3ULLA

Human mitochondrial single-stranded dna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
106
Chain Sequence
b'LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BINDING PROTEIN
molecule tags Dna binding protein
publication title Crystal structure of human mitochondrial single-stranded DNA binding protein at 2.4 A resolution.
pubmed doi rcsb
total genus 14
structure length 106
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ullA00
4YY3L 3TREA 1PH3A 4X64Q 1G6PA 4LF9L 4LNQA 4HJ5A 3UDGA 4NXNQ 3DLLA 4B3TL 1SLJA 2ATWA 2EQSA 3PF4A 4YHHL 3CP0A 2VNUD 1CSQA 4NPSA 4IO9A 1C0AA 4DV7Q 3T1YQ 2H5XA 1NMGA 4Y7NH 5AJ3L 1G291 4DV3Q 4DR6Q 2XGTA 2LXJA 1RL2A 2JA8G 5M5YH 3CCRA 1YITA 3CCQA 5FLMH 4DV5Q 1Q1EA 4KLKA 4OX9L 4B3RQ 2CKZB 3OTOL 2WFWA 5IP9G 1C7YA 4A3LG 3D31A 1L1OA 4C2MH 3RZOH 4DV6Q 3CCEA 1SMXA 4JI0Q 4DV4Q 2WP8J 4ALPA 4L5RC 4UP9A 1PH7A 1KQSA 1HNXL 2B29A 4A3GH 1WOCA 5C4XG 4R1JA 1FJGQ 1Q46A 3I4MH 1IBLL 1PHJA 5C3EH 4JI5Q 4MNOA 1KRTA 4BA2I 4UP8A 1I94Q 2MQHA 3E0EA 4A3EG 2OQKA 2VZAA 4YCVA 4DV1L 3PO2G 2K75A 2IHFA 4PZ6A 2C35B 3PCOB 3Q8DA 4GNXA 1PH5A 4YCWA 5ELOA 4X62Q 1UE6A 2Z6KA 2VUMH 4MZ9A 4RG1A 4X65L 1VQOA 1U5KA 5EAYA 2PMZE 2OTJA 2A19A 4DV0L 2KHJA 1HR0Q 4BBRH 1X3GA 2KBNA 1B7YB 1E24A 1VQEA 2K4KA 3PIOA 3HOUG 1UE5A 4K0KL 4A76A 3JAMi 1NBWA 1L1OB 4OONA 1S40A 3UDXA 2I0QA 4GOPB 5M5WH 1PFSA 3CC4A 1ASYA 1W2BA 2CQOA 2RF4A 2OWOA 5FJ8H 2FXQA 4GOPA 1PH2A 4DK3C 3T1HQ 3L0OA 1VQBA 2RHSB 1KAWA 2A1AA 4X66L 2RCNA 1X3FA 4DUYQ 1QUQB 3BZKA 4PMWA 3HOWH 4A3MH 3RN5A 3RLFA 4DUZL 4UY8C 4AQYQ 1XTDA 2N8NA 1VS0A 4P71A 3M4OH 1HZAA 1VQ5A 3OW2A 1V9PA 1VQ6A 4KHZA 1E3PA 1GO3E 1Q7YC 1VQ8A 2VQEQ 4A3MG 2HIXA 2F4VL 3CCVA 2V1CC 2UUCL 1XNRL 1TWGH 3PUYA 1LUZA 5IYDG 5M3MG 4POGA 1AE3A 5C44G 2HHHQ 1HNWQ 2KENA 4R4TA 2KHIA 4IFDG 4LFAQ 3FKIH 1VQFA 2MFIA 2VL6A 4JBKA 3S1MH 3KJOA 4TQUS 5E7NA 3ULJA 1XNQL 1N33L 2IHEA 2VS1A 4C3HH 1HZCA 4JI8Q 5IP7G 2WB1E 1Q12A 4DR2L 4A3JG 4A3KH 1S72A 2ASBA 1OXTA 5FLXc 5M3FG 1B70B 4GN5A 3PUZA 1N8RC 2E2IH 1A0IA 1X3EA 1XMQQ 1HNZQ 1N32L 1PVOA 4QQBX 1G51A 1WYDA 4QY7A 3NEMA 3HFZB 