3ULLA

Human mitochondrial single-stranded dna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
106
Chain Sequence
LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human mitochondrial single-stranded DNA binding protein at 2.4 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords DNA BINDING PROTEIN
total genus 14
structure length 106
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ullA00
4LUVA 3DM3A 5C4JH 1OXXK 4JI3L 2UUCL 2GN5A 5IE8A 1PHJA 1BBWA 1TWAH 4C3HH 1IBLL 4DV1Q 2N8NA 3CCLA 2AWOA 3AFPA 1FVIA 1WFQA 4A3DG 4HJAA 1XNQQ 3ICEA 5IYCH 4GNXB 1N36Q 3S17H 2UUAL 3KF6A 3UDGA 4DV3L 2B63H 3CQZH 3W5OA 4AH6A 2ALYB 3D0FA 4X6AH 2JA5G 3WWVA 3A5ZB 3EIVA 3T1HQ 4BY1G 2Q2TA 4B3TL 2VUMG 4A3GH 4JOIC 5FJ8G 4Y7NH 4WJ4A 4ALPA 4X66Q 1X6OA 2CCZA 4L5QA 4APVA 5C44H 1CKOA 4OWXB 3M4QA 1AH9A 4QIWE 1I5FA 4YWKA 1CKNA 2D0PA 4GKKQ 4QJFA 2B3GA 3M85A 3ULLA 1YJ9A 4A3FG 1HZAA 3PUXA 3PSIA 4IPGA 4JI6L 3RLFA 5FJ8H 4LF9Q 4MTNA 2UXBL 1EIYB 1HZCA 2JA6H 3PO2G 1IXRA 5IYCG 1Y1VH 5AJ3Q 4BXXG 1Z47A 3J81j 4DV6L 1PH4A 4DNIA 4HIDA 1E1OA 2YTVA 3K81C 1XPRA 2E2JH 4R4IA 4IO9A 1VQFA 2NN6G 3HOXG 2Z6KA 2BH2A 1PH7A 4A93H 4A3DH 2RHSB 5IT9c 1VQ7A 4UY8C 4FDBA 3RZOH 3FP9A 3PUVA 2FXQA 4A4IA 4DR1Q 1XJVA 4DV5Q 2I5LX 4IPCA 1PA6A 1XMOQ 2PMZE 1VQ8A 1ASYA 1HNWQ 2R7ZH 4R4OA 2A1AA 1PFSA 4QGUA 1N33Q 1HR0W 4DR7Q 2OCEA 5JJKA 3UDXA 4J15A 4JI2Q 4BA1I 4L5RC 4X65L 3K80C 3H3VH 3GTMH 4DK6C 3BZCA 2BA0A 2PI2E 4LFBL 4A3KH 3LGJA 1HNZQ 1YBYA 5C3EG 1YVCA 4DUYQ 1K8GA 4LFAL 4AQYQ 4X64Q 3F1ZA 1KD1C 3CP0A 1HH2P 4PZ7A 1XPOA 4MZ9A 2QA4A 5DLQE 3SGIA 2GVAA 3CCMA 1BVSA 4A93G 1L1OA 4PMWA 3G48A 3CCRA 4OONA 5IP9G 1Y1VG 1KRSA 5H1SE 1X9NA 1XNQL 4B3RQ 1U5KA 3VDYA 1FJGL 1P16A 4OWTB 1YNXA 2F4VQ 3A0JA 2VQEQ 3T1YL 1WYDA 1HNXQ 1HNZL 1LYLA 3E9HA 3RLNA 4A3IH 4A3EH 3CCUA 2UUCQ 3S1NH 3I4MG 1I6HH 4A76A 4IFDJ 1X65A 5ELNA 5IY0A 3JC66 1K9MC 2AHOB 5IYBG 4LUOA 4JI4L 2CQOA 2JJQA 4DR4L 2ZJRA 1X3EA 4C3JH 1VQAA 4LF5Q 2WB1E 2JA9A 1E22A 1Y1WG 1NBWA 2JEBI 1VQBA 1EUJA 4A3GG 4DK3C 1VQJA 4YHHL 1XMOL 1PH1A 2VS1A 4LW1A 1HZBA 2K14A 4JI7L 4R4TA 3F2DA 1UE5A 4DAYB 3GTJH 1VQ4A 1VQ5A 3E9IA 5M3FH 3J80i 2A19A 2B63G 4JG2A 1KQSA 4NXNL 2OQ0A 2R6GA 4GN4B 1LM0A 5M5YH 2E2IH 1K3RA 1EQQA 3IRBA 4GN3B 4LF4L 2XGTA 1W3SA 4DV4Q 5IP7H 3GTGH 2KHJA 5LMNW 1MKHA 5C0XI 3HKSA 1TWHH 2I5MX 2Q2HA 4R4CA 4UP7A 5M5WH 1YJWA 3HOYH 1J6QA 4LF9L 2JA8H 4GKKL 2EXDA 4GLVB 4YY3Q 3S15H 1WI5A 5IYBH 3HOWG 4P73A 3ZJYC 1PYBA 5C44G 3CMEA 3BZKA 1Q1EA 4HIOA 1H95A 4X65Q 1Q46A 2AWNA 4GNXC 2HIXA 2CFMA 3J7ZC 4B3RL 3PCOB 1JJCB 1SRUA 2BA1A 4DR5Q 2CKZB 3UE0A 3UE1A 2XTIA 4AIMA 1FJGQ 3H15A 1XNRL 2MFIA 2VNUD 4O0AA 3KJPA 3T1YQ 2PQAB 4LWCA 1XPUA 3I4NG 2YTXA 3S1RH 2K5HA 4AQYL 1PH8A 4DV7Q 3GD7A 4LF8L 3TRZA 3KDFB 4DPGA 3PIPA 4ME3A 3HOVG 3HOZG 4QQBX 1FL0A 3A5UA 1JB7A 3GTKH 1IBMQ 1X56A 3RN2A 5HGQA 1JMCA 4JI2L 4A3JH 3TQYA 3K7AH 3S1MH 1IBLQ 1Q1BA 3PV0A 2DGYA 4LFBQ 4IOAA 4DV0Q 3FHWA 1E7ZA 2HIVA 1VQHA 3PO3H 4PZ8A 1I50H 1Q8KA 1CUKA 4XTCS 2F52A 4B3ML 3U4VA 1I3QH 2NVXH 3CF5A 2ZJQA 4LF6L 2ZM6Q 3I4MH 3I55A 4H02A 1UEBA 1B70B 1C7YA 4LF5L 4KLKA 1R9TH 3HKZE 1RL2A 3RN5A 2IHFA 2WFWA 2IT1A 4JI0L 3HFZB 2K75A 5GAEC 1G291 1YEZA 4IJLA 4YCVA 4DV0L 1PH3A 1OXVA 4POFA 4JI5Q 2F4VL 2EIFA 2VUMH 2N78A 4X62Q 4B3TQ 3H0GH 3T1HL 4RMFA 5M5XH 4MNOA 3M9BA 1NMGA 2Q2UA 5M3FG 1PH2A 4DR3Q 3PIOA 4GOPA 2UXCL 5K36G 2UUAQ 4JCVE 1EQRA 2E8GA 4GN5A 4YWMA 3CCQA 5LMUQ 1S72A 2ASBA 1YHQA 1JT8A 1YZ6A 1NTGA 2IX1A 1G6PA 3CCJA 1A63A 4EX5A 1VQOA 1Q7YC 2A8VA 4EQ5A 3S24A 4A3BH 4A3KG 1PYSB 3D31A 4GLXA 4DR7L 3B6YA 3HOWH 2DUDA 5C0XG 4KHPL 4X66L 1IBKQ 1EYGA 4KHZA 3TS2A 1GD7A 1KRTA 3UDIA 4A3IG 2E2HH 4BA2I 4TQUS 3CW2C 5LMUL 2IY5B 1UE1A 2B29A 2JK8A 4DV5L 1SFOH 1Q82C 2WP8J 3GTQH 2WB1G 4C3IH 4UP9A 4B3MQ 1NMFA 4NXMQ 3UDFA 5JJIA 1SE8A 2LXJA 4DV6Q 1OXUA 4LUZA 4R1JA 2Y0SE 1N36L 5GQOA 2ES2A 2CWPA 3CCSA 4QY7A 3K0XA 1OXSC 2OWOA 4GOPC 1PH5A 4GLAC 4DV1L 2HHHQ 2F3IA 5EAYA 4GOPB 2E5LQ 1D8LA 3FKIH 4JI3Q 3MXNB 4OX9Q 4POGA 3BJUA 4C2MH 2OTLA 3PO2H 2N49A 3PUWA 3PF4A 2NVYH 5ELOA 4DV7L 4HIMA 1G51A 3NENA 2RCNA 1XMQQ 1VQ6A 1PV4A 1E1TA 5LMNQ 1X54A 2LSSA 2JA8G 1QVCA 1KIXA 2JE6I 2CWAA 4YCUA 3F2CA 4PG3A 2VL6A 2VQEL 1HZ9A 4JV5L 3W1GA 1EOVA 1K83H 4LF7L 1HNXL 2Y0SG 3HOZH 4JI1Q 4IOCA 3PF5A 2ATWA 1X55A 1WCMH 2HT1A 2ZTEA 1J5EQ 1VQDA 2UU9Q 4A3MH 2PQAA 2UXCQ 1J5EL 2UU9L 4DR3L 1KAWA 1GM5A 1X3FA 2N3SA 1HR0Q 1VQLA 2UUBQ 1TWGH 4DR2L 2I0QA 4LNQA 3PUYA 5IWAQ 1N34Q 1CKMA 4GS3A 1D7QA 3CXCA 4JI0Q 4LF7Q 3L2PA 3RNUA 4NB3A 1X3GA 5C3EH 2RHQB 2KCTA 4JI7Q 2K52A 3KYHC 1UE7A 2YYZA 4DAMA 4DR6L 2IHEA 3CPWA 3J80c 4DR6Q 4DV4L 4AYBE 3CAMA 1IYJB 4P74A 1HJPA 2KHIA 4DR1L 2EQSA 4UP8A 2YU9H 3L7ZC 1HNWL 4HJ8A 3HKZG 3HOUH 1GO3E 1VQCA 2YTYA 3M3YH 1CSPA 3ULJA 4NXML 3JAMi 4BBRG 1PH9A 5HY6A 1SROA 3KF8B 1IBML 2KCMA 4DV2Q 4GKJL 3HOVH 2R7DA 3EBEA 4K0KQ 3G6EA 4WJ3M 1BKBA 2YV5A 2HQLA 4LFCL 4A3MG 1JJ2A 1YI2A 1I94L 5GROA 4JI8Q 4OWWB 3Q8DA 4X64L 1VQNA 2H5XA 2VZAA 1VQ9A 4BXXH 1L2FA 3I7FA 5IYDH 1K73C 2IX0A 2NZOA 1CKNB 1Z9FA 2I5HA 1O7IA 3S14H 3G71A 4JBJA 2WAQG 3OTOQ 4IFDI 4A3CG 1NJIC 2OTJA 1VQPA 4DUZL 4A3BG 3H3VI 3OTOL 1S3OA 1XTDA 1JJGA 1YITA 3TEHB 4JV5Q 3I4OA 5LMNL 3PGZA 2NN6I 4NPSA 2GVBA 4A3LH 1VQKA 1RIPA 4JC0A 1S40A 1Y14B 3KOJA 1T9HA 4LFAQ 1E24A 3NELA 4JI1L 4L5TA 5C4XG 3K8AA 1YIJA 1A0IA 4IPDA 3STBD 4NXNQ 2NZHA 1BBUA 4RG1A 3J81i 3OW2A 3CCEA 1C9OA 1VQIA 3CMAA 1KC8C 1SLJA 1DGSA 1A62A 1L0WA 2R7FA 2K4KA 5JEAJ 2V1CC 2Z0SA 4JI5L 3F2BA 3GTLH 3CC4A 1K0RA 4A3FH 2NVQH 4IJHA 5AJ3L 2R93G 4A75A 2ZM6L 4JBKA 2R92G 4HJ9A 4JI4Q 2PNHA 4OXPA 4XIGS 5BR8L 4BBSH 2UXDL 4YWLA 3CCVA 3K7UC 4OO1G 1N34L 1C0AA 3EN2A 4BY1H 4L5SA 1KXLA 5IWAL 2MNAA 4LF8Q 1AE2A 1CSQA 4QL5A 2VQFQ 5JEAG 3GTPH 2K5VA 2MQHA 1LUZA 1VCIA 3A74A 4YY3L 4JBWA 4DKAC 2JEAI 2JA5H 2NVTH 3GTOH 1V1QA 1A8VA 1W2BA 5M3MH 2OQKA 2D62A 2KBNA 1N32L 1OXTA 2K50A 1XNRQ 1SR3A 5C0XJ 1WOCA 3MEFA 3I4NH 3RLOA 1N32Q 4DR5L 4P75A 3STBC 1YJNA 2JA6G 3M4PA 1V43A 3BU2A 2BH8A 2ZTCA 1GKHA 4HJ5A 4BY7H 1B7YB 1QUQB 3J81c 5GAHC 3RZDH 1XMQL 4LF6Q 3PO3G 2C35B 4DUZQ 1QZGA 1PH6A 3S16H 4BBSG 2AMCB 1N33L 3U50C 4YCWA 1Q86C 4B3SQ 1ASZA 3U58A 1EIFA 1L1OB 1TXYA 4DV3Q 1EFWA 3CC7A 1L1OC 3AEVA 2E5LL 1IBKL 1N9WA 4OX9L 3FKIG 2HHHL 3L0OA 4JI8L 4IFDG 4Y52H 2RF4A 1I94Q 3CC2A 1IZ6A 2KENA 1SMXA 4X62L 5GADC 3HOXH 4AYBG 3NEMA 5IP9H 5M3MG 1UE6A 5FLMG 3HOUG 1M1KC 4P72A 4A3JG 3J7A5 2JA7G 4DR2Q 1KHIA 3KLWA 1P8LA 4LF4Q 3H0GG 3ER0A 4HIKA 4DR4Q 3KF6B 1VS0A 1YHAA 3DLLA 4A3LG 1NE3A 1Q81C 3RR5A 2AKWB 4JI6Q 3I56A 1LTLA 4R4QA 2JQOA 1VQGA 1GVPA 3CD6A 2UXBQ 4O2DA 1B8AA 1SN8A 1UWVA 2L15A 3OYYA 4IPHA 1WCMG 3AYHB 3W1BA 4YHHQ 4HJ7A 1QVFA 1IL2A 3M7NA 3NBHB 4UPAA 3S1QH 1NY4A 5IYDG 2R7ZG 1K8AC 3GDEA 1MJEA 2Q2IA 3ERSX 4BY7G 2R93H 3KFUA 1QZHA 1HR0L 1KL9A 2UUBL 5J3BA 3S2HH 2WAQE 5FLXc 4A3CH 1JE5A 4KHPQ 3KDFA 3F8TA 5IP7G 3AFQA 2ZJPA 1FGUA 4GNXA 1QVGA 3HOYG 2JA7H 3E0EA 1M90C 2VY3A 1VQEA 4KI0A 2VQFL 4K0KL 4OO1I 1EWIA 1YHBA 4DV2L 4GKJQ 4BBRH 4LFCQ 1Y1WH 1E3PA 5C4XH 3ULPA 2VW9A 2QGQA 5FLMH 2QEXA 1TWFH 2UXDQ 1OTCA 1Q12A 2ID0A 5BR8Q 4P71A 1U0LA 1WJJA 3AQQA 2MO0A 3CPFA 3GO5A 3I2ZA 4PZ6A 2LXKA 1PVOA 1TWCH 5JJLA 4DUYL 4JOIA 1MIUA 5GAGC 1QUQA 2PI2A 2ZTDA 3TS0A 1MJCA 1V9PA 3TREA 2R92H 3U4ZA 3M4OH 4A3EG 4JBMA 4B3SL 5E7NA 4JYAL 3JAMc 3S2DH 3KJOA 2MO1A 3PUZA 4JYAQ 1VQMA 2Z6KC 3G4SA 1AE3A 2K5NA 1N8RC 2D0OA 4TVAB
chains in the Genus database with same CATH superfamily
4Q0FA 1JWSD 1OXXK 4JI3L 2UUCL 4C3HH 1RTOA 1D6EC 1KNEA 5ISRA 4OEMB 3FVQA 3CCLA 2BCOA 2O5IC 2AWOA 3PIO3 3AFPA 4JK1C 4DGZA 5FO9B 4UAIA 1XNQQ 2BDNA 4A3JB 5IYCH 3ICEA 1F2LA 2KHSA 2B8FA 3S17H 1DONA 4X6AH 4HN7A 2Q2TA 4A3GH 2VUMG 4Y7NH 1DJRD 4KKUA 3J7AV 5FLXE 1CI3M 1AH9A 2D0PA 4RGTA 2E2IB 3T4AC 1LT5D 4A3FG 2KJXA 2UXBL 4CGYB 1Y1VB 1HZCA 2JA6H 2IL8A 4CDFC 5AJ3Q 1Z47A 3LX0A 1FNVA 4DNIA 4HIDA 1E1OA 3H91A 5DAUA 4R4IA 2NBFA 1HQRD 4LAAA 2Z6KA 1F9SA 4ZCKA 1VQ7A 1U9RA 3FP9A 1XJVA 2I5LX 4HR7B 3JAME 2A1AA 1HR0W 4C3JB 4JI2Q 2NYZD 4L5RC 4X65L 3K80C 1PFBA 4DK6C 3BZCA 4A3KH 1YBYA 5C3EG 4DUYQ 4LFAL 3E5SA 2G9HD 1KD1C 1XPOA 4V190 2A68C 1X9NA 1XNQL 1FD7D 4CKEA 1U5KA 3VDYA 5C3WA 3GTQB 2F0IA 1YNXA 3DM1A 2F4VQ 2PCFB 1WYDA 1HNXQ 3E9HA 4KKSA 4A76A 4IFDJ 1X65A 4RKBA 1K9MC 1SYFA 2A5HA 2JJQA 1SYBA 4DR4L 1NBWA 4ULLA 1EUJA 2E76C 1S5DD 4YHHL 1XMOL 1PH1A 4XQQA 5IODA 1A3VA 1PLFA 1UE5A 4X3KA 1KTKA 2E2DC 1BOSA 1VQ4A 2A73B 4NXNL 2OQ0A 4GN4B 2K5DA 1EQQA 3IRBA 1CHPD 4RH6A 1SAPA 3M4YA 1JB3A 2Q2HA 1J6QA 3GP7A 4LF9L 1PXUA 2K6AA 4GLVB 4KJOA 1WI5A 4O42A 3HOWG 5C44G 5BN5A 2PNRC 1Q1EA 5KIXA 2HIXA 2F0PA 2EYPA 4C1NI 1NCVA 2CKZB 3UE0A 3UE1A 4AIMA 5I4DA 2QDBA 1XNRL 2X6LA 4K8JA 4J8QA 5C3EB 1CTMA 3S1RH 4AQYL 4DV7Q 2K04A 3KDFB 4ME3A 4BWGB 4ID6A 3K5LA 1JB7A 1IBMQ 2NUCA 1JMCA 4LFBQ 2Z6BA 4KK7A 3A54A 2HUGA 4ODGA 1TVXA 4RWSC 1JWUD 4KLKA 2WKDA 5C0XH 1RL2A 3RN5A 1Y69U 3I4LA 1TS2A 4M8AA 2KEDA 3HFZB 3P20A 2EIFA 2N78A 4B3TQ 5M5XB 1PRTB 2Q2UA 3I70A 3NWSA 4DR3Q 2IJ0A 2EYFA 2UUAQ 1EQRA 2F0HA 1UAPA 1B3AA 3CCQA 4K2KA 5CYUA 3MXGA 1TKWB 1YHQA 2ASBA 1JT8A 1YZ6A 2GA4B 1KDBA 3CCJA 1BR9A 2A6HC 4DR7L 2I46A 2R61A 1PTOD 1F2ZA 1HQMC 3TS2A 1GD7A 1TWHB 2MJ8A 4FP5D 4BA2I 3C2PA 2XWBB 5JJZA 1UE1A 5IOCA 5I6YA 1QE6A 1BCPB 2F0GA 4DV5L 3A8JE 1Q82C 2WP8J 2WB1G 3VYUA 1EZ6A 1NMFA 4NXMQ 1N36L 2AQ3B 3FRPB 3K0XA 4GOPC 4DV1L 4C3HB 1RCVD 1A2TA 5EAYA 5JEAH 1HFGA 1IW7C 4HEDA 2XWJB 3BJUA 2N49A 3PUWA 1J9OA 3PF4A 3N52A 4Q5VA 3HS0C 2RCNA 1VQ6A 2IW3A 5IGFA 1E1TA 