3ULEG

Structure of bos taurus arp2/3 complex with bound inhibitor ck-869 and atp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
137
Chain Sequence
ARFRKVDVGEYDENKFVDEEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 40
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3uleG00
3UKUG 2P9IG 4JD2G 2P9UG 2P9SG 2P9KG 2P9PG 4XEIG 1TYQG 3DWLG 3DXKG 3UKRG 3ULEG 3RSEG 2P9NG 3DXMG 1K8KG 1U2VG 2P9LG
chains in the Genus database with same CATH superfamily
2X6IA 4WNGA 4YDEA 3PE4A 3R7RA 3ZFWA 2XENA 3SD5A 3EIQC 5BV1A 4FLHA 3FUJA 4U8VD 4PS8A 4XIFA 5BNWA 2LNIA 2P9UG 3UX4A 3PZ2A 3AU4A 4UQXA 4RLYA 4U0ZA 3CHSA 2VSYA 4ZFHA 4U04A 4Z68A 4C0MA 4L9PA 3VTXA 5T4YA 3V2XA 4LNGA 1TNBA 2PM6A 2JLBA 4GTRA 4F3VA 3ULEG 2R5SA 4XX5A 1E90A 3G2WA 4OVUA 3CKCA 4U63A 4K03A 5CEAA 2YHEA 2LSVA 2A5UA 5BUZA 4HNAD 5LP0A 2ZU6B 4I9EA 5BXOA 4GA2A 4DX1A 3DSVA 2XCCA 2DCPA 5FWQA 5EIDA 3T8KA 4EQFA 3TWXA 4L7TA 3R9AB 5A23A 1DVPA 3L13A 2XCBA 2I2OA 4BETA 4I9CA 1X81A 2Y3AA 3CEQA 4KVOA 5T3RA 2H6FA 2CHXA 3DBSA 3CVLA 3B7UX 2A4ZA 2XGMA 2XZDG 3SHFA 2WMNA 4ATGA 4UQZA 3Q4AB 5LFAA 3BG0B 4ANWA 3ZGQA 3FUHA 4A3TA 4OAVB 1KZOA 2IFUA 1EPUA 3UKRG 5AYWD 5FZSA 2L0TB 1KPSB 4CEMA 1TNYA 1DC2A 4GMLA 2ETCA 3NOGD 5CERB 3LJNA 1N95A 3HXCA 4GYWA 2IONA 3TWTA 2GRPB 1HH8A 4L23A 4AY5A 3KD7A 3JQ0A 2VGEA 4JXTA 2IF4A 1IHBA 4B8AA 2WXHA 4YDWA 4HI8A 3CHOA 5G05C 1S64A 2C0MA 3PDNA 3DSWA 4F6RD 5FT9A 3S7FA 4GTSA 3ZNGA 3ESKA 4M3OA 4ILIA 3QK0A 4G8LA 1UJKA 1H19A 1H6KA 2DIWA 5KBAA 2VSOE 2L0IA 4M7CA 4RG6A 1IYGA 4QFVA 1JUQA 3LVQE 3CV0A 3FUIA 3ZYQA 2F8YA 2I9CA 3KEZA 2WXFA 3AJIA 3D9IA 3L9TA 1Z6TA 1WAO1 4AXHA 2BUGA 3CK8A 3HYMB 1H6PA 1FCHA 3CHMA 1OCZE 4DI3A 2NXPA 1TN6A 3UINC 4QQIA 1DCQA 3AAAC 4WWPA 4HRMB 3D9LA 2Q7FA 3CQCB 3B7TA 3DPYA 4Q94A 3FDHA 4JZYA 4J7WA 1EDUA 5EYLA 3UT7A 4HRLA 4MRUA 2WXKA 2J4DA 3ZYMA 4G1TA 1OCCE 4C9BB 2QYJA 3APFA 4UWFA 4K5AB 4BX9A 5AARA 4NIKA 1K1AA 2DZOA 1U3CA 1WG0A 2WPVA 4TUMA 1SA5A 4G26A 4DRXE 3D9NA 1YA0A 2IO2C 5AQAA 4DLQA 4GZ5A 2XPZA 3ULYA 5B3SE 3S7BA 5A6CA 2FO1E 4IULA 1TNOA 3CVPA 1N4RA 1OT8A 3C5RA 1JPLA 2MRIA 3LPZA 4F53A 4BTAA 5EDSA 2Y0BG 5JHAA 4OVVA 4CRWA 3FU6A 4BTBA 2MHKA 5HQ8A 3Q75A 2RG8A 3AU5A 4UWLA 3UM0A 4EHMA 4G24A 3QWPA 4Y6CA 4MLPA 2WXGA 3CVYA 3TAXA 2X3MA 4RVBA 3APDA 1HO8A 2OCCE 3HXFA 4N39A 5ANLA 3G2UA 3CLJA 2CFZA 4RSYA 2MOWA 4CZ2D 3ASOE 4UI9J 1NP7A 1NZNA 1E7UA 1WM5A 4HORA 4I17A 5CBOA 3Q9UC 4WWOA 4TXRA 1FVHA 2OV8A 1QQEA 4BESA 3HHMA 4GPMA 4FULA 4L2YA 3TXNA 4GTMA 1EF1C 3DSTA 1HF8A 3KSQA 3CQGB 1JCSA 3DEOA 4J8YA 3FULA 5CRVA 1SQMA 3FTYA 2IY0C 3ZKJA 4B0ZA 3FFLA 3IHVA 3FH8A 4GTQA 4F1PA 3E30A 3FH5A 2WXIA 3FEXA 3ASGA 3Q49B 4CDMA 2EINE 2WQ6A 2BF0X 5AQBA 4EECA 4HB5A 4JEUA 2EIME 1O1TA 3KSLA 3K9IA 3ONLA 2E0IA 4FU3A 2XGOA 5BT1A 2BTDA 1GW6A 4GCNA 3ZHEB 4N2QA 2BEDA 2P58C 3QB2A 2RFAA 2IQCA 2PQRA 3AG4E 4N3AA 1NFIE 4I1MA 4LEUA 1D9SA 2V5FA 3JCKC 3ZW3A 1YCSB 3CVQA 3VLDA 2XZTG 2GGFA 5EILA 