA 3CERA 1XNRK 4JKGB 4B9TA 4FJ7A 3H3NO 4M3XA 2IOCA 1NK7A 4ZTJA 4AHRA 2F4VK 4FW1A 3RSEB 4FJHA 1ESVA 4Z4IA 3WEEA 1YHQN 3TAMA 2P9PA 4CF2A 3CCSN 1UOCA 4FJ9A 4PKGA 3UIQA 4DS5A 2E8AA 3KKSA 2VWKA 4BQZA 2UXBK 3VQ6A 5E26A 2CH6A 3O9SA 3CMEN 3SQ1A 2IVNA 4CEZA 5LMNK 3BP8A 2QWRA 4JKBA 3SCXA 3PIOL 2O8CB 1KAZA 2GBZA 2ZGZA 3OYFA 2OZSA 5D3GA 4W5QA 5CYMA 1QSLA 1HMVA 4KI6A 1X9JA 5C24A 2F8SA 3MCAB 3EYZA 1NBWA 3GBTA 5FRMA 3GL1A 3CC4N 5BPNA 4JN4A 3AVGA 4FJXA 4CGGA 2IDOA 5M1PA 5M1NA 3CYMA 1C0FA 4JS4A 1TKDA 3FFKB 3M8RA 3SQ0A 1JJ2M 3Q7BA 1HNWK 2P9UA 2HNYA 2XRIA 1I94K 5AZJB 3O1WA 1J6ZA 4CESA 4GVEA 3SPYA 1FJGK 1SV5A 4OKJA 3AVAA 1ZBIA 3AARA 4EAHD 5AFUA 4BRFA 4PL7A 2A5XA 4FJIA 1VSJA 4FWSA 2JWLA 1VK0A 2VQEK 3LALA 2YX6A 2EWSA 1VQON 4CK2A 1TL3A 3C95A 4JEPA 4LF8K 1MU2A 4AH9A 1WAJA 4M3YA 3AVLA 1DLOA 3AA5X 3TI0A 4FJNA 3CFPA 3O5BA 1N34K 3AA3A 3WUHA 3NF6A 1NK4A 4CJLA 4BR5A 1IJJA 3QEIA 1BO5O 1RT1A 3U8XA 4WQ4C 4I9QA 2F9TA 4E7JA 3NMUA 2DFEA 5C42A 4NLBA 4RTFD 4JV5K 5J1EA 4FM1A 2HHWA 3QDKA 3LWLA 4YORA 1Q9XA 3P39A 4BVOA 1QSYA 4H0VB 4B9LA 3AGRA 4Z4EA 4NLCA 4CHPA 5KGXA 4IJAA 3J81O 4MQ3A 3EZ5A 3QEPA 3HP9A 3FZLA 3HZ6A 3OHRA 4H0TB 3B8AX 4OPJA 3THXA 5AQTA 4OJRA 1KVCA 2ZD1A 2HHXA 5EY4A 1LAVA 4FPAA 4EHUA 1QQMA 4JI0K 3BZCA 3A5MC 4CEEA 4DR5K 4DTOA 3VQCA 4CF1A 4CZLA 3SUQA 1D9DA 5JVHL 4JYAK 3VF2A 1N33K 3AAQA 4IDHA 1C0MA 4CHQA 3SAFA 3NH2A 1WSFA 2I7NA 3DLKA 3IS9A 4B3TK 2OZMA 2NRWA 2D0OA 1EWRA 2GWKA 1JLFA 3KLEA 3ZSXA 3I8DA 1NK6A 2E20A 1T44A 2LSNA 3JXUA 1C1BA 4CZHA 3V9ZA 1VQ4N 2HVHA 4FLTA 4JI7K 1ASWA 4WQ5C 2OTJN 3E1YA 2Y1JA 4O55A 4JK9A 5KTQA 4KHPK 4CIFA 3HVTA 5FLXO 3WNFA 4DMNA 1L3VA 4E7KA 2G8FA 2YHAA 4Z4CA 2IS3A 2QM1A 3CHWA 1D4XA 1DGKN 1KAXA 4O4GA 2P9SB 3PLAA 5AFUH 3RMAA 4AHCA 1HPMA 4DLEA 3VGLA 2ITGA 2VGNA 1EO1A 1VRUA 4CFAA 1C1AA 4X66K 4FK4A 4JK8A 3U4LA 4BR9A 4FZXC 3GG4A 4H4MA 4ID1A 4JD2A 1NKBA 4FWKA 4FLVA 3QICA 4M3UA 1NGIA 3VOVA 1YAGA 1ZBHA 1BCMA 4B3OA 3MX5A 5C0YA 4I2QA 1EKEA 1KD1O 1U6ZA 4DU1A 4CZIA 4KPYA 4JNEA 4E0DA 1Y64A 4CHYA 4U7BA 3L2VA 4RW9A 1RBSA 5KI6A 1NGBA 3CFOA 1HYSA 1JLCA 2X78A 2X6SA 4CZKA 3RRGA 3SNNA 3MXMA 5BRFA 4Z4GA 3D2EA 4IO9L 2UU9K 1V4SA 1VSLA 1KC8O 1TYQA 5TKWA 1C6VA 1KTQA 2WTUA 3PX4A 3VQ8A 1UA0A 4JI2K 3SQ2A 3HPOA 3SPZA 5HLFA 3DMJA 3LDLA 1BL3A 4FLUA 3RMCA 1XNQK 4CEBA 3IKMA 4GKKK 3UE5A 3TTFA 3NGIA 4W5NA 1ZBUA 1KQSM 1K8AO 1S22A 4A5BA 3WNGA 3OS0A 3NH1A 3KK3A 1JLGA 3LM2A 2E5LK 1CLQA 3E9PA 3ZT4A 1D5AA 1TGOA 3F2KA 3LP3A 4ZTFA 1WSEA 2QKKA 3IAYA 4JRQA 2PYLA 1Y97A 2VWJA 5FPNA 3K5LA 4MDBA 3RMBA 1NWKA 1VSDA 5FROA 3ZSOA 4IWVA 2FBVA 5LL6Z 4B9NA 1L3TA 1OVQA 4WQ5A 1F21A 1OH8A 1YJNN 4F3TA 4CHZA 3DOKA 4B9MA 4I2PA 3BDPA 3ENBA 3NHGA 1ASVA 1VSMA 4E72A 2NRZA 1YF5L 1BUPA 4FZYA 4F4KA 1JLEA 4KO0A 4ID5A 4NCGA 2WBNA 3THVA 1I3AA 4KAZA 1JCFA 4BROA 4N47A 4CE9A 1SZ2A 3CJCA 1IO2A 4MDAA 4CJSA 4MO4A 4FJJA 3I33A 3EO3A 1FKOA 3K2PA 1RT3A 3VQEA 1Q81O 4AM7A 4DFMA 2QWOA 3DM2A 3KLHA 1N8RO 4EIAA 2WUSA 3FZKA 1YTAA 2Q31A 1HUXA 3QO9A 2W40A 1HQUA 1O13A 4DSLA 5GAEP 1P90A 1RDDA 4LH5A 3DRSA 4YOYA 4KB1A 4I6MA 4QOZB 2FXUA 1CZ9A 3A0IX 4JI5K 4CFCA 4L3QA 3NGZA 4BQLA 4JKAA 1JCEA 1GLDG 5C12A 4JI8K 3TPQA 2YNIA 5KPRA 5AQMA 1MWMA 1HJOA 1TUYA 4JK7A 1WNSA 1REVA 1VQ6N 4J2BA 2IIRA 3L3VA 3LP1A 3D6RA 3V9UA 3VEXA 4HHTA 1YJWN 3PO4A 4ILGB 4BRHA 3O8MA 1B92A 4PHTX 2P5OA 3SAHA 4N56A 2RF2A 5AZIB 1WOQA 2PZSA 4DWIA 2QWPA 3W3DA 1ITGA 4JKCA 4RWTA 2A42A 1NMNA 1M90O 2OPQA 3WQTA 3R1XA 3VQ7A 4B1ZA 4DTMA 4DUZK 3SYZA 3ASMA 3IMXA 4BEBA 1T6DA 3CCUN 1RT5A 1TAQA 4JHDB 4HTUA 4A62A 5FPEA 3C6AA 2GX9A 3OYBA 1GOBA 2DFHA 1P8ZA 4OLAA 1CZBA 4CIGA 2OTLN 3OJSA 2XY6A 2O8EA 4A61A 3ZSWA 4Y0WA 1BWFO 1WBBA 2X74A 5BRHA 3AVBA 3C6UA 3VEWA 1GLLO 1YVNA 3TANA 3ZCMA 2R7YA 3CJ1A 3LM9A 1RNHA 3IUCA 1XMOK 1VQPN 1JLAA 1NGEA 3VQ5A 4DR1K 4B3MK 4WCEL 3EN9A 3PX6A 4H4OA 4DQPA 1S9EA 2VG5A 1J54A 3LPUA 3CC7N 2IVOA 2W42A 4KHYA 1Z26A 4BRIA 1YXQA 5HRPA 4IFEA 2ZJRL 1TKXA 4OO1J 1RT7A 3I56N 4MFBA 1JCGA 3CCRN 4B8CA 4F8RA 3DRPA 2O8BB 3TTDA 3ZEUB 2ZM6K 2HHHK 3THWB 5JENA 4IEIA 1MDUB 2V7YA 2O8FB 4DCHA 1RDWX 3GE1A 3OYIA 3JAMO 4FL9A 5AQRA 5FRNA 3MCPA 3PY8A 1RT4A 2WFBA 2UXCK 1NGDA 2F96A 4FW2A 5HOOA 4K0KK 3HP6A 3LDQA 5AR0A 1KVAA 4CEQA 4NB4A 3VA3A 4DQ8A 2ZF5O 4DV4K 1I39A 3BF1A 3S41A 1EETA 3EKSA 5BR9A 5AJ3K 1X1PA 3M1FA 2P9IB 1VRTA 1NK8A 1QQCA 3OYDA 3M6GA 1HYZA 3O1BA 2YHYA 3KK2A 3LAKA 1L3SA 3E9LA 3A5NC 4WE1A 2YNGA 1OVYA 3SV3A 2OPPA 3IRXA 2W00A 4N76A 3SAGA 1MA9B 3VTIA 2BGGA 4DV7K 3AVIA 4PA1A 3VF4A 1IG8A 3AVNA 1WLJA 3LAMA 1RDBA 4CW7B 1IBKK 1VQMN 2A40A 3U9DA 2JGUA 2OYQA 4J2DA 1T05A 2FF6A 4KKOA 4H0PA 4FLXA 3CETA 3AGKA 4CEOA 2YNHA 2WOMA 4HTLA 3VGKA 2HSTA 3FZFA 1CZAN 3T1AA 2IC3A 1IG9A 2RE2A 3MDQA 1EWQA 3A2FA 4LF7K 1UWBA 3NH0A 3EE8A 4LFCK 3HI0A 3M3ZA 1VQLN 4BE7B 3VQ9A 3WNEA 5SZTA 4PKIA 2PY5A 3DXMA 4ILJA 2V52B 1VQNN 4KV8A 3SBTA 2E88A 1QS4A 1HNIA 4O8UA 2BANA 1Q82O 4DV1K 4GW6A 3DLHA 4CGDA 3HK2A 4G9ZA 1QHAA 3ZETB 3F9MA 3AVFA 4IJNA 1NKCA 2A6AA 4F9OA 4CVNE 4DLGA 3HSCA 4BACA 3CFRA 4BDPA 3DWLA 4QAGA 4WFNL 3QLHA 3IFRA 1CXUA 1NK0A 5IT9O 2HOEA 3OW2M 5GADP 1K73O 3ALYA 2HNZA 3BZKA 1VQKN 1SL1A 4YOTA 1RBRA 4CEAA 4CJ3A 4DKWA 3TABA 4Z4FA 4FK0A 2QKBA 3U3GA 4XIUA 4L8RB 3ULEB 4KTQA 1HJRA 1SL0A 4BC4A 3NF7A 4ILHA 2X6NA 4DSEA 1YJ9N 1Q7YO 4IDKA 1ATRA 1BG3A 3T19A 3WXJA 3H45C 4M3TA 2NRTA 1QVFM 3V9XA 3LZIA 2YNFA 5C25A 1TK8A 4M63C 3HPHA 4BR2A 5T7BA 5MLCQ 2YKMA 3SMPA 3NFAA 4CGIA 3R3LA 4CJ4A 4BRKA 3LANA 5KRSA 3THWA 2B6AA 1Q86O 1QVGM 3K58A 1KFDA 1QZ5A 2ZJPL 4B3SK 4BY9C 4A2BA 4M7XA 5HRSA 3DI6A 4YOVA 3KLGA 5JVGL 4IOXA 3RR7A 2A41A 1T03A 2EHGA 4OPAA 4X62K 5AQYA 3DXKB 4WFAL 1S5JA 4Q5VA 2Z1IA 3VESA 4CJKA 1BI4B 1BA0A 4FWMA 3DLLL 5JS2A 3R9PA 4BC3A 2E2PA 1HLUA 3MN7A 4BWJA 1HKGA 3MXIA 3NDKA 3QNNA 2P9LB 1XWLA 3K5NA 4E3SA 3DLEA 2YV0X 4W5OA 4ISGA 4N5SA 3O9RA 4JKEA 3MEDA 5HRRA 3DOLA 3L2QA 2UUBK 2FC0A 2BUPA 3H46O 3QEWA 4C8OA 2E1YA 3M8QA 1BCOA 3PUFA 2Q36A 3FLCO 3NCIA 3OYAA 5AQFA 2OANA 4K41A 4CZEA 5F0XA 4JI6K 5HL7L 4CEDA 1YTUA 1GLJO 3NAEA 3C6TA 4B9QA 1RBUA 3KWGA 3K5MA 1XHXA 2QWNA 3UKUA 4E1MA 4GVMA 5KGWA 3C0BA 1VSIA 3MN9A 3CD6N 2KQ2A 5JLFA 3OVNA 4CGJA 2D1KA 3CF5L 3LZJA 2UUAK 4NCBA 2D5RA 1NGFA 3AO4A 4FVUA 3EY1A 1LW2A 1S1VA 3DLGA 4WF9L 1L3UA 1XC3A 3MEGA 4JKGA 4GKJK 1HKCA 1U04A 1RFQA 2EX3A 1DT9A 2KZMA 3HOSA 3WNHA 2VG7A 3RSEA 3VENA 1OH7A 3OYNA 3ZSZA 5BPMA 3FR0A 3RR8A 4HCCA 2FSNA 3MMVA 4IFVA 3OYKA 4XJXA 3THYB 4K43A 3L2UA 2YHBA 2HMPA 3HJFA 5ADXA 4CJTA 1X9MA 2HW3A 