5KNDA 1PTOF 4HCEA 2LSSA 3Q6SA 1JE4A 5IT9L 3HOWB 2Z1CA 4YCUA 4PG3A 2VL6A 2B2YA 2VQEL 1WTRA 1EOVA 1TWFB 2XVSA 1O7YA 2EXZA 2L1BA 3L3OC 4KY5A 1QJOA 1EY5A 1GM5A 1X3FA 1RKNA 2RDHA 3F2UA 1XYIA 1N34Q 4K2LA 2F0NA 1IKLA 4P2CB 2G5DA 4JI0Q 3L2PA 2K33A 5C3EH 4IFDH 2K52A 3KYHC 4DAMA 3J80c 1C4QA 2AUJD 3CAMA 4P74A 5D3DA 5CR3A 1HJPA 4DR1L 2F0WA 4UP8A 2YU9H 3I72A 1HNWL 1W6JA 5IGDA 2YTYA 3C46A 4JPBW 1CSPA 2QF7A 3OWEB 1AP0A 1RD9D 1IBML 2KCMA 3HP3A 4DV2Q 2KCNA 4KKTA 3RMHA 2G9DA 2OF1A 4WJ3M 2HQLA 4A3MG 4HTHA 1JJ2A 1SYDA 4BXXH 5IYDH 1K73C 2NZOA 1Z9FA 3S14H 4JBJA 2WAQG 3OTOQ 1NJIC 5LL6S 2OTJA 2E75C 4DUZL 3H3VI 1QOHA 1XTDA 4JV5Q 4MN3A 3PGZA 3R93A 1WTOA 3A7LA 4A3LH 1VQKA 4CKBA 4JC0A 1S5CD 2RDFA 3D4WA 2B8GA 2K5QA 3HOUB 4N9PA 1A0IA 5C4ZA 3CCEA 3KLSA 1C9OA 2C5CA 2HDMA 1DGSA 2NWGA 3S1RB 3KF8A 5JEAJ 3SXHA 4JI5L 3VR2A 2LFNA 3GTLH 4C3HG 2R92B 4CJ0B 2R92G 4K6DA 2PNHA 4CBVA 5BR8L 4QB4A 2EOTA 4ZK9B 3EN2A 3GTGB 4LK1C 4Y7NB 2VQFQ 4QL5A 5CBEE 1LUZA 5FKAC 2NVTH 2HCIA 1TWGB 1A8VA 2RBMA 3Q22A 1W2BA 1CQVA 1N32L 2OQKA 2CHBD 1OXTA 2K50A 5ELBA 1SR3A 1D1KA 1H9MA 1S4ZA 1WOCA 3MEFA 2K32A 3I4NH 3STBC 1YJNA 1PFMA 2JA6G 2BH8A 3VR4A 2L12A 1QUQB 1K83B 2OXPA 5IGEA 3RZDH 2WAQB 4BBSG 1Q86C 3S16B 1FYCA 1TXYA 1L1OB 4DV3Q 1EFWA 4IQZA 3D4DA 1ICWA 3AEVA 4OIJA 1IBKL 2E5LL 2SNSA 3VYTA 3L0OA 4JI8L 4ZLTF 1I94Q 1PYWD 3CC2A 3HEJA 4XDXA 5GADC 2D9UA 4U68A 1STGA 5IP9H 5M3MG 3HOUG 3R8BA 2CH4A 3OIPA 4LF4Q 3H0GG 4KD3A 1Q81C 1RDPD 1EOTA 5FOBB 3CD6A 3VR3A 3OYYA 1QVFA 3AYHB 2CW0D 3NBHB 4UPAA 1PZID 3TP7A 3AU7A 5IYDG 1MBYA 3GDEA 4BY7B 1ILPA 2WIIB 1QZHA 4IN3A 3J81E 1SNCA 4H44C 1SNDA 5J3BA 3KDFA 1F2MA 5IP7G 1SJHD 2B2WC 4QCLA 1TY0A 2JA7H 2KVMA 3VYRA 2VQFL 2WKCA 5EKKA 1MSGA 1NR4A 4DV2L 2K5WA 4BBRH 5BN3A 5C4XH 3ULPA 2F0UA 1LLRD 4ZUIA 2E2JH 4P71A 1WJJA 3I2ZA 1HPCA 3IFDA 1TWCH 4C3IB 1MIUA 1SYEA 1MJCA 3TREA 5E7NA 2XSCA 4BBSB 5ELEA 1VMPA 2D0OA 1ENFA 2QILA 4TVAB 4LUVA 3TZDA 3SHLA 1STAA 2GN5A 1PHJA 2N8NA 3MAQA 3DEOA 2PMZB 2KOLA 2L0CA 4IUQA 2H1EA 2F0QA 2ICEC 1WVLA 5M3MB 4HJAA 1BCPF 4GNXB 2N88A 4PNYA 2M9VA 3UDGA 3D6WA 2PW7A 2B63H 1TY2A 2ALYB 3D0FA 1PRTD 4QUCA 1WCMB 4BY1G 1B50A 1X3PA 2EYMA 3EJIA 1EU3A 1CKNA 4X3TA 4QJFA 2B3GA 1K0SA 1YJ9A 4OHJA 2EYHA 2F1MA 1IKMA 4IPGA 5FJ8H 4MTNA 1LT4D 1G91A 3PO2G 3ONAB 4ABNA 3J81j 4DV6L 3FKIB 3KBGA 2J0TD 2ZXOA 1PH4A 1ILQA 1T5XD 3GTPB 3K81C 2K01A 1HTPA 1BCPD 1PZJD 4ZKBB 4IUPA 2RHSB 4UY8C 3RZOH 3PO2H 2FXQA 4A4IA 1PA6A 3W2DA 4R4OA 2F0DA 2RKSA 3URYA 1PFSA 4RGMA 2PZTA 3NTHA 4NMZA 4KMUC 4XXEA 4DR7Q 5KRUA 3U9OA 3UDXA 2F0FA 4J15A 5DEHA 1CK1A 2MP1A 4TKOB 3GTMH 2BA0A 3K7AB 3IKJA 3BVZA 5M3FB 2JYOA 3I91A 4AQYQ 4X64Q 2TMPA 4PZ7A 1HH2P 3MFYA 5DLQE 4KHVA 4A93G 1L1OA 4PMWA 3CCRA 5H1SE 4B3RQ 1JOKA 3A0JA 2M2LA 1LABA 4ZRZA 2NVTB 2EYJA 5ELNA 3H94A 5KNBA 4LF5Q 2WB1E 1E22A 1Y1WG 3PMFA 4DU9A 1VQJA 3D4RA 4A3FB 4EQNA 2VS1A 1TT2A 1ZYRC 4DAYB 1VQ5A 3E9IA 3J80i 2A19A 3PIP3 4JG2A 1BUVT 1CM9A 1EQVA 4OELB 2XGTA 1W3SA 3R3OA 1V1PA 3HKSA 1PFNA 1TQOA 4GKKL 4YY3Q 5KGUA 1EY8A 1HA5A 1UUPA 5IYBH 3ZJYC 3CMEA 3A56A 3AB9A 5D65A 1Q46A 3QG1A 1SBBB 2N55A 3MZ5A 4GNXC 3PCOB 4HSPA 1SRUA 4DR5Q 3WOEA 1EL0A 2VNUD 4BS9A 2MFIA 2VB3X 3H09A 1ET9A 4LWCA 1XPUA 1ENCA 1LTID 1M8AA 2K5HA 3OMGA 1PH8A 3GD7A 2A69D 4QF4A 3PIPA 4DPGA 1EIGA 3HOZG 4QQBX 2VXWA 3A8IE 3H6MA 1X56A 5HGQA 3MTSA 4JI2L 3T13A 1ZEQX 1JOQA 3PV0A 2DGYA 2XRQD 4EQPA 4IOAA 1VQHA 3DMUA 2OT2A 1I50H 1S5ED 1CUKA 2F52A 2MUYA 3MC0B 3U4VA 4B3ML 3I4MH 3CF5A 3OOCA 2EVBA 1B70B 3HKZB 1R9TH 1TWCB 2RCFA 1I4PA 2F0OA 2IHFA 2IT1A 4LJZC 4UDUC 1STEA 5GAEC 4YCVA 2EDGA 4POFA 2TSSA 4E6IA 4ZUJA 3NK9A 1A3UA 4MNOA 5JPNC 5M5XH 1NMGA 5C6AA 1WTPA 5M3FG 1HXYD 4GOPA 3KK7A 3RUZA 4GN5A 4YWMA 3T51B 5LMUQ 1T5EA 1F9QA 2R3ZA 1G6PA 1EY9A 1X3QA 1M4VA 4A3KG 1Q90A 1PYSB 3D31A 2F3VA 2DUDA 4XYQA 5C0XG 3A8KE 1LTTD 2JP1A 4X3SA 1CZWA 5LMUL 2IY5B 3GTQH 1SFOH 3J7YW 1AZQA 2WACA 5DM63 1EYAA 2QCPX 2Y0SE 2O2LD 5GQOA 2ES2A 1STBA 1LT3D 2CWPA 2PPBC 4I7ZC 2OWOA 2EY5A 5FLXL 4OX9Q 3FKIH 4JI3Q 5E4XA 1KLGD 4JW0A 4POGA 1BF4A 2B2WA 2RSNA 3IL8A 2BOSA 2SDFA 4IUTA 3NSWA 1NNXA 3S1MB 4JVZA 2CWAA 3F2CA 4HMIA 3HG9A 3QOLA 3W1GA 2EE1A 1K83H 1SE4A 4WRDA 3HOZH 4IOCA 1WCMH 3GQBA 4A3MB 4A3MH 2PQAA 5D14A 2UXCQ 4RFBA 1Z6HA 4NP5A 4XYOA 1KAWA 1VQLA 2N3SA 4ILWA 2I0QA 4LNQA 3I3CA 1HTLD 4GS3A 3UI2A 1X3GA 5I9PA 1TR5A 3CRLC 4WJWA 2IHEA 3CPWA 4ZQ3A 2FINB 1H9JA 3KLRA 4K5WA 3S1NB 4OIKA 3L7ZC 1EWCA 2DY8A 3HKZG 4HJ8A 1GO3E 3SVMA 3H0GB 3M3YH 1PH9A 4BBRB 1SROA 1EY7A 4HMJA 4DK0A 2R7DA 3G6EA 1TU2B 3WDNA 2YV5A 5LL6X 4OGQC 1XX8A 1I94L 1DYQA 4KD4A 3VYSA 1B2TA 2H5XA 2VZAA 4IALA 1L2FA 3I7FA 2NB0A 4LMQD 2PW5A 1CKNB 3PO3B 2X6GA 5E4WC 3MA2B 1EY0A 1JJGA 4B08A 3I4OA 3ND9A 2NN6I 4WFN3 1FR3A 1AEXA 4X3UA 1ESRA 5AFWA 3I90A 2CVRA 1T9HA 1E24A 3NELA 1SYCA 4KN7C 4L63B 1BXTA 1YIJA 3ZYYX 4NXNQ 3G7LA 3NQTA 4L6TB 3J81i 3LWUA 1STNA 2B2VC 3CMAA 3OW2A 1KC8C 1A62A 2Q8TA 1CA5A 5D3IB 3C1EA 2ZXRA 2QW7A 1SJED 2SOBA 2A74C 1K0RA 4A3FH 3CC4A 1QCBD 5IGGA 4N8FA 5AJ3L 4IUVA 1HCZA 4JI4Q 1MHWC 4DAPA 4BBSH 1I50B 1N34L 4L5SA 4BY1H 1KXLA 1YNJD 5IWAL 2E2JB 1V1OA 4V0BA 2JA8B 1AE2A 2LY7A 4IZ8A 2JEAI 1L0XB 4DKAC 1KLUD 1V1QA 2B2YC 5I6WA 2KBNA 1LT6D 5IGBA 1JOOA 5IGCA 2B2VA 1B44D 1K3BC 4P75A 1BNZA 3BU2A 3J81c 1KDCA 2K1BA 2EPBA 3PO2B 2DJGC 3FKIG 4PV1C 2HHHL 2IPKD 4IFDG 4Y52H 1W6KA 2PZUA 1SMXA 1EFID 3KLSX 2P5ZX 2Z4HA 1UE6A 4P72A 5EJWA 3J7A5 4DR2Q 4KV6A 1KHIA 2L9HA 1E2ZA 4DR4Q 1YHAA 4FF3A 1NE3A 3RR5A 3VR6A 1PDQA 1LTLA 3TP8A 4F7XA 1D1IA 4O2DA 2XNAC 3NP8A 1HA6A 5F2DA 2HDLA 3S1QH 1NY4A 2B2TC 2FHTA 5ELCA 2R93H 2QEJC 1RHPA 1HR0L 2UUBL 3QO2A 3S2HH 1JE5A 1O78A 2ZJPA 5LHY1 1NSNS 4RHRA 3E0EA 1M90C 4KI0A 1U4LA 4OO1I 1EWIA 1YHBA 1EIHA 1K8OA 4LFCQ 3PQIA 4BY1B 1OTCA 1Q12A 1SMYD 4YIJA 1U0LA 3K5NA 3AQQA 2MO0A 4PZ6A 4JOIA 2Q8RE 2PI2A 3TS0A 4IURA 2D2CC 2FFKB 4B3SL 3M4OB 5EPJA 3PUZA 1VQMA 3G4SA 2CW0C 3E3XA 1ONLA 1LACA 4QMGA 5J1ZA 3DHQA 4J1MA 4DNTB 1BBWA 1TWAH 1IBLL 3Q23A 4DV1Q 3MXNA 1FVIA 1WFQA 4A3DB 4CDCC 1YNJC 1EZ8A 2F0EA 5JVH3 1EY4A 3RZOB 3KF6A 3CHBD 4DV3L 5ELDA 3CQZH 3VA5A 3W5OA 3H3VC 2JA5G 1E2WA 3WWVA 3EIVA 5BN4A 1QG7A 3T1HQ 4FXGC 2MGSA 4C56C 4B3TL 4JOIC 4WJ4A 4X66Q 4FO2A 2CCZA 5CGKA 5C44H 3AMUA 4KJNA 3M4QA 4QIWE 3OW7A 1XTCD 4GKKQ 1AFPA 2HD3A 3ULLA 3EFXD 1QNUA 5DM73 4JI6L 1HZAA 1J8IA 3PSIA 1LO5D 2O4XA 3RLFA 1E0BA 1IXRA 1Y1VH 4K14A 1B3QA 1XWEA 4IO9A 1VQFA 1PH7A 3GTKB 1H9SA 4A93H 4A3DH 1V8QA 4FDBA 2A68D 4DR1Q 4DV5Q 4IPCA 3LNNA 1ASYA 1HNWQ 3T16A 3M3YB 1N33Q 2JN4A 3NTKA 2OCEA 1I3QB 4DNRB 2NVXB 2RDGA 3DWPA 1SYGA 1GHKA 3H3VH 2Z9HA 3SK8A 1HNZQ 3V2TA 2K7VA 3FDTA 1K8GA 4FF4A 5M9OA 3CP0A 5M5YB 1DM0B 4FVMA 4MZ9A 3CCMA 1JICA 3G48A 1JQYD 2M00A 1RJTA 1FJGL 5EPKA 4OWTB 3T1YL 1KNAA 1HNZL 3RLNA 4A3IH 1NR2A 5CV6A 2EJMA 3C1FA 3JC66 3S1QB 2AHOB 5IYBG 2EY2A 2CQOA 3QJYA 1X3EA 1JWMD 1VQAA 3N6RA 1Y1WB 3R2IA 2JEBI 1VQBA 5CORA 4CDEC 4O1NA 2KQ3A 2K14A 1JORA 1Y8OB 3GTJH 2B63B 1KQSA 2DNEA 2R6GA 3BZDB 1LM0A 4R8NA 4LF4L 1K3RA 4DV4Q 4ZAIA 3NE5B 4UHVA 4G7ZC 1MKHA 5C0XI 1KAAA 1YJWA 4UP7A 3OMCA 3HOYH 1WTXA 3WOFA 1YNND 4H13C 1R9TB 3BZKA 4C2MB 1H95A 2KA7A 4X65Q 2AWNA 2CFMA 4B3RL 1JJCB 4R9WA 2BA1A 4QIWB 1FNWA 3J81L 3H15A 1IYUA 5COYA 4O0AA 3KJPA 1EEFD 1SNOA 4TSSA 1FNUA 4QUFA 5IT9E 4LF8L 2X69A 2CQAA 1CQFA 1SSOA 3RD4A 4F88A 3HOZB 3HOVB 3A5UA 1SE2A 3GTKH 4A93B 3FPPA 1AN8A 3TQYA 3K7AH 3JAML 3S1MH 1Q1BA 4GZYC 3FHWA 4PZ8A 1Q8KA 2BE5C 1I3QH 2NVXH 2ZJQA 4LF6L 3NPPA 2ZM6Q 1Y8PB 1UEBA 1C7YA 2QKIC 3HKZE 2WFWA 1WTQA 1S5FD 1I6HB 4IJLA 1A15A 2VUMH 4X62Q 1PTOH 2EY6A 3T1HL 1X32A 3M9BA 3E6ZX 1PH2A 4PMBA 5NUCA 3MVVA 5G3LD 1F9PA 1NTGA 1QILA 1R4PB 4EX5A 1VQOA 1Q7YC 3LWEA 1WTHA 4EQ5A 4MTKA 3S24A 1G2TA 1MGSA 1B9NA 5EQ0A 4GLXA 3NHHA 5EKIA 3HOWH 1GUTA 1F77A 1EYGA 1KRTA 3Q24A 3R2TA 2E2HH 4TQUS 1H9KA 3CW2C 2B29A 4RCOA 3EROA 4UP9A 4B3MQ 4FXKC 5CV8A 5JJIA 3T53B 2BDOA 3S9WA 4DV6Q 4R1JA 3IAYA 4QY7A 1BBXC 1U4PA 1OXSC 1TWAB 1GUSA 1F2YA 4GOPB 1O7ZA 2OTLA 2NVYH 5ELOA 3NENA 1DOKA 1Q3LA 2F3WA 2K28A 4A3BB 1PV4A 2JA8G 2JE6I 4DXGA 1HZ9A 4JV5L 3NBIA 5TSSA 4LF7L 1HNXL 2IX3A 5M5WB 3TN2A 3SK5A 1Y8NB 2L5TA 1J5EL 2UU9L 1TWGH 4DR2L 2AUKA 2EYLA 5C4HA 3PUYA 5IWAQ 2AQ2B 2LMCB 3K6OA 1SMYC 4LF7Q 3RNUA 2HQEA 3MXPA 4RAUC 4FNFA 1UE7A 2YYZA 5E1FA 4DR6Q 1PZKD 3ND8A 1IYJB 2A6HD 2A69C 1D5XC 3SK6A 1QNKA 2KHIA 1GUOA 4KY6A 4DXFA 3J80L 3HOUH 1VQCA 2RQXA 3ULJA 4CDDC 1VF7A 4BBRG 2V4DA 5KEEA 4RA8A 1VDZA 1BKBA 4LFCL 5FO7B 1YI2A 4OWWB 3CU7A 1VQNA 1VQ9A 5ELFA 2XN9C 1CA6A 5K5PA 1SE3A 2F0SA 3I8ZA 2IX0A 4J6HA 1GJXA 2I5HA 1O7IA 3G71A 4A3CG 4IFDI 1C48A 5E3FA 1VQPA 1S5BD 1S3OA 4G57A 2EJFC 1YITA 5T1IA 2GVBA 3S15B 3U9SA 3K5OA 1R4QB 4MIUA 4XT3B 1Y14B 4Z9CB 4LFAQ 3SEBA 4A3IB 4L5TA 5C4XG 2EYOA 4IPDA 1ZKOA 5A35A 2NZHA 2RA4A 1ML0D 3O13A 1L0WA 2B2UA 2V1CC 4TRDA 3S2HB 2B2TA 1PMRA 3GTMB 2VB2X 2NVQH 3DXJC 2ZXPA 3M7GA 1WD1A 3FEWX 1B53A 4A75A 4JBKA 3J80E 1DCZA 4EVOA 4OXPA 3OHXC 3P75A 1IYVA 1DZ1A 2UXDL 4YWLA 3CCVA 3FMCA 3K7UC 3X3MA 4OO1G 1HFNA 3EQLC 2MNAA 1CSQA 2F0LA 2K5VA 3A74A 1BCPC 1VCIA 4YY3L 4JBWA 3I73A 2JA5H 5CC4A 3GTOH 5HURA 1GUNA 3MXUA 5A2QL 5HGTA 2C9OA 4OO1H 3GV6A 1XNRQ 5C0XJ 4DR5L 1BO0A 5KYIA 1E2VA 1V43A 1AW7A 4KY7A 4HJ5A 1LTSD 4BY7H 1SNPA 3G6JB 3TP6A 5GAHC 1XMQL 3QB3A 3PO3G 2C35B 4DUZQ 1QZGA 3S16H 2AMCB 1N33L 1ASZA 3U58A 1VMCA 2F0KA 1BDOA 3TSSA 3VR5A 4NW2A 3CC7A 1L1OC 4OX9L 2F0JA 2KENA 4DFAA 4IUUA 3VA7A 1EQTA 2NN6H 3HOXH 4AYBG 2I07B 1GOZA 4FF2A 4G7OC 1M1KC 3OSOA 1P8LA 4HIKA 