3CVUA 5LCWC 2Y1LE 5ENPD 4AY6A 5JJ7A 1NA3A 5LCWJ 3NZUA 3CHPA 3U64A 3RJVA 1TN7A 3FUKA 1HFAA 2V4HC 3QNKA 3UUXA 2IEJA 4WUYA 1BI8B 4YDOA 2B6CA 3CK7A 3TWVA 3EHRA 2X6KA 1LF8A 3PS6A 1OY3D 3D9JA 3CKBA 3AS8A 3EU5A 4CT4A 2Y4TA 5HI7A 2DZNA 3DXMG 1HX8A 2F8XK 2WQHA 4AEZC 4GYOA 3ZXPA 1U2VG 1UG3A 4B94A 2AXZA 3W9FA 3SI5A 2XRYA 3B7SA 1V54E 3L16A 1OXJA 3IBEA 3J5PA 4G8KA 3TWRA 3I4RB 4I2WA 3X2QE 3SO8A 3UMVA 1O5MA 4GZDA 3MYVA 4I1AA 5FQ4A 3Q7AA 3JXIA 3E33A 4FP7A 3SFZA 3S2AA 2OEVA 4HQDA 3MKQA 1QBQA 3ML8A 4XKCA 4U7EB 3JQ1A 4UWGA 3UT4A 3ZU7B 2P9IG 4A63B 3QKYA 5JHBA 4LRZA 4BEPA 2RD0A 5BV0A 1TNZA 1INZA 4JHRA 5FQ8A 5KNGA 3I5PA 4LG6A 3DSSA 4MS6A 3ISMC 1HZ4A 1MJ0A 3ASHA 3PEVB 2XEEA 4XI9A 3IHYA 2LAIA 5CMWA 5HKPA 2XEVA 3VLEA 3V79K 3BG1B 1MZCA 3G2SA 5H7PA 3NF1A 4IN3B 1LTXA 5D0OD 4U96D 2X6JA 3EU9A 3FTZA 2V4LA 4LNBA 2GRLA 3AG3E 1MX2A 2PNNA 2VGYA 4J8EA 2FO7A 3BUAA 3MGBA 4JW1A 1PC2A 3WXXA 3S7DA 2WVIA 4IRUA 3NOCD 3IXEA 3OXGA 5FINA 4JPSA 3SNXA 4HRNA 4GTVA 5CECB 3DEPA 2CHWA 4HOQA 4G2VA 3FEYA 5KCMA 3ZPJA 4P29A 5HS0A 1BLXB 2C2LA 4GMJA 2RKKA 3FP3A 4HLLA 1OWLA 4IYPA 1IHGA 3QWVA 4PH4B 3BEEA 2R02A 3L82A 1YMPA 2GRQB 5AQ9A 3PZ1A 2QFCA 3EJNA 4Q96A 1KLXA 3LCAA 2FBNA 2WXJA 2OOEA 1DNPA 4U8HA 3PVLA 4ABNA 1MHQA 2P9KG 4YVOA 3RRMB 5J90A 3CR3A 5B1BE 2C0LA 2H6IA 2WMOA 4WWNA 3UTMA 3I4GA 4U0UA 1S70B 2DWZA 3LS8A 3FTVA 1TEZA 4BT8A 2BKGA 5T8IA 3R9MA 5CMYA 1RZ4A 1FT2A 2J09A 1N4SA 4GB9A 4BT9A 3CVWA 3E4BA 5BPPA 4NRHB 3CSFA 1D8EA 3QWWA 3SFXA 5KJLA 3G2TA 1JWFA 3LDZA 2HYZA 3OXLA 3PZ3A 4LSZE 4U07A 4YDYA 5EIBE 2V5QC 4FHKA 3Q73A 2QZAA 3ABME 4TRQA 2ZIRA 3PUKA 3B7BA 2J49A 3UT8A 5BW8C 2DVWA 1E7VA 4X8QA 3FU0A 2XHEA 4DX2A 5B1AE 2WXRA 3TL5A 1AP7A 3RAUA 2R59A 3ASNE 2NYJA 3ESLA 4C0EA 2XRZA 3WG7E 3LJ3A 1NA0A 3T5VA 3U66A 3UQ3A 4I2ZA 3ZUVB 2EQXA 3OTNA 2Y4UA 2P2CP 3RU0A 4CT0A 3TWSA 4FJYA 2VGXA 3URZA 2H6HA 3TWQA 3JUEA 5JJ6A 2KM4A 3QDNA 3FUNA 3BQOA 3B13A 4FA6A 5C2YA 5CCLA 1H2VC 2X6HA 3Q47B 3MJWA 3ZHEA 3LKUA 4O1OA 1K1BA 3DPDA 3ASDA 4WNFA 4JC8A 3PNTB 4K0RA 3E34A 4HOTA 4XE0A 4AJWA 4GU5A 4JVSA 3EHMA 1W3BA 3EHNA 4PDXA 4BSZB 3SQVA 3C98A 3SBTB 3UM3A 4J8FA 2XS8A 4GCOA 2GRMA 3IV0A 4LUNU 2A5EA 1TJCA 1Y6IA 1V55E 3UI2A 4YNDA 3FUFA 4DPRA 2YINA 2VSXE 2J08A 5JJTA 3GZ2A 3KS2A 2LUHA 4TV3A 3SBSA 1H2UA 3ENEA 3QOUA 2AW6A 2PQNA 5ARFA 4BERA 2R05A 3AS5A 4DLOA 3FU5A 4JHKA 4UWHA 3RRUA 1O1SA 3MV2B 5E75A 4MKTA 3L6AA 5CHEE 5CRUA 4O60A 2VTBB 4B8CB 1N0RA 5AENA 3OXFA 2KATA 3Q79A 4UWKA 2HR2A 2F0YA 5DBKA 2OVBA 3FY4A 4HOSA 1N0QA 4BSXA 3C3QA 4UI9C 4L1BA 4APFA 3ULQA 2NC9A 2IJGX 3RKVA 5J08A 4ME2A 3FUEA 4FC8A 1HG5A 1QZ2A 1E8YA 2I1KA 2FI7A 2JEKA 3ZYKA 3L54A 3P2BA 3D9HA 3DSUA 4WNDA 3UPVA 4GMRA 2AWIA 3CIAA 4KZCA 3VLFA 5C1DA 1ZU2A 1Q2ZA 3JXJA 2WXQA 3MEKA 3D3MA 2EIJE 5D66A 2FEZA 3ABLE 4JB8P 5ENOD 4AV7A 4XEIG 3V31A 4LCTA 4EZJA 2CHZA 1G3NB 2WB2A 5AN8A 4CGVA 4V3IA 3ZEFA 4J8SA 1N54A 4GTPA 4N3BA 3MKQB 3MV3B 1MX4A 3ZRHA 4R7LA 2WXPA 5AAOA 