3SMSA 2FBXA 3ENOA 3ULDA 1X3MA 3A8YA 3SUOA 2P51A 1S72N 1A5WA 3PO5A 2O8CA 3KZBA 2CH5A 4FO0A 1IH7A 1NGHA 2D0BA 4FLYA 2ZGYA 2A3ZA 2P9NB 3C7NB 2JWKA 5LJWA 1KSPA 2I7PA 2Q97A 3ULEA 3HRGA 4GNIA 4B3RK 3VQPA 4FM0A 2QWQA 4BG8A 1J9AA 2NZTA 3CCJN 3EKUA 1JLBA 3O9TA 1NJIO 3PSFA 1JXEA 1SKWA 5AZJA 4M3WA 3O08A 1K8KB 4WQ4A 3SUPA 2GWJA 2YCHA 2DFFA 4DHYA 3O4WA 3C6HA 3RWUA 4JS5A 5BRDA 4IEEA 4CJ5A 4HCBA 3V1QA 3C94A 5C2FA 5BN9A 1TUUA 2D0AA 5EOYA 4C1NI 3ISNC 2GTDA 4FWPA 3TU5A 4AM6A 3J7YP 3V6DA 1U2VB 4PUOA 2G8IA 1BIZA 1LOTB 4BRNA 3VETA 3EE9A 2KFNA 1QQNA 2G8KA 4M7YA 3G25A 3QFUA 1M1KO 1Z05A 3CC2N 4RG8A 5AQOA 1S1TA 2JLEA 5EX5A 4IKFA 2OCEA 3P5JA 4FZZA 1OH5A 1XMQK 4A57A 5JLHA 5CR4A 4FM2A 4DQQA 1GLFO 3NF8A 2W6LA 4JKHA 2HMIA 1LAWA 3OYJA 4IBNA 3E01A 4DU3A 2F8TA 1ATSA 2ASPA 4M45A 4NYFA 3I55N 2C1GA 3ZSRA 5KQ8A 1IV0A 2XY8A 4CI6A 2QTDA 4H5RA 4B1YB 3H3OB 3HO1A 2AA4A 1YVUA 4AF1A 3L6QA 1BQNA 1Z25A 2KFZA 2BE2A 3SQ4A 1LWFA 1S1XA 1X9SA 1VHXA 5ADXH 4KHQA 2HB5A 4FWNA 3KIOA 3K59A 3M8PA 4BR0A 4Y1CA 5C10A 5I42A 3H08A 1JLQA 4K8XA 3TSQA 3SV4A 5AQZA 4H03B 4AHVA 4CJEA 2D0CA 3BGRA 3AO2A 1RTJA 3HL8A 3CQXA 3U9ZA 3D2FB 2O4GA 2O8DB 1FXXA 4MLEA 1QSSA 3ZT3A 3CJ7A 4DTRA 3SI6A 1YUWA
chains in the Genus database with same CATH topology
2YJEA 3TTDA 3VMFB 3ZEUB 1X9JA 5GAGP 3MCAB 2Q0UA 1NBWA 4BVPA 1ZC6A 4IEIA 3GBTA 4QS8A 2YI1A 5M1OA 1MDUB 2V7YA 3H1VX 3GL1A 4WYBA 2YHXA 3CI5A 4JN4A 3VPZA 1RDWX 4DCHA 5BPNA 3GE1A 3CC4N 5GIOA 3O9UA 4FL9A 5AQRA 5FPMA 4H0YB 5M1PA 5M1FA 5M1NA 3MCPA 1VQ7N 4I6MB 1C0FA 4LC9B 2WFBA 1NGDA 2P9SA 3VF6A 3FFKB 1JJ2M 3Q7BA 3UB5A 2P9UA 1XUPO 2VWBA 2BTFA 5AZJB 3O1WA 3TSUA 3NVKA 1J6ZA 3J7ZO 4GVEA 5LJVA 5HOOA 4XH4A 3LDQA 5AR0A 3MK6A 3AARA 2E2OA 4NB4A 4EAHD 4BRFA 4H0OA 4DQ8A 5AFUA 3QFPA 4PL7A 2A5XA 2CGJA 2ZF5O 5I9EB 4FWSA 1SS6A 3SK3A 3BF1A 2JWLA 3O6WA 3S41A 2YX6A 2EWSA 1VQON 3EKSA 3R6MA 5BR9A 3PIPL 4FWOA 4JEPA 1ILYA 3M1FA 4K25A 5AQQA 3HBTA 2P9IB 4IOCL 3QBXA 4YDUC 2NNWA 3GOIA 3HTVA 3M6GA 3O1BA 2YHYA 3CJBA 5KPZA 3LDOA 3E9LA 3A5NC 3MWPA 4BC5A 1OVYA 3O5BA 5GINA 2W00A 1HX1A 3WUHA 5AQVA 3SAGA 1MA9B 3VTIA 3DXKA 1QZ6A 4BR5A 1IJJA 3HOTA 1K8KA 1BO5O 3U8XA 4WQ4C 2F9TA 3VF4A 1YIJN 3NMUA 3BF3A 4BRQA 4NLBA 4RTFD 4XH1A 1IG8A 5CHIA 4XEIA 3N4PA 3QDKA 1VQMN 2A40A 2J4RA 4YORA 4XH5A 3P39A 3U9DA 4BVOA 2QEXN 5ELZA 4H0VB 3CMAN 2P9LA 3ID6A 2FF6A 3AGRA 2RHKA 4H0PA 3CETA 3AGKA 4NLCA 2AP1A 4FOEA 1T3VA 1U2VA 3VGKA 4HTLA 2HSTA 3FZFA 1CZAN 4IJAA 5AQLA 3FZHA 4H5VA 1RGIA 2PFUA 2RE2A 4H5TA 2GELA 2C1IA 3MDQA 5AQSA 3OBWA 3CXCM 3QMLA 3EE8A 3KVGA 3HI0A 3M3ZA 1VQLN 3FZLA 3HZ6A 4BRGA 3OHRA 4BE7B 4BRPA 4H0TB 3B8AX 3ZX3A 3E66A 5AQNA 3ATVA 5AQTA 3CCVN 4PKIA 5EY4A 2NRXA 3TSPA 5KQDA 3DXMA 4FPAA 3CPEA 1QQMA 4ILJA 2V52B 3A5MC 3UKRB 3WEEB 4CZFA 4EHUA 4BGAA 4GV3A 1VQNN 2FF3B 3SBTA 2E88A 4O8UA 3LL3A 4O5FA 1Q82O 4CZLA 1ATNA 5M1KA 5JVHL 3VF2A 2FSKA 4BGBA 1NGJA 4G9ZA 1QHAA 3AAQA 4B1UB 4IDHA 3ZETB 3F9MA 5LY3A 4IJNA 5AQWA 4GV9A 3SAFA 2A6AA 1NLVA 2I7NA 4F9OA 3K9KA 3HSCA 4FWQA 2VCPA 2NRWA 2D0OA 3CJAA 4A5AA 3RVCA 2GWKA 3DWLA 3IDHA 4CBUA 5AQIA 3SLCA 5EVZA 2E20A 1T44A 4BR4A 4WFNL 3IFRA 3JXUA 5AQHA 3G4SN 2E2QA 4CZHA 4BG9A 2HOEA 1VQ4N 2HF3A 5AQPA 3OW2M 5GADP 4WQ5C 1K73O 3CCEN 2OTJN 3E1YA 5B8HA 1E4GT 4JK9A 1H1VA 4FWRA 1VQKN 4B1VA 4YOTA 4DKWA 2QWLA 1V4TA 3CPWM 2ASMA 3LDPA 3G71N 2W41A 2E2NA 3ULEB 3R8EA 4BC4A 2QM1A 4ILHA 1YJ9N 3CHWA 1D4XA 1DGKN 1Q7YO 1ATRA 1BG3A 1KAXA 3WXJA 4U67L 2P9SB 3PLAA 5AFUH 3H45C 2NRTA 2KLAA 1HPMA 2Q0RA 1QVFM 3VGLA 2P9UB 2VGNA 4A59A 1EO1A 4M63C 4IO8A 2HF4A 4BR2A 2Q2RA 5MLCQ 3SMPA 1NMDA 4KH6A 1X3NA 3P38A 4FSVA 4JK8A 4J8FA 2P9KB 3U4LA 4BR9A 1DKGD 2IVPA 4BRAA 1Q18A 3AAPA 3DAWA 3GG4A 3R3LA 4JD2A 3VEVA 4BRKA 3WXIA 3P4IA 4FWKA 4YOWA 3QICA 5GIPA 3MN6A 1NGIA 3VOVA 3MN5A 2P9NA 1YAGA 4MO5A 3C7NA 4YDUA 3CCQN 1Q86O 3ATUA 1QVGM 1QZ5A 2ZJPL 3MX5A 3CCMN 4BY9C 4A2BA 1NGGA 4M7XA 5C0YA 4K42A 4YOVA 5JVGL 3EZWA 4HWIA 1BU6O 3FGUA 4IOXA 3I8BA 1U6ZA 1KD1O 5BPLA 2A41A 4CZIA 4JKDA 3QBWA 4OPAA 4JNEA 5AQYA 3DXKB 1Y64A 4QS7A 3Q7CA 3SBGA 4A2AA 4WFAL 3NVMA 4U7BA 3VESA 1BA0A 4FWMA 3VEOA 1QQOA 1NGBA 3DLLL 4QS9A 2PAVA 3R9PA 4BC3A 4YOXA 2E2PA 1HLUA 2BH1A 3KHYA 4H0XB 4CZKA 5JMVA 3TTCA 3MN7A 4CD1A 5BRFA 1HKGA 3D2EA 1BA1A 2CGLA 3J8AA 4R79A 1V4SA 5BN8A 4IO9L 1GLEG 1TYQA 2P9LB 4ISEA 5TKWA 1KC8O 3GDQA 4JKFA 5C2DA 1NGAA 2WC9A 3MX2A 1VQ5N 3CJ9A 1KXPA 4BREA 3DJCA 5AQUA 2DPNA 3O9QA 1GLAG 3LDLA 4ISGA 3O9RA 4JKEA 1S3XA 2QWMA 3IKMA 3UE5A 3KK7A 3TTFA 5AZIA 2BUPA 3H46O 2Q1NA 3CQYA 2E1YA 2ZJQL 3WQUA 3WT0A 1KQSM 1K8AO 2Q36A 3FLCO 1S22A 5F2RA 3W0LA 4A5BA 5M1QA 3P31A 5EXWA 5AQFA 2OANA 4K41A 4KBOA 3VGMA 3VTHA 4CZEA 3DXMB 5F0XA 5HL7L 2FLOA 2KHOA 1GLJO 3LM2A 5TKYA 2QXLA 4B9QA 3KWGA 2PBDA 2QWNA 3UKUA 2QW9A 2P9PB 3E9PA 4Z94A 3F2KA 4BRDA 1W97L 3C0BA 4O8KA 3MN9A 2E1ZA 3CD6N 4CZJA 4JHDA 5JLFA 4CZMA 3C65A 2D1KA 3VEZA 3EL2A 3CF5L 2NRRA 5FPNA 4MDBA 2V51B 3F5TA 1NWKA 4RCHA 1NGFA 3M5RA 4FVUA 4IWVA 3VERA 5JICA 4WF9L 1R59O 2HBMA 4JAXA 4WQ5A 4BRLA 1XC3A 3ZYYX 4JKGA 4C1NK 1YJNN 1HKCA 4OPHA 1W2BM 3ENBA 1RFQA 3UKRA 1DT9A 3HOSA 3KWIA 3VENA 3RSEA 4GV6A 3H1QA 2NRZA 4DB3A 3FR0A 3T69A 5BPMA 2FSNA 1YF5L 3MMVA 1BUPA 5KPTA 4XJXA 1SQKA 4K43A 4CJ7A 2WBNA 4KH5A 2YJFA 1JCFA 4BROA 2HMPA 5ADXA 1BOTO 1SZ2A 1YI2N 3CJCA 4MDAA 3SMSA 4MO4A 5CE3A 3I33A 4FWLA 3EO3A 3ENOA 1Z6RA 1X3MA 1Q81O 3A8YA 4AM7A 3CIPA 2QWOA 2NLXA 5FPDA 3D2FA 1S72N 2UYTA 3KZBA 1KAYA 2CH5A 4FO0A 4JD2B 5AQGA 1N8RO 1NGHA 3L4QA 4CBWA 4EIAA 2ZGYA 4CZGA 2WUSA 3HM8A 3FZKA 4B1WB 2A3ZA 2P9NB 5E84A 3ZEUA 3C7NB 2JWKA 2Q31A 5LJWA 1HUXA 4EFHA 1YITN 1E4FT 1OKJA 5F1XA 2I7PA 2Q97A 4FOIA 3QB0A 2W40A 1HKBA 1O13A 3ULEA 3HRGA 4GNIA 5GAEP 3N4QA 1P90A 2F9WA 4EHTA 1T6CA 2QWQA 3MWTA 4YOYA 2ZWHA 2CGKA 4BG8A 1GLCG 3OBYA 3O80A 2NZTA 1G99A 3CCJN 4I6MA 5BREA 3EKUA 2FXUA 3A0IX 2V7ZA 1NJIO 3O9TA 4L3QA 5AQJA 3A5OC 4JKAA 1JCEA 4BQLA 3CCLN 1GLDG 2HBJA 2P9KA 5AZJA 3O08A 1K8KB 4WQ4A 5C12A 2QA4N 4IXCA 2GWJA 2YCHA 3D2EB 3TPQA 4DHYA 5KPRA 3O4WA 1TYQB 2VGMA 3C6HA 5AQMA 5DM6L 1MWMA 1HJOA 5BRDA 4B1XB 1MWKA 5DM7L 3E9OA 4IEEA 1TUYA 3WXKA 4BR7A 4JK7A 3ZX2A 1VQ6N 5C2FA 1NM1A 1VQ8N 4KH4A 5BN9A 1WUAA 2IIRA 3SJHA 4YOUA 1TUUA 3WXLA 3K9JA 3WXMB 3D6RA 5EOYA 4C1NI 3VEXA 1YJWN 3A5LC 2P9IA 2GTDA 4FWPA 4H5WA 4ILGB 3O8MA 4NO7A 3TU5A 4AM6A 1U2VB 4BRHA 4CD3A 4PHTX 4UY8O 3SAHA 5AZIB 1WOQA 1LOTB 2GEMA 4BRNA 3VETA 3EE9A 3FE1A 1QQNA 2QWPA 3W3DA 4RWTA 4JKCA 2A42A 4M7YA 1M90O 3WQTA 3G25A 2D0PA 3QFUA 