2WV6D 3ER0A 3KF6B 1VS0A 1U4RA 2AKWB 2F4IA 4JI6Q 5DNFA 1SNQA 4R4QA 1SNMA 1VQGA 2JQOA 2UXBQ 1SN8A 1LV9A 3W1BA 1IL2A 4HJ7A 4YHHQ 3M7NA 3TBIB 2R7ZB 2R7ZG 1K8AC 1QWYA 1RODA 4PQXA 2Q2IA 3RZDB 2WAQE 5FLXc 4A3CH 4N9TA 1TS5A 3F8TA 3SR1A 4DK1A 3AFQA 2XRSD 1HUMA 4U673 2E74C 2PO4A 4MHEA 4K0KL 1ET6A 1H9SB 4ZYSA 5FLMH 2ID0A 1G6ZA 2E2HB 3MHBA 3CPFA 1MSHA 1JC7A 1HHVA 2NZ1D 4DUYL 5CV9A 5KYLA 2H4OA 1V9PA 2R92H 3CRKC 4A3EB 1NAPA 1CFMA 2J7ZA 4C3JG 4A3EG 1PRTC 3JAMc 2ENBA 3S2DH 3S2DB 3KJOA 2B2UC 2MO1A 4JYAQ 3S14B 1AE3A 1IBKQ 1IL8A 1O7LA 3ITPA 1G8ZD 3DM3A 5C4JH 2R93B 5IE8A 3DEPA 2PZWA 1B9MA 2F0MA 4XQNA 4A3DG 1V1PB 1N36Q 1OO9B 2UUAL 1PRTF 3GV3A 3J7AF 4AH6A 3T56B 1NUCA 2QDLA 2FJ2A 3BVMA 3A5ZB 1JR0D 4F8MA 3V05A 4G4KA 5FJ8G 4ALPA 1X6OA 3NUCA 4L5QA 4APVA 1GXDC 4B9WA 1CKOA 4OWXB 3V96A 1I5FA 1D5ZC 4YWKA 3D8GA 4CJ2C 3M85A 1ZXTA 4LF9Q 3PUXA 4RGNA 1D2BA 1EIYB 5IYCG 4BXXG 2PYKA 4FYDA 2YTVA 1XPRA 4M1UB 2NN6G 3HOXG 1STYA 2BH2A 2K05A 5JAVA 3BDOA 4N8X1 2OEOA 4KN4C 5IT9c 3S17B 3PUVA 4ME5A 2KEEA 3BDLA 2PMZE 5FO8B 1XMOQ 1VQ8A 2A6ED 2R7ZH 3A7AB 1IW7D 5I9OA 4QGUA 5EGTA 5JJKA 3TZUA 2ICIA 4BA1I 2KUMA 2JXMB 2PI2E 4LFBL 5CV5A 3LGJA 5C5MA 1LTRD 1YVCA 3F1ZA 2D5DA 2QA4A 4L8JA 1XXGA 3SGIA 2GVAA 5I2XA 1BVSA 5C4JB 4OONA 5IP9G 1Y1VG 1KRSA 1I4QA 3NWTA 1P16A 2VQEQ 3GTOB 2JA5B 1LYLA 3BS1A 4A3EH 3K57A 2UUCQ 3CCUA 3S1NH 1I6HH 3I4MG 5T1GA 3KUPA 3BYTB 5IY0A 3FPUB 1GUWA 4LUOA 4JI4L 2ZJRA 4C3JH 2JA9A 1MD2D 4A3GG 4DK3C 1ENAA 4S3SA 3SDZA 4A3GB 2F03A 5EPLA 4LW1A 3C3LA 1HZBA 4JI7L 4R4TA 3F2DA 5M3FH 2B63G 2O5JC 2EZVA 3MEHA 2E2IH 5M5YH 4GN3B 1YNNC 4DAVA 4H0LC 5IP7H 2KHJA 5LMNW 3D6CA 3GTGH 1TWHH 2I5MX 4R4CA 5M5WH 2JA8H 2EXDA 3S15H 1TS3A 2SNMA 3SE0A 4P73A 1PYBA 1KABA 4CKCA 4HIOA 4C1NK 3J7ZC 4PMCA 1MI2A 4XQJA 1FJGQ 2XTIA 3K59A 1SXTA 3I4NB 3I4NG 3T1YQ 2PQAB 3D3RA 1HRJA 2YTXA 3TRZA 3QOJA 3Q0AA 2MPMA 1G2SA 1VF5C 3HOVG 1GHJA 1FL0A 1WTVA 4RCNA 1EYDA 1A2UA 1CT1D 3RN2A 4A3JH 4A3KB 1IBLQ 4I7AA 1PTOC 4DV0Q 1E7ZA 2HIVA 1B1ZA 2LS01 3PO3H 1QB5D 4XTCS 3NQIA 1I4HA 4RHSA 3I55A 4H02A 2L4NA 4OL7A 4LF5L 3IFTA 2L11A 2Z4IA 5IIFA 5C44B 3DWQA 4JI0L 2K75A 4RGOS 1G291 1YEZA 4DV0L 3NBHA 2F4VL 1PH3A 1OXVA 4JI5Q 4RKLA 3H0GH 4RMFA 4HSVA 1D5MC 2DNCA 3PIOA 2UXCL 5K36G 1UEAB 4JCVE 2E8GA 1S72A 1EEID 4XT1B 2IX1A 5FK9C 1A63A 3EVQA 4WORA 2A8VA 2RVLA 4A3BH 3B6YA 5EKLA 4HCSA 4X66L 4ZKCB 2ZT9C 4KHZA 3I4MB 3UDIA 1EYCA 4DN4M 3W3AA 4A3IG 2NVQB 2JK8A 2NTSA 5J22A 1WD0A 4C3IH 1K28A 3UDFA 1SE8A 2LXJA 1OXUA 4LUZA 2AQ1B 4K5VA 3CCSA 3QR8A 4DAYA 1PH5A 4GLAC 5C3XA 2HHHQ 5G3LF 2F3IA 2E5LQ 1D8LA 1ICFB 1SEBD 2WINB 3MXNB 2RSOA 2J4XA 1O80A 4C2MH 2NVYB 4DV7L 4HIMA 1G51A 1XMQQ 1TS4A 5LMNQ 1X54A 2NTTA 3MWYW 1DXMA 2KECA 5CBAE 3KBXA 1QVCA 3CQZB 1KIXA 2FMCA 2F0TA 1JCKB 2Y0SG 3BVGA 4JI1Q 1HUNA 3PF5A 2ATWA 1X55A 3QIAA 2HT1A 2ZTEA 3GTLB 1J5EQ 1VQDA 2UU9Q 1SFOB 3NTIA 4DR3L 1EWHA 1HR0Q 2UUBQ 3X3NA 1CKMA 1D7QA 3CXCA 1A6XA 3ERQA 3HZXA 2DY7A 4CJ1B 4NB3A 3BDCA 2HCCA 2RHQB 2KCTA 3TMEA 4JI7Q 4DR6L 1DOMA 2F0VA 3TP5A 4DV4L 4AYBE 4HAEA 1LTAD 3MFGA 2EQSA 1BQQT 4EGVA 1KDAA 1LTGD 2EJGC 4NXML 5EBDA 3JAMi 5HY6A 4FF1A 3KF8B 5C5LA 4GKJL 3HOVH 3EBEA 4G7HC 4K0KQ 1EY6A 2B39A 3OPOA 5GROA 4JI8Q 3Q8DA 4X64L 5J39A 4A3BG 3OTOL 1ZYRD 3TEHB 3HOYB 5LMNL 2KCCA 4NPSA 2XIWA 1RIPA 1S40A 3OIQA 2Y0SB 1II3A 3KOJA 5CV7A 5I2YA 4DF7A 4JI1L 3K8AA 2JA7B 1F9RA 3DUZA 3STBD 4RG1A 1BBUA 2WB1B 3EA6A 3K0YA 1VQIA 4NKLA 2R7FA 2K4KA 3TDQA 2Z0SA 3F2BA 4IJHA 1I4RA 4K8IA 2R93G 3K5MA 2ZM6L 3HGBA 4HJ9A 4XIGS 2K03A 3BYYB 4AYBB 4DA2A 5EBCA 1RF2D 1C0AA 3P7JA 2FMMA 1I6VC 4KTAA 4F87A 4LF8Q 1STHA 3GTPH 5JEAG 2CH4W 1FGBD 2MQHA 4K5XA 3DWAA 5JPMC 5M3MH 5KNCA 2D62A 2YU9B 1N32Q 2VUMB 1RTNA 3RLOA 1PTOB 3M4PA 4NDXA 2JA6B 4C3IG 2ZTCA 3HRZC 1GKHA 1B7YB 1DOLA 4IUNA 4LF6Q 4FXDA 1CZGA 1PH6A 3U50C 4YCWA 4B3SQ 3A55A 1I4XA 1EIFA 2MHVA 1GUGA 1U4MA 1SDFA 1N9WA 1WTWA 2RF4A 1IZ6A 2PQEA 4I65A 4X62L 3HOXB 3SK4A 2IWHA 5C4XB 3NEMA 5FLMG 2L55A 4A3JG 2JA7G 4EQOA 1DD2A 3KLWA 2Q8IB 1LTBD 5L37A 4A3LG 3DLLA 3OWFA 2DJFC 1ESFA 3I56A 4H7BA 1L0YB 1GVPA 1C8CA 3K58A 1B8AA 1UWVA 1Z7TA 2L15A 1Q8IA 4IPHA 5CMDA 1WCMG 4B9XA 1H9RA 1MJEA 4BY7G 3ERSX 3KFUA 1KL9A 1TIID 2A6EC 2BE5D 3L9AX 2JSOA 1CHQD 4KHPQ 4GNXA 1FGUA 2LKVA 3CKIB 1QVGA 3GTJB 1IHZA 2SEBD 3HOYG 2EY1A 5CV4A 2VY3A 2Z8LA 1VQEA 5K36H 3E0JA 1B4OA 5JOBA 4GKJQ 1Y1WH 1A3TA 2DN8A 1E3PA 2VW9A 1UNSA 2QGQA 2QEXA 1TWFH 1AZPA 2UXDQ 1EU4A 5BR8Q 4KHPL 3QWNA 3GO5A 5A2QE 5JJLA 1I4GA 4CHTB 2LXKA 3P1HA 1PVOA 5GAGC 1QUQA 2ZTDA 4R8IA 1K8MA 4K6LA 3NXWA 3U4ZA 3M4OH 4JBMA 4JYAL 2Z6KC 3BG3A 1SLJA 2K5NA 1N8RC 5JVG3
chains in the Genus database with same CATH topology
4LUVA 3DM3A 5C4JH 1OXXK 4JI3L 2UUCL 2GN5A 5IE8A 1PHJA 1BBWA 1TWAH 4C3HH 1IBLL 4DV1Q 2N8NA 3CCLA 2AWOA 3AFPA 1FVIA 1WFQA 4A3DG 4HJAA 1XNQQ 3ICEA 5IYCH 4GNXB 1N36Q 3S17H 2UUAL 3KF6A 3UDGA 4DV3L 2B63H 3CQZH 3W5OA 4AH6A 2ALYB 3D0FA 4X6AH 2JA5G 3WWVA 3A5ZB 3EIVA 3T1HQ 4BY1G 2Q2TA 4B3TL 2VUMG 4A3GH 4JOIC 5FJ8G 4Y7NH 4WJ4A 4ALPA 4X66Q 1X6OA 2CCZA 4L5QA 4APVA 5C44H 1CKOA 4OWXB 3M4QA 1AH9A 4QIWE 1I5FA 4YWKA 1CKNA 2D0PA 4GKKQ 4QJFA 2B3GA 3M85A 3ULLA 1YJ9A 4A3FG 1HZAA 3PUXA 3PSIA 4IPGA 4JI6L 3RLFA 5FJ8H 4LF9Q 4MTNA 2UXBL 1EIYB 1HZCA 2JA6H 3PO2G 1IXRA 5IYCG 1Y1VH 5AJ3Q 4BXXG 1Z47A 3J81j 4DV6L 1PH4A 4DNIA 4HIDA 1E1OA 2YTVA 3K81C 1XPRA 2E2JH 4R4IA 4IO9A 1VQFA 2NN6G 3HOXG 2Z6KA 2BH2A 1PH7A 4A93H 4A3DH 2RHSB 5IT9c 1VQ7A 4UY8C 4FDBA 3RZOH 3FP9A 3PUVA 2FXQA 4A4IA 4DR1Q 1XJVA 4DV5Q 2I5LX 4IPCA 1PA6A 1XMOQ 2PMZE 1VQ8A 1ASYA 1HNWQ 2R7ZH 4R4OA 2A1AA 1PFSA 4QGUA 1N33Q 1HR0W 4DR7Q 2OCEA 5JJKA 3UDXA 4J15A 4JI2Q 4BA1I 4L5RC 4X65L 3K80C 3H3VH 3GTMH 4DK6C 3BZCA 2BA0A 2PI2E 4LFBL 4A3KH 3LGJA 1HNZQ 1YBYA 5C3EG 1YVCA 4DUYQ 1K8GA 4LFAL 4AQYQ 4X64Q 3F1ZA 1KD1C 3CP0A 1HH2P 4PZ7A 1XPOA 4MZ9A 2QA4A 5DLQE 3SGIA 2GVAA 3CCMA 1BVSA 4A93G 1L1OA 4PMWA 3G48A 3CCRA 4OONA 5IP9G 1Y1VG 1KRSA 5H1SE 1X9NA 1XNQL 4B3RQ 1U5KA 3VDYA 1FJGL 1P16A 4OWTB 1YNXA 2F4VQ 3A0JA 2VQEQ 3T1YL 1WYDA 1HNXQ 1HNZL 1LYLA 3E9HA 3RLNA 4A3IH 4A3EH 3CCUA 2UUCQ 3S1NH 3I4MG 1I6HH 4A76A 4IFDJ 1X65A 5ELNA 5IY0A 3JC66 1K9MC 2AHOB 5IYBG 4LUOA 4JI4L 2CQOA 2JJQA 4DR4L 2ZJRA 1X3EA 4C3JH 1VQAA 4LF5Q 2WB1E 2JA9A 1E22A 1Y1WG 1NBWA 2JEBI 1VQBA 1EUJA 4A3GG 4DK3C 1VQJA 4YHHL 1XMOL 1PH1A 2VS1A 4LW1A 1HZBA 2K14A 4JI7L 4R4TA 3F2DA 1UE5A 4DAYB 3GTJH 1VQ4A 1VQ5A 3E9IA 5M3FH 3J80i 2A19A 2B63G 4JG2A 1KQSA 4NXNL 2OQ0A 2R6GA 4GN4B 1LM0A 5M5YH 2E2IH 1K3RA 1EQQA 3IRBA 4GN3B 4LF4L 2XGTA 1W3SA 4DV4Q 5IP7H 3GTGH 2KHJA 5LMNW 1MKHA 5C0XI 3HKSA 1TWHH 2I5MX 2Q2HA 4R4CA 4UP7A 5M5WH 1YJWA 3HOYH 1J6QA 4LF9L 2JA8H 4GKKL 2EXDA 4GLVB 4YY3Q 3S15H 1WI5A 5IYBH 3HOWG 4P73A 3ZJYC 1PYBA 5C44G 3CMEA 3BZKA 1Q1EA 4HIOA 1H95A 4X65Q 1Q46A 2AWNA 4GNXC 2HIXA 2CFMA 3J7ZC 4B3RL 3PCOB 1JJCB 1SRUA 2BA1A 4DR5Q 2CKZB 3UE0A 3UE1A 2XTIA 4AIMA 1FJGQ 3H15A 1XNRL 2MFIA 2VNUD 4O0AA 3KJPA 3T1YQ 2PQAB 4LWCA 1XPUA 3I4NG 2YTXA 3S1RH 2K5HA 4AQYL 1PH8A 4DV7Q 3GD7A 4LF8L 3TRZA 3KDFB 4DPGA 3PIPA 4ME3A 3HOVG 3HOZG 4QQBX 1FL0A 3A5UA 1JB7A 3GTKH 1IBMQ 1X56A 3RN2A 5HGQA 1JMCA 4JI2L 4A3JH 3TQYA 3K7AH 3S1MH 1IBLQ 1Q1BA 3PV0A 2DGYA 4LFBQ 4IOAA 4DV0Q 3FHWA 1E7ZA 2HIVA 1VQHA 3PO3H 4PZ8A 1I50H 1Q8KA 1CUKA 4XTCS 2F52A 4B3ML 3U4VA 1I3QH 2NVXH 3CF5A 2ZJQA 4LF6L 2ZM6Q 3I4MH 3I55A 4H02A 1UEBA 1B70B 1C7YA 4LF5L 4KLKA 1R9TH 3HKZE 1RL2A 3RN5A 2IHFA 2WFWA 2IT1A 4JI0L 3HFZB 2K75A 5GAEC 1G291 1YEZA 4IJLA 4YCVA 4DV0L 1PH3A 1OXVA 4POFA 4JI5Q 2F4VL 2EIFA 2VUMH 2N78A 4X62Q 4B3TQ 3H0GH 3T1HL 4RMFA 5M5XH 4MNOA 3M9BA 1NMGA 2Q2UA 5M3FG 1PH2A 4DR3Q 3PIOA 4GOPA 2UXCL 5K36G 2UUAQ 4JCVE 1EQRA 2E8GA 4GN5A 4YWMA 3CCQA 5LMUQ 1S72A 2ASBA 1YHQA 1JT8A 1YZ6A 1NTGA 2IX1A 1G6PA 3CCJA 1A63A 4EX5A 1VQOA 1Q7YC 2A8VA 4EQ5A 3S24A 4A3BH 4A3KG 1PYSB 3D31A 4GLXA 4DR7L 3B6YA 3HOWH 2DUDA 5C0XG 4KHPL 4X66L 1IBKQ 1EYGA 4KHZA 3TS2A 1GD7A 1KRTA 3UDIA 4A3IG 2E2HH 4BA2I 4TQUS 3CW2C 5LMUL 2IY5B 1UE1A 2B29A 2JK8A 4DV5L 1SFOH 1Q82C 2WP8J 3GTQH 2WB1G 4C3IH 4UP9A 4B3MQ 1NMFA 4NXMQ 3UDFA 5JJIA 1SE8A 2LXJA 4DV6Q 1OXUA 4LUZA 4R1JA 2Y0SE 1N36L 5GQOA 2ES2A 2CWPA 3CCSA 4QY7A 3K0XA 1OXSC 2OWOA 4GOPC 1PH5A 4GLAC 4DV1L 2HHHQ 2F3IA 5EAYA 4GOPB 2E5LQ 1D8LA 3FKIH 4JI3Q 3MXNB 4OX9Q 4POGA 3BJUA 4C2MH 2OTLA 3PO2H 2N49A 3PUWA 3PF4A 2NVYH 5ELOA 4DV7L 4HIMA 1G51A 3NENA 2RCNA 1XMQQ 1VQ6A 1PV4A 1E1TA 5LMNQ 1X54A 2LSSA 2JA8G 1QVCA 1KIXA 2JE6I 2CWAA 4YCUA 3F2CA 4PG3A 2VL6A 2VQEL 1HZ9A 4JV5L 3W1GA 1EOVA 1K83H 4LF7L 1HNXL 2Y0SG 3HOZH 4JI1Q 4IOCA 3PF5A 2ATWA 1X55A 1WCMH 2HT1A 2ZTEA 1J5EQ 1VQDA 2UU9Q 4A3MH 2PQAA 2UXCQ 1J5EL 2UU9L 4DR3L 1KAWA 1GM5A 1X3FA 2N3SA 1HR0Q 1VQLA 2UUBQ 1TWGH 4DR2L 2I0QA 4LNQA 3PUYA 5IWAQ 1N34Q 1CKMA 4GS3A 1D7QA 3CXCA 4JI0Q 4LF7Q 3L2PA 3RNUA 4NB3A 1X3GA 5C3EH 2RHQB 2KCTA 4JI7Q 2K52A 3KYHC 1UE7A 2YYZA 4DAMA 4DR6L 2IHEA 3CPWA 3J80c 4DR6Q 4DV4L 4AYBE 3CAMA 1IYJB 4P74A 1HJPA 2KHIA 4DR1L 2EQSA 4UP8A 2YU9H 3L7ZC 1HNWL 4HJ8A 3HKZG 3HOUH 1GO3E 1VQCA 2YTYA 3M3YH 1CSPA 3ULJA 4NXML 3JAMi 4BBRG 1PH9A 5HY6A 1SROA 3KF8B 1IBML 2KCMA 4DV2Q 4GKJL 3HOVH 2R7DA 3EBEA 4K0KQ 3G6EA 4WJ3M 1BKBA 2YV5A 2HQLA 4LFCL 4A3MG 1JJ2A 1YI2A 1I94L 5GROA 4JI8Q 4OWWB 3Q8DA 4X64L 1VQNA 2H5XA 2VZAA 1VQ9A 4BXXH 1L2FA 3I7FA 5IYDH 1K73C 2IX0A 2NZOA 1CKNB 1Z9FA 2I5HA 1O7IA 3S14H 3G71A 4JBJA 2WAQG 3OTOQ 4IFDI 4A3CG 1NJIC 2OTJA 1VQPA 4DUZL 4A3BG 3H3VI 3OTOL 1S3OA 1XTDA 1JJGA 1YITA 3TEHB 4JV5Q 3I4OA 5LMNL 3PGZA 2NN6I 4NPSA 2GVBA 4A3LH 1VQKA 1RIPA 