3F6QA 4E85A 5EYPF 4BX8A 4L2LA 4Q69A 2WXOA 3PEUB 1Y8MA 2XEHA 3SGHA 4DX7D 3Q5MA 3KAEA 3Q78A 3FU3A 1HG2A 4FADA 2OEWA 1SA4A 3RIBA 1DCEA 3CVNA 3SY2A 3DRAA 4RG9A 3J5QB 4KYOB 5ENQD 3L22A 3KEAA 1HE8A 2DBAA 4H7YA 2LO6A 3SFYA 5G04C 2KBXA 3N71A 3MCXA 5EKQD 3Q15A 5ENRD 3NQPA 2ETAA 1RW2A 3PZDA 4NURA 1E96B 2FULA 3W9GA 3V2OA 1JCRA 3MZLB 1KZPA 4JD2G 1H2TC 3D9KA 4AM9A 1B89A 3NBNB 2JABA 3DSXA 4GTTA 2QY7A 1ELRA 4J0UA 2VTBA 2HM8A 2IU1A 3UXGA 1ELWA 4A55A 4DUIA 4KT6B 4A1SA 1OCRE 3AG2E 4U0SA 4JA7A 3LY8A 1SZAA 2VSNA 2AVPA 1K3ZD 1HS6A 2J9QA 2LXLA 3S7JA 2WXLA 2VYIA 1N94A 3T5XA 2V0PA 4DI4A 4BY6A 2KZTB 3Q7FA 5AIJA 5KJKA 2PL2A 2J8SD 4JEHA 5EX0A 4DK5A 1HXIA 4GZ3A 3PUJA 4K5BA 3TXMA 2DYSE 4O6FA 1KT1A 4DJAA 4AIFA 2H6GA 4FJZA 3GW4A 3E32A 2UWJG 1N4QA 3D9MA 4PS3A 2XQ0A 3CVVA 2AXVA 2ZXWE 1D8DA 1UW4B 2AJAA 4G11A 2GROB 4KMOA 3UM2A 3UIOC 3PH0C 4ANVA 2GW1A 2R03A 4CDRA 4HFGA 1A5EA 4DX6D 1FPPA 1LD8A 1BI7B 3BU8A 4HS2A 5FQ7A 5DIZA 1WDYA 1JWGA 3L17A 5ENTD 4NQ0A 4CDNA 3LEWA 2VQ2A 2YHCA 1LD7A 5FTPA 1OWOA 1TN8A 3B95A 4ILHB 4F1SA 5KJMA 4NACA 1A17A 3QC1A 4W9RA 1HU3A 4OYSA 3RK6A 4O1PA 2GRRB 3HDXA 3RRNB 1NI1A 3UKUG 2RFMA 2J4BA 3PNLB 3UIPC 4A1GA 2X38A 3VTYA 3EIJA 2EILE 5A7DB 1H0AA 3CK9A 3TGOA 2WQ7A 3EDTB 5JMND 3HXEA 5ENSD 4XZ4A 2P9LG 3C3OA 3RO3A 4I1OB 2BKKB 2CFUA 3OAWA 3LY7A 4N5QA 3HXBA 4C48B 4GA0A 4EBAA 1IXVA 4BWRA 5HRYA 3PE3A 5FZQA 4GZCA 3JUIA 4N5CA 5G55A 3TJPA 4HVBA 3IEGA 2IOSA 4F7AA 1S63A 1IKND 3IKOB 4ZHBA 4XI0A 3NB2A 2L6JA 4LNUD 3FTUA 4WNEA 2DYRE 4GAAA 1E8WA 1N4PA 3EHQA 3MX3A 5FQ6A 2L6BA 3SZ7A 3U9WA 2VJ8A 3GZ1A 4URKA 2WXMA 2V8SE 3FTSA 2LSUA 2ONDA 4I6GA 4B93B 4U95D 2PZIA 4H7XA 5ARGA 3PRZA 5IY5E 5AJLA 4I6JA 2KC7A 2ETBA 1X5BA 3HXDA 2QYUA 4ANXA 1TR4A 2XPYA 1U3DA 2LAHA 1AWCB 4ANUA 3JYSA 5KNHD 2ZGGA 3FWVA 3V30A 3C72A 1VDYA 3UM1A 2FF4A 3HVEA 4AOFA 4EPZA 2ILRA 3B7RL 3AS4A 4ILGA 1N52A 1BD8A 1H6OA 2KXPC 5KWDA 1MQSA 5G2NA 1Z3XA 3RSEG 2KCLA 4B89A 1S0PA 4HLEA 4HOUA 5FZRA 1QNFA 3HIZA 2NSZA 1IQRA 2ZGDA 3CHQA 3O4ZA 2GRNB 1OWPA 4HBDA 4KXKB 4FLBA 5ENNA 4BFRA 4TUUA 2E2EA 3ONKA 5LOZA 1P5QA 1L5JA 5LX8A 2I1JA 5CBNA 3QAQA 2ZISA 3C3RA 4HXIA 4KZ0A 5G05J 2HO1A 2KCVA 4E6HA 4EZLA 5G04J 3T8MA 4A3VA 4LERA 2R2LA 1OWMA 4UQYA 3LYAA 4APOA 1XGWA 2CG3A 3TG4A 4PS7A 3CHRA 4D10C 1EYHA 1QYMA 1TYQG 4G25A 1UN8A 2WXNA 4ACLA 3NAWA 4ATZD 4GA1A 2YQ8A 3ZVVA 4EZKA 3P1UA 2I6HA 2XGSA 4JL0A 1PY1A 3FUMA 3GYZA 4U8YD 1E8ZA 3RO2A 2XS1A 3EUVA 3FUDA 4FHJA 4ACKA 4TXPA 1E8XA 4I43A 5ANRA 4GPKA 1ZB1A 1N11A 4I6EA 1SVXA 5D0QD 5AQ7A 5AJDA 4GZ6A 3DXKG 3CVXA 2X6FA 1ELKA 4HI9A 1N9AA 2LXMA 4G23A 5M72A 1XNFA 3U3WA 1OUVA 1ZBPA 3CSTA 4AP2A 3NZSA 3FTWA 2EIKE 4UI9K 5JA4D 4N3CA 2IOLA 5EN5D 3T9KA 4OAUC 4CGWA 4CYMD 4UUCA 2KZTA 4XKBA 2KCKA 4JA9A 1TNUA 3CGHA 1UJJA 3O48A 2B0OE 5FIOA 2UY1A 3FH7A 4YVQC 2WM9A 5EX3A 3D9OA 3L08A 1FVFA 1MYOA 4KBQA 2IO3C 1NL4A 4AVXA 4Y6WA 1BU9A 2CG2A 3LY9A 4EBAG 4GTOA 4WAFA 4GYYA 1OCOE 4N2SA 5BXUA 3GZSA 