3R1XA 2D4WA 4C23A 2ITMA 4B1ZA 1M1KO 1Z05A 3CC2N 3BUZB 5AQXA 5AQOA 2H3GX 2FSJA 3IMXA 3L0QA 4BEBA 5EX5A 3VEYA 3D7EO 1T6DA 3UKUB 3CCUN 2YHWA 4CBXA 3FZMA 2HBLA 4A57A 3LDNA 2KKZA 5JLHA 2GUPA 5CR4A 1GLFO 1VQ9N 2QI2A 1BDGA 4JKHA 3BEXA 3T7ZA 4JHDB 4BC2A 3L4IA 4IZ9A 4A62A 5FPEA 3JS6A 3G6EN 3C6AA 5H1SQ 1ATSA 1XQSC 2ASPA 2GX9A 3ENHA 4IOAL 1K9MO 1DEJA 3I55N 2C1GA 1P8ZA 5KQ8A 5GAHP 3ZX0A 4CI6A 5C15A 3H6EA 1SAZA 1NGCA 2NRHA 2HBKA 4H5NA 3ID8A 2OTLN 4A61A 1VAZA 4Y0WA 4WFBL 1BWFO 2QTDA 2ASOA 4H5RA 4B1YB 5BRHA 4BECA 3CERA 3H3OB 3OA9A 4JKGB 3VEWA 2AA4A 1ZXOA 2NRVA 3H3NO 4AF1A 1EQYA 3L6QA 1GLLO 1YVNA 3CJ1A 3LM9A 3IUCA 4PL8A 4BRMA 1VQPN 5AQKA 3RSEB 1C0GA 1ESVA 5ADXH 4FWNA 4GY2B 1NGEA 3WEEA 4E1JA 1YHQN 3CCSN 2P9PA 2VYPA 4PKHA 1LCUA 4BRCA 4BR0A 4WCEL 5C10A 2F7TA 3EN9A 4PKGA 3AY9A 2E8AA 3TSQA 4BQZA 3CC7N 5AQZA 2IVOA 4H03B 5E26A 2CH6A 4BRIA 1ZBSA 3O9SA 1YXQA 3ZETA 1RDUA 3CMEN 4IFEA 2ZJRL 3CQXA 2IVNA 4OO1J 3I56N 3U9ZA 3D2FB 1JCGA 3BP8A 2QWRA 3CCRN 4JKBA 4FPBA 1GLBG 1KAZA 3PIOL 4MLEA 2ZGZA 4MLHA 3CJ7A 4ISFA 1YUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJE A;  3ZEU B;  1X9J A;  2Q0U A;  1NBW A;  4BVP A;  1ZC6 A;  3GBT A;  4QS8 A;  2YI1 A;  1MDU B;  2V7Y A;  3H1V X;  3GL1 A;  4WYB A;  2YHX A;  3CI5 A;  4JN4 A;  3VPZ A;  1RDW X;  4DCH A;  5BPN A;  3GE1 A;  4FL9 A;  5AQR A;  5FPM A;  4H0Y B;  3MCP A;  4I6M B;  1C0F A;  4LC9 B;  1NGD A;  2P9S A;  3VF6 A;  3FFK B;  3UB5 A;  2P9U A;  1XUP O;  2VWB A;  2BTF A;  5AZJ B;  3O1W A;  1J6Z A;  5LJV A;  4XH4 A;  3LDQ A;  5AR0 A;  3MK6 A;  3AAR A;  2E2O A;  4NB4 A;  4EAH D;  4BRF A;  4H0O A;  4DQ8 A;  5AFU A;  3QFP A;  4PL7 A;  2A5X A;  2CGJ A;  2ZF5 O;  5I9E B;  4FWS A;  3SK3 A;  3BF1 A;  3O6W A;  3S41 A;  2EWS A;  3EKS A;  3R6M A;  5BR9 A;  4FWO A;  3M1F A;  4K25 A;  5AQQ A;  3HBT A;  2P9I B;  3QBX A;  4YDU C;  3GOI A;  3HTV A;  3M6G A;  3O1B A;  2YHY A;  3CJB A;  5KPZ A;  3LDO A;  3A5N C;  4BC5 A;  3O5B A;  1HX1 A;  3WUH A;  5AQV A;  1MA9 B;  3DXK A;  1QZ6 A;  4BR5 A;  1IJJ A;  1K8K A;  1BO5 O;  3U8X A;  4WQ4 C;  2F9T A;  3VF4 A;  3BF3 A;  4BRQ A;  4RTF D;  4XH1 A;  1IG8 A;  4XEI A;  3QDK A;  2A40 A;  2J4R A;  3U9D A;  4XH5 A;  4BVO A;  5ELZ A;  4H0V B;  2P9L A;  2FF6 A;  4H0P A;  3CET A;  2AP1 A;  4FOE A;  1U2V A;  3VGK A;  4HTL A;  3FZF A;  1CZA N;  4IJA A;  5AQL A;  3FZH A;  4H5V A;  1RGI A;  4H5T A;  2GEL A;  3MDQ A;  5AQS A;  3QML A;  3KVG A;  3HI0 A;  3M3Z A;  3FZL A;  3HZ6 A;  4BRG A;  3OHR A;  4BRP A;  4H0T B;  3B8A X;  3ZX3 A;  5AQN A;  3ATV A;  5AQT A;  4PKI A;  5EY4 A;  5KQD A;  3DXM A;  4FPA A;  4EHU A;  1QQM A;  3UKR B;  2V52 B;  3A5M C;  3WEE B;  4CZF A;  4BGA A;  2FF3 B;  2E88 A;  3LL3 A;  4O5F A;  4CZL A;  1ATN A;  3VF2 A;  2FSK A;  4BGB A;  1NGJ A;  1QHA A;  3AAQ A;  4B1U B;  3ZET B;  3F9M A;  5LY3 A;  4IJN A;  5AQW A;  2A6A A;  1NLV A;  2I7N A;  4F9O A;  3HSC A;  4FWQ A;  2VCP A;  2D0O A;  3CJA A;  2GWK A;  3DWL A;  3IDH A;  4CBU A;  5AQI A;  3SLC A;  5EVZ A;  2E20 A;  1T44 A;  4BR4 A;  3IFR A;  3JXU A;  5AQH A;  2E2Q A;  4CZH A;  4BG9 A;  2HOE A;  2HF3 A;  5AQP A;  4WQ5 C;  5B8H A;  1E4G T;  1H1V A;  4FWR A;  4B1V A;  2QWL A;  1V4T A;  2ASM A;  3LDP A;  2W41 A;  2E2N A;  3ULE B;  3R8E A;  4BC4 A;  2QM1 A;  3CHW A;  1D4X A;  1DGK N;  1ATR A;  1BG3 A;  1KAX A;  3WXJ A;  2P9S B;  5AFU H;  3H45 C;  2Q0R A;  1HPM A;  3VGL A;  2P9U B;  4M63 C;  4IO8 A;  2HF4 A;  4BR2 A;  2Q2R A;  3SMP A;  1NMD A;  1X3N A;  4J8F A;  4FSV A;  2P9K B;  3U4L A;  4BR9 A;  1DKG D;  2IVP A;  4BRA A;  1Q18 A;  3AAP A;  3DAW A;  3GG4 A;  4JD2 A;  3VEV A;  4BRK A;  3WXI A;  3P4I A;  4FWK A;  3QIC A;  3MN6 A;  1NGI A;  3VOV A;  3MN5 A;  2P9N A;  1YAG A;  4MO5 A;  3C7N A;  4YDU A;  3ATU A;  1QZ5 A;  4A2B A;  1NGG A;  4M7X A;  4K42 A;  3EZW A;  4HWI A;  1BU6 O;  3FGU A;  3I8B A;  1U6Z A;  5BPL A;  2A41 A;  4CZI A;  3QBW A;  4JNE A;  5AQY A;  3DXK B;  1Y64 A;  4QS7 A;  4A2A A;  3VES A;  1BA0 A;  4FWM A;  3VEO A;  1QQO A;  1NGB A;  4QS9 A;  2PAV A;  3R9P A;  4BC3 A;  2E2P A;  1HLU A;  3KHY A;  4H0X B;  4CZK A;  5JMV A;  3MN7 A;  4CD1 A;  5BRF A;  1HKG A;  3D2E A;  1BA1 A;  2CGL A;  3J8A A;  1V4S A;  5BN8 A;  1GLE G;  1TYQ A;  2P9L B;  4ISE A;  3GDQ A;  1NGA A;  3CJ9 A;  1KXP A;  4BRE A;  3DJC A;  5AQU A;  2DPN A;  1GLA G;  3LDL A;  4ISG A;  1S3X A;  2QWM A;  3UE5 A;  5AZI A;  2BUP A;  3H46 O;  2Q1N A;  3CQY A;  2E1Y A;  3WQU A;  3WT0 A;  2Q36 A;  3FLC O;  1S22 A;  5F2R A;  3W0L A;  5EXW A;  5AQF A;  2OAN A;  4K41 A;  4KBO A;  3VGM A;  4CZE A;  5F0X A;  3DXM B;  2FLO A;  2KHO A;  1GLJ O;  3LM2 A;  5TKY A;  2QXL A;  4B9Q A;  2PBD A;  2QWN A;  3UKU A;  2QW9 A;  2P9P B;  4Z94 A;  4BRD A;  3C0B A;  4O8K A;  3MN9 A;  2E1Z A;  4CZJ A;  4JHD A;  5JLF A;  4CZM A;  2D1K A;  3VEZ A;  3EL2 A;  5FPN A;  2V51 B;  1NWK A;  4RCH A;  1NGF A;  4IWV A;  3VER A;  5JIC A;  1R59 O;  4JAX A;  4BRL A;  4WQ5 A;  1XC3 A;  1HKC A;  1RFQ A;  3UKR A;  3VEN A;  3RSE A;  3H1Q A;  4DB3 A;  5BPM A;  3FR0 A;  2FSN A;  3MMV A;  1BUP A;  5KPT A;  1SQK A;  4K43 A;  4CJ7 A;  2YJF A;  1JCF A;  4BRO A;  2HMP A;  5ADX A;  1BOT O;  1SZ2 A;  3CJC A;  3SMS A;  4MO4 A;  5CE3 A;  3I33 A;  4FWL A;  3EO3 A;  3ENO A;  1Z6R A;  1X3M A;  3A8Y A;  4AM7 A;  3CIP A;  2QWO A;  2NLX A;  5FPD A;  3D2F A;  2UYT A;  3KZB A;  1KAY A;  2CH5 A;  4FO0 A;  4JD2 B;  5AQG A;  1NGH A;  4CBW A;  4EIA A;  2ZGY A;  4CZG A;  2WUS A;  3HM8 A;  3FZK A;  4B1W B;  2A3Z A;  2P9N B;  5E84 A;  3ZEU A;  3C7N B;  2Q31 A;  5LJW A;  1HUX A;  4EFH A;  1E4F T;  1OKJ A;  5F1X A;  2I7P A;  2Q97 A;  4FOI A;  3QB0 A;  2W40 A;  1HKB A;  3ULE A;  4GNI A;  2F9W A;  4EHT A;  1T6C A;  2QWQ A;  2ZWH A;  2CGK A;  4BG8 A;  1GLC G;  3O80 A;  2NZT A;  1G99 A;  4I6M A;  5BRE A;  3EKU A;  2FXU A;  3A0I X;  2V7Z A;  4L3Q A;  5AQJ A;  3A5O C;  4BQL A;  1JCE A;  1GLD G;  2P9K A;  5AZJ A;  3O08 A;  1K8K B;  4WQ4 A;  4IXC A;  2GWJ A;  2YCH A;  3D2E B;  3TPQ A;  4DHY A;  5KPR A;  3O4W A;  1TYQ B;  5AQM A;  1MWM A;  1HJO A;  5BRD A;  4B1X B;  1MWK A;  1TUY A;  3WXK A;  4BR7 A;  3ZX2 A;  1NM1 A;  5BN9 A;  1WUA A;  2IIR A;  3SJH A;  3WXL A;  1TUU A;  5EOY A;  3VEX A;  3A5L C;  2P9I A;  2GTD A;  4FWP A;  4H5W A;  4NO7 A;  3O8M A;  3TU5 A;  4AM6 A;  4BRH A;  1U2V B;  4CD3 A;  5AZI B;  1WOQ A;  1LOT B;  2GEM A;  4BRN A;  3VET A;  3FE1 