4JC0A 1S40A 1Y14B 3KOJA 1T9HA 4LFAQ 1E24A 3NELA 4JI1L 4L5TA 5C4XG 3K8AA 1YIJA 1A0IA 4IPDA 3STBD 4NXNQ 2NZHA 1BBUA 4RG1A 3J81i 3OW2A 3CCEA 1C9OA 1VQIA 3CMAA 1KC8C 1SLJA 1DGSA 1A62A 1L0WA 2R7FA 2K4KA 5JEAJ 2V1CC 2Z0SA 4JI5L 3F2BA 3GTLH 3CC4A 1K0RA 4A3FH 2NVQH 4IJHA 5AJ3L 2R93G 4A75A 2ZM6L 4JBKA 2R92G 4HJ9A 4JI4Q 2PNHA 4OXPA 4XIGS 5BR8L 4BBSH 2UXDL 4YWLA 3CCVA 3K7UC 4OO1G 1N34L 1C0AA 3EN2A 4BY1H 4L5SA 1KXLA 5IWAL 2MNAA 4LF8Q 1AE2A 1CSQA 4QL5A 2VQFQ 5JEAG 3GTPH 2K5VA 2MQHA 1LUZA 1VCIA 3A74A 4YY3L 4JBWA 4DKAC 2JEAI 2JA5H 2NVTH 3GTOH 1V1QA 1A8VA 1W2BA 5M3MH 2OQKA 2D62A 2KBNA 1N32L 1OXTA 2K50A 1XNRQ 1SR3A 5C0XJ 1WOCA 3MEFA 3I4NH 3RLOA 1N32Q 4DR5L 4P75A 3STBC 1YJNA 2JA6G 3M4PA 1V43A 3BU2A 2BH8A 2ZTCA 1GKHA 4HJ5A 4BY7H 1B7YB 1QUQB 3J81c 5GAHC 3RZDH 1XMQL 4LF6Q 3PO3G 2C35B 4DUZQ 1QZGA 1PH6A 3S16H 4BBSG 2AMCB 1N33L 3U50C 4YCWA 1Q86C 4B3SQ 1ASZA 3U58A 1EIFA 1L1OB 1TXYA 4DV3Q 1EFWA 3CC7A 1L1OC 3AEVA 2E5LL 1IBKL 1N9WA 4OX9L 3FKIG 2HHHL 3L0OA 4JI8L 4IFDG 4Y52H 2RF4A 1I94Q 3CC2A 1IZ6A 2KENA 1SMXA 4X62L 5GADC 3HOXH 4AYBG 3NEMA 5IP9H 5M3MG 1UE6A 5FLMG 3HOUG 1M1KC 4P72A 4A3JG 3J7A5 2JA7G 4DR2Q 1KHIA 3KLWA 1P8LA 4LF4Q 3H0GG 3ER0A 4HIKA 4DR4Q 3KF6B 1VS0A 1YHAA 3DLLA 4A3LG 1NE3A 1Q81C 3RR5A 2AKWB 4JI6Q 3I56A 1LTLA 4R4QA 2JQOA 1VQGA 1GVPA 3CD6A 2UXBQ 4O2DA 1B8AA 1SN8A 1UWVA 2L15A 3OYYA 4IPHA 1WCMG 3AYHB 3W1BA 4YHHQ 4HJ7A 1QVFA 1IL2A 3M7NA 3NBHB 4UPAA 3S1QH 1NY4A 5IYDG 2R7ZG 1K8AC 3GDEA 1MJEA 2Q2IA 3ERSX 4BY7G 2R93H 3KFUA 1QZHA 1HR0L 1KL9A 2UUBL 5J3BA 3S2HH 2WAQE 5FLXc 4A3CH 1JE5A 4KHPQ 3KDFA 3F8TA 5IP7G 3AFQA 2ZJPA 1FGUA 4GNXA 1QVGA 3HOYG 2JA7H 3E0EA 1M90C 2VY3A 1VQEA 4KI0A 2VQFL 4K0KL 4OO1I 1EWIA 1YHBA 4DV2L 4GKJQ 4BBRH 4LFCQ 1Y1WH 1E3PA 5C4XH 3ULPA 2VW9A 2QGQA 5FLMH 2QEXA 1TWFH 2UXDQ 1OTCA 1Q12A 2ID0A 5BR8Q 4P71A 1U0LA 1WJJA 3AQQA 2MO0A 3CPFA 3GO5A 3I2ZA 4PZ6A 2LXKA 1PVOA 1TWCH 5JJLA 4DUYL 4JOIA 1MIUA 5GAGC 1QUQA 2PI2A 2ZTDA 3TS0A 1MJCA 1V9PA 3TREA 2R92H 3U4ZA 3M4OH 4A3EG 4JBMA 4B3SL 5E7NA 4JYAL 3JAMc 3S2DH 3KJOA 2MO1A 3PUZA 4JYAQ 1VQMA 2Z6KC 3G4SA 1AE3A 2K5NA 1N8RC 2D0OA 4TVAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUV A;  3DM3 A;  5C4J H;  1OXX K;  4JI3 L;  2UUC L;  2GN5 A;  5IE8 A;  1PHJ A;  1BBW A;  1TWA H;  4C3H H;  1IBL L;  4DV1 Q;  2N8N A;  3CCL A;  2AWO A;  3AFP A;  1FVI A;  1WFQ A;  4A3D G;  4HJA A;  1XNQ Q;  3ICE A;  5IYC H;  4GNX B;  1N36 Q;  3S17 H;  2UUA L;  3KF6 A;  3UDG A;  4DV3 L;  2B63 H;  3CQZ H;  3W5O A;  4AH6 A;  2ALY B;  3D0F A;  4X6A H;  2JA5 G;  3WWV A;  3A5Z B;  3EIV A;  3T1H Q;  4BY1 G;  2Q2T A;  4B3T L;  2VUM G;  4A3G H;  4JOI C;  5FJ8 G;  4Y7N H;  4WJ4 A;  4ALP A;  4X66 Q;  1X6O A;  2CCZ A;  4L5Q A;  4APV A;  5C44 H;  1CKO A;  4OWX B;  3M4Q A;  1AH9 A;  4QIW E;  1I5F A;  4YWK A;  1CKN A;  2D0P A;  4GKK Q;  4QJF A;  2B3G A;  3M85 A;  3ULL A;  1YJ9 A;  4A3F G;  1HZA A;  3PUX A;  3PSI A;  4IPG A;  4JI6 L;  3RLF A;  5FJ8 H;  4LF9 Q;  4MTN A;  2UXB L;  1EIY B;  1HZC A;  2JA6 H;  3PO2 G;  1IXR A;  5IYC G;  1Y1V H;  5AJ3 Q;  4BXX G;  1Z47 A;  3J81 j;  4DV6 L;  1PH4 A;  4DNI A;  4HID A;  1E1O A;  2YTV A;  3K81 C;  1XPR A;  2E2J H;  4R4I A;  4IO9 A;  1VQF A;  2NN6 G;  3HOX G;  2Z6K A;  2BH2 A;  1PH7 A;  4A93 H;  4A3D H;  2RHS B;  5IT9 c;  1VQ7 A;  4UY8 C;  4FDB A;  3RZO H;  3FP9 A;  3PUV A;  2FXQ A;  4A4I A;  4DR1 Q;  1XJV A;  4DV5 Q;  2I5L X;  4IPC A;  1PA6 A;  1XMO Q;  2PMZ E;  1VQ8 A;  1ASY A;  1HNW Q;  2R7Z H;  4R4O A;  2A1A A;  1PFS A;  4QGU A;  1N33 Q;  1HR0 W;  4DR7 Q;  2OCE A;  5JJK A;  3UDX A;  4J15 A;  4JI2 Q;  4BA1 I;  4L5R C;  4X65 L;  3K80 C;  3H3V H;  3GTM H;  4DK6 C;  3BZC A;  2BA0 A;  2PI2 E;  4LFB L;  4A3K H;  3LGJ A;  1HNZ Q;  1YBY A;  5C3E G;  1YVC A;  4DUY Q;  1K8G A;  4LFA L;  4AQY Q;  4X64 Q;  3F1Z A;  1KD1 C;  3CP0 A;  1HH2 P;  4PZ7 A;  1XPO A;  4MZ9 A;  2QA4 A;  5DLQ E;  3SGI A;  2GVA A;  3CCM A;  1BVS A;  4A93 G;  1L1O A;  4PMW A;  3G48 A;  3CCR A;  4OON A;  5IP9 G;  1Y1V G;  1KRS A;  5H1S E;  1X9N A;  1XNQ L;  4B3R Q;  1U5K A;  3VDY A;  1FJG L;  1P16 A;  4OWT B;  1YNX A;  2F4V Q;  3A0J A;  2VQE Q;  3T1Y L;  1WYD A;  1HNX Q;  1HNZ L;  1LYL A;  3E9H A;  3RLN A;  4A3I H;  4A3E H;  3CCU A;  2UUC Q;  3S1N H;  3I4M G;  1I6H H;  4A76 A;  4IFD J;  1X65 A;  5ELN A;  5IY0 A;  3JC6 6;  1K9M C;  2AHO B;  5IYB G;  4LUO A;  4JI4 L;  2CQO A;  2JJQ A;  4DR4 L;  2ZJR A;  1X3E A;  4C3J H;  1VQA A;  4LF5 Q;  2WB1 E;  2JA9 A;  1E22 A;  1Y1W G;  1NBW A;  2JEB I;  1VQB A;  1EUJ A;  4A3G G;  4DK3 C;  1VQJ A;  4YHH L;  1XMO L;  1PH1 A;  2VS1 A;  4LW1 A;  1HZB A;  2K14 A;  4JI7 L;  4R4T A;  3F2D A;  1UE5 A;  4DAY B;  3GTJ H;  1VQ4 A;  1VQ5 A;  3E9I A;  5M3F H;  3J80 i;  2A19 A;  2B63 G;  4JG2 A;  1KQS A;  4NXN L;  2OQ0 A;  2R6G A;  4GN4 B;  1LM0 A;  5M5Y H;  2E2I H;  1K3R A;  1EQQ A;  3IRB A;  4GN3 B;  4LF4 L;  2XGT A;  1W3S A;  4DV4 Q;  5IP7 H;  3GTG H;  2KHJ A;  5LMN W;  1MKH A;  5C0X I;  3HKS A;  1TWH H;  2I5M X;  2Q2H A;  4R4C A;  4UP7 A;  5M5W H;  1YJW A;  3HOY H;  1J6Q A;  4LF9 L;  2JA8 H;  4GKK L;  2EXD A;  4GLV B;  4YY3 Q;  3S15 H;  1WI5 A;  5IYB H;  3HOW G;  4P73 A;  3ZJY C;  1PYB A;  5C44 G;  3CME A;  3BZK A;  1Q1E A;  4HIO A;  1H95 A;  4X65 Q;  1Q46 A;  2AWN A;  4GNX C;  2HIX A;  2CFM A;  3J7Z C;  4B3R L;  3PCO B;  1JJC B;  1SRU A;  2BA1 A;  4DR5 Q;  2CKZ B;  3UE0 A;  3UE1 A;  2XTI A;  4AIM A;  1FJG Q;  3H15 A;  1XNR L;  2MFI A;  2VNU D;  4O0A A;  3KJP A;  3T1Y Q;  2PQA B;  4LWC A;  1XPU A;  3I4N G;  2YTX A;  3S1R H;  2K5H A;  4AQY L;  1PH8 A;  4DV7 Q;  3GD7 A;  4LF8 L;  3TRZ A;  3KDF B;  4DPG A;  3PIP A;  4ME3 A;  3HOV G;  3HOZ G;  4QQB X;  1FL0 A;  3A5U A;  1JB7 A;  3GTK H;  1IBM Q;  1X56 A;  3RN2 A;  5HGQ A;  1JMC A;  4JI2 L;  4A3J H;  3TQY A;  3K7A H;  3S1M H;  1IBL Q;  1Q1B A;  3PV0 A;  2DGY A;  4LFB Q;  4IOA A;  4DV0 Q;  3FHW A;  1E7Z A;  2HIV A;  1VQH A;  3PO3 H;  4PZ8 A;  1I50 H;  1Q8K A;  1CUK A;  4XTC S;  2F52 A;  4B3M L;  3U4V A;  1I3Q H;  2NVX H;  3CF5 A;  2ZJQ A;  4LF6 L;  2ZM6 Q;  3I4M H;  3I55 A;  4H02 A;  1UEB A;  1B70 B;  1C7Y A;  4LF5 L;  4KLK A;  1R9T H;  3HKZ E;  1RL2 A;  3RN5 A;  2IHF A;  2WFW A;  2IT1 A;  4JI0 L;  3HFZ B;  2K75 A;  5GAE C;  1G29 1;  1YEZ A;  4IJL A;  4YCV A;  4DV0 L;  1PH3 A;  1OXV A;  4POF A;  4JI5 Q;  2F4V L;  2EIF A;  2VUM H;  2N78 A;  4X62 Q;  4B3T Q;  3H0G H;  3T1H L;  4RMF A;  5M5X H;  4MNO A;  3M9B A;  1NMG A;  2Q2U A;  5M3F G;  1PH2 A;  4DR3 Q;  3PIO A;  4GOP A;  2UXC L;  5K36 G;  2UUA Q;  4JCV E;  1EQR A;  2E8G A;  4GN5 A;  4YWM A;  3CCQ A;  5LMU Q;  1S72 A;  2ASB A;  1YHQ A;  1JT8 A;  1YZ6 A;  1NTG A;  2IX1 A;  1G6P A;  3CCJ A;  1A63 A;  4EX5 A;  1VQO A;  1Q7Y C;  2A8V A;  4EQ5 A;  3S24 A;  4A3B H;  4A3K G;  1PYS B;  3D31 A;  4GLX A;  4DR7 L;  3B6Y A;  3HOW H;  2DUD A;  5C0X G;  4KHP L;  4X66 L;  1IBK Q;  1EYG A;  4KHZ A;  3TS2 A;  1GD7 A;  1KRT A;  3UDI A;  4A3I G;  2E2H H;  4BA2 I;  4TQU S;  3CW2 C;  5LMU L;  2IY5 B;  1UE1 A;  2B29 A;  2JK8 A;  4DV5 L;  1SFO H;  1Q82 C;  2WP8 J;  3GTQ H;  2WB1 G;  4C3I H;  4UP9 A;  4B3M Q;  1NMF A;  4NXM Q;  3UDF A;  5JJI A;  1SE8 A;  2LXJ A;  4DV6 Q;  1OXU A;  4LUZ A;  4R1J A;  2Y0S E;  1N36 L;  5GQO A;  2ES2 A;  2CWP A;  3CCS A;  4QY7 A;  3K0X A;  1OXS C;  2OWO A;  4GOP C;  1PH5 A;  4GLA C;  4DV1 L;  2HHH Q;  2F3I A;  5EAY A;  4GOP B;  2E5L Q;  1D8L A;  3FKI H;  4JI3 Q;  3MXN B;  4OX9 Q;  4POG A;  3BJU A;  4C2M H;  2OTL A;  3PO2 H;  2N49 A;  3PUW A;  3PF4 A;  2NVY H;  5ELO A;  4DV7 L;  4HIM A;  1G51 A;  3NEN A;  2RCN A;  1XMQ Q;  1VQ6 A;  1PV4 A;  1E1T A;  5LMN Q;  1X54 A;  2LSS A;  2JA8 G;  1QVC A;  1KIX A;  2JE6 I;  2CWA A;  4YCU A;  3F2C A;  4PG3 A;  2VL6 A;  2VQE L;  1HZ9 A;  4JV5 L;  3W1G A;  1EOV A;  1K83 H;  4LF7 L;  1HNX L;  2Y0S G;  3HOZ H;  4JI1 Q;  4IOC A;  3PF5 A;  2ATW A;  1X55 A;  1WCM H;  2HT1 A;  2ZTE A;  1J5E Q;  1VQD A;  2UU9 Q;  4A3M H;  2PQA A;  2UXC Q;  1J5E L;  2UU9 L;  4DR3 L;  1KAW A;  1GM5 A;  1X3F A;  2N3S A;  1HR0 Q;  1VQL A;  2UUB Q;  1TWG H;  4DR2 L;  2I0Q A;  4LNQ A;  3PUY A;  5IWA Q;  1N34 Q;  1CKM A;  4GS3 A;  1D7Q A;  3CXC A;  4JI0 Q;  4LF7 Q;  3L2P A;  3RNU A;  4NB3 A;  1X3G A;  5C3E H;  2RHQ B;  2KCT A;  4JI7 Q;  2K52 A;  3KYH C;  1UE7 A;  2YYZ A;  4DAM A;  4DR6 L;  2IHE A;  3CPW A;  3J80 c;  4DR6 Q;  4DV4 L;  4AYB E;  3CAM A;  1IYJ B;  4P74 A;  1HJP A;  2KHI A;  4DR1 L;  2EQS A;  4UP8 A;  2YU9 H;  3L7Z C;  1HNW L;  4HJ8 A;  3HKZ G;  3HOU H;  1GO3 E;  1VQC A;  2YTY A;  3M3Y H;  1CSP A;  3ULJ A;  4NXM L;  3JAM i;  4BBR G;  1PH9 A;  5HY6 A;  1SRO A;  3KF8 B;  1IBM L;  2KCM A;  4DV2 Q;  4GKJ L;  3HOV H;  2R7D A;  3EBE A;  4K0K Q;  3G6E A;  4WJ3 M;  1BKB A;  2YV5 A;  2HQL A;  4LFC L;  4A3M G;  1JJ2 A;  1YI2 A;  1I94 L;  5GRO A;  4JI8 Q;  4OWW B;  3Q8D A;  4X64 L;  1VQN A;  2H5X A;  2VZA A;  1VQ9 A;  4BXX H;  1L2F A;  3I7F A;  5IYD H;  1K73 C;  2IX0 A;  2NZO A;  1CKN B;  1Z9F A;  2I5H A;  1O7I A;  3S14 H;  3G71 A;  4JBJ A;  2WAQ G;  3OTO Q;  4IFD I;  4A3C G;  1NJI C;  2OTJ A;  1VQP A;  4DUZ L;  4A3B G;  3H3V I;  3OTO L;  1S3O A;  1XTD A;  1JJG A;  1YIT A;  3TEH B;  4JV5 Q;  3I4O A;  5LMN L;  3PGZ A;  2NN6 I;  4NPS A;  2GVB A;  4A3L H;  1VQK A;  1RIP A;  4JC0 A;  1S40 A;  1Y14 B;  3KOJ A;  1T9H A;  4LFA Q;  1E24 A;  3NEL