3CPFA 1QVCA 1KRSA 1LM0A 1W3SA 1BKBA 4JOIC 1K83H 3AFPA 4OWTB 2N78A 5BR8Q 3CPWA 3ER0A 4LFBQ 1E22A 2R7ZH 4NB3A 4A3DG 2BA0A 3KYHC 5IYCH 4LF6Q 3L7ZC 3KF6B 2YTXA 2NZHA 4DR3Q 4DV2L 2UXBQ 2N3SA 1YJWA 4B3ML 2VW9A 4DV2Q 1EQRA 3F8TA 4GOPC 3HOZH 1YBYA 5IWAQ 4JBWA 3PUXA 1CSPA 4BY1G 2UUAQ 3WWVA 2JA9A 4AYBE 1X9NA 4LFBL 4IPDA 4JI7L 1SR3A 1M90C 1WJJA 1XMOL 3HOYH 4DAYB 4LF4L 3K81C 3GTLH 1M1KC 1E7ZA 2Z0SA 4YCUA 2EXDA 1N34Q 1YJNA 3A0JA 2R93H 2MNAA 3H0GG 4LUOA 1YHQA 2PI2E 4JCVE 2N49A 4POFA 1YI2A 3HOYG 1IBMQ 2UXDL 1NE3A 4A3KG 2K52A 3UE0A 4BXXG 3EBEA 1U0LA 1JJ2A 2F3IA 1Y1VG 1YHBA 3STBD 1N34L 1VQ9A 1HH2P 4LFAL 5IE8A 2R92H 2PNHA 2ZJPA 2UUBQ 1YJ9A 4LF4Q 2BH2A 3J80i 1V43A 1YZ6A 5LMNL 3HOUH 2MO0A 3E9IA 4IPCA 2UUCQ 5IYDH 4DPGA 4A3EH 3S14H 4LUZA 1WI5A 1FL0A 3AYHB 4QJFA 2OCEA 2R92G 1J6QA 3FKIG 4OWXB 3M3YH 3NBHB 3J7A5 2MO1A 4DR7Q 4A75A 2ZTCA 4GLVB 2ALYB 3K7AH 3HOWG 3FP9A 4KI0A 4JBJA 4AQYL 1IBML 2JA6G 1O7IA 5LMNW 2UXDQ 4BBSH 3I56A 4R4OA 4O2DA 3CCMA 1VQDA 2ZJQA 2RHQB 4R4IA 1A63A 1JE5A 3T1HL 2YU9H 1EIFA 2JA7G 3G6EA 5DLQE 1X65A 3AFQA 5ELNA 1XMOQ 2IY5B 3HOVH 4GNXC 1WFQA 3KF6A 1VQ7A 2NN6I 3GTQH 4BY7G 2OQ0A 3UDFA 1PA6A 1MJEA 2I5LX 3A5ZB 1AH9A 4DR7L 4A3CH 3PUVA 3K0XA 2CWPA 1N33Q 3S2DH 3KDFA 2UXBL 1XNQQ 4DR3L 1ASZA 4O0AA 4DAMA 2Q2UA 5IYBG 1QVGA 3KDFB 4YWKA 4DV0Q 5LMNQ 1I5FA 2VUMG 2NVYH 4A4IA 2AHOB 3IRBA 3M4PA 2I5MX 1N9WA 1NMFA 3U4ZA 4DKAC 2UUBL 3EN2A 2QEXA 1Z47A 5GQOA 3LGJA 1A62A 4P72A 2B63H 2CWAA 3J7ZC 3CQZH 2K14A 5IT9c 1BBUA 1XMQL 3BZCA 1IBLQ 1FVIA 2YV5A 3KFUA 2LXKA 2WB1G 1PYBA 1L0WA 4A3IH 3S2HH 2Z6KC 3G48A 1X6OA 3ERSX 4L5TA 1VQNA 2WAQE 4OO1G 3I4OA 1HNXQ 1PH6A 4QGUA 3J81i 3PO2H 2IX0A 2HIVA 5HY6A 2F52A 4DV4L 1XJVA 2R6GA 4YWMA 2PQAA 3U4VA 1EOVA 4HJ8A 4HJ9A 3HKSA 1PYSB 2HHHL 1HNWL 1NTGA 3W5OA 4JI7Q 2E8GA 1I50H 1C9OA 3S24A 1BBWA 2UUAL 4OX9Q 2OTLA 1K73C 3STBC 1JT8A 5IWAL 3F2BA 2VQEL 4ME3A 4A93H 1SN8A 5IY0A 1K0RA 3KJPA 3G71A 2R7FA 3OYYA 1Q1BA 4IPGA 5AJ3Q 1PH4A 1VQLA 4B3MQ 3M7NA 4IFDI 3FHWA 3HOXG 4LF6L 4EX5A 4XTCS 1D8LA 1HJPA 2JJQA 5IYCG 5C0XI 3S1QH 1OTCA 2BA1A 4LUVA 5BR8L 5GADC 4X62L 1OXUA 4X66Q 