A;  1QQN A;  2QWP A;  3W3D A;  4RWT A;  2A42 A;  4M7Y A;  3WQT A;  3G25 A;  2D0P A;  3QFU A;  2D4W A;  4C23 A;  2ITM A;  4B1Z A;  1Z05 A;  3BUZ B;  5AQX A;  5AQO A;  2H3G X;  2FSJ A;  3IMX A;  3L0Q A;  5EX5 A;  3VEY A;  3D7E O;  1T6D A;  3UKU B;  2YHW A;  4CBX A;  3FZM A;  3LDN A;  5JLH A;  2GUP A;  1GLF O;  1BDG A;  4BC2 A;  3BEX A;  4JHD B;  3L4I A;  4IZ9 A;  4A62 A;  5FPE A;  3JS6 A;  1ATS A;  1XQS C;  2ASP A;  3ENH A;  1DEJ A;  1P8Z A;  5KQ8 A;  3ZX0 A;  4CI6 A;  3H6E A;  1SAZ A;  1NGC A;  2NRH A;  4H5N A;  3ID8 A;  4A61 A;  4Y0W A;  1BWF O;  2ASO A;  4H5R A;  4B1Y B;  5BRH A;  3CER A;  3H3O B;  3VEW A;  2AA4 A;  1ZXO A;  3H3N O;  1EQY A;  3L6Q A;  1GLL O;  1YVN A;  3CJ1 A;  3LM9 A;  3IUC A;  4PL8 A;  4BRM A;  5AQK A;  3RSE B;  1C0G A;  1ESV A;  5ADX H;  4FWN A;  4GY2 B;  1NGE A;  3WEE A;  4E1J A;  2P9P A;  2VYP A;  4PKH A;  1LCU A;  4BRC A;  4BR0 A;  3EN9 A;  4PKG A;  3AY9 A;  2E8A A;  4BQZ A;  5AQZ A;  2IVO A;  4H03 B;  5E26 A;  2CH6 A;  4BRI A;  1ZBS A;  1YXQ A;  3ZET A;  3CQX A;  2IVN A;  3U9Z A;  3D2F B;  1JCG A;  3BP8 A;  2QWR A;  4FPB A;  1GLB G;  1KAZ A;  4MLE A;  2ZGZ A;  4MLH A;  3CJ7 A;  4ISF A;  1YUW A; 
#chains in the Genus database with same CATH topology
 2YJE A;  4PY5 A;  2BDP A;  1NOZ A;  5GAG P;  1RTD A;  4CJR A;  1TV6 A;  1O1W A;  1JL2 A;  3D0P A;  2Q0U A;  4BVP A;  1SKS A;  1K6Y A;  2YI1 A;  5M1O A;  3H1V X;  4JLH A;  4WYB A;  2YHX A;  3CI5 A;  3VPZ A;  3P83 D;  4ELU A;  4DSJ A;  4NCA A;  1LWE A;  3LDS A;  4YNQ A;  5M1F A;  1VQ7 N;  4KFB A;  4EP5 A;  2P9S A;  1SL2 A;  4CF0 A;  3UB5 A;  1NOY A;  1XUP O;  2VWB A;  3TSU A;  3NVK A;  3T3F A;  4XH4 A;  1E3M A;  4B9V A;  3MK6 A;  4F2S A;  2E2O A;  4H0O A;  2CGJ A;  5I9E B;  3O6W A;  2G8V A;  4GMJ B;  4CFB A;  3R6M A;  1ILY A;  3FFI A;  5AQQ A;  4IOC L;  4CJV A;  4FJK A;  3QBX A;  4YDU C;  2NNW A;  2ZQB A;  4J2A A;  3GOI A;  3HTV A;  2HHQ A;  5HP1 A;  4LF4 K;  3ZSY A;  4Z4H A;  3OTO K;  4FLZ A;  3QIO A;  3J80 O;  1HX1 A;  5AQV A;  3PV8 A;  4C8N A;  4K8Z A;  4CJQ A;  1QZ6 A;  1K8K A;  1KRP A;  3BF3 A;  4BRQ A;  1VSE A;  2I5J A;  4XEI A;  3O3F A;  3VQD A;  2J4R A;  5ELZ A;  4EZ6 A;  3CMA N;  3ID6 A;  1TK5 A;  1DTT A;  2RHK A;  4AIL C;  4OLB A;  2QK9 A;  4E7L A;  1DTQ A;  4FOE A;  1U2V A;  3G10 A;  5AQL A;  1RGI A;  2PFU A;  2RN2 A;  2GEL A;  2C1I A;  1UA1 A;  5AQS A;  3QML A;  3KVG A;  4F3O A;  4BRP A;  3ZX3 A;  5AQN A;  1HYV A;  3ATV A;  3LP2 A;  4FJ5 A;  3QER A;  1WSG A;  2NRX A;  3TSP A;  5KQD A;  3RMD A;  3CPE A;  1BGX T;  3WEE B;  4CZF A;  4TSX A;  4BGA A;  4KRE A;  3L8B A;  2PYJ A;  3JSM A;  3HVR A;  3LL3 A;  4O5F A;  4KTW A;  1ATN A;  4HVJ A;  4DFJ A;  5HRN A;  1WN7 A;  4B1U B;  4CHO A;  3ZT1 A;  5AQW A;  5CYQ A;  1ZYQ A;  4GV9 A;  1NLV A;  1U48 A;  3ZT2 A;  3KJV A;  4FWQ A;  4DR6 K;  2VCP A;  4A5A A;  1WSH A;  2G8H A;  4CBU A;  4M3Z A;  4DTJ A;  4X65 K;  1A5V A;  4OGC A;  3OY9 A;  3CCE N;  1IKW A;  2E4L A;  4B9U A;  1H1V A;  3CG7 A;  1HQE A;  4UQG A;  2ASM A;  3G71 N;  3VQQ A;  1IKY A;  3R8E A;  3KTQ A;  4U67 L;  2KLA A;  4LSN A;  3AO3 A;  2P9U B;  4A59 A;  4CJW A;  4OGE A;  4CER A;  4IO8 A;  5BR8 K;  3QET A;  1LW0 A;  4KH6 A;  1X3N A;  1T7P A;  4FSV A;  3TAG A;  2IAJ A;  4O0J A;  1FKP A;  4BDZ A;  2IGI A;  4OVL A;  4BRA A;  3AAP A;  3MEE A;  3DAW A;  1RTH A;  3VEV A;  3CQ8 A;  3WXI A;  3P4I A;  4YOW A;  5GIP A;  3P1G A;  4KB0 A;  4YDU A;  3CCQ N;  3ATU A;  4CCH A;  4CIE A;  3AA4 A;  3OYG A;  1W7A A;  4K42 A;  4FJG A;  3EZW A;  4DF4 A;  4HWI A;  2E6L A;  4JKD A;  4OPK A;  3QBW A;  4QS7 A;  4A2A A;  3Q7C A;  3F9K A;  3SBG A;  2RPI A;  3ZSV A;  1U49 A;  1TKT A;  4DF8 A;  3O3G A;  3KHY A;  2BH1 A;  4H0X B;  5JMV A;  4NXN K;  1U4B A;  4CD1 A;  4FYD A;  3HST B;  2CGL A;  3J8A A;  4R79 A;  4ISE A;  4CF9 A;  3GDQ A;  4JKF A;  5C2D A;  1NGA A;  2WC9 A;  4LD0 A;  4DSK A;  1U47 A;  2VG6 A;  4BRE A;  3DJC A;  5AQU A;  4OKE A;  1GLA G;  3ITH A;  4BWM A;  5AZI A;  2P5G A;  3CQY A;  5CY4 A;  2ZJQ L;  3THX B;  3NGY A;  5HRO A;  3P31 A;  5EXW A;  4ICL A;  4KBO A;  2B4J A;  2FLO A;  3F73 A;  2Z1J A;  4DFK A;  2QXL A;  4R5P A;  2PBD A;  2QW9 A;  2UUC K;  4DQS A;  2XY5 A;  4BRD A;  1W97 L;  4O8K A;  2E1Z A;  2HND A;  4JHD A;  4CGH A;  4CZM A;  5IWA K;  3C65 A;  1N5Y A;  2V51 B;  3F5T A;  4OKK A;  4DR2 K;  3M8S A;  5JIC A;  4LY7 A;  4C1N K;  1R0A A;  4DTS A;  3QES A;  3KKR A;  4DSI A;  4HUF A;  1KLM A;  4GV6 A;  1BQM A;  3IG1 A;  3H1Q A;  4DB3 A;  3HT3 A;  5KPT A;  1XI1 A;  3T1Y K;  1T8E A;  1HNV A;  4Q0B A;  4KH5 A;  4AQY K;  1WSJ A;  3AVK A;  1BOT O;  3MEC A;  1KVB A;  3V1O A;  3HXM A;  1HPZ A;  1RDC A;  4FWL A;  1ASU A;  1Z6R A;  3I0R A;  4M41 A;  2NLX A;  3TWH A;  1RDA A;  1IKX A;  4KI4 A;  1NNE A;  2UYT A;  2G8U A;  4W5R A;  4JD2 B;  5KRT A;  3L4Q A;  4CBW A;  2NUB A;  4CZG A;  3V81 A;  4FJL A;  2O8B A;  2VQF K;  3HM8 A;  4B1W B;  5E84 A;  3ZEU A;  4EFH A;  1YIT N;  1RCH A;  4I9L A;  4FOI A;  5EU7 A;  1HKB A;  1EXQ A;  4DG1 A;  2A1R A;  4CGF A;  3N4Q A;  1N36 K;  2O8F A;  4EHT A;  3MWT A;  1FW6 A;  2CGK A;  4DTU A;  1GLC G;  2XO7 A;  1S1U A;  5BRE A;  3A5O C;  2FBT A;  2HBJ A;  1TVR A;  1HRH A;  4CEF A;  3D2E B;  1TYQ B;  2VGM A;  3OYH A;  3KLF A;  4B1X B;  1S1W A;  1MWK A;  1NG9 A;  3QEV A;  3VQB A;  3NE6 A;  3WXK A;  4YY3 K;  1NM1 A;  1J5E K;  4DS4 A;  1VQ8 N;  3ZLJ A;  3SJH A;  1WUA A;  3O4N A;  4YOU A;  1Q8I A;  2P9I A;  3AVJ A;  4H5W A;  2Z1H A;  5CZ1 A;  2GEM A;  3KD5 E;  3FE1 A;  4DTX A;  4HUE A;  2D4W A;  4C23 A;  3NF9 A;  3DYA A;  5AQX A;  2H3G X;  3NBP A;  4E19 A;  1NJX A;  3D7E O;  4EZ9 A;  2HBL A;  4O44 A;  3LDN A;  2KKZ A;  3MAQ A;  1VQ9 N;  1XC9 A;  4BC2 A;  3BEX A;  3AA2 A;  3L4I A;  4IZ9 A;  5LMU K;  3KD1 E;  5H1S Q;  3RRH A;  1VSF A;  4CFD A;  1DEJ A;  4BDY A;  2AJQ A;  4DR4 K;  4ZHR A;  5GAH P;  1UAX A;  3H6E A;  1RTI A;  1NGC A;  2NRH A;  3TAR A;  1VAZ A;  4BEC A;  1GOA A;  4O5B A;  3OA9 A;  2ZE2 A;  1ZXO A;  2NRV A;  1EQY A;  4PL8 A;  4BRM A;  5AQK A;  1C0G A;  1QHT A;  1EP4 A;  2KZZ A;  3ZT0 A;  4GY2 B;  1WBD A;  4E1J A;  4RW7 A;  1TK0 A;  2VYP A;  4PKH A;  4BRC A;  1LCU A;  3L2R A;  1ZBF A;  2F7T A;  4E89 A;  1NK9 A;  3AY9 A;  4J2E A;  2GUI A;  1NJZ A;  1B9F A;  3CYG A;  4CK1 A;  1ZBL A;  1ZBS A;  1OH6 A;  3ZET A;  1RDU A;  1KCF A;  1W0H A;  