A;  4JI1 L;  4L5T A;  5C4X G;  3K8A A;  1YIJ A;  1A0I A;  4IPD A;  3STB D;  4NXN Q;  2NZH A;  1BBU A;  4RG1 A;  3J81 i;  3OW2 A;  3CCE A;  1C9O A;  1VQI A;  3CMA A;  1KC8 C;  1SLJ A;  1DGS A;  1A62 A;  1L0W A;  2R7F A;  2K4K A;  5JEA J;  2V1C C;  2Z0S A;  4JI5 L;  3F2B A;  3GTL H;  3CC4 A;  1K0R A;  4A3F H;  2NVQ H;  4IJH A;  5AJ3 L;  2R93 G;  4A75 A;  2ZM6 L;  4JBK A;  2R92 G;  4HJ9 A;  4JI4 Q;  2PNH A;  4OXP A;  4XIG S;  5BR8 L;  4BBS H;  2UXD L;  4YWL A;  3CCV A;  3K7U C;  4OO1 G;  1N34 L;  1C0A A;  3EN2 A;  4BY1 H;  4L5S A;  1KXL A;  5IWA L;  2MNA A;  4LF8 Q;  1AE2 A;  1CSQ A;  4QL5 A;  2VQF Q;  5JEA G;  3GTP H;  2K5V A;  2MQH A;  1LUZ A;  1VCI A;  3A74 A;  4YY3 L;  4JBW A;  4DKA C;  2JEA I;  2JA5 H;  2NVT H;  3GTO H;  1V1Q A;  1A8V A;  1W2B A;  5M3M H;  2OQK A;  2D62 A;  2KBN A;  1N32 L;  1OXT A;  2K50 A;  1XNR Q;  1SR3 A;  5C0X J;  1WOC A;  3MEF A;  3I4N H;  3RLO A;  1N32 Q;  4DR5 L;  4P75 A;  3STB C;  1YJN A;  2JA6 G;  3M4P A;  1V43 A;  3BU2 A;  2BH8 A;  2ZTC A;  1GKH A;  4HJ5 A;  4BY7 H;  1B7Y B;  1QUQ B;  3J81 c;  5GAH C;  3RZD H;  1XMQ L;  4LF6 Q;  3PO3 G;  2C35 B;  4DUZ Q;  1QZG A;  1PH6 A;  3S16 H;  4BBS G;  2AMC B;  1N33 L;  3U50 C;  4YCW A;  1Q86 C;  4B3S Q;  1ASZ A;  3U58 A;  1EIF A;  1L1O B;  1TXY A;  4DV3 Q;  1EFW A;  3CC7 A;  1L1O C;  3AEV A;  2E5L L;  1IBK L;  1N9W A;  4OX9 L;  3FKI G;  2HHH L;  3L0O A;  4JI8 L;  4IFD G;  4Y52 H;  2RF4 A;  1I94 Q;  3CC2 A;  1IZ6 A;  2KEN A;  1SMX A;  4X62 L;  5GAD C;  3HOX H;  4AYB G;  3NEM A;  5IP9 H;  5M3M G;  1UE6 A;  5FLM G;  3HOU G;  1M1K C;  4P72 A;  4A3J G;  3J7A 5;  2JA7 G;  4DR2 Q;  1KHI A;  3KLW A;  1P8L A;  4LF4 Q;  3H0G G;  3ER0 A;  4HIK A;  4DR4 Q;  3KF6 B;  1VS0 A;  1YHA A;  3DLL A;  4A3L G;  1NE3 A;  1Q81 C;  3RR5 A;  2AKW B;  4JI6 Q;  3I56 A;  1LTL A;  4R4Q A;  2JQO A;  1VQG A;  1GVP A;  3CD6 A;  2UXB Q;  4O2D A;  1B8A A;  1SN8 A;  1UWV A;  2L15 A;  3OYY A;  4IPH A;  1WCM G;  3AYH B;  3W1B A;  4YHH Q;  4HJ7 A;  1QVF A;  1IL2 A;  3M7N A;  3NBH B;  4UPA A;  3S1Q H;  1NY4 A;  5IYD G;  2R7Z G;  1K8A C;  3GDE A;  1MJE A;  2Q2I A;  3ERS X;  4BY7 G;  2R93 H;  3KFU A;  1QZH A;  1HR0 L;  1KL9 A;  2UUB L;  5J3B A;  3S2H H;  2WAQ E;  5FLX c;  4A3C H;  1JE5 A;  4KHP Q;  3KDF A;  3F8T A;  5IP7 G;  3AFQ A;  2ZJP A;  1FGU A;  4GNX A;  1QVG A;  3HOY G;  2JA7 H;  3E0E A;  1M90 C;  2VY3 A;  1VQE A;  4KI0 A;  2VQF L;  4K0K L;  4OO1 I;  1EWI A;  1YHB A;  4DV2 L;  4GKJ Q;  4BBR H;  4LFC Q;  1Y1W H;  1E3P A;  5C4X H;  3ULP A;  2VW9 A;  2QGQ A;  5FLM H;  2QEX A;  1TWF H;  2UXD Q;  1OTC A;  1Q12 A;  2ID0 A;  5BR8 Q;  4P71 A;  1U0L A;  1WJJ A;  3AQQ A;  2MO0 A;  3CPF A;  3GO5 A;  3I2Z A;  4PZ6 A;  2LXK A;  1PVO A;  1TWC H;  5JJL A;  4DUY L;  4JOI A;  1MIU A;  5GAG C;  1QUQ A;  2PI2 A;  2ZTD A;  3TS0 A;  1MJC A;  1V9P A;  3TRE A;  2R92 H;  3U4Z A;  3M4O H;  4A3E G;  4JBM A;  4B3S L;  5E7N A;  4JYA L;  3JAM c;  3S2D H;  3KJO A;  2MO1 A;  3PUZ A;  4JYA Q;  1VQM A;  2Z6K C;  3G4S A;  1AE3 A;  2K5N A;  1N8R C;  2D0O A;  4TVA B; 
#chains in the Genus database with same CATH topology
 4Q0F A;  1JWS D;  1OXX K;  4JI3 L;  2UUC L;  4C3H H;  1RTO A;  1D6E C;  1KNE A;  5ISR A;  4OEM B;  3FVQ A;  3CCL A;  2BCO A;  2O5I C;  2AWO A;  3PIO 3;  3AFP A;  4JK1 C;  4DGZ A;  5FO9 B;  4UAI A;  1XNQ Q;  2BDN A;  4A3J B;  5IYC H;  3ICE A;  1F2L A;  2KHS A;  2B8F A;  3S17 H;  1DON A;  4X6A H;  4HN7 A;  2Q2T A;  4A3G H;  2VUM G;  4Y7N H;  1DJR D;  4KKU A;  3J7A V;  5FLX E;  1CI3 M;  1AH9 A;  2D0P A;  4RGT A;  2E2I B;  3T4A C;  1LT5 D;  4A3F G;  2KJX A;  2UXB L;  4CGY B;  1Y1V B;  1HZC A;  2JA6 H;  2IL8 A;  4CDF C;  5AJ3 Q;  1Z47 A;  3LX0 A;  1FNV A;  4DNI A;  4HID A;  1E1O A;  3H91 A;  5DAU A;  4R4I A;  2NBF A;  1HQR D;  4LAA A;  2Z6K A;  1F9S A;  4ZCK A;  1VQ7 A;  1U9R A;  3FP9 A;  1XJV A;  2I5L X;  4HR7 B;  3JAM E;  2A1A A;  1HR0 W;  4C3J B;  4JI2 Q;  2NYZ D;  4L5R C;  4X65 L;  3K80 C;  1PFB A;  4DK6 C;  3BZC A;  4A3K H;  1YBY A;  5C3E G;  4DUY Q;  4LFA L;  3E5S A;  2G9H D;  1KD1 C;  1XPO A;  4V19 0;  2A68 C;  1X9N A;  1XNQ L;  1FD7 D;  4CKE A;  1U5K A;  3VDY A;  5C3W A;  3GTQ B;  2F0I A;  1YNX A;  3DM1 A;  2F4V Q;  2PCF B;  1WYD A;  1HNX Q;  3E9H A;  4KKS A;  4A76 A;  4IFD J;  1X65 A;  4RKB A;  1K9M C;  1SYF A;  2A5H A;  2JJQ A;  1SYB A;  4DR4 L;  1NBW A;  4ULL A;  1EUJ A;  2E76 C;  1S5D D;  4YHH L;  1XMO L;  1PH1 A;  4XQQ A;  5IOD A;  1A3V A;  1PLF A;  1UE5 A;  4X3K A;  1KTK A;  2E2D C;  1BOS A;  1VQ4 A;  2A73 B;  4NXN L;  2OQ0 A;  4GN4 B;  2K5D A;  1EQQ A;  3IRB A;  1CHP D;  4RH6 A;  1SAP A;  3M4Y A;  1JB3 A;  2Q2H A;  1J6Q A;  3GP7 A;  4LF9 L;  1PXU A;  2K6A A;  4GLV B;  4KJO A;  1WI5 A;  4O42 A;  3HOW G;  5C44 G;  5BN5 A;  2PNR C;  1Q1E A;  5KIX A;  2HIX A;  2F0P A;  2EYP A;  4C1N I;  1NCV A;  2CKZ B;  3UE0 A;  3UE1 A;  4AIM A;  5I4D A;  2QDB A;  1XNR L;  2X6L A;  4K8J A;  4J8Q A;  5C3E B;  1CTM A;  3S1R H;  4AQY L;  4DV7 Q;  2K04 A;  3KDF B;  4ME3 A;  4BWG B;  4ID6 A;  3K5L A;  1JB7 A;  1IBM Q;  2NUC A;  1JMC A;  4LFB Q;  2Z6B A;  4KK7 A;  3A54 A;  2HUG A;  4ODG A;  1TVX A;  4RWS C;  1JWU D;  4KLK A;  2WKD A;  5C0X H;  1RL2 A;  3RN5 A;  1Y69 U;  3I4L A;  1TS2 A;  4M8A A;  2KED A;  3HFZ B;  3P20 A;  2EIF A;  2N78 A;  4B3T Q;  5M5X B;  1PRT B;  2Q2U A;  3I70 A;  3NWS A;  4DR3 Q;  2IJ0 A;  2EYF A;  2UUA Q;  1EQR A;  2F0H A;  1UAP A;  1B3A A;  3CCQ A;  4K2K A;  5CYU A;  3MXG A;  1TKW B;  1YHQ A;  2ASB A;  1JT8 A;  1YZ6 A;  2GA4 B;  1KDB A;  3CCJ A;  1BR9 A;  2A6H C;  4DR7 L;  2I46 A;  2R61 A;  1PTO D;  1F2Z A;  1HQM C;  3TS2 A;  1GD7 A;  1TWH B;  2MJ8 A;  4FP5 D;  4BA2 I;  3C2P A;  2XWB B;  5JJZ A;  1UE1 A;  5IOC A;  5I6Y A;  1QE6 A;  1BCP B;  2F0G A;  4DV5 L;  3A8J E;  1Q82 C;  2WP8 J;  2WB1 G;  3VYU A;  1EZ6 A;  1NMF A;  4NXM Q;  1N36 L;  2AQ3 B;  3FRP B;  3K0X A;  4GOP C;  4DV1 L;  4C3H B;  1RCV D;  1A2T A;  5EAY A;  5JEA H;  1HFG A;  1IW7 C;  4HED A;  2XWJ B;  3BJU A;  2N49 A;  3PUW A;  1J9O A;  3PF4 A;  3N52 A;  4Q5V A;  3HS0 C;  2RCN A;  1VQ6 A;  2IW3 A;  5IGF A;  1E1T A;  5KND A;  1PTO F;  4HCE A;  2LSS A;  3Q6S A;  1JE4 A;  5IT9 L;  3HOW B;  2Z1C A;  4YCU A;  4PG3 A;  2VL6 A;  2B2Y A;  2VQE L;  1WTR A;  1EOV A;  1TWF B;  2XVS A;  1O7Y A;  2EXZ A;  2L1B A;  3L3O C;  4KY5 A;  1QJO A;  1EY5 A;  1GM5 A;  1X3F A;  1RKN A;  2RDH A;  3F2U A;  1XYI A;  1N34 Q;  4K2L A;  2F0N A;  1IKL A;  4P2C B;  2G5D A;  4JI0 Q;  3L2P A;  2K33 A;  5C3E H;  4IFD H;  2K52 A;  3KYH C;  4DAM A;  3J80 c;  1C4Q A;  2AUJ D;  3CAM A;  4P74 A;  5D3D A;  5CR3 A;  1HJP A;  4DR1 L;  2F0W A;  4UP8 A;  2YU9 H;  3I72 A;  1HNW L;  1W6J A;  5IGD A;  2YTY A;  3C46 A;  4JPB W;  1CSP A;  2QF7 A;  3OWE B;  1AP0 A;  1RD9 D;  1IBM L;  2KCM A;  3HP3 A;  4DV2 Q;  2KCN A;  4KKT A;  3RMH A;  2G9D A;  2OF1 A;  4WJ3 M;  2HQL A;  4A3M G;  4HTH A;  1JJ2 A;  1SYD A;  4BXX H;  5IYD H;  1K73 C;  2NZO A;  1Z9F A;  3S14 H;  4JBJ A;  2WAQ G;  3OTO Q;  1NJI C;  5LL6 S;  2OTJ A;  2E75 C;  4DUZ L;  3H3V I;  1QOH A;  1XTD A;  4JV5 Q;  4MN3 A;  3PGZ A;  3R93 A;  1WTO A;  3A7L A;  4A3L H;  1VQK A;  4CKB A;  4JC0 A;  1S5C D;  2RDF A;  3D4W A;  2B8G A;  2K5Q A;  3HOU B;  4N9P A;  1A0I A;  5C4Z A;  3CCE A;  3KLS A;  1C9O A;  2C5C A;  2HDM A;  1DGS A;  2NWG A;  3S1R B;  3KF8 A;  5JEA J;  3SXH A;  4JI5 L;  3VR2 A;  2LFN A;  3GTL H;  4C3H G;  2R92 B;  4CJ0 B;  2R92 G;  4K6D A;  2PNH A;  4CBV A;  5BR8 L;  4QB4 A;  2EOT A;  4ZK9 B;  3EN2 A;  3GTG B;  4LK1 C;  4Y7N B;  2VQF Q;  4QL5 A;  5CBE E;  1LUZ A;  5FKA C;  2NVT H;  2HCI A;  1TWG B;  1A8V A;  2RBM A;  3Q22 A;  1W2B A;  1CQV A;  1N32 L;  2OQK A;  2CHB D;  1OXT A;  2K50 A;  5ELB A;  1SR3 A;  1D1K A;  1H9M A;  1S4Z A;  1WOC A;  3MEF A;  2K32 A;  3I4N H;  3STB C;  1YJN A;  1PFM A;  2JA6 G;  2BH8 A;  3VR4 A;  2L12 A;  1QUQ B;  1K83 B;  2OXP A;  5IGE A;  3RZD H;  2WAQ B;  4BBS G;  1Q86 C;  3S16 B;  1FYC A;  1TXY A;  1L1O B;  4DV3 Q;  1EFW A;  4IQZ A;  3D4D A;  1ICW A;  3AEV A;  4OIJ A;  1IBK L;  2E5L L;  2SNS A;  3VYT A;  3L0O A;  4JI8 L;  4ZLT F;  1I94 Q;  1PYW D;  3CC2 A;  3HEJ A;  4XDX A;  5GAD C;  2D9U A;  4U68 A;  1STG A;  5IP9 H;  5M3M G;  3HOU G;  3R8B A;  2CH4 A;  3OIP A;  4LF4 Q;  3H0G G;  4KD3 A;  1Q81 C;  1RDP D;  1EOT A;  5FOB B;  3CD6 A;  3VR3 A;  3OYY A;  1QVF A;  3AYH B;  2CW0 D;  3NBH B;  4UPA A;  1PZI D;  3TP7 A;  3AU7 A;  5IYD G;  1MBY A;  3GDE A;  4BY7 B;  1ILP A;  2WII B;  1QZH A;  4IN3 A;  3J81 E;  1SNC A;  4H44 C;  1SND A;  5J3B A;  3KDF A;  1F2M A;  5IP7 G;  1SJH D;  2B2W C;  4QCL A;  1TY0 A;  2JA7 H;  2KVM A;  3VYR A;  2VQF L;  2WKC A;  5EKK A;  1MSG A;  1NR4 A;  4DV2 L;  2K5W A;  4BBR H;  5BN3 A;  5C4X H;  3ULP A;  2F0U A;  1LLR D;  4ZUI A;  2E2J H;  4P71 A;  1WJJ A;  3I2Z A;  1HPC A;  3IFD A;  1TWC H;  4C3I B;  1MIU A;  1SYE A;  1MJC A;  3TRE A;  5E7N A;  2XSC A;  4BBS B;  5ELE A;  1VMP A;  2D0O A;  1ENF A;  2QIL A;  4TVA B;  4LUV A;  3TZD A;  3SHL A;  1STA A;  2GN5 A;  1PHJ A;  2N8N A;  3MAQ A;  3DEO A;  2PMZ B;  2KOL A;  2L0C A;  4IUQ A;  2H1E A;  2F0Q A;  2ICE C;  1WVL A;  5M3M B;  4HJA A;  1BCP F;  4GNX B;  2N88 A;  4PNY A;  2M9V A;  3UDG A;  3D6W A;  2PW7 A;  2B63 H;  1TY2 A;  2ALY B;  3D0F A;  1PRT D;  4QUC A;  1WCM