5D2MC 3TWWA 3U4TA 3E37A 1IQUA 3DWLG 4TXQA 3SF4A 2P9NG 2Y69E 3ASFA 4KVMA 1TJFA 1BPOA 5CEDB 4J6IA 3TG5A 3LXUX 1FT1A 1KT0A 1SZ9A 2XPIA 1YYHA 4RQIA 3PZ4A 1OWNA 3APCA 3ZYLA 2MYOA 3QJZA 3LVRE 3HG0D 3MA5A 1K8KG 3R7QA 2M63A 5FJYA 3ZXSA 2QC9A 2F37A 3MKRA 1Z5SC 1Z3YA 3HRAA 3FTXA 3I3NA 3ZN3A 3FHEA 1WY6A 1SW6A 1UN9A 2J07A 1PAQA 1UOHA 3G2VA 5KJNA 2YNQA 3AG1E 4PUCA 1O1RA 2HE0A 4JHJA 1JCQA 2P9PG 4K5CA 4J8DA 2PM7A 2R17C 2OVFA 2VGXB 3D9PA 3TWUA 4CCAA 2L9BA 5E76A 3ZIMA 1MX6A 5CCMA 2UY1B 3HVEB 3Q9NC 3PREA 3QARA 3ABKE 3ML9A 4DX5D 2AXUA 2P9SG 4MBGA 5ITZF
chains in the Genus database with same CATH topology
3UKUG 2P9IG 4JD2G 2P9UG 2P9SG 2P9KG 2P9PG 4XEIG 1TYQG 3DWLG 3DXKG 3UKRG 3ULEG 3RSEG 2P9NG 3DXMG 1K8KG 1U2VG 2P9LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKU G;  2P9I G;  4JD2 G;  2P9U G;  2P9S G;  2P9K G;  2P9P G;  4XEI G;  1TYQ G;  3DWL G;  3DXK G;  3UKR G;  3ULE G;  3RSE G;  2P9N G;  3DXM G;  1K8K G;  1U2V G;  2P9L G; 
#chains in the Genus database with same CATH topology
 2X6I A;  4WNG A;  4YDE A;  3PE4 A;  3R7R A;  3ZFW A;  2XEN A;  3SD5 A;  3EIQ C;  5BV1 A;  4FLH A;  3FUJ A;  4U8V D;  4PS8 A;  4XIF A;  5BNW A;  2LNI A;  2P9U G;  3UX4 A;  3PZ2 A;  3AU4 A;  4UQX A;  4RLY A;  4U0Z A;  3CHS A;  2VSY A;  4ZFH A;  4U04 A;  4Z68 A;  4C0M A;  4L9P A;  3VTX A;  5T4Y A;  3V2X A;  4LNG A;  1TNB A;  2PM6 A;  2JLB A;  4GTR A;  4F3V A;  3ULE G;  2R5S A;  4XX5 A;  1E90 A;  3G2W A;  4OVU A;  3CKC A;  4U63 A;  4K03 A;  5CEA A;  2YHE A;  2LSV A;  2A5U A;  5BUZ A;  4HNA D;  5LP0 A;  2ZU6 B;  4I9E A;  5BXO A;  4GA2 A;  4DX1 A;  3DSV A;  2XCC A;  2DCP A;  5FWQ A;  5EID A;  3T8K A;  4EQF A;  3TWX A;  4L7T A;  3R9A B;  5A23 A;  1DVP A;  3L13 A;  2XCB A;  2I2O A;  4BET A;  4I9C A;  1X81 A;  2Y3A A;  3CEQ A;  4KVO A;  5T3R A;  2H6F A;  2CHX A;  3DBS A;  3CVL A;  3B7U X;  2A4Z A;  2XGM A;  2XZD G;  3SHF A;  2WMN A;  4ATG A;  4UQZ A;  3Q4A B;  5LFA A;  3BG0 B;  4ANW A;  3ZGQ A;  3FUH A;  4A3T A;  4OAV B;  1KZO A;  2IFU A;  1EPU A;  3UKR G;  5AYW D;  5FZS A;  2L0T B;  1KPS B;  4CEM A;  1TNY A;  1DC2 A;  4GML A;  2ETC A;  3NOG D;  5CER B;  3LJN A;  1N95 A;  3HXC A;  4GYW A;  2ION A;  3TWT A;  2GRP B;  1HH8 A;  4L23 A;  4AY5 A;  3KD7 A;  3JQ0 A;  2VGE A;  4JXT A;  2IF4 A;  1IHB A;  4B8A A;  2WXH A;  4YDW A;  4HI8 A;  3CHO A;  5G05 C;  1S64 A;  2C0M A;  3PDN A;  3DSW A;  4F6R D;  5FT9 A;  3S7F A;  4GTS A;  3ZNG A;  3ESK A;  4M3O A;  4ILI A;  3QK0 A;  4G8L A;  1UJK A;  1H19 A;  1H6K A;  2DIW A;  5KBA A;  2VSO E;  2L0I A;  4M7C A;  4RG6 A;  1IYG A;  4QFV A;  1JUQ A;  3LVQ E;  3CV0 A;  3FUI A;  3ZYQ A;  2F8Y A;  2I9C A;  3KEZ A;  2WXF A;  3AJI A;  3D9I A;  3L9T A;  1Z6T A;  1WAO 1;  4AXH A;  2BUG A;  3CK8 A;  3HYM B;  1H6P A;  1FCH A;  3CHM A;  1OCZ E;  4DI3 A;  2NXP A;  1TN6 A;  3UIN C;  4QQI A;  1DCQ A;  3AAA C;  4WWP A;  4HRM B;  3D9L A;  