4DFP A;  4E7H A;  1S9G A;  3JYT A;  4N41 A;  3EEQ A;  3S3N A;  4FPB A;  1GLB G;  4B9S A;  4MLH A;  5A2Q O;  3ZSQ A;  4ISF A;  3VMF B;  4C8M A;  3AO5 A;  3QIP A;  2OPS A;  1G15 A;  1ZC6 A;  4DV0 K;  4QS8 A;  4KHS A;  5GIO A;  3O9U A;  5FPM A;  2KTQ A;  4H0Y B;  3AVM A;  4I6M B;  1TL1 A;  4LC9 B;  3VF6 A;  4KHN A;  4V19 S;  3SJJ A;  3LPT A;  3PSI A;  2BTF A;  1RBT A;  4FK2 A;  4ELT A;  5HBM A;  3J7Z O;  5LJV A;  4AHU A;  4FVM A;  1JKH A;  3QFP A;  1SS6 A;  3SK3 A;  1BHL A;  1B9D A;  4NYN A;  1JXB A;  4BE2 A;  3PIP L;  4FWO A;  3S5T A;  4K25 A;  3HBT A;  4BE1 A;  4JI3 K;  3K5O A;  3CJB A;  5KPZ A;  3LDO A;  4E7I A;  3MWP A;  4Y1D A;  4BC5 A;  4CHN A;  2UXD K;  5GIN A;  1SUQ A;  4QCL A;  1HR0 K;  3DXK A;  3HOT A;  1A5X A;  1BI4 A;  4KHW A;  1YIJ N;  3OYL A;  1C0T A;  5CHI A;  4XH1 A;  2Y1I A;  2YKN A;  4LF5 K;  3N4P A;  3RTV A;  5FDL A;  4NXM K;  4IG0 A;  4DV2 K;  4XH5 A;  2QEX N;  4E1N A;  2P9L A;  1IKV A;  1RT6 A;  3CM5 A;  4ELV A;  4LFA K;  3BY5 A;  2AP1 A;  2XHB A;  1JL1 A;  3AO1 A;  1T3V A;  3AV9 A;  2O8E B;  4EP4 A;  1NU0 A;  3FZH A;  4H5V A;  4H5T A;  3V4I A;  3OBW A;  3CXC M;  4DQI A;  2Q3S A;  4B8A B;  4BRG A;  2HHS A;  3E66 A;  4JI1 K;  3CCV N;  3UKR B;  3B6P A;  4GV3 A;  2FF3 B;  1VSK A;  4JI4 K;  4CK3 A;  5M1K A;  2FSK A;  4BGB A;  1NGJ A;  2OPR A;  4RW8 A;  4KTZ A;  5LY3 A;  3CM6 A;  1TKZ A;  2QXF A;  4DR3 K;  3K9K A;  1D9F A;  4M42 A;  3CJA A;  5JS1 A;  3RVC A;  1NK5 A;  3IDH A;  5AQI A;  3SLC A;  5EVZ A;  4BR4 A;  1XHZ A;  5AQH A;  4X64 K;  3G4S N;  2E2Q A;  4BG9 A;  4HUG A;  2HF3 A;  5AQP A;  3S9H A;  5B8H A;  1E4G T;  4FWR A;  1J53 A;  4B1V A;  1S6P A;  2QWL A;  1V4T A;  3CPW M;  3LDP A;  3DLB A;  2W41 A;  2E2N A;  1CXQ A;  1HNX K;  3THY A;  1IBM K;  3QEX A;  2Q0R A;  1C1C A;  3AVC A;  4PQU A;  4DV3 K;  3V1R A;  2HF4 A;  2Q2R A;  4RW4 A;  4KHU A;  3VQ4 A;  1NMD A;  2HHV A;  3P38 A;  4J8F A;  1FK9 A;  2P9K B;  3TAE A;  1X9W A;  4DV5 K;  1DKG D;  2IVP A;  4PWD A;  4LSL A;  1Q18 A;  1RIL A;  2O4I A;  4G1Q A;  5I3U A;  4DV6 K;  1J5O A;  3MN6 A;  3MN5 A;  2P9N A;  4MO5 A;  3C7N A;  3DLR A;  3CCM N;  3OJU A;  1YT3 A;  1NGG A;  2GV9 A;  5E41 A;  1BU6 O;  3FGU A;  4Z0U A;  3I8B A;  1D8Y A;  1LWC A;  4CEC A;  4LH4 A;  5BPL A;  5K14 A;  4AHT A;  3NVM A;  3TR8 A;  3VEO A;  4FLW A;  1QQO A;  2A1S A;  3O4Q A;  3HYF A;  2PAV A;  4QS9 A;  1U45 A;  3OYE A;  1BIU A;  4YOX A;  3LP0 A;  3D45 A;  1HNZ K;  3TTC A;  3OS2 A;  1BA1 A;  4IG3 A;  5BN8 A;  1GLE G;  2OA8 A;  1BIS A;  4FJM A;  3MX2 A;  1VQ5 N;  3CJ9 A;  1KXP A;  1N32 K;  2DPN A;  2HVI A;  1Q9Y A;  3O9Q A;  4BE0 A;  1EX4 A;  1S3X A;  3G0Z A;  2QWM A;  4DU4 A;  3KK7 A;  4FJ8 A;  3V9S A;  1QTM A;  2Q1N A;  3HM9 A;  3WQU A;  3WT0 A;  5F2R A;  3W0L A;  3B6O A;  4CJU A;  5M1Q A;  3HPG A;  1NJY A;  3VGM A;  3VTH A;  4DUY K;  3DXM B;  4LFB K;  2ETJ A;  4FCY A;  2WON A;  3S3O A;  2KHO A;  5TKY A;  3I0S A;  3O3H A;  2P9P B;  4Z94 A;  3L3U A;  4DSF A;  1RT2 A;  4CF8 A;  4CZJ A;  3PX0 A;  3QNO A;  2B5J A;  1VSH A;  3OYC A;  3VEZ A;  3EL2 A;  2NRR A;  1NJW A;  4RCH A;  3M5R A;  3TAQ A;  3VER A;  1R59 O;  2HBM A;  4JAX A;  4BRL A;  2RKI A;  1WSI A;  3ZYY X;  3T1H K;  3SZ2 A;  1GOC A;  4DR7 K;  4DTP A;  4OPH A;  1W2B M;  1RBV A;  4YFU A;  3UKR A;  3J7A P;  3KWI A;  5DK5 A;  4LF9 K;  3T69 A;  1W9H A;  1SQK A;  4CJ7 A;  2E6M A;  2YJF A;  3MXJ A;  2HHT A;  2DY4 A;  2KW4 A;  1L5U A;  3S3M A;  1YI2 N;  5J2M A;  3VN5 A;  5CE3 A;  3DRR A;  3SUN A;  4B08 A;  1KFS A;  3CIP A;  5FPD A;  3D2F A;  2O8D A;  1KAY A;  4RW6 A;  5AQG A;  5J2Q A;  2XY7 A;  1E4F T;  1OKJ A;  5F1X A;  3QB0 A;  3V9W A;  1QE1 A;  1LV5 A;  1TAU A;  2F9W A;  3TAP A;  1T6C A;  2ZWH A;  2G8W A;  3KLI A;  3OS1 A;  1N6Q A;  3OBY A;  3O80 A;  1G99 A;  2Z1G A;  3U3Y A;  2V7Z A;  4IFY A;  5AQJ A;  2P9K A;  1C0U A;  4DTN A;  2QA4 N;  1IBL K;  3K0S A;  4IXC A;  3L2W A;  4YHH K;  1WB9 A;  2P1J A;  3LWM A;  5DM6 L;  4FXD A;  5DM7 L;  3E9O A;  1KLN A;  4O0I A;  5DMR A;  4F2R A;  4BR7 A;  4DQR A;  3ZX2 A;  3QIN A;  4C8L A;  4CJP A;  4KH4 A;  3U6F A;  3WXL A;  3VQA A;  3K9J A;  3WXM B;  3A5L C;  1NKE A;  4NO7 A;  4M3R A;  4CJF A;  4UY8 O;  4CD3 A;  4C8K A;  2D0P A;  2ITM A;  5SWM A;  3BUZ B;  2FSJ A;  3L0Q A;  3TAF A;  3AVH A;  3VEY A;  1S6Q A;  4JRP A;  5CZ2 A;  3UKU B;  4AHS A;  2W6K A;  2YHW A;  4CBX A;  3FZM A;  2ATQ A;  4OX9 K;  2GUP A;  2QI2 A;  1BDG A;  3T7Z A;  3CCL N;  3G6E N;  3JS6 A;  4W5T A;  4KRF A;  4IOA L;  1XQS C;  3ENH A;  1K9M O;  3KK1 A;  1SKR A;  4LF6 K;  5J2N A;  2HHU A;  4H8K A;  3K57 A;  2HHI A;  3ZX0 A;  1WAF A;  5C15 A;  3VA0 A;  1SAZ A;  4H5N A;  4I7F A;  2HBK A;  5J2P A;  3ID8 A;  3OYM A;  4WFB L;  2DTU A;  2ASO A;  2FBY A;  3CER A;  1XNR K;  4JKG B;  4B9T A;  4FJ7 A;  3H3N O;  4M3X A;  2IOC A;  1NK7 A;  4ZTJ A;  4AHR A;  2F4V K;  4FW1 A;  3RSE B;  4FJH A;  1ESV A;  4Z4I A;  3WEE A;  1YHQ N;  3TAM A;  2P9P A;  4CF2 A;  3CCS N;  1UOC A;  4FJ9 A;  4PKG A;  3UIQ A;  4DS5 A;  2E8A A;  3KKS A;  2VWK A;  4BQZ A;  2UXB K;  3VQ6 A;  5E26 A;  2CH6 A;  3O9S A;  3CME N;  3SQ1 A;  2IVN A;  4CEZ A;  5LMN K;  3BP8 A;  2QWR A;  4JKB A;  3SCX A;  3PIO L;  2O8C B;  1KAZ A;  2GBZ A;  2ZGZ A;  3OYF A;  2OZS A;  5D3G A;  4W5Q A;  5CYM A;  1QSL A;  1HMV A;  4KI6 A;  1X9J A;  5C24 A;  2F8S A;  3MCA B;  3EYZ A;  1NBW A;  3GBT A;  5FRM A;  3GL1 A;  3CC4 N;  5BPN A;  4JN4 A;  3AVG A;  4FJX A;  4CGG A;  2IDO A;  5M1P A;  5M1N A;  3CYM A;  1C0F A;  4JS4 A;  1TKD A;  3FFK B;  3M8R A;  3SQ0 A;  1JJ2 M;  3Q7B A;  1HNW K;  2P9U A;  2HNY A;  2XRI A;  1I94 K;  5AZJ B;  3O1W A;  1J6Z A;  4CES A;  4GVE A;  3SPY A;  1FJG K;  1SV5 A;  4OKJ A;  3AVA A;  1ZBI A;  3AAR A;  4EAH D;  5AFU A;  4BRF A;  4PL7 A;  2A5X A;  4FJI A;  1VSJ A;  4FWS A;  2JWL A;  1VK0 A;  2VQE K;  3LAL A;  2YX6 A;  2EWS A;  1VQO N;  4CK2 A;  1TL3 A;  3C95 A;  4JEP A;  4LF8 K;  1MU2 A;  4AH9 A;  1WAJ A;  4M3Y A;  3AVL A;  1DLO A;  3AA5 X;  3TI0 A;  4FJN A;  3CFP A;  3O5B A;  1N34 K;  3AA3 A;  3WUH A;  3NF6 A;  1NK4 A;  4CJL A;  4BR5 A;  1IJJ A;  3QEI A;  1BO5 O;  1RT1 A;  3U8X A;  4WQ4 C;  4I9Q A;  2F9T A;  4E7J A;  3NMU A;  2DFE A;  5C42 A;  4NLB A;  4RTF D;  4JV5 K;  5J1E A;  4FM1 A;  2HHW A;  3QDK A;  3LWL A;  4YOR A;  1Q9X A;  3P39 A;  4BVO A;  1QSY A;  4H0V B;  4B9L A;  3AGR A;  