B;  4BY1 G;  1B50 A;  1X3P A;  2EYM A;  3EJI A;  1EU3 A;  1CKN A;  4X3T A;  4QJF A;  2B3G A;  1K0S A;  1YJ9 A;  4OHJ A;  2EYH A;  2F1M A;  1IKM A;  4IPG A;  5FJ8 H;  4MTN A;  1LT4 D;  1G91 A;  3PO2 G;  3ONA B;  4ABN A;  3J81 j;  4DV6 L;  3FKI B;  3KBG A;  2J0T D;  2ZXO A;  1PH4 A;  1ILQ A;  1T5X D;  3GTP B;  3K81 C;  2K01 A;  1HTP A;  1BCP D;  1PZJ D;  4ZKB B;  4IUP A;  2RHS B;  4UY8 C;  3RZO H;  3PO2 H;  2FXQ A;  4A4I A;  1PA6 A;  3W2D A;  4R4O A;  2F0D A;  2RKS A;  3URY A;  1PFS A;  4RGM A;  2PZT A;  3NTH A;  4NMZ A;  4KMU C;  4XXE A;  4DR7 Q;  5KRU A;  3U9O A;  3UDX A;  2F0F A;  4J15 A;  5DEH A;  1CK1 A;  2MP1 A;  4TKO B;  3GTM H;  2BA0 A;  3K7A B;  3IKJ A;  3BVZ A;  5M3F B;  2JYO A;  3I91 A;  4AQY Q;  4X64 Q;  2TMP A;  4PZ7 A;  1HH2 P;  3MFY A;  5DLQ E;  4KHV A;  4A93 G;  1L1O A;  4PMW A;  3CCR A;  5H1S E;  4B3R Q;  1JOK A;  3A0J A;  2M2L A;  1LAB A;  4ZRZ A;  2NVT B;  2EYJ A;  5ELN A;  3H94 A;  5KNB A;  4LF5 Q;  2WB1 E;  1E22 A;  1Y1W G;  3PMF A;  4DU9 A;  1VQJ A;  3D4R A;  4A3F B;  4EQN A;  2VS1 A;  1TT2 A;  1ZYR C;  4DAY B;  1VQ5 A;  3E9I A;  3J80 i;  2A19 A;  3PIP 3;  4JG2 A;  1BUV T;  1CM9 A;  1EQV A;  4OEL B;  2XGT A;  1W3S A;  3R3O A;  1V1P A;  3HKS A;  1PFN A;  1TQO A;  4GKK L;  4YY3 Q;  5KGU A;  1EY8 A;  1HA5 A;  1UUP A;  5IYB H;  3ZJY C;  3CME A;  3A56 A;  3AB9 A;  5D65 A;  1Q46 A;  3QG1 A;  1SBB B;  2N55 A;  3MZ5 A;  4GNX C;  3PCO B;  4HSP A;  1SRU A;  4DR5 Q;  3WOE A;  1EL0 A;  2VNU D;  4BS9 A;  2MFI A;  2VB3 X;  3H09 A;  1ET9 A;  4LWC A;  1XPU A;  1ENC A;  1LTI D;  1M8A A;  2K5H A;  3OMG A;  1PH8 A;  3GD7 A;  2A69 D;  4QF4 A;  3PIP A;  4DPG A;  1EIG A;  3HOZ G;  4QQB X;  2VXW A;  3A8I E;  3H6M A;  1X56 A;  5HGQ A;  3MTS A;  4JI2 L;  3T13 A;  1ZEQ X;  1JOQ A;  3PV0 A;  2DGY A;  2XRQ D;  4EQP A;  4IOA A;  1VQH A;  3DMU A;  2OT2 A;  1I50 H;  1S5E D;  1CUK A;  2F52 A;  2MUY A;  3MC0 B;  3U4V A;  4B3M L;  3I4M H;  3CF5 A;  3OOC A;  2EVB A;  1B70 B;  3HKZ B;  1R9T H;  1TWC B;  2RCF A;  1I4P A;  2F0O A;  2IHF A;  2IT1 A;  4LJZ C;  4UDU C;  1STE A;  5GAE C;  4YCV A;  2EDG A;  4POF A;  2TSS A;  4E6I A;  4ZUJ A;  3NK9 A;  1A3U A;  4MNO A;  5JPN C;  5M5X H;  1NMG A;  5C6A A;  1WTP A;  5M3F G;  1HXY D;  4GOP A;  3KK7 A;  3RUZ A;  4GN5 A;  4YWM A;  3T51 B;  5LMU Q;  1T5E A;  1F9Q A;  2R3Z A;  1G6P A;  1EY9 A;  1X3Q A;  1M4V A;  4A3K G;  1Q90 A;  1PYS B;  3D31 A;  2F3V A;  2DUD A;  4XYQ A;  5C0X G;  3A8K E;  1LTT D;  2JP1 A;  4X3S A;  1CZW A;  5LMU L;  2IY5 B;  3GTQ H;  1SFO H;  3J7Y W;  1AZQ A;  2WAC A;  5DM6 3;  1EYA A;  2QCP X;  2Y0S E;  2O2L D;  5GQO A;  2ES2 A;  1STB A;  1LT3 D;  2CWP A;  2PPB C;  4I7Z C;  2OWO A;  2EY5 A;  5FLX L;  4OX9 Q;  3FKI H;  4JI3 Q;  5E4X A;  1KLG D;  4JW0 A;  4POG A;  1BF4 A;  2B2W A;  2RSN A;  3IL8 A;  2BOS A;  2SDF A;  4IUT A;  3NSW A;  1NNX A;  3S1M B;  4JVZ A;  2CWA A;  3F2C A;  4HMI A;  3HG9 A;  3QOL A;  3W1G A;  2EE1 A;  1K83 H;  1SE4 A;  4WRD A;  3HOZ H;  4IOC A;  1WCM H;  3GQB A;  4A3M B;  4A3M H;  2PQA A;  5D14 A;  2UXC Q;  4RFB A;  1Z6H A;  4NP5 A;  4XYO A;  1KAW A;  1VQL A;  2N3S A;  4ILW A;  2I0Q A;  4LNQ A;  3I3C A;  1HTL D;  4GS3 A;  3UI2 A;  1X3G A;  5I9P A;  1TR5 A;  3CRL C;  4WJW A;  2IHE A;  3CPW A;  4ZQ3 A;  2FIN B;  1H9J A;  3KLR A;  4K5W A;  3S1N B;  4OIK A;  3L7Z C;  1EWC A;  2DY8 A;  3HKZ G;  4HJ8 A;  1GO3 E;  3SVM A;  3H0G B;  3M3Y H;  1PH9 A;  4BBR B;  1SRO A;  1EY7 A;  4HMJ A;  4DK0 A;  2R7D A;  3G6E A;  1TU2 B;  3WDN A;  2YV5 A;  5LL6 X;  4OGQ C;  1XX8 A;  1I94 L;  1DYQ A;  4KD4 A;  3VYS A;  1B2T A;  2H5X A;  2VZA A;  4IAL A;  1L2F A;  3I7F A;  2NB0 A;  4LMQ D;  2PW5 A;  1CKN B;  3PO3 B;  2X6G A;  5E4W C;  3MA2 B;  1EY0 A;  1JJG A;  4B08 A;  3I4O A;  3ND9 A;  2NN6 I;  4WFN 3;  1FR3 A;  1AEX A;  4X3U A;  1ESR A;  5AFW A;  3I90 A;  2CVR A;  1T9H A;  1E24 A;  3NEL A;  1SYC A;  4KN7 C;  4L63 B;  1BXT A;  1YIJ A;  3ZYY X;  4NXN Q;  3G7L A;  3NQT A;  4L6T B;  3J81 i;  3LWU A;  1STN A;  2B2V C;  3CMA A;  3OW2 A;  1KC8 C;  1A62 A;  2Q8T A;  1CA5 A;  5D3I B;  3C1E A;  2ZXR A;  2QW7 A;  1SJE D;  2SOB A;  2A74 C;  1K0R A;  4A3F H;  3CC4 A;  1QCB D;  5IGG A;  4N8F A;  5AJ3 L;  4IUV A;  1HCZ A;  4JI4 Q;  1MHW C;  4DAP A;  4BBS H;  1I50 B;  1N34 L;  4L5S A;  4BY1 H;  1KXL A;  1YNJ D;  5IWA L;  2E2J B;  1V1O A;  4V0B A;  2JA8 B;  1AE2 A;  2LY7 A;  4IZ8 A;  2JEA I;  1L0X B;  4DKA C;  1KLU D;  1V1Q A;  2B2Y C;  5I6W A;  2KBN A;  1LT6 D;  5IGB A;  1JOO A;  5IGC A;  2B2V A;  1B44 D;  1K3B C;  4P75 A;  1BNZ A;  3BU2 A;  3J81 c;  1KDC A;  2K1B A;  2EPB A;  3PO2 B;  2DJG C;  3FKI G;  4PV1 C;  2HHH L;  2IPK D;  4IFD G;  4Y52 H;  1W6K A;  2PZU A;  1SMX A;  1EFI D;  3KLS X;  2P5Z X;  2Z4H A;  1UE6 A;  4P72 A;  5EJW A;  3J7A 5;  4DR2 Q;  4KV6 A;  1KHI A;  2L9H A;  1E2Z A;  4DR4 Q;  1YHA A;  4FF3 A;  1NE3 A;  3RR5 A;  3VR6 A;  1PDQ A;  1LTL A;  3TP8 A;  4F7X A;  1D1I A;  4O2D A;  2XNA C;  3NP8 A;  1HA6 A;  5F2D A;  2HDL A;  3S1Q H;  1NY4 A;  2B2T C;  2FHT A;  5ELC A;  2R93 H;  2QEJ C;  1RHP A;  1HR0 L;  2UUB L;  3QO2 A;  3S2H H;  1JE5 A;  1O78 A;  2ZJP A;  5LHY 1;  1NSN S;  4RHR A;  3E0E A;  1M90 C;  4KI0 A;  1U4L A;  4OO1 I;  1EWI A;  1YHB A;  1EIH A;  1K8O A;  4LFC Q;  3PQI A;  4BY1 B;  1OTC A;  1Q12 A;  1SMY D;  4YIJ A;  1U0L A;  3K5N A;  3AQQ A;  2MO0 A;  4PZ6 A;  4JOI A;  2Q8R E;  2PI2 A;  3TS0 A;  4IUR A;  2D2C C;  2FFK B;  4B3S L;  3M4O B;  5EPJ A;  3PUZ A;  1VQM A;  3G4S A;  2CW0 C;  3E3X A;  1ONL A;  1LAC A;  4QMG A;  5J1Z A;  3DHQ A;  4J1M A;  4DNT B;  1BBW A;  1TWA H;  1IBL L;  3Q23 A;  4DV1 Q;  3MXN A;  1FVI A;  1WFQ A;  4A3D B;  4CDC C;  1YNJ C;  1EZ8 A;  2F0E A;  5JVH 3;  1EY4 A;  3RZO B;  3KF6 A;  3CHB D;  4DV3 L;  5ELD A;  3CQZ H;  3VA5 A;  3W5O A;  3H3V C;  2JA5 G;  1E2W A;  3WWV A;  3EIV A;  5BN4 A;  1QG7 A;  3T1H Q;  4FXG C;  2MGS A;  4C56 C;  4B3T L;  4JOI C;  4WJ4 A;  4X66 Q;  4FO2 A;  2CCZ A;  5CGK A;  5C44 H;  3AMU A;  4KJN A;  3M4Q A;  4QIW E;  3OW7 A;  1XTC D;  4GKK Q;  1AFP A;  2HD3 A;  3ULL A;  3EFX D;  1QNU A;  5DM7 3;  4JI6 L;  1HZA A;  1J8I A;  3PSI A;  1LO5 D;  2O4X A;  3RLF A;  1E0B A;  1IXR A;  1Y1V H;  4K14 A;  1B3Q A;  1XWE A;  4IO9 A;  1VQF A;  1PH7 A;  3GTK B;  1H9S A;  4A93 H;  4A3D H;  1V8Q A;  4FDB A;  2A68 D;  4DR1 Q;  4DV5 Q;  4IPC A;  3LNN A;  1ASY A;  1HNW Q;  3T16 A;  3M3Y B;  1N33 Q;  2JN4 A;  3NTK A;  2OCE A;  1I3Q B;  4DNR B;  2NVX B;  2RDG A;  3DWP A;  1SYG A;  1GHK A;  3H3V H;  2Z9H A;  3SK8 A;  1HNZ Q;  3V2T A;  2K7V A;  3FDT A;  1K8G A;  4FF4 A;  5M9O A;  3CP0 A;  5M5Y B;  1DM0 B;  4FVM A;  4MZ9 A;  3CCM A;  1JIC A;  3G48 A;  1JQY D;  2M00 A;  1RJT A;  1FJG L;  5EPK A;  4OWT B;  3T1Y L;  1KNA A;  1HNZ L;  3RLN A;  4A3I H;  1NR2 A;  5CV6 A;  2EJM A;  3C1F A;  3JC6 6;  3S1Q B;  2AHO B;  5IYB G;  2EY2 A;  2CQO A;  3QJY A;  1X3E A;  1JWM D;  1VQA A;  3N6R A;  1Y1W B;  3R2I A;  2JEB I;  1VQB A;  5COR A;  4CDE C;  4O1N A;  2KQ3 A;  2K14 A;  1JOR A;  1Y8O B;  3GTJ H;  2B63 B;  1KQS A;  2DNE A;  2R6G A;  3BZD B;  1LM0 A;  4R8N A;  4LF4 L;  1K3R A;  4DV4 Q;  4ZAI A;  3NE5 B;  4UHV A;  4G7Z C;  1MKH A;  5C0X I;  1KAA A;  1YJW A;  4UP7 A;  3OMC A;  3HOY H;  1WTX A;  3WOF A;  1YNN D;  4H13 C;  1R9T B;  3BZK A;  4C2M B;  1H95 A;  2KA7 A;  4X65 Q;  2AWN A;  2CFM A;  4B3R L;  1JJC B;  4R9W A;  2BA1 A;  4QIW B;  1FNW A;  3J81 L;  3H15 A;  1IYU A;  5COY A;  4O0A A;  3KJP A;  1EEF D;  1SNO A;  4TSS A;  1FNU A;  4QUF A;  5IT9 E;  4LF8 L;  2X69 A;  2CQA A;  1CQF A;  1SSO A;  3RD4 A;  4F88 A;  3HOZ B;  3HOV B;  3A5U A;  1SE2 A;  3GTK H;  4A93 B;  3FPP A;  1AN8 A;  3TQY A;  3K7A H;  3JAM L;  3S1M H;  1Q1B A;  4GZY C;  3FHW A;  4PZ8 A;  1Q8K A;  2BE5 C;  1I3Q H;  2NVX H;  2ZJQ A;  4LF6 L;  3NPP A;  2ZM6 Q;  1Y8P B;  1UEB A;  1C7Y A;  2QKI C;  3HKZ E;  2WFW A;  1WTQ A;  1S5F D;  1I6H B;  4IJL A;  1A15 A;  2VUM H;  4X62 Q;  1PTO H;  2EY6 A;  3T1H L;  1X32 A;  3M9B A;  3E6Z X;  1PH2 A;  4PMB A;  5NUC A;  3MVV A;  5G3L D;  1F9P A;  1NTG A;  1QIL A;  1R4P B;  4EX5 A;  1VQO A;  1Q7Y C;  3LWE A;  1WTH A;  4EQ5 A;  4MTK A;  3S24 A;  1G2T A;  1MGS A;  1B9N A;  5EQ0 A;  4GLX A;  3NHH A;  5EKI A;  3HOW H;  1GUT A;  1F77 A;  1EYG A;  1KRT A;  3Q24 A;  3R2T A;  2E2H H;  4TQU S;  1H9K A;  3CW2 C;  2B29 A;  4RCO A;  3ERO A;  4UP9 A;  4B3M Q;  4FXK C;  5CV8 A;  5JJI A;  3T53 B;  2BDO A;  3S9W A;  4DV6 Q;  4R1J A;  3IAY A;  4QY7 A;  1BBX C;  1U4P A;  1OXS C;  1TWA B;  1GUS A;  1F2Y A;  4GOP B;  1O7Z A;  2OTL A;  2NVY H;  5ELO A;  3NEN A;  1DOK A;  1Q3L A;  2F3W A;  2K28 A;  4A3B B;  1PV4 A;  2JA8 G;  2JE6 I;  4DXG A;  1HZ9 A;  4JV5 L;  3NBI A;  5TSS A;  4LF7 L;  1HNX L;  2IX3 A;  5M5W B;  3TN2 A;  3SK5 A;  1Y8N B;  2L5T A;  1J5E L;  2UU9 L;  1TWG H;  4DR2 L;  2AUK A;  2EYL A;  5C4H A;  3PUY A;  5IWA Q;  2AQ2 B;  2LMC B;  3K6O A;  1SMY C;  4LF7 Q;  3RNU A;  2HQE A;  3MXP A;  4RAU C;  4FNF A;  1UE7 A;  2YYZ A;  5E1F A;  4DR6 Q;  1PZK D;  3ND8 A;  1IYJ B;  2A6H D;  2A69 C;  1D5X C;  3SK6 A;  1QNK A;  2KHI A;  1GUO A;  4KY6 A;  4DXF A;  3J80 L;  3HOU H;  1VQC A;  2RQX A;  3ULJ A;  4CDD C;  1VF7 A;  4BBR G;  2V4D A;  5KEE A;  4RA8 A;  1VDZ A;  1BKB A;  4LFC L;  5FO7 B;  1YI2 A;  4OWW B;  3CU7 A;  1VQN A;  1VQ9 A;  