2Q7F A;  3CQC B;  3B7T A;  3DPY A;  4Q94 A;  3FDH A;  4JZY A;  4J7W A;  1EDU A;  5EYL A;  3UT7 A;  4HRL A;  4MRU A;  2WXK A;  2J4D A;  3ZYM A;  4G1T A;  1OCC E;  4C9B B;  2QYJ A;  3APF A;  4UWF A;  4K5A B;  4BX9 A;  5AAR A;  4NIK A;  1K1A A;  2DZO A;  1U3C A;  1WG0 A;  2WPV A;  4TUM A;  1SA5 A;  4G26 A;  4DRX E;  3D9N A;  1YA0 A;  2IO2 C;  5AQA A;  4DLQ A;  4GZ5 A;  2XPZ A;  3ULY A;  5B3S E;  3S7B A;  5A6C A;  2FO1 E;  4IUL A;  1TNO A;  3CVP A;  1N4R A;  1OT8 A;  3C5R A;  1JPL A;  2MRI A;  3LPZ A;  4F53 A;  4BTA A;  5EDS A;  2Y0B G;  5JHA A;  4OVV A;  4CRW A;  3FU6 A;  4BTB A;  2MHK A;  5HQ8 A;  3Q75 A;  2RG8 A;  3AU5 A;  4UWL A;  3UM0 A;  4EHM A;  4G24 A;  3QWP A;  4Y6C A;  4MLP A;  2WXG A;  3CVY A;  3TAX A;  2X3M A;  4RVB A;  3APD A;  1HO8 A;  2OCC E;  3HXF A;  4N39 A;  5ANL A;  3G2U A;  3CLJ A;  2CFZ A;  4RSY A;  2MOW A;  4CZ2 D;  3ASO E;  4UI9 J;  1NP7 A;  1NZN A;  1E7U A;  1WM5 A;  4HOR A;  4I17 A;  5CBO A;  3Q9U C;  4WWO A;  4TXR A;  1FVH A;  2OV8 A;  1QQE A;  4BES A;  3HHM A;  4GPM A;  4FUL A;  4L2Y A;  3TXN A;  4GTM A;  1EF1 C;  3DST A;  1HF8 A;  3KSQ A;  3CQG B;  1JCS A;  3DEO A;  4J8Y A;  3FUL A;  5CRV A;  1SQM A;  3FTY A;  2IY0 C;  3ZKJ A;  4B0Z A;  3FFL A;  3IHV A;  3FH8 A;  4GTQ A;  4F1P A;  3E30 A;  3FH5 A;  2WXI A;  3FEX A;  3ASG A;  3Q49 B;  4CDM A;  2EIN E;  2WQ6 A;  2BF0 X;  5AQB A;  4EEC A;  4HB5 A;  4JEU A;  2EIM E;  1O1T A;  3KSL A;  3K9I A;  3ONL A;  2E0I A;  4FU3 A;  2XGO A;  5BT1 A;  2BTD A;  1GW6 A;  4GCN A;  3ZHE B;  4N2Q A;  2BED A;  2P58 C;  3QB2 A;  2RFA A;  2IQC A;  2PQR A;  3AG4 E;  4N3A A;  1NFI E;  4I1M A;  4LEU A;  1D9S A;  2V5F A;  3JCK C;  3ZW3 A;  1YCS B;  3CVQ A;  3VLD A;  2XZT G;  2GGF A;  5EIL A;  3CVU A;  5LCW C;  2Y1L E;  5ENP D;  4AY6 A;  5JJ7 A;  1NA3 A;  5LCW J;  3NZU A;  3CHP A;  3U64 A;  3RJV A;  1TN7 A;  3FUK A;  1HFA A;  2V4H C;  3QNK A;  3UUX A;  2IEJ A;  4WUY A;  1BI8 B;  4YDO A;  2B6C A;  3CK7 A;  3TWV A;  3EHR A;  2X6K A;  1LF8 A;  3PS6 A;  1OY3 D;  3D9J A;  3CKB A;  3AS8 A;  3EU5 A;  4CT4 A;  2Y4T A;  5HI7 A;  2DZN A;  3DXM G;  1HX8 A;  2F8X K;  2WQH A;  4AEZ C;  4GYO A;  3ZXP A;  1U2V G;  1UG3 A;  4B94 A;  2AXZ A;  3W9F A;  3SI5 A;  2XRY A;  3B7S A;  1V54 E;  3L16 A;  1OXJ A;  3IBE A;  3J5P A;  4G8K A;  3TWR A;  3I4R B;  4I2W A;  3X2Q E;  3SO8 A;  3UMV A;  1O5M A;  4GZD A;  3MYV A;  4I1A A;  5FQ4 A;  3Q7A A;  3JXI A;  3E33 A;  4FP7 A;  3SFZ A;  3S2A A;  2OEV A;  4HQD A;  3MKQ A;  1QBQ A;  3ML8 A;  4XKC A;  4U7E B;  3JQ1 A;  4UWG A;  3UT4 A;  3ZU7 B;  2P9I G;  4A63 B;  3QKY A;  5JHB A;  4LRZ A;  4BEP A;  2RD0 A;  5BV0 A;  1TNZ A;  1INZ A;  4JHR A;  5FQ8 A;  5KNG A;  3I5P A;  4LG6 A;  3DSS A;  4MS6 A;  3ISM C;  1HZ4 A;  1MJ0 A;  3ASH A;  3PEV B;  2XEE A;  4XI9 A;  3IHY A;  2LAI A;  5CMW A;  5HKP A;  2XEV A;  3VLE A;  3V79 K;  3BG1 B;  1MZC A;  3G2S A;  