4Z4E A;  4NLC A;  4CHP A;  5KGX A;  4IJA A;  3J81 O;  4MQ3 A;  3EZ5 A;  3QEP A;  3HP9 A;  3FZL A;  3HZ6 A;  3OHR A;  4H0T B;  3B8A X;  4OPJ A;  3THX A;  5AQT A;  4OJR A;  1KVC A;  2ZD1 A;  2HHX A;  5EY4 A;  1LAV A;  4FPA A;  4EHU A;  1QQM A;  4JI0 K;  3BZC A;  3A5M C;  4CEE A;  4DR5 K;  4DTO A;  3VQC A;  4CF1 A;  4CZL A;  3SUQ A;  1D9D A;  5JVH L;  4JYA K;  3VF2 A;  1N33 K;  3AAQ A;  4IDH A;  1C0M A;  4CHQ A;  3SAF A;  3NH2 A;  1WSF A;  2I7N A;  3DLK A;  3IS9 A;  4B3T K;  2OZM A;  2NRW A;  2D0O A;  1EWR A;  2GWK A;  1JLF A;  3KLE A;  3ZSX A;  3I8D A;  1NK6 A;  2E20 A;  1T44 A;  2LSN A;  3JXU A;  1C1B A;  4CZH A;  3V9Z A;  1VQ4 N;  2HVH A;  4FLT A;  4JI7 K;  1ASW A;  4WQ5 C;  2OTJ N;  3E1Y A;  2Y1J A;  4O55 A;  4JK9 A;  5KTQ A;  4KHP K;  4CIF A;  3HVT A;  5FLX O;  3WNF A;  4DMN A;  1L3V A;  4E7K A;  2G8F A;  2YHA A;  4Z4C A;  2IS3 A;  2QM1 A;  3CHW A;  1D4X A;  1DGK N;  1KAX A;  4O4G A;  2P9S B;  3PLA A;  5AFU H;  3RMA A;  4AHC A;  1HPM A;  4DLE A;  3VGL A;  2ITG A;  2VGN A;  1EO1 A;  1VRU A;  4CFA A;  1C1A A;  4X66 K;  4FK4 A;  4JK8 A;  3U4L A;  4BR9 A;  4FZX C;  3GG4 A;  4H4M A;  4ID1 A;  4JD2 A;  1NKB A;  4FWK A;  4FLV A;  3QIC A;  4M3U A;  1NGI A;  3VOV A;  1YAG A;  1ZBH A;  1BCM A;  4B3O A;  3MX5 A;  5C0Y A;  4I2Q A;  1EKE A;  1KD1 O;  1U6Z A;  4DU1 A;  4CZI A;  4KPY A;  4JNE A;  4E0D A;  1Y64 A;  4CHY A;  4U7B A;  3L2V A;  4RW9 A;  1RBS A;  5KI6 A;  1NGB A;  3CFO A;  1HYS A;  1JLC A;  2X78 A;  2X6S A;  4CZK A;  3RRG A;  3SNN A;  3MXM A;  5BRF A;  4Z4G A;  3D2E A;  4IO9 L;  2UU9 K;  1V4S A;  1VSL A;  1KC8 O;  1TYQ A;  5TKW A;  1C6V A;  1KTQ A;  2WTU A;  3PX4 A;  3VQ8 A;  1UA0 A;  4JI2 K;  3SQ2 A;  3HPO A;  3SPZ A;  5HLF A;  3DMJ A;  3LDL A;  1BL3 A;  4FLU A;  3RMC A;  1XNQ K;  4CEB A;  3IKM A;  4GKK K;  3UE5 A;  3TTF A;  3NGI A;  4W5N A;  1ZBU A;  1KQS M;  1K8A O;  1S22 A;  4A5B A;  3WNG A;  3OS0 A;  3NH1 A;  3KK3 A;  1JLG A;  3LM2 A;  2E5L K;  1CLQ A;  3E9P A;  3ZT4 A;  1D5A A;  1TGO A;  3F2K A;  3LP3 A;  4ZTF A;  1WSE A;  2QKK A;  3IAY A;  4JRQ A;  2PYL A;  1Y97 A;  2VWJ A;  5FPN A;  3K5L A;  4MDB A;  3RMB A;  1NWK A;  1VSD A;  5FRO A;  3ZSO A;  4IWV A;  2FBV A;  5LL6 Z;  4B9N A;  1L3T A;  1OVQ A;  4WQ5 A;  1F21 A;  1OH8 A;  1YJN N;  4F3T A;  4CHZ A;  3DOK A;  4B9M A;  4I2P A;  3BDP A;  3ENB A;  3NHG A;  1ASV A;  1VSM A;  4E72 A;  2NRZ A;  1YF5 L;  1BUP A;  4FZY A;  4F4K A;  1JLE A;  4KO0 A;  4ID5 A;  4NCG A;  2WBN A;  3THV A;  1I3A A;  4KAZ A;  1JCF A;  4BRO A;  4N47 A;  4CE9 A;  1SZ2 A;  3CJC A;  1IO2 A;  4MDA A;  4CJS A;  4MO4 A;  4FJJ A;  3I33 A;  3EO3 A;  1FKO A;  3K2P A;  1RT3 A;  3VQE A;  1Q81 O;  4AM7 A;  4DFM A;  2QWO A;  3DM2 A;  3KLH A;  1N8R O;  4EIA A;  2WUS A;  3FZK A;  1YTA A;  2Q31 A;  1HUX A;  3QO9 A;  2W40 A;  1HQU A;  1O13 A;  4DSL A;  5GAE P;  1P90 A;  1RDD A;  4LH5 A;  3DRS A;  4YOY A;  4KB1 A;  4I6M A;  4QOZ B;  2FXU A;  1CZ9 A;  3A0I X;  4JI5 K;  4CFC A;  4L3Q A;  3NGZ A;  4BQL A;  4JKA A;  1JCE A;  1GLD G;  5C12 A;  4JI8 K;  3TPQ A;  2YNI A;  5KPR A;  5AQM A;  1MWM A;  1HJO A;  1TUY A;  4JK7 A;  1WNS A;  1REV A;  1VQ6 N;  4J2B A;  2IIR A;  3L3V A;  3LP1 A;  3D6R A;  3V9U A;  3VEX A;  4HHT A;  1YJW N;  3PO4 A;  4ILG B;  4BRH A;  3O8M A;  1B92 A;  4PHT X;  2P5O A;  3SAH A;  4N56 A;  2RF2 A;  5AZI B;  1WOQ A;  2PZS A;  4DWI A;  2QWP A;  3W3D A;  1ITG A;  4JKC A;  4RWT A;  2A42 A;  1NMN A;  1M90 O;  2OPQ A;  3WQT A;  3R1X A;  3VQ7 A;  4B1Z A;  4DTM A;  4DUZ K;  3SYZ A;  3ASM A;  3IMX A;  4BEB A;  1T6D A;  3CCU N;  1RT5 A;  1TAQ A;  4JHD B;  4HTU A;  4A62 A;  5FPE A;  3C6A A;  2GX9 A;  3OYB A;  1GOB A;  2DFH A;  1P8Z A;  4OLA A;  1CZB A;  4CIG A;  2OTL N;  3OJS A;  2XY6 A;  2O8E A;  4A61 A;  3ZSW A;  4Y0W A;  1BWF O;  1WBB A;  2X74 A;  5BRH A;  3AVB A;  3C6U A;  3VEW A;  1GLL O;  1YVN A;  3TAN A;  3ZCM A;  2R7Y A;  3CJ1 A;  3LM9 A;  1RNH A;  3IUC A;  1XMO K;  1VQP N;  1JLA A;  1NGE A;  3VQ5 A;  4DR1 K;  4B3M K;  4WCE L;  3EN9 A;  3PX6 A;  4H4O A;  4DQP A;  1S9E A;  2VG5 A;  1J54 A;  3LPU A;  3CC7 N;  2IVO A;  2W42 A;  4KHY A;  1Z26 A;  4BRI A;  1YXQ A;  5HRP A;  4IFE A;  2ZJR L;  1TKX A;  4OO1 J;  1RT7 A;  3I56 N;  4MFB A;  1JCG A;  3CCR N;  4B8C A;  4F8R A;  3DRP A;  2O8B B;  3TTD A;  3ZEU B;  2ZM6 K;  2HHH K;  3THW B;  5JEN A;  4IEI A;  1MDU B;  2V7Y A;  2O8F B;  4DCH A;  1RDW X;  3GE1 A;  3OYI A;  3JAM O;  4FL9 A;  5AQR A;  5FRN A;  3MCP A;  3PY8 A;  1RT4 A;  2WFB A;  2UXC K;  1NGD A;  2F96 A;  4FW2 A;  5HOO A;  4K0K K;  3HP6 A;  3LDQ A;  5AR0 A;  1KVA A;  4CEQ A;  4NB4 A;  3VA3 A;  4DQ8 A;  2ZF5 O;  4DV4 K;  1I39 A;  3BF1 A;  3S41 A;  1EET A;  3EKS A;  5BR9 A;  5AJ3 K;  1X1P A;  3M1F A;  2P9I B;  1VRT A;  1NK8 A;  1QQC A;  3OYD A;  3M6G A;  1HYZ A;  3O1B A;  2YHY A;  3KK2 A;  3LAK A;  1L3S A;  3E9L A;  3A5N C;  4WE1 A;  2YNG A;  1OVY A;  3SV3 A;  2OPP A;  3IRX A;  2W00 A;  4N76 A;  3SAG A;  1MA9 B;  3VTI A;  2BGG A;  4DV7 K;  3AVI A;  4PA1 A;  3VF4 A;  1IG8 A;  3AVN A;  1WLJ A;  3LAM A;  1RDB A;  4CW7 B;  1IBK K;  1VQM N;  2A40 A;  3U9D A;  2JGU A;  2OYQ A;  4J2D A;  1T05 A;  2FF6 A;  4KKO A;  4H0P A;  4FLX A;  3CET A;  3AGK A;  4CEO A;  2YNH A;  2WOM A;  4HTL A;  3VGK A;  2HST A;  3FZF A;  1CZA N;  3T1A A;  2IC3 A;  1IG9 A;  2RE2 A;  3MDQ A;  1EWQ A;  3A2F A;  4LF7 K;  1UWB A;  3NH0 A;  3EE8 A;  4LFC K;  3HI0 A;  3M3Z A;  1VQL N;  4BE7 B;  3VQ9 A;  3WNE A;  5SZT A;  4PKI A;  2PY5 A;  3DXM A;  4ILJ A;  2V52 B;  1VQN N;  4KV8 A;  3SBT A;  2E88 A;  1QS4 A;  1HNI A;  4O8U A;  2BAN A;  1Q82 O;  4DV1 K;  4GW6 A;  3DLH A;  4CGD A;  3HK2 A;  4G9Z A;  1QHA A;  3ZET B;  3F9M A;  3AVF A;  4IJN A;  1NKC A;  2A6A A;  4F9O A;  4CVN E;  4DLG A;  3HSC A;  4BAC A;  3CFR A;  4BDP A;  3DWL A;  4QAG A;  4WFN L;  3QLH A;  3IFR A;  1CXU A;  1NK0 A;  5IT9 O;  2HOE A;  3OW2 M;  5GAD P;  1K73 O;  3ALY A;  2HNZ A;  3BZK A;  1VQK N;  1SL1 A;  4YOT A;  1RBR A;  4CEA A;  4CJ3 A;  4DKW A;  3TAB A;  4Z4F A;  4FK0 A;  2QKB A;  3U3G A;  4XIU A;  4L8R B;  3ULE B;  4KTQ A;  1HJR A;  1SL0 A;  4BC4 A;  3NF7 A;  4ILH A;  2X6N A;  4DSE A;  1YJ9 N;  1Q7Y O;  4IDK A;  1ATR A;  1BG3 A;  3T19 A;  3WXJ A;  3H45 C;  4M3T A;  2NRT A;  1QVF M;  3V9X A;  3LZI A;  2YNF A;  5C25 A;  1TK8 A;  4M63 C;  3HPH A;  4BR2 A;  5T7B A;  5MLC Q;  2YKM A;  