5ELF A;  2XN9 C;  1CA6 A;  5K5P A;  1SE3 A;  2F0S A;  3I8Z A;  2IX0 A;  4J6H A;  1GJX A;  2I5H A;  1O7I A;  3G71 A;  4A3C G;  4IFD I;  1C48 A;  5E3F A;  1VQP A;  1S5B D;  1S3O A;  4G57 A;  2EJF C;  1YIT A;  5T1I A;  2GVB A;  3S15 B;  3U9S A;  3K5O A;  1R4Q B;  4MIU A;  4XT3 B;  1Y14 B;  4Z9C B;  4LFA Q;  3SEB A;  4A3I B;  4L5T A;  5C4X G;  2EYO A;  4IPD A;  1ZKO A;  5A35 A;  2NZH A;  2RA4 A;  1ML0 D;  3O13 A;  1L0W A;  2B2U A;  2V1C C;  4TRD A;  3S2H B;  2B2T A;  1PMR A;  3GTM B;  2VB2 X;  2NVQ H;  3DXJ C;  2ZXP A;  3M7G A;  1WD1 A;  3FEW X;  1B53 A;  4A75 A;  4JBK A;  3J80 E;  1DCZ A;  4EVO A;  4OXP A;  3OHX C;  3P75 A;  1IYV A;  1DZ1 A;  2UXD L;  4YWL A;  3CCV A;  3FMC A;  3K7U C;  3X3M A;  4OO1 G;  1HFN A;  3EQL C;  2MNA A;  1CSQ A;  2F0L A;  2K5V A;  3A74 A;  1BCP C;  1VCI A;  4YY3 L;  4JBW A;  3I73 A;  2JA5 H;  5CC4 A;  3GTO H;  5HUR A;  1GUN A;  3MXU A;  5A2Q L;  5HGT A;  2C9O A;  4OO1 H;  3GV6 A;  1XNR Q;  5C0X J;  4DR5 L;  1BO0 A;  5KYI A;  1E2V A;  1V43 A;  1AW7 A;  4KY7 A;  4HJ5 A;  1LTS D;  4BY7 H;  1SNP A;  3G6J B;  3TP6 A;  5GAH C;  1XMQ L;  3QB3 A;  3PO3 G;  2C35 B;  4DUZ Q;  1QZG A;  3S16 H;  2AMC B;  1N33 L;  1ASZ A;  3U58 A;  1VMC A;  2F0K A;  1BDO A;  3TSS A;  3VR5 A;  4NW2 A;  3CC7 A;  1L1O C;  4OX9 L;  2F0J A;  2KEN A;  4DFA A;  4IUU A;  3VA7 A;  1EQT A;  2NN6 H;  3HOX H;  4AYB G;  2I07 B;  1GOZ A;  4FF2 A;  4G7O C;  1M1K C;  3OSO A;  1P8L A;  4HIK A;  2WV6 D;  3ER0 A;  3KF6 B;  1VS0 A;  1U4R A;  2AKW B;  2F4I A;  4JI6 Q;  5DNF A;  1SNQ A;  4R4Q A;  1SNM A;  1VQG A;  2JQO A;  2UXB Q;  1SN8 A;  1LV9 A;  3W1B A;  1IL2 A;  4HJ7 A;  4YHH Q;  3M7N A;  3TBI B;  2R7Z B;  2R7Z G;  1K8A C;  1QWY A;  1ROD A;  4PQX A;  2Q2I A;  3RZD B;  2WAQ E;  5FLX c;  4A3C H;  4N9T A;  1TS5 A;  3F8T A;  3SR1 A;  4DK1 A;  3AFQ A;  2XRS D;  1HUM A;  4U67 3;  2E74 C;  2PO4 A;  4MHE A;  4K0K L;  1ET6 A;  1H9S B;  4ZYS A;  5FLM H;  2ID0 A;  1G6Z A;  2E2H B;  3MHB A;  3CPF A;  1MSH A;  1JC7 A;  1HHV A;  2NZ1 D;  4DUY L;  5CV9 A;  5KYL A;  2H4O A;  1V9P A;  2R92 H;  3CRK C;  4A3E B;  1NAP A;  1CFM A;  2J7Z A;  4C3J G;  4A3E G;  1PRT C;  3JAM c;  2ENB A;  3S2D H;  3S2D B;  3KJO A;  2B2U C;  2MO1 A;  4JYA Q;  3S14 B;  1AE3 A;  1IBK Q;  1IL8 A;  1O7L A;  3ITP A;  1G8Z D;  3DM3 A;  5C4J H;  2R93 B;  5IE8 A;  3DEP A;  2PZW A;  1B9M A;  2F0M A;  4XQN A;  4A3D G;  1V1P B;  1N36 Q;  1OO9 B;  2UUA L;  1PRT F;  3GV3 A;  3J7A F;  4AH6 A;  3T56 B;  1NUC A;  2QDL A;  2FJ2 A;  3BVM A;  3A5Z B;  1JR0 D;  4F8M A;  3V05 A;  4G4K A;  5FJ8 G;  4ALP A;  1X6O A;  3NUC A;  4L5Q A;  4APV A;  1GXD C;  4B9W A;  1CKO A;  4OWX B;  3V96 A;  1I5F A;  1D5Z C;  4YWK A;  3D8G A;  4CJ2 C;  3M85 A;  1ZXT A;  4LF9 Q;  3PUX A;  4RGN A;  1D2B A;  1EIY B;  5IYC G;  4BXX G;  2PYK A;  4FYD A;  2YTV A;  1XPR A;  4M1U B;  2NN6 G;  3HOX G;  1STY A;  2BH2 A;  2K05 A;  5JAV A;  3BDO A;  4N8X 1;  2OEO A;  4KN4 C;  5IT9 c;  3S17 B;  3PUV A;  4ME5 A;  2KEE A;  3BDL A;  2PMZ E;  5FO8 B;  1XMO Q;  1VQ8 A;  2A6E D;  2R7Z H;  3A7A B;  1IW7 D;  5I9O A;  4QGU A;  5EGT A;  5JJK A;  3TZU A;  2ICI A;  4BA1 I;  2KUM A;  2JXM B;  2PI2 E;  4LFB L;  5CV5 A;  3LGJ A;  5C5M A;  1LTR D;  1YVC A;  3F1Z A;  2D5D A;  2QA4 A;  4L8J A;  1XXG A;  3SGI A;  2GVA A;  5I2X A;  1BVS A;  5C4J B;  4OON A;  5IP9 G;  1Y1V G;  1KRS A;  1I4Q A;  3NWT A;  1P16 A;  2VQE Q;  3GTO B;  2JA5 B;  1LYL A;  3BS1 A;  4A3E H;  3K57 A;  2UUC Q;  3CCU A;  3S1N H;  1I6H H;  3I4M G;  5T1G A;  3KUP A;  3BYT B;  5IY0 A;  3FPU B;  1GUW A;  4LUO A;  4JI4 L;  2ZJR A;  4C3J H;  2JA9 A;  1MD2 D;  4A3G G;  4DK3 C;  1ENA A;  4S3S A;  3SDZ A;  4A3G B;  2F03 A;  5EPL A;  4LW1 A;  3C3L A;  1HZB A;  4JI7 L;  4R4T A;  3F2D A;  5M3F H;  2B63 G;  2O5J C;  2EZV A;  3MEH A;  2E2I H;  5M5Y H;  4GN3 B;  1YNN C;  4DAV A;  4H0L C;  5IP7 H;  2KHJ A;  5LMN W;  3D6C A;  3GTG H;  1TWH H;  2I5M X;  4R4C A;  5M5W H;  2JA8 H;  2EXD A;  3S15 H;  1TS3 A;  2SNM A;  3SE0 A;  4P73 A;  1PYB A;  1KAB A;  4CKC A;  4HIO A;  4C1N K;  3J7Z C;  4PMC A;  1MI2 A;  4XQJ A;  1FJG Q;  2XTI A;  3K59 A;  1SXT A;  3I4N B;  3I4N G;  3T1Y Q;  2PQA B;  3D3R A;  1HRJ A;  2YTX A;  3TRZ A;  3QOJ A;  3Q0A A;  2MPM A;  1G2S A;  1VF5 C;  3HOV G;  1GHJ A;  1FL0 A;  1WTV A;  4RCN A;  1EYD A;  1A2U A;  1CT1 D;  3RN2 A;  4A3J H;  4A3K B;  1IBL Q;  4I7A A;  1PTO C;  4DV0 Q;  1E7Z A;  2HIV A;  1B1Z A;  2LS0 1;  3PO3 H;  1QB5 D;  4XTC S;  3NQI A;  1I4H A;  4RHS A;  3I55 A;  4H02 A;  2L4N A;  4OL7 A;  4LF5 L;  3IFT A;  2L11 A;  2Z4I A;  5IIF A;  5C44 B;  3DWQ A;  4JI0 L;  2K75 A;  4RGO S;  1G29 1;  1YEZ A;  4DV0 L;  3NBH A;  2F4V L;  1PH3 A;  1OXV A;  4JI5 Q;  4RKL A;  3H0G H;  4RMF A;  4HSV A;  1D5M C;  2DNC A;  3PIO A;  2UXC L;  5K36 G;  1UEA B;  4JCV E;  2E8G A;  1S72 A;  1EEI D;  4XT1 B;  2IX1 A;  5FK9 C;  1A63 A;  3EVQ A;  4WOR A;  2A8V A;  2RVL A;  4A3B H;  3B6Y A;  5EKL A;  4HCS A;  4X66 L;  4ZKC B;  2ZT9 C;  4KHZ A;  3I4M B;  3UDI A;  1EYC A;  4DN4 M;  3W3A A;  4A3I G;  2NVQ B;  2JK8 A;  2NTS A;  5J22 A;  1WD0 A;  4C3I H;  1K28 A;  3UDF A;  1SE8 A;  2LXJ A;  1OXU A;  4LUZ A;  2AQ1 B;  4K5V A;  3CCS A;  3QR8 A;  4DAY A;  1PH5 A;  4GLA C;  5C3X A;  2HHH Q;  5G3L F;  2F3I A;  2E5L Q;  1D8L A;  1ICF B;  1SEB D;  2WIN B;  3MXN B;  2RSO A;  2J4X A;  1O80 A;  4C2M H;  2NVY B;  4DV7 L;  4HIM A;  1G51 A;  1XMQ Q;  1TS4 A;  5LMN Q;  1X54 A;  2NTT A;  3MWY W;  1DXM A;  2KEC A;  5CBA E;  3KBX A;  1QVC A;  3CQZ B;  1KIX A;  2FMC A;  2F0T A;  1JCK B;  2Y0S G;  3BVG A;  4JI1 Q;  1HUN A;  3PF5 A;  2ATW A;  1X55 A;  3QIA A;  2HT1 A;  2ZTE A;  3GTL B;  1J5E Q;  1VQD A;  2UU9 Q;  1SFO B;  3NTI A;  4DR3 L;  1EWH A;  1HR0 Q;  2UUB Q;  3X3N A;  1CKM A;  1D7Q A;  3CXC A;  1A6X A;  3ERQ A;  3HZX A;  2DY7 A;  4CJ1 B;  4NB3 A;  3BDC A;  2HCC A;  2RHQ B;  2KCT A;  3TME A;  4JI7 Q;  4DR6 L;  1DOM A;  2F0V A;  3TP5 A;  4DV4 L;  4AYB E;  4HAE A;  1LTA D;  3MFG A;  2EQS A;  1BQQ T;  4EGV A;  1KDA A;  1LTG D;  2EJG C;  4NXM L;  5EBD A;  3JAM i;  5HY6 A;  4FF1 A;  3KF8 B;  5C5L A;  4GKJ L;  3HOV H;  3EBE A;  4G7H C;  4K0K Q;  1EY6 A;  2B39 A;  3OPO A;  5GRO A;  4JI8 Q;  3Q8D A;  4X64 L;  5J39 A;  4A3B G;  3OTO L;  1ZYR D;  3TEH B;  3HOY B;  5LMN L;  2KCC A;  4NPS A;  2XIW A;  1RIP A;  1S40 A;  3OIQ A;  2Y0S B;  1II3 A;  3KOJ A;  5CV7 A;  5I2Y A;  4DF7 A;  4JI1 L;  3K8A A;  2JA7 B;  1F9R A;  3DUZ A;  3STB D;  4RG1 A;  1BBU A;  2WB1 B;  3EA6 A;  3K0Y A;  1VQI A;  4NKL A;  2R7F A;  2K4K A;  3TDQ A;  2Z0S A;  3F2B A;  4IJH A;  1I4R A;  4K8I A;  2R93 G;  3K5M A;  2ZM6 L;  3HGB A;  4HJ9 A;  4XIG S;  2K03 A;  3BYY B;  4AYB B;  4DA2 A;  5EBC A;  1RF2 D;  1C0A A;  3P7J A;  2FMM A;  1I6V C;  4KTA A;  4F87 A;  4LF8 Q;  1STH A;  3GTP H;  5JEA G;  2CH4 W;  1FGB D;  2MQH A;  4K5X A;  3DWA A;  5JPM C;  5M3M H;  5KNC A;  2D62 A;  2YU9 B;  1N32 Q;  2VUM B;  1RTN A;  3RLO A;  1PTO B;  3M4P A;  4NDX A;  2JA6 B;  4C3I G;  2ZTC A;  3HRZ C;  1GKH A;  1B7Y B;  1DOL A;  4IUN A;  4LF6 Q;  4FXD A;  1CZG A;  1PH6 A;  3U50 C;  4YCW A;  4B3S Q;  3A55 A;  1I4X A;  1EIF A;  2MHV A;  1GUG A;  1U4M A;  1SDF A;  1N9W A;  1WTW A;  2RF4 A;  1IZ6 A;  2PQE A;  4I65 A;  4X62 L;  3HOX B;  3SK4 A;  2IWH A;  5C4X B;  3NEM A;  5FLM G;  2L55 A;  4A3J G;  2JA7 G;  4EQO A;  1DD2 A;  3KLW A;  2Q8I B;  1LTB D;  5L37 A;  4A3L G;  3DLL A;  3OWF A;  2DJF C;  1ESF A;  3I56 A;  4H7B A;  1L0Y B;  1GVP A;  1C8C A;  3K58 A;  1B8A A;  1UWV A;  1Z7T A;  2L15 A;  1Q8I A;  4IPH A;  5CMD A;  1WCM G;  4B9X A;  1H9R A;  1MJE A;  4BY7 G;  3ERS X;  3KFU A;  1KL9 A;  1TII D;  2A6E C;  2BE5 D;  3L9A X;  2JSO A;  1CHQ D;  4KHP Q;  4GNX A;  1FGU A;  2LKV A;  3CKI B;  1QVG A;  3GTJ B;  1IHZ A;  2SEB D;  3HOY G;  2EY1 A;  5CV4 A;  2VY3 A;  2Z8L A;  1VQE A;  5K36 H;  3E0J A;  1B4O A;  5JOB A;  4GKJ Q;  1Y1W H;  1A3T A;  2DN8 A;  1E3P A;  2VW9 A;  1UNS A;  2QGQ A;  2QEX A;  1TWF H;  1AZP A;  2UXD Q;  1EU4 A;  5BR8 Q;  4KHP L;  3QWN A;  3GO5 A;  5A2Q E;  5JJL A;  1I4G A;  4CHT B;  2LXK A;  3P1H A;  1PVO A;  5GAG C;  1QUQ A;  2ZTD A;  4R8I A;  1K8M A;  4K6L A;  3NXW A;  3U4Z A;  3M4O H;  4JBM A;  4JYA L;  2Z6K C;  3BG3 A;  1SLJ A;  2K5N A;  1N8R C;  5JVG 3; 
#chains in the Genus database with same CATH homology