5H7P A;  3NF1 A;  4IN3 B;  1LTX A;  5D0O D;  4U96 D;  2X6J A;  3EU9 A;  3FTZ A;  2V4L A;  4LNB A;  2GRL A;  3AG3 E;  1MX2 A;  2PNN A;  2VGY A;  4J8E A;  2FO7 A;  3BUA A;  3MGB A;  4JW1 A;  1PC2 A;  3WXX A;  3S7D A;  2WVI A;  4IRU A;  3NOC D;  3IXE A;  3OXG A;  5FIN A;  4JPS A;  3SNX A;  4HRN A;  4GTV A;  5CEC B;  3DEP A;  2CHW A;  4HOQ A;  4G2V A;  3FEY A;  5KCM A;  3ZPJ A;  4P29 A;  5HS0 A;  1BLX B;  2C2L A;  4GMJ A;  2RKK A;  3FP3 A;  4HLL A;  1OWL A;  4IYP A;  1IHG A;  3QWV A;  4PH4 B;  3BEE A;  2R02 A;  3L82 A;  1YMP A;  2GRQ B;  5AQ9 A;  3PZ1 A;  2QFC A;  3EJN A;  4Q96 A;  1KLX A;  3LCA A;  2FBN A;  2WXJ A;  2OOE A;  1DNP A;  4U8H A;  3PVL A;  4ABN A;  1MHQ A;  2P9K G;  4YVO A;  3RRM B;  5J90 A;  3CR3 A;  5B1B E;  2C0L A;  2H6I A;  2WMO A;  4WWN A;  3UTM A;  3I4G A;  4U0U A;  1S70 B;  2DWZ A;  3LS8 A;  3FTV A;  1TEZ A;  4BT8 A;  2BKG A;  5T8I A;  3R9M A;  5CMY A;  1RZ4 A;  1FT2 A;  2J09 A;  1N4S A;  4GB9 A;  4BT9 A;  3CVW A;  3E4B A;  5BPP A;  4NRH B;  3CSF A;  1D8E A;  3QWW A;  3SFX A;  5KJL A;  3G2T A;  1JWF A;  3LDZ A;  2HYZ A;  3OXL A;  3PZ3 A;  4LSZ E;  4U07 A;  4YDY A;  5EIB E;  2V5Q C;  4FHK A;  3Q73 A;  2QZA A;  3ABM E;  4TRQ A;  2ZIR A;  3PUK A;  3B7B A;  2J49 A;  3UT8 A;  5BW8 C;  2DVW A;  1E7V A;  4X8Q A;  3FU0 A;  2XHE A;  4DX2 A;  5B1A E;  2WXR A;  3TL5 A;  1AP7 A;  3RAU A;  2R59 A;  3ASN E;  2NYJ A;  3ESL A;  4C0E A;  2XRZ A;  3WG7 E;  3LJ3 A;  1NA0 A;  3T5V A;  3U66 A;  3UQ3 A;  4I2Z A;  3ZUV B;  2EQX A;  3OTN A;  2Y4U A;  2P2C P;  3RU0 A;  4CT0 A;  3TWS A;  4FJY A;  2VGX A;  3URZ A;  2H6H A;  3TWQ A;  3JUE A;  5JJ6 A;  2KM4 A;  3QDN A;  3FUN A;  3BQO A;  3B13 A;  4FA6 A;  5C2Y A;  5CCL A;  1H2V C;  2X6H A;  3Q47 B;  3MJW A;  3ZHE A;  3LKU A;  4O1O A;  1K1B A;  3DPD A;  3ASD A;  4WNF A;  4JC8 A;  3PNT B;  4K0R A;  3E34 A;  4HOT A;  4XE0 A;  4AJW A;  4GU5 A;  4JVS A;  3EHM A;  1W3B A;  3EHN A;  4PDX A;  4BSZ B;  3SQV A;  3C98 A;  3SBT B;  3UM3 A;  4J8F A;  2XS8 A;  4GCO A;  2GRM A;  3IV0 A;  4LUN U;  2A5E A;  1TJC A;  1Y6I A;  1V55 E;  3UI2 A;  4YND A;  3FUF A;  4DPR A;  2YIN A;  2VSX E;  2J08 A;  5JJT A;  3GZ2 A;  3KS2 A;  2LUH A;  4TV3 A;  3SBS A;  1H2U A;  3ENE A;  3QOU A;  2AW6 A;  2PQN A;  5ARF A;  4BER A;  2R05 A;  3AS5 A;  4DLO A;  3FU5 A;  4JHK A;  4UWH A;  3RRU A;  1O1S A;  3MV2 B;  5E75 A;  4MKT A;  3L6A A;  5CHE E;  5CRU A;  4O60 A;  2VTB B;  4B8C B;  1N0R A;  5AEN A;  3OXF A;  2KAT A;  3Q79 A;  4UWK A;  2HR2 A;  2F0Y A;  5DBK A;  2OVB A;  3FY4 A;  4HOS A;  1N0Q A;  4BSX A;  3C3Q A;  4UI9 C;  4L1B A;  4APF A;  3ULQ A;  2NC9 A;  2IJG X;  3RKV A;  5J08 A;  4ME2 A;  3FUE A;  4FC8 A;  1HG5 A;  1QZ2 A;  1E8Y A;  2I1K A;  2FI7 A;  2JEK A;  3ZYK A;  3L54 A;  3P2B A;  3D9H A;  3DSU A;  4WND A;  3UPV A;  4GMR A;  2AWI A;  3CIA A;  4KZC A;  3VLF A;  5C1D A;  1ZU2 A;  1Q2Z A;  3JXJ A;  