5C4XH 1SRUA 3CMAA 1TWAH 1EWIA 1VCIA 1PH9A 4EQ5A 1SFOH 1GKHA 1HNZL 4QIWE 5M5XH 1E1OA 1K8AC 3RLOA 3H3VH 1N32Q 1P16A 1HZBA 4GN3B 4APVA 3A5UA 2GVAA 2YYZA 2QA4A 1KL9A 3H3VI 3EIVA 1KD1C 3CCLA 3I4NG 4DR2Q 4JI8L 1YHAA 3S1RH 3PUWA 2R7DA 4GKJL 1K8GA 3GD7A 1CKMA 1E1TA 4JI1L 4IJHA 2A8VA 1HR0L 4DV6L 1YEZA 3GTOH 3PO3H 1LTLA 5GROA 3RZDH 1KHIA 4L5QA 4TVAB 2ID0A 4A3DH 1UE7A 3BJUA 2ZTDA 4IPHA 1NY4A 3F2DA 1EYGA 5M3MH 1VQKA 1XNRQ 2E2HH 3I4NH 1TWCH 2F4VQ 1VQPA 3RR5A 4DV1Q 3L2PA 4DR6L 4DV3L 1I94L 2HT1A 2JEAI 3S17H 4DV7L 3HOZG 4AIMA 3D0FA 3S15H 3CD6A 4JI2L 1OXXK 4OWWB 2JA7H 4B3TQ 4DUZQ 3KOJA 3CCSA 4GNXB 1FJGL 3PO3G 4DUYL 1IXRA 1HZ9A 2JK8A 1S3OA 3GTGH 3GTMH 3ICEA 1Q82C 4A3BH 2JEBI 1LYLA 3M85A 3MEFA 3NENA 1XPOA 4JI4L 4LFCQ 5IYBH 1MIUA 1IYJB 4P74A 1FGUA 2DUDA 2VQFQ 2B3GA 5JJKA 2K50A 2Q2TA 3OTOQ 1BVSA 4K0KQ 1NJIC 3TRZA 2I5HA 3RNUA 2AWOA 1L1OC 4PG3A 3J81j 3PF5A 4P75A 2QGQA 3CCUA 1CKNA 1B8AA 1D7QA 3K80C 1VQMA 2CFMA 3HOVG 4NXML 2AKWB 4JYAQ 3PV0A 4YHHQ 3S16H 1CKNB 2Q2IA 5IP9H 4A3LH 3UE1A 1DGSA 3A74A 1P8LA 4X65Q 5FLMG 4LW1A 3CC2A 1QUQA 5K36G 2DGYA 1YNXA 4YY3Q 3PIPA 2ZM6L 1IZ6A 5JJIA 2JQOA 3CF5A 4P73A 1MJCA 4JBMA 2BH8A 4UPAA 1I6HH 3GTJH 3VDYA 4JI5L 1OXSC 5C4JH 2YTYA 2D0PA 4LF8Q 4QL5A 1AE2A 3H0GH 4IOCA 1JB7A 4KHPL 4DR5L 5JJLA 4BXXH 3AEVA 3W1BA 4LF5L 2NVTH 1TXYA 2UXCQ 1EFWA 4HIKA 1Y1VH 2K5NA 3CW2C 3PSIA 4R4QA 2CCZA 3NELA 4DR1L 4BBSG 4BA1I 1T9HA 5LMUQ 4JI0L 4IFDJ 3CMEA 2KCMA 2NVXH 4A3BG 1YVCA 3CAMA 4C3IH 1N36L 4B3RL 4OO1I 4DV5L 2YTVA 4LWCA 4BY1H 4JI6Q 1PH8A 1Y14B 3H15A 1Q8KA 4HIMA 3KF8B 3CC7A 1VQCA 3T1YL 4DR4Q 4WJ4A 1MKHA 4PZ7A 4A3FH 1X55A 3G4SA 1YIJA 4JC0A 3S1NH 2AMCB 2K5HA 3TQYA 4JI6L 4NXNL 1KXLA 1PH1A 4LF9Q 2NN6G 4X64L 2NVQH 4HIOA 2UU9L 2LSSA 1PV4A 4B3SL 4DNIA 1UE1A 4XIGS 4IOAA 4A3FG 4JI3Q 2JA5H 3RLNA 3GTKH 2PQAB 1J5EQ 1IBKQ 2E5LL 1EQQA 2NZOA 4GKKL 1VQAA 4C3JH 1WCMG 5GAHC 1RIPA 3MXNB 2ES2A 2B63G 3B6YA 2JA8H 2UXCL 5C0XG 5C0XJ 1CKOA 3ULLA 1GD7A 3I7FA 3CXCA 2IX1A 4JV5Q 4GKKQ 1SROA 2JA5G 4RMFA 3W1GA 3AQQA 1J5EL 1IBKL 1XPRA 3K8AA 4LF7Q 2HQLA 4L5SA 4GN4B 4GLAC 3U58A 1Z9FA 4MTNA 4PZ8A 