 4LUV A;  3DM3 A;  5C4J H;  1OXX K;  4JI3 L;  2UUC L;  2GN5 A;  5IE8 A;  1PHJ A;  1BBW A;  1TWA H;  4C3H H;  1IBL L;  4DV1 Q;  2N8N A;  3CCL A;  2AWO A;  3AFP A;  1FVI A;  1WFQ A;  4A3D G;  4HJA A;  1XNQ Q;  3ICE A;  5IYC H;  4GNX B;  1N36 Q;  3S17 H;  2UUA L;  3KF6 A;  3UDG A;  4DV3 L;  2B63 H;  3CQZ H;  3W5O A;  4AH6 A;  2ALY B;  3D0F A;  4X6A H;  2JA5 G;  3WWV A;  3A5Z B;  3EIV A;  3T1H Q;  4BY1 G;  2Q2T A;  4B3T L;  2VUM G;  4A3G H;  4JOI C;  5FJ8 G;  4Y7N H;  4WJ4 A;  4ALP A;  4X66 Q;  1X6O A;  2CCZ A;  4L5Q A;  4APV A;  5C44 H;  1CKO A;  4OWX B;  3M4Q A;  1AH9 A;  4QIW E;  1I5F A;  4YWK A;  1CKN A;  2D0P A;  4GKK Q;  4QJF A;  2B3G A;  3M85 A;  3ULL A;  1YJ9 A;  4A3F G;  1HZA A;  3PUX A;  3PSI A;  4IPG A;  4JI6 L;  3RLF A;  5FJ8 H;  4LF9 Q;  4MTN A;  2UXB L;  1EIY B;  1HZC A;  2JA6 H;  3PO2 G;  1IXR A;  5IYC G;  1Y1V H;  5AJ3 Q;  4BXX G;  1Z47 A;  3J81 j;  4DV6 L;  1PH4 A;  4DNI A;  4HID A;  1E1O A;  2YTV A;  3K81 C;  1XPR A;  2E2J H;  4R4I A;  4IO9 A;  1VQF A;  2NN6 G;  3HOX G;  2Z6K A;  2BH2 A;  1PH7 A;  4A93 H;  4A3D H;  2RHS B;  5IT9 c;  1VQ7 A;  4UY8 C;  4FDB A;  3RZO H;  3FP9 A;  3PUV A;  2FXQ A;  4A4I A;  4DR1 Q;  1XJV A;  4DV5 Q;  2I5L X;  4IPC A;  1PA6 A;  1XMO Q;  2PMZ E;  1VQ8 A;  1ASY A;  1HNW Q;  2R7Z H;  4R4O A;  2A1A A;  1PFS A;  4QGU A;  1N33 Q;  1HR0 W;  4DR7 Q;  2OCE A;  5JJK A;  3UDX A;  4J15 A;  4JI2 Q;  4BA1 I;  4L5R C;  4X65 L;  3K80 C;  3H3V H;  3GTM H;  4DK6 C;  3BZC A;  2BA0 A;  2PI2 E;  4LFB L;  4A3K H;  3LGJ A;  1HNZ Q;  1YBY A;  5C3E G;  1YVC A;  4DUY Q;  1K8G A;  4LFA L;  4AQY Q;  4X64 Q;  3F1Z A;  1KD1 C;  3CP0 A;  1HH2 P;  4PZ7 A;  1XPO A;  4MZ9 A;  2QA4 A;  5DLQ E;  3SGI A;  2GVA A;  3CCM A;  1BVS A;  4A93 G;  1L1O A;  4PMW A;  3G48 A;  3CCR A;  4OON A;  5IP9 G;  1Y1V G;  1KRS A;  5H1S E;  1X9N A;  1XNQ L;  4B3R Q;  1U5K A;  3VDY A;  1FJG L;  1P16 A;  4OWT B;  1YNX A;  2F4V Q;  3A0J A;  2VQE Q;  3T1Y L;  1WYD A;  1HNX Q;  1HNZ L;  1LYL A;  3E9H A;  3RLN A;  4A3I H;  4A3E H;  3CCU A;  2UUC Q;  3S1N H;  3I4M G;  1I6H H;  4A76 A;  4IFD J;  1X65 A;  5ELN A;  5IY0 A;  3JC6 6;  1K9M C;  2AHO B;  5IYB G;  4LUO A;  4JI4 L;  2CQO A;  2JJQ A;  4DR4 L;  2ZJR A;  1X3E A;  4C3J H;  1VQA A;  4LF5 Q;  2WB1 E;  2JA9 A;  1E22 A;  1Y1W G;  1NBW A;  2JEB I;  1VQB A;  1EUJ A;  4A3G G;  4DK3 C;  1VQJ A;  4YHH L;  1XMO L;  1PH1 A;  2VS1 A;  4LW1 A;  1HZB A;  2K14 A;  4JI7 L;  4R4T A;  3F2D A;  1UE5 A;  4DAY B;  3GTJ H;  1VQ4 A;  1VQ5 A;  3E9I A;  5M3F H;  3J80 i;  2A19 A;  2B63 G;  4JG2 A;  1KQS A;  4NXN L;  2OQ0 A;  2R6G A;  4GN4 B;  1LM0 A;  5M5Y H;  2E2I H;  1K3R A;  1EQQ A;  3IRB A;  4GN3 B;  4LF4 L;  2XGT A;  1W3S A;  4DV4 Q;  5IP7 H;  3GTG H;  2KHJ A;  5LMN W;  1MKH A;  5C0X I;  3HKS A;  1TWH H;  2I5M X;  2Q2H A;  4R4C A;  4UP7 A;  5M5W H;  1YJW A;  3HOY H;  1J6Q A;  4LF9 L;  2JA8 H;  4GKK L;  2EXD A;  4GLV B;  4YY3 Q;  3S15 H;  1WI5 A;  5IYB H;  3HOW G;  4P73 A;  3ZJY C;  1PYB A;  5C44 G;  3CME A;  3BZK A;  1Q1E A;  4HIO A;  1H95 A;  4X65 Q;  1Q46 A;  2AWN A;  4GNX C;  2HIX A;  2CFM A;  3J7Z C;  4B3R L;  3PCO B;  1JJC B;  1SRU A;  2BA1 A;  4DR5 Q;  2CKZ B;  3UE0 A;  3UE1 A;  2XTI A;  4AIM A;  1FJG Q;  3H15 A;  1XNR L;  2MFI A;  2VNU D;  4O0A A;  3KJP A;  3T1Y Q;  2PQA B;  4LWC A;  1XPU A;  3I4N G;  2YTX A;  3S1R H;  2K5H A;  4AQY L;  1PH8 A;  4DV7 Q;  3GD7 A;  4LF8 L;  3TRZ A;  3KDF B;  4DPG A;  3PIP A;  4ME3 A;  3HOV G;  3HOZ G;  4QQB X;  1FL0 A;  3A5U A;  1JB7 A;  3GTK H;  1IBM Q;  1X56 A;  3RN2 A;  5HGQ A;  1JMC A;  4JI2 L;  4A3J H;  3TQY A;  3K7A H;  3S1M H;  1IBL Q;  1Q1B A;  3PV0 A;  2DGY A;  4LFB Q;  4IOA A;  4DV0 Q;  3FHW A;  1E7Z A;  2HIV A;  1VQH A;  3PO3 H;  4PZ8 A;  1I50 H;  1Q8K A;  1CUK A;  4XTC S;  2F52 A;  4B3M L;  3U4V A;  1I3Q H;  2NVX H;  3CF5 A;  2ZJQ A;  4LF6 L;  2ZM6 Q;  3I4M H;  3I55 A;  4H02 A;  1UEB A;  1B70 B;  1C7Y A;  4LF5 L;  4KLK A;  1R9T H;  3HKZ E;  1RL2 A;  3RN5 A;  2IHF A;  2WFW A;  2IT1 A;  4JI0 L;  3HFZ B;  2K75 A;  5GAE C;  1G29 1;  1YEZ A;  4IJL A;  4YCV A;  4DV0 L;  1PH3 A;  1OXV A;  4POF A;  4JI5 Q;  2F4V L;  2EIF A;  2VUM H;  2N78 A;  4X62 Q;  4B3T Q;  3H0G H;  3T1H L;  4RMF A;  5M5X H;  4MNO A;  3M9B A;  1NMG A;  2Q2U A;  5M3F G;  1PH2 A;  4DR3 Q;  3PIO A;  4GOP A;  2UXC L;  5K36 G;  2UUA Q;  4JCV E;  1EQR A;  2E8G A;  4GN5 A;  4YWM A;  3CCQ A;  5LMU Q;  1S72 A;  2ASB A;  1YHQ A;  1JT8 A;  1YZ6 A;  1NTG A;  2IX1 A;  1G6P A;  3CCJ A;  1A63 A;  4EX5 A;  1VQO A;  1Q7Y C;  2A8V A;  4EQ5 A;  3S24 A;  4A3B H;  4A3K G;  1PYS B;  3D31 A;  4GLX A;  4DR7 L;  3B6Y A;  3HOW H;  2DUD A;  5C0X G;  4KHP L;  4X66 L;  1IBK Q;  1EYG A;  4KHZ A;  3TS2 A;  1GD7 A;  1KRT A;  3UDI A;  4A3I G;  2E2H H;  4BA2 I;  4TQU S;  3CW2 C;  5LMU L;  2IY5 B;  1UE1 A;  2B29 A;  2JK8 A;  4DV5 L;  1SFO H;  1Q82 C;  2WP8 J;  3GTQ H;  2WB1 G;  4C3I H;  4UP9 A;  4B3M Q;  1NMF A;  4NXM Q;  3UDF A;  5JJI A;  1SE8 A;  2LXJ A;  4DV6 Q;  1OXU A;  4LUZ A;  4R1J A;  2Y0S E;  1N36 L;  5GQO A;  2ES2 A;  2CWP A;  3CCS A;  4QY7 A;  3K0X A;  1OXS C;  2OWO A;  4GOP C;  1PH5 A;  4GLA C;  4DV1 L;  2HHH Q;  2F3I A;  5EAY A;  4GOP B;  2E5L Q;  1D8L A;  3FKI H;  4JI3 Q;  3MXN B;  4OX9 Q;  4POG A;  3BJU A;  4C2M H;  2OTL A;  3PO2 H;  2N49 A;  3PUW A;  3PF4 A;  2NVY H;  5ELO A;  4DV7 L;  4HIM A;  1G51 A;  3NEN A;  2RCN A;  1XMQ Q;  1VQ6 A;  1PV4 A;  1E1T A;  5LMN Q;  1X54 A;  2LSS A;  2JA8 G;  1QVC A;  1KIX A;  2JE6 I;  2CWA A;  4YCU A;  3F2C A;  4PG3 A;  2VL6 A;  2VQE L;  1HZ9 A;  4JV5 L;  3W1G A;  1EOV A;  1K83 H;  4LF7 L;  1HNX L;  2Y0S G;  3HOZ H;  4JI1 Q;  4IOC A;  3PF5 A;  2ATW A;  1X55 A;  1WCM H;  2HT1 A;  2ZTE A;  1J5E Q;  1VQD A;  2UU9 Q;  4A3M H;  2PQA A;  2UXC Q;  1J5E L;  2UU9 L;  4DR3 L;  1KAW A;  1GM5 A;  1X3F A;  2N3S A;  1HR0 Q;  1VQL A;  2UUB Q;  1TWG H;  4DR2 L;  2I0Q A;  4LNQ A;  3PUY A;  5IWA Q;  1N34 Q;  1CKM A;  4GS3 A;  1D7Q A;  3CXC A;  4JI0 Q;  4LF7 Q;  3L2P A;  3RNU A;  4NB3 A;  1X3G A;  5C3E H;  2RHQ B;  2KCT A;  4JI7 Q;  2K52 A;  3KYH C;  1UE7 A;  2YYZ A;  4DAM A;  4DR6 L;  2IHE A;  3CPW A;  3J80 c;  4DR6 Q;  4DV4 L;  4AYB E;  3CAM A;  1IYJ B;  4P74 A;  1HJP A;  2KHI A;  4DR1 L;  2EQS A;  4UP8 A;  2YU9 H;  3L7Z C;  1HNW L;  4HJ8 A;  3HKZ G;  3HOU H;  1GO3 E;  1VQC A;  2YTY A;  3M3Y H;  1CSP A;  3ULJ A;  4NXM L;  3JAM i;  4BBR G;  1PH9 A;  5HY6 A;  1SRO A;  3KF8 B;  1IBM L;  2KCM A;  4DV2 Q;  4GKJ L;  3HOV H;  2R7D A;  3EBE A;  4K0K Q;  3G6E A;  4WJ3 M;  1BKB A;  2YV5 A;  2HQL A;  4LFC L;  4A3M G;  1JJ2 A;  1YI2 A;  1I94 L;  5GRO A;  4JI8 Q;  4OWW B;  3Q8D A;  4X64 L;  1VQN A;  2H5X A;  2VZA A;  1VQ9 A;  4BXX H;  1L2F A;  3I7F A;  5IYD H;  1K73 C;  2IX0 A;  2NZO A;  1CKN B;  1Z9F A;  2I5H A;  1O7I A;  3S14 H;  3G71 A;  4JBJ A;  2WAQ G;  3OTO Q;  4IFD I;  4A3C G;  1NJI C;  2OTJ A;  1VQP A;  4DUZ L;  4A3B G;  3H3V I;  3OTO L;  1S3O A;  1XTD A;  1JJG A;  1YIT A;  3TEH B;  4JV5 Q;  3I4O A;  5LMN L;  3PGZ A;  2NN6 I;  4NPS A;  2GVB A;  4A3L H;  1VQK A;  1RIP A;  4JC0 A;  1S40 A;  1Y14 B;  3KOJ A;  1T9H A;  4LFA Q;  1E24 A;  3NEL A;  4JI1 L;  4L5T A;  5C4X G;  3K8A A;  1YIJ A;  1A0I A;  4IPD A;  3STB D;  4NXN Q;  2NZH A;  1BBU A;  4RG1 A;  3J81 i;  3OW2 A;  3CCE A;  1C9O A;  1VQI A;  3CMA A;  1KC8 C;  1SLJ A;  1DGS A;  1A62 A;  1L0W A;  2R7F A;  2K4K A;  5JEA J;  2V1C C;  2Z0S A;  4JI5 L;  3F2B A;  3GTL H;  3CC4 A;  1K0R A;  4A3F H;  2NVQ H;  4IJH A;  5AJ3 L;  2R93 G;  4A75 A;  2ZM6 L;  4JBK A;  2R92 G;  4HJ9 A;  4JI4 Q;  2PNH A;  4OXP A;  4XIG S;  5BR8 L;  4BBS H;  2UXD L;  4YWL A;  3CCV A;  3K7U C;  4OO1 G;  1N34 L;  1C0A A;  3EN2 A;  4BY1 H;  4L5S A;  1KXL A;  5IWA L;  2MNA A;  4LF8 Q;  1AE2 A;  1CSQ A;  4QL5 A;  2VQF Q;  5JEA G;  3GTP H;  2K5V A;  2MQH A;  1LUZ A;  1VCI A;  3A74 A;  4YY3 L;  4JBW A;  4DKA C;  2JEA I;  2JA5 H;  2NVT H;  3GTO H;  1V1Q A;  1A8V A;  1W2B A;  5M3M H;  2OQK A;  2D62 A;  2KBN A;  1N32 L;  1OXT A;  2K50 A;  1XNR Q;  1SR3 A;  5C0X J;  1WOC A;  3MEF A;  3I4N H;  3RLO A;  1N32 Q;  4DR5 L;  4P75 A;  3STB C;  1YJN A;  2JA6 G;  3M4P A;  1V43 A;  3BU2 A;  2BH8 A;  2ZTC A;  1GKH A;  4HJ5 A;  4BY7 H;  1B7Y B;  1QUQ B;  3J81 c;  5GAH C;  3RZD H;  1XMQ L;  4LF6 Q;  3PO3 G;  2C35 B;  4DUZ Q;  1QZG A;  1PH6 A;  3S16 H;  4BBS G;  2AMC B;  1N33 L;  3U50 C;  4YCW A;  1Q86 C;  4B3S Q;  1ASZ A;  3U58 A;  1EIF A;  1L1O B;  1TXY A;  4DV3 Q;  1EFW A;  3CC7 A;  1L1O C;  3AEV A;  2E5L L;  1IBK L;  1N9W A;  4OX9 L;  3FKI G;  2HHH L;  3L0O A;  4JI8 L;  4IFD G;  4Y52 H;  2RF4 A;  1I94 Q;  3CC2 A;  1IZ6 A;  2KEN A;  1SMX A;  4X62 L;  5GAD C;  3HOX H;  4AYB G;  3NEM A;  5IP9 H;  5M3M G;  1UE6 A;  5FLM G;  3HOU G;  1M1K C;  4P72 A;  4A3J G;  3J7A 5;  2JA7 G;  4DR2 Q;  1KHI A;  3KLW A;  1P8L A;  4LF4 Q;  3H0G G;  3ER0 A;  4HIK A;  4DR4 Q;  3KF6 B;  1VS0 A;  1YHA A;  3DLL A;  4A3L G;  1NE3 A;  1Q81 C;  3RR5 A;  2AKW B;  4JI6 Q;  3I56 A;  1LTL A;  4R4Q A;  2JQO A;  1VQG A;  1GVP A;  3CD6 A;  2UXB Q;  4O2D A;  1B8A A;  1SN8 A;  1UWV A;  2L15 A;  3OYY A;  4IPH A;  1WCM G;  3AYH B;  3W1B A;  4YHH Q;  4HJ7 A;  1QVF A;  1IL2 A;  3M7N A;  3NBH B;  4UPA A;  3S1Q H;  1NY4 A;  5IYD G;  2R7Z G;  1K8A C;  3GDE A;  1MJE A;  2Q2I A;  3ERS X;  4BY7 G;  2R93 H;  3KFU A;  1QZH A;  1HR0 L;  1KL9 A;  2UUB L;  5J3B A;  3S2H H;  2WAQ E;  5FLX c;  4A3C H;  1JE5 A;  4KHP Q;  3KDF A;  3F8T A;  5IP7 G;  3AFQ A;  2ZJP A;  1FGU A;  4GNX A;  1QVG A;  3HOY G;  2JA7 H;  3E0E A;  1M90 C;  2VY3 A;  1VQE A;  4KI0 A;  2VQF L;  4K0K L;  4OO1 I;  1EWI A;  1YHB A;  4DV2 L;  4GKJ Q;  4BBR H;  4LFC Q;  1Y1W H;  1E3P A;  5C4X H;  3ULP A;  2VW9 A;  2QGQ A;  5FLM H;  2QEX A;  1TWF H;  2UXD Q;  1OTC A;  1Q12 A;  2ID0 A;  5BR8 Q;  4P71 A;  1U0L A;  1WJJ A;  3AQQ A;  2MO0 A;  3CPF A;  3GO5 A;  3I2Z A;  4PZ6 A;  2LXK A;  1PVO A;  1TWC H;  5JJL A;  4DUY L;  4JOI A;  1MIU A;  5GAG C;  1QUQ A;  2PI2 A;  2ZTD A;  3TS0 A;  1MJC A;  1V9P A;  3TRE A;  2R92 H;  3U4Z A;  3M4O H;  4A3E G;  4JBM A;  4B3S L;  5E7N A;  4JYA L;  3JAM c;  3S2D H;  3KJO A;  2MO1 A;  3PUZ A;  4JYA Q;  1VQM A;  2Z6K C;  3G4S A;  1AE3 A;  2K5N A;  1N8R C;  2D0O A;  4TVA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...