2WXQ A;  3MEK A;  3D3M A;  2EIJ E;  5D66 A;  2FEZ A;  3ABL E;  4JB8 P;  5ENO D;  4AV7 A;  4XEI G;  3V31 A;  4LCT A;  4EZJ A;  2CHZ A;  1G3N B;  2WB2 A;  5AN8 A;  4CGV A;  4V3I A;  3ZEF A;  4J8S A;  1N54 A;  4GTP A;  4N3B A;  3MKQ B;  3MV3 B;  1MX4 A;  3ZRH A;  4R7L A;  2WXP A;  5AAO A;  3F6Q A;  4E85 A;  5EYP F;  4BX8 A;  4L2L A;  4Q69 A;  2WXO A;  3PEU B;  1Y8M A;  2XEH A;  3SGH A;  4DX7 D;  3Q5M A;  3KAE A;  3Q78 A;  3FU3 A;  1HG2 A;  4FAD A;  2OEW A;  1SA4 A;  3RIB A;  1DCE A;  3CVN A;  3SY2 A;  3DRA A;  4RG9 A;  3J5Q B;  4KYO B;  5ENQ D;  3L22 A;  3KEA A;  1HE8 A;  2DBA A;  4H7Y A;  2LO6 A;  3SFY A;  5G04 C;  2KBX A;  3N71 A;  3MCX A;  5EKQ D;  3Q15 A;  5ENR D;  3NQP A;  2ETA A;  1RW2 A;  3PZD A;  4NUR A;  1E96 B;  2FUL A;  3W9G A;  3V2O A;  1JCR A;  3MZL B;  1KZP A;  4JD2 G;  1H2T C;  3D9K A;  4AM9 A;  1B89 A;  3NBN B;  2JAB A;  3DSX A;  4GTT A;  2QY7 A;  1ELR A;  4J0U A;  2VTB A;  2HM8 A;  2IU1 A;  3UXG A;  1ELW A;  4A55 A;  4DUI A;  4KT6 B;  4A1S A;  1OCR E;  3AG2 E;  4U0S A;  4JA7 A;  3LY8 A;  1SZA A;  2VSN A;  2AVP A;  1K3Z D;  1HS6 A;  2J9Q A;  2LXL A;  3S7J A;  2WXL A;  2VYI A;  1N94 A;  3T5X A;  2V0P A;  4DI4 A;  4BY6 A;  2KZT B;  3Q7F A;  5AIJ A;  5KJK A;  2PL2 A;  2J8S D;  4JEH A;  5EX0 A;  4DK5 A;  1HXI A;  4GZ3 A;  3PUJ A;  4K5B A;  3TXM A;  2DYS E;  4O6F A;  1KT1 A;  4DJA A;  4AIF A;  2H6G A;  4FJZ A;  3GW4 A;  3E32 A;  2UWJ G;  1N4Q A;  3D9M A;  4PS3 A;  2XQ0 A;  3CVV A;  2AXV A;  2ZXW E;  1D8D A;  1UW4 B;  2AJA A;  4G11 A;  2GRO B;  4KMO A;  3UM2 A;  3UIO C;  3PH0 C;  4ANV A;  2GW1 A;  2R03 A;  4CDR A;  4HFG A;  1A5E A;  4DX6 D;  1FPP A;  1LD8 A;  1BI7 B;  3BU8 A;  4HS2 A;  5FQ7 A;  5DIZ A;  1WDY A;  1JWG A;  3L17 A;  5ENT D;  4NQ0 A;  4CDN A;  3LEW A;  2VQ2 A;  2YHC A;  1LD7 A;  5FTP A;  1OWO A;  1TN8 A;  3B95 A;  4ILH B;  4F1S A;  5KJM A;  4NAC A;  1A17 A;  3QC1 A;  4W9R A;  1HU3 A;  4OYS A;  3RK6 A;  4O1P A;  2GRR B;  3HDX A;  3RRN B;  1NI1 A;  3UKU G;  2RFM A;  2J4B A;  3PNL B;  3UIP C;  4A1G A;  2X38 A;  3VTY A;  3EIJ A;  2EIL E;  5A7D B;  1H0A A;  3CK9 A;  3TGO A;  2WQ7 A;  3EDT B;  5JMN D;  3HXE A;  5ENS D;  4XZ4 A;  2P9L G;  3C3O A;  3RO3 A;  4I1O B;  2BKK B;  2CFU A;  3OAW A;  3LY7 A;  4N5Q A;  3HXB A;  4C48 B;  4GA0 A;  4EBA A;  1IXV A;  4BWR A;  5HRY A;  3PE3 A;  5FZQ A;  4GZC A;  3JUI A;  4N5C A;  5G55 A;  3TJP A;  4HVB A;  3IEG A;  2IOS A;  4F7A A;  1S63 A;  1IKN D;  3IKO B;  4ZHB A;  4XI0 A;  3NB2 A;  2L6J A;  4LNU D;  3FTU A;  4WNE A;  2DYR E;  4GAA A;  1E8W A;  1N4P A;  3EHQ A;  3MX3 A;  5FQ6 A;  2L6B A;  3SZ7 A;  3U9W A;  2VJ8 A;  3GZ1 A;  4URK A;  2WXM A;  2V8S E;  3FTS A;  2LSU A;  2OND A;  4I6G A;  4B93 B;  4U95 D;  2PZI A;  4H7X A;  5ARG A;  3PRZ A;  5IY5 E;  5AJL A;  4I6J A;  2KC7 A;  2ETB A;  1X5B A;  3HXD A;  2QYU A;  4ANX A;  1TR4 A;  2XPY A;  1U3D A;  2LAH A;  