3SMP A;  3NFA A;  4CGI A;  3R3L A;  4CJ4 A;  4BRK A;  3LAN A;  5KRS A;  3THW A;  2B6A A;  1Q86 O;  1QVG M;  3K58 A;  1KFD A;  1QZ5 A;  2ZJP L;  4B3S K;  4BY9 C;  4A2B A;  4M7X A;  5HRS A;  3DI6 A;  4YOV A;  3KLG A;  5JVG L;  4IOX A;  3RR7 A;  2A41 A;  1T03 A;  2EHG A;  4OPA A;  4X62 K;  5AQY A;  3DXK B;  4WFA L;  1S5J A;  4Q5V A;  2Z1I A;  3VES A;  4CJK A;  1BI4 B;  1BA0 A;  4FWM A;  3DLL L;  5JS2 A;  3R9P A;  4BC3 A;  2E2P A;  1HLU A;  3MN7 A;  4BWJ A;  1HKG A;  3MXI A;  3NDK A;  3QNN A;  2P9L B;  1XWL A;  3K5N A;  4E3S A;  3DLE A;  2YV0 X;  4W5O A;  4ISG A;  4N5S A;  3O9R A;  4JKE A;  3MED A;  5HRR A;  3DOL A;  3L2Q A;  2UUB K;  2FC0 A;  2BUP A;  3H46 O;  3QEW A;  4C8O A;  2E1Y A;  3M8Q A;  1BCO A;  3PUF A;  2Q36 A;  3FLC O;  3NCI A;  3OYA A;  5AQF A;  2OAN A;  4K41 A;  4CZE A;  5F0X A;  4JI6 K;  5HL7 L;  4CED A;  1YTU A;  1GLJ O;  3NAE A;  3C6T A;  4B9Q A;  1RBU A;  3KWG A;  3K5M A;  1XHX A;  2QWN A;  3UKU A;  4E1M A;  4GVM A;  5KGW A;  3C0B A;  1VSI A;  3MN9 A;  3CD6 N;  2KQ2 A;  5JLF A;  3OVN A;  4CGJ A;  2D1K A;  3CF5 L;  3LZJ A;  2UUA K;  4NCB A;  2D5R A;  1NGF A;  3AO4 A;  4FVU A;  3EY1 A;  1LW2 A;  1S1V A;  3DLG A;  4WF9 L;  1L3U A;  1XC3 A;  3MEG A;  4JKG A;  4GKJ K;  1HKC A;  1U04 A;  1RFQ A;  2EX3 A;  1DT9 A;  2KZM A;  3HOS A;  3WNH A;  2VG7 A;  3RSE A;  3VEN A;  1OH7 A;  3OYN A;  3ZSZ A;  5BPM A;  3FR0 A;  3RR8 A;  4HCC A;  2FSN A;  3MMV A;  4IFV A;  3OYK A;  4XJX A;  3THY B;  4K43 A;  3L2U A;  2YHB A;  2HMP A;  3HJF A;  5ADX A;  4CJT A;  1X9M A;  2HW3 A;  3SMS A;  2FBX A;  3ENO A;  3ULD A;  1X3M A;  3A8Y A;  3SUO A;  2P51 A;  1S72 N;  1A5W A;  3PO5 A;  2O8C A;  3KZB A;  2CH5 A;  4FO0 A;  1IH7 A;  1NGH A;  2D0B A;  4FLY A;  2ZGY A;  2A3Z A;  2P9N B;  3C7N B;  2JWK A;  5LJW A;  1KSP A;  2I7P A;  2Q97 A;  3ULE A;  3HRG A;  4GNI A;  4B3R K;  3VQP A;  4FM0 A;  2QWQ A;  4BG8 A;  1J9A A;  2NZT A;  3CCJ N;  3EKU A;  1JLB A;  3O9T A;  1NJI O;  3PSF A;  1JXE A;  1SKW A;  5AZJ A;  4M3W A;  3O08 A;  1K8K B;  4WQ4 A;  3SUP A;  2GWJ A;  2YCH A;  2DFF A;  4DHY A;  3O4W A;  3C6H A;  3RWU A;  4JS5 A;  5BRD A;  4IEE A;  4CJ5 A;  4HCB A;  3V1Q A;  3C94 A;  5C2F A;  5BN9 A;  1TUU A;  2D0A A;  5EOY A;  4C1N I;  3ISN C;  2GTD A;  4FWP A;  3TU5 A;  4AM6 A;  3J7Y P;  3V6D A;  1U2V B;  4PUO A;  2G8I A;  1BIZ A;  1LOT B;  4BRN A;  3VET A;  3EE9 A;  2KFN A;  1QQN A;  2G8K A;  4M7Y A;  3G25 A;  3QFU A;  1M1K O;  1Z05 A;  3CC2 N;  4RG8 A;  5AQO A;  1S1T A;  2JLE A;  5EX5 A;  4IKF A;  2OCE A;  3P5J A;  4FZZ A;  1OH5 A;  1XMQ K;  4A57 A;  5JLH A;  5CR4 A;  4FM2 A;  4DQQ A;  1GLF O;  3NF8 A;  2W6L A;  4JKH A;  2HMI A;  1LAW A;  3OYJ A;  4IBN A;  3E01 A;  4DU3 A;  2F8T A;  1ATS A;  2ASP A;  4M45 A;  4NYF A;  3I55 N;  2C1G A;  3ZSR A;  5KQ8 A;  1IV0 A;  2XY8 A;  4CI6 A;  2QTD A;  4H5R A;  4B1Y B;  3H3O B;  3HO1 A;  2AA4 A;  1YVU A;  4AF1 A;  3L6Q A;  1BQN A;  1Z25 A;  2KFZ A;  2BE2 A;  3SQ4 A;  1LWF A;  1S1X A;  1X9S A;  1VHX A;  5ADX H;  4KHQ A;  2HB5 A;  4FWN A;  3KIO A;  3K59 A;  3M8P A;  4BR0 A;  4Y1C A;  5C10 A;  5I42 A;  3H08 A;  1JLQ A;  4K8X A;  3TSQ A;  3SV4 A;  5AQZ A;  4H03 B;  4AHV A;  4CJE A;  2D0C A;  3BGR A;  3AO2 A;  1RTJ A;  3HL8 A;  3CQX A;  3U9Z A;  3D2F B;  2O4G A;  2O8D B;  1FXX A;  4MLE A;  1QSS A;  3ZT3 A;  3CJ7 A;  4DTR A;  3SI6 A;  1YUW A; 
#chains in the Genus database with same CATH homology
 2YJE A;  3TTD A;  3VMF B;  3ZEU B;  1X9J A;  5GAG P;  3MCA B;  2Q0U A;  1NBW A;  4BVP A;  1ZC6 A;  4IEI A;  3GBT A;  4QS8 A;  2YI1 A;  5M1O A;  1MDU B;  2V7Y A;  3H1V X;  3GL1 A;  4WYB A;  2YHX A;  3CI5 A;  4JN4 A;  3VPZ A;  1RDW X;  4DCH A;  5BPN A;  3GE1 A;  3CC4 N;  5GIO A;  3O9U A;  4FL9 A;  5AQR A;  5FPM A;  4H0Y B;  5M1P A;  5M1F A;  5M1N A;  3MCP A;  1VQ7 N;  4I6M B;  1C0F A;  4LC9 B;  2WFB A;  1NGD A;  2P9S A;  3VF6 A;  3FFK B;  1JJ2 M;  3Q7B A;  3UB5 A;  2P9U A;  1XUP O;  2VWB A;  2BTF A;  5AZJ B;  3O1W A;  3TSU A;  3NVK A;  1J6Z A;  3J7Z O;  4GVE A;  5LJV A;  5HOO A;  4XH4 A;  3LDQ A;  5AR0 A;  3MK6 A;  3AAR A;  2E2O A;  4NB4 A;  4EAH D;  4BRF A;  4H0O A;  4DQ8 A;  5AFU A;  3QFP A;  4PL7 A;  2A5X A;  2CGJ A;  2ZF5 O;  5I9E B;  4FWS A;  1SS6 A;  3SK3 A;  3BF1 A;  2JWL A;  3O6W A;  3S41 A;  2YX6 A;  2EWS A;  1VQO N;  3EKS A;  3R6M A;  5BR9 A;  3PIP L;  4FWO A;  4JEP A;  1ILY A;  3M1F A;  4K25 A;  5AQQ A;  3HBT A;  2P9I B;  4IOC L;  3QBX A;  4YDU C;  2NNW A;  3GOI A;  3HTV A;  3M6G A;  3O1B A;  2YHY A;  3CJB A;  5KPZ A;  3LDO A;  3E9L A;  3A5N C;  3MWP A;  4BC5 A;  1OVY A;  3O5B A;  5GIN A;  2W00 A;  1HX1 A;  3WUH A;  5AQV A;  3SAG A;  1MA9 B;  3VTI A;  3DXK A;  1QZ6 A;  4BR5 A;  1IJJ A;  3HOT A;  1K8K A;  1BO5 O;  3U8X A;  4WQ4 C;  2F9T A;  3VF4 A;  1YIJ N;  3NMU A;  3BF3 A;  4BRQ A;  4NLB A;  4RTF D;  4XH1 A;  1IG8 A;  5CHI A;  4XEI A;  3N4P A;  3QDK A;  1VQM N;  2A40 A;  2J4R A;  4YOR A;  4XH5 A;  3P39 A;  3U9D A;  4BVO A;  2QEX N;  5ELZ A;  4H0V B;  3CMA N;  2P9L A;  3ID6 A;  2FF6 A;  3AGR A;  2RHK A;  4H0P A;  3CET A;  3AGK A;  4NLC A;  2AP1 A;  4FOE A;  1T3V A;  1U2V A;  3VGK A;  4HTL A;  2HST A;  3FZF A;  1CZA N;  4IJA A;  5AQL A;  3FZH A;  4H5V A;  1RGI A;  2PFU A;  2RE2 A;  4H5T A;  2GEL A;  2C1I A;  3MDQ A;  5AQS A;  3OBW A;  3CXC M;  3QML A;  3EE8 A;  3KVG A;  3HI0 A;  3M3Z A;  1VQL N;  3FZL A;  3HZ6 A;  4BRG A;  3OHR A;  4BE7 B;  4BRP A;  4H0T B;  3B8A X;  3ZX3 A;  3E66 A;  5AQN A;  3ATV A;  5AQT A;  3CCV N;  4PKI A;  5EY4 A;  2NRX A;  3TSP A;  5KQD A;  3DXM A;  4FPA A;  3CPE A;  1QQM A;  4ILJ A;  2V52 B;  3A5M C;  3UKR B;  3WEE B;  4CZF A;  4EHU A;  4BGA A;  4GV3 A;  1VQN N;  2FF3 B;  3SBT A;  2E88 A;  4O8U A;  3LL3 A;  4O5F A;  1Q82 O;  4CZL A;  1ATN A;  5M1K A;  5JVH L;  3VF2 A;  2FSK A;  4BGB A;  1NGJ A;  4G9Z A;  1QHA A;  3AAQ A;  4B1U B;  4IDH A;  3ZET B;  3F9M A;  5LY3 A;  4IJN A;  5AQW A;  4GV9 A;  3SAF A;  2A6A A;  1NLV A;  2I7N A;  4F9O A;  3K9K A;  3HSC A;  4FWQ A;  2VCP A;  2NRW A;  2D0O A;  3CJA A;  4A5A A;  3RVC A;  2GWK A;  3DWL A;  3IDH A;  4CBU A;  5AQI A;  3SLC A;  5EVZ A;  2E20 A;  1T44 A;  4BR4 A;  4WFN L;  3IFR A;  3JXU A;  5AQH A;  3G4S N;  2E2Q A;  4CZH A;  4BG9 A;  2HOE A;  1VQ4 N;  2HF3 A;  5AQP A;  3OW2 M;  5GAD P;  4WQ5 C;  1K73 O;  3CCE N;  2OTJ N;  3E1Y A;  5B8H A;  1E4G T;  4JK9 A;  1H1V A;  4FWR A;  1VQK N;  4B1V A;  4YOT A;  4DKW A;  2QWL A;  1V4T A;  3CPW M;  2ASM A;  3LDP A;  3G71 N;  2W41 A;  2E2N A;  3ULE B;  3R8E A;  4BC4 A;  2QM1 A;  4ILH A;  1YJ9 N;  3CHW A;  1D4X A;  1DGK N;  1Q7Y O;  1ATR A;  1BG3 A;  1KAX A;  3WXJ A;  4U67 L;  2P9S B;  3PLA A;  5AFU H;  3H45 C;  2NRT A;  2KLA A;  1HPM A;  2Q0R A;  1QVF M;  3VGL A;  2P9U B;  2VGN A;  4A59 A;  1EO1 A;  4M63 C;  4IO8 A;  2HF4 A;  4BR2 A;  2Q2R A;  5MLC Q;  3SMP A;  1NMD A;  4KH6 A;  1X3N A;  3P38 A;  4FSV A;  4JK8 A;  4J8F A;  2P9K B;  3U4L A;  4BR9 A;  1DKG D;  2IVP A;  4BRA A;  1Q18 A;  3AAP A;  3DAW A;  3GG4 A;  3R3L A;  4JD2 A;  3VEV A;  4BRK A;  3WXI A;  3P4I A;  4FWK A;  4YOW A;  3QIC A;  5GIP A;  3MN6 A;  1NGI A;  3VOV A;  3MN5 A;  2P9N A;  1YAG A;  4MO5 A;  3C7N A;  4YDU A;  3CCQ N;  1Q86 O;  3ATU A;  1QVG M;  1QZ5 A;  2ZJP L;  3MX5 A;  3CCM N;  4BY9 C;  4A2B A;  1NGG A;  4M7X A;  5C0Y A;  4K42 A;  4YOV A;  5JVG L;  3EZW A;  4HWI A;  1BU6 O;  3FGU A;  4IOX A;  3I8B A;  1U6Z A;  1KD1 O;  5BPL A;  2A41 A;  4CZI A;  4JKD A;  3QBW A;  4OPA A;  4JNE A;  5AQY A;  3DXK B;  1Y64 A;  4QS7 A;  3Q7C A;  3SBG A;  4A2A A;  4WFA L;  3NVM A;  4U7B A;  3VES A;  1BA0 A;  4FWM A;  3VEO A;  1QQO A;  1NGB A;  3DLL L;  4QS9 A;  2PAV A;  3R9P A;  4BC3 A;  4YOX A;  2E2P A;  1HLU A;  2BH1 A;  3KHY A;  4H0X B;  4CZK A;  5JMV A;  3TTC A;  3MN7 A;  4CD1 A;  5BRF A;  1HKG A;  3D2E A;  1BA1 A;  2CGL A;  3J8A A;  4R79 A;  1V4S A;  5BN8 A;  4IO9 L;  1GLE G;  1TYQ A;  2P9L B;  4ISE A;  5TKW A;  1KC8 O;  3GDQ A;  4JKF A;  5C2D A;  1NGA A;  2WC9 A;  3MX2 A;  1VQ5 N;  3CJ9 A;  1KXP A;  4BRE A;  3DJC A;  5AQU A;  2DPN A;  3O9Q A;  1GLA G;  3LDL A;  4ISG A;  3O9R A;  4JKE A;  1S3X A;  2QWM A;  3IKM A;  3UE5 A;  3KK7 A;  3TTF A;  5AZI A;  2BUP A;  3H46 O;  2Q1N A;  3CQY A;  2E1Y A;  2ZJQ L;  3WQU A;  3WT0 A;  1KQS M;  1K8A O;  2Q36 A;  3FLC O;  1S22 A;  5F2R A;  3W0L A;  4A5B A;  5M1Q A;  3P31 A;  5EXW A;  5AQF A;  2OAN A;  4K41 A;  4KBO A;  3VGM A;  3VTH A;  4CZE A;  3DXM B;  5F0X A;  5HL7 L;  2FLO A;  2KHO A;  1GLJ O;  3LM2 A;  5TKY A;  2QXL A;  4B9Q A;  3KWG A;  2PBD A;  2QWN A;  3UKU A;  2QW9 A;  2P9P B;  3E9P A;  4Z94 A;  3F2K A;  4BRD A;  1W97 L;  3C0B A;  4O8K A;  3MN9 A;  2E1Z A;  3CD6 N;  4CZJ A;  4JHD A;  5JLF A;  4CZM A;  3C65 A;  2D1K A;  3VEZ A;  3EL2 A;  3CF5 L;  2NRR A;  5FPN A;  4MDB A;  2V51 B;  3F5T A;  1NWK A;  4RCH A;  1NGF A;  3M5R A;  4FVU A;  4IWV A;  3VER A;  5JIC A;  4WF9 L;  1R59 O;  2HBM A;  4JAX A;  4WQ5 A;  4BRL A;  1XC3 A;  3ZYY X;  4JKG A;  4C1N K;  1YJN N;  1HKC A;  4OPH A;  1W2B M;  3ENB A;  1RFQ A;  3UKR A;  1DT9 A;  3HOS A;  3KWI A;  3VEN A;  3RSE A;  4GV6 A;  3H1Q A;  2NRZ A;  4DB3 A;  3FR0 A;  3T69 A;  5BPM A;  2FSN A;  1YF5 L;  3MMV A;  1BUP A;  5KPT A;  4XJX A;  1SQK A;  4K43 A;  4CJ7 A;  2WBN A;  4KH5 A;  2YJF A;  1JCF A;  4BRO A;  2HMP A;  5ADX A;  1BOT O;  1SZ2 A;  1YI2 N;  3CJC A;  4MDA A;  3SMS A;  4MO4 A;  5CE3 A;  3I33 A;  4FWL A;  3EO3 A;  3ENO A;  1Z6R A;  1X3M A;  1Q81 O;  3A8Y A;  4AM7 A;  3CIP A;  2QWO A;  2NLX A;  5FPD A;  3D2F A;  1S72 N;  2UYT A;  3KZB A;  1KAY A;  2CH5 A;  4FO0 A;  4JD2 B;  5AQG A;  1N8R O;  1NGH A;  3L4Q A;  4CBW A;  4EIA A;  2ZGY A;  4CZG A;  2WUS A;  3HM8 A;  3FZK A;  4B1W B;  2A3Z A;  2P9N B;  5E84 A;  3ZEU A;  3C7N B;  2JWK A;  2Q31 A;  5LJW A;  1HUX A;  4EFH A;  1YIT N;  1E4F T;  1OKJ A;  5F1X A;  2I7P A;  2Q97 A;  4FOI A;  3QB0 A;  2W40 A;  1HKB A;  1O13 A;  3ULE A;  3HRG A;  4GNI A;  5GAE P;  3N4Q A;  1P90 A;  2F9W A;  4EHT A;  1T6C A;  2QWQ A;  3MWT A;  4YOY A;  2ZWH A;  2CGK A;  4BG8 A;  1GLC G;  3OBY A;  3O80 A;  2NZT A;  1G99 A;  3CCJ N;  4I6M A;  5BRE A;  3EKU A;  2FXU A;  3A0I X;  2V7Z A;  1NJI O;  3O9T A;  4L3Q A;  5AQJ A;  3A5O C;  4JKA A;  1JCE A;  4BQL A;  3CCL N;  1GLD G;  2HBJ A;  2P9K A;  5AZJ A;  3O08 A;  1K8K B;  4WQ4 A;  5C12 A;  2QA4 N;  4IXC A;  2GWJ A;  2YCH A;  3D2E B;  3TPQ A;  4DHY A;  5KPR A;  3O4W A;  1TYQ B;  2VGM A;  3C6H A;  5AQM A;  5DM6 L;  1MWM A;  1HJO A;  5BRD A;  4B1X B;  1MWK A;  5DM7 L;  3E9O A;  4IEE A;  1TUY A;  3WXK A;  4BR7 A;  4JK7 A;  3ZX2 A;  1VQ6 N;  5C2F A;  1NM1 A;  1VQ8 N;  4KH4 A;  5BN9 A;  1WUA A;  2IIR A;  3SJH A;  4YOU A;  1TUU A;  3WXL A;  3K9J A;  3WXM B;  3D6R A;  5EOY A;  4C1N I;  3VEX A;  1YJW N;  3A5L C;  2P9I A;  2GTD A;  4FWP A;  4H5W A;  4ILG B;  3O8M A;  4NO7 A;  3TU5 A;  4AM6 A;  1U2V B;  4BRH A;  4CD3 A;  4PHT X;  4UY8 O;  3SAH A;  5AZI B;  1WOQ A;  1LOT B;  2GEM A;  4BRN A;  3VET A;  3EE9 A;  3FE1 A;  1QQN A;  2QWP A;  3W3D A;  4RWT A;  4JKC A;  2A42 A;  4M7Y A;  1M90 O;  3WQT A;  3G25 A;  2D0P A;  3QFU A;  3R1X A;  2D4W A;  4C23 A;  2ITM A;  4B1Z A;  1M1K O;  1Z05 A;  3CC2 N;  3BUZ B;  5AQX A;  5AQO A;  2H3G X;  2FSJ A;  3IMX A;  3L0Q A;  4BEB A;  5EX5 A;  3VEY A;  3D7E O;  1T6D A;  3UKU B;  3CCU N;  2YHW A;  4CBX A;  3FZM A;  2HBL A;  4A57 A;  3LDN A;  2KKZ A;  5JLH A;  2GUP A;  5CR4 A;  1GLF O;  1VQ9 N;  2QI2 A;  1BDG A;  4JKH A;  3BEX A;  3T7Z A;  4JHD B;  4BC2 A;  3L4I A;  4IZ9 A;  4A62 A;  5FPE A;  3JS6 A;  3G6E N;  3C6A A;  5H1S Q;  1ATS A;  1XQS C;  2ASP A;  2GX9 A;  3ENH A;  4IOA L;  1K9M O;  1DEJ A;  3I55 N;  2C1G A;  1P8Z A;  5KQ8 A;  5GAH P;  3ZX0 A;  4CI6 A;  5C15 A;  3H6E A;  1SAZ A;  1NGC A;  2NRH A;  2HBK A;  4H5N A;  3ID8 A;  2OTL N;  4A61 A;  1VAZ A;  4Y0W A;  4WFB L;  1BWF O;  2QTD A;  2ASO A;  4H5R A;  4B1Y B;  5BRH A;  4BEC A;  3CER A;  3H3O B;  3OA9 A;  4JKG B;  3VEW A;  2AA4 A;  1ZXO A;  2NRV A;  3H3N O;  4AF1 A;  1EQY A;  3L6Q A;  1GLL O;  1YVN A;  3CJ1 A;  3LM9 A;  3IUC A;  4PL8 A;  4BRM A;  1VQP N;  5AQK A;  3RSE B;  1C0G A;  1ESV A;  5ADX H;  4FWN A;  4GY2 B;  1NGE A;  3WEE A;  4E1J A;  1YHQ N;  3CCS N;  2P9P A;  2VYP A;  4PKH A;  1LCU A;  4BRC A;  4BR0 A;  4WCE L;  5C10 A;  2F7T A;  3EN9 A;  4PKG A;  3AY9 A;  2E8A A;  3TSQ A;  4BQZ A;  3CC7 N;  5AQZ A;  2IVO A;  4H03 B;  5E26 A;  2CH6 A;  4BRI A;  1ZBS A;  3O9S A;  1YXQ A;  3ZET A;  1RDU A;  3CME N;  4IFE A;  2ZJR L;  3CQX A;  2IVN A;  4OO1 J;  3I56 N;  3U9Z A;  3D2F B;  1JCG A;  3BP8 A;  2QWR A;  3CCR N;  4JKB A;  4FPB A;  1GLB G;  1KAZ A;  3PIO L;  4MLE A;  2ZGZ A;  4MLH A;  3CJ7 A;  4ISF A;  1YUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...