1AWC B;  4ANU A;  3JYS A;  5KNH D;  2ZGG A;  3FWV A;  3V30 A;  3C72 A;  1VDY A;  3UM1 A;  2FF4 A;  3HVE A;  4AOF A;  4EPZ A;  2ILR A;  3B7R L;  3AS4 A;  4ILG A;  1N52 A;  1BD8 A;  1H6O A;  2KXP C;  5KWD A;  1MQS A;  5G2N A;  1Z3X A;  3RSE G;  2KCL A;  4B89 A;  1S0P A;  4HLE A;  4HOU A;  5FZR A;  1QNF A;  3HIZ A;  2NSZ A;  1IQR A;  2ZGD A;  3CHQ A;  3O4Z A;  2GRN B;  1OWP A;  4HBD A;  4KXK B;  4FLB A;  5ENN A;  4BFR A;  4TUU A;  2E2E A;  3ONK A;  5LOZ A;  1P5Q A;  1L5J A;  5LX8 A;  2I1J A;  5CBN A;  3QAQ A;  2ZIS A;  3C3R A;  4HXI A;  4KZ0 A;  5G05 J;  2HO1 A;  2KCV A;  4E6H A;  4EZL A;  5G04 J;  3T8M A;  4A3V A;  4LER A;  2R2L A;  1OWM A;  4UQY A;  3LYA A;  4APO A;  1XGW A;  2CG3 A;  3TG4 A;  4PS7 A;  3CHR A;  4D10 C;  1EYH A;  1QYM A;  1TYQ G;  4G25 A;  1UN8 A;  2WXN A;  4ACL A;  3NAW A;  4ATZ D;  4GA1 A;  2YQ8 A;  3ZVV A;  4EZK A;  3P1U A;  2I6H A;  2XGS A;  4JL0 A;  1PY1 A;  3FUM A;  3GYZ A;  4U8Y D;  1E8Z A;  3RO2 A;  2XS1 A;  3EUV A;  3FUD A;  4FHJ A;  4ACK A;  4TXP A;  1E8X A;  4I43 A;  5ANR A;  4GPK A;  1ZB1 A;  1N11 A;  4I6E A;  1SVX A;  5D0Q D;  5AQ7 A;  5AJD A;  4GZ6 A;  3DXK G;  3CVX A;  2X6F A;  1ELK A;  4HI9 A;  1N9A A;  2LXM A;  4G23 A;  5M72 A;  1XNF A;  3U3W A;  1OUV A;  1ZBP A;  3CST A;  4AP2 A;  3NZS A;  3FTW A;  2EIK E;  4UI9 K;  5JA4 D;  4N3C A;  2IOL A;  5EN5 D;  3T9K A;  4OAU C;  4CGW A;  4CYM D;  4UUC A;  2KZT A;  4XKB A;  2KCK A;  4JA9 A;  1TNU A;  3CGH A;  1UJJ A;  3O48 A;  2B0O E;  5FIO A;  2UY1 A;  3FH7 A;  4YVQ C;  2WM9 A;  5EX3 A;  3D9O A;  3L08 A;  1FVF A;  1MYO A;  4KBQ A;  2IO3 C;  1NL4 A;  4AVX A;  4Y6W A;  1BU9 A;  2CG2 A;  3LY9 A;  4EBA G;  4GTO A;  4WAF A;  4GYY A;  1OCO E;  4N2S A;  5BXU A;  3GZS A;  5D2M C;  3TWW A;  3U4T A;  3E37 A;  1IQU A;  3DWL G;  4TXQ A;  3SF4 A;  2P9N G;  2Y69 E;  3ASF A;  4KVM A;  1TJF A;  1BPO A;  5CED B;  4J6I A;  3TG5 A;  3LXU X;  1FT1 A;  1KT0 A;  1SZ9 A;  2XPI A;  1YYH A;  4RQI A;  3PZ4 A;  1OWN A;  3APC A;  3ZYL A;  2MYO A;  3QJZ A;  3LVR E;  3HG0 D;  3MA5 A;  1K8K G;  3R7Q A;  2M63 A;  5FJY A;  3ZXS A;  2QC9 A;  2F37 A;  3MKR A;  1Z5S C;  1Z3Y A;  3HRA A;  3FTX A;  3I3N A;  3ZN3 A;  3FHE A;  1WY6 A;  1SW6 A;  1UN9 A;  2J07 A;  1PAQ A;  1UOH A;  3G2V A;  5KJN A;  2YNQ A;  3AG1 E;  4PUC A;  1O1R A;  2HE0 A;  4JHJ A;  1JCQ A;  2P9P G;  4K5C A;  4J8D A;  2PM7 A;  2R17 C;  2OVF A;  2VGX B;  3D9P A;  3TWU A;  4CCA A;  2L9B A;  5E76 A;  3ZIM A;  1MX6 A;  5CCM A;  2UY1 B;  3HVE B;  3Q9N C;  3PRE A;  3QAR A;  3ABK E;  3ML9 A;  4DX5 D;  2AXU A;  2P9S G;  4MBG A;  5ITZ F; 
#chains in the Genus database with same CATH homology
 3UKU G;  2P9I G;  4JD2 G;  2P9U G;  2P9S G;  2P9K G;  2P9P G;  4XEI G;  1TYQ G;  3DWL G;  3DXK G;  3UKR G;  3ULE G;  3RSE G;  2P9N G;  3DXM G;  1K8K G;  1U2V G;  2P9L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...