5C44H 2WAQG 2ZM6Q 4HIDA 1Y1WG 2UU9Q 3JC66 1GM5A 1UEBA 3M9BA 3K7UC 1K9MC 3J80c 1IL2A 3I4MG 5HGQA 2R7ZG 4HJ7A 2XTIA 3I55A 4X6AH 3GO5A 1KC8C 3I2ZA 1HR0W 1X56A 5J3BA 3TS2A 2Y0SE 2PI2A 4A3IG 4JV5L 2ZJRA 4HJAA 2GN5A 4BY7H 1TWHH 3HOXH 1KIXA 4IJLA 1N36Q 4WJ3M 3F2CA 5GAEC 3TS0A 1V1QA 2D0OA 4YWLA 4A3CG 3M4QA 3TEHB 1CUKA 3SGIA 4LFCL 4OXPA 1L2FA 3RN2A 4B3SQ 1TWFH 3UDIA 4FDBA 1WCMH 2IT1A 4LF5Q 5GAGC 3GDEA 4GLXA 1VQIA 5FJ8G 4JI2Q 1Q86C 1JMCA 1JJCB 3ULPA 4KHPQ 1H95A 3HKZE 4LF8L 1OXVA 2ZTEA 2Q2HA 1X54A 5JEAJ 4A93G 4DR4L 5JEAG 1VQGA 1VQJA 1EIYB 4JOIA 1K3RA 1QZGA 4UP7A 3JAMc 1VQ4A 1I3QH 3E9HA 1EUJA 2K5VA 4R4CA 5IP7H 5H1SE 4A3JH 1JJGA 1QVFA 3KLWA 2L15A 4GS3A 4H02A 1Y1WH 4BBRG 2E2JH 4LF7L 2GVBA 1A8VA 2Y0SG 1R9TH 3PGZA 4JYAL 4Y52H 4NXMQ 1UWVA 5LMUL 4JI1Q 4DR1Q 3BU2A 4A3GG 4JG2A 2EIFA 1Q81C 2R93G 3DM3A 4GKJQ 2JA6H 1SE8A 3CCJA 1GVPA 2AWNA 3HKZG 3J81c 4AH6A 1VQHA 4DR5Q 2VY3A 2KCTA 2JE6I 2VQFL 3U50C 2E5LQ 4J15A 5C3EG 1QZHA 4JI4Q 1XPUA 3F1ZA 4DK6C 2D62A 4JI3L 5M3FH 4AYBG 3GTPH 3ZJYC
chains in the Genus database with same CATH superfamily
1E2ZA 2MUYA 4FF3A 3UDGA 4IALA 1CZGA 1B50A 1QNKA 4YHHL 3CP0A 3QWNA 2VNUD 1HRJA 1JWSD 1C0AA 2EY6A 1NMGA 1TWHB 2JP1A 3HOXB 4DR6Q 3U9SA 3NK9A 3A55A 5CV4A 5HURA 4KLKA 4DV5Q 3OTOL 4ZCKA 2WFWA 4A3LG 5CV9A 2F3WA 3TMEA 2J4XA 3RZOH 1SMXA 2IPKD 2A68D 2WP8J 3FPPA 1PH7A 3H6MA 4A3GH 1F2MA 1EOTA 1FJGQ 1Q46A 2N55A 4DFAA 2I46A 1U9RA 2OQKA 2GA4B 3O13A 4PZ6A 2C35B 2L9HA 2K01A 1PH5A 5ELOA 1SJHD 1VQOA 1U5KA 3EQLC 1QCBD 2OTJA 1K83B 2K28A 3FRPB 2Z4HA 4CKBA 1B7YB 2F0FA 1PFNA 4RWSC 2Z4IA 2BOSA 1CZWA 4A76A 2EYOA 4PMBA 4KY6A 4DGZA 2FXQA 2C5CA 3T1HQ 2RHSB 1X3FA 4IQZA 5JEAH 4DUYQ 1HTLD 1RJTA 1V1PA 4MN3A 4A3MH 3RLFA 2QDLA 4AQYQ 5E1FA 3M4OH 3A8JE 2DJGC 2K5QA 3OW2A 3BYTB 1VQ6A 1Q7YC 1I4HA 3A8KE 1J8IA 2NVQB 2F0EA 1U4PA 5CV6A 4CGYB 1SAPA 2KHIA 1VQFA 2MFIA 1TS5A 4JBKA 3R2TA 3KJOA 4TQUS 4BY7B 2VS1A 4C3HH 1S72A 1HZCA 4A3JG 2B8GA 3V05A 4UAIA 3DUZA 4GN5A 1A0IA 2NZ1D 1N32L 1DOMA 4BS9A 3VR4A 1G51A 5CBEE 1LTRD 3HFZB 3CPFA 4JOIC 2O2LD 1K83H 4OWTB 2N78A 2R7ZH 4LJZC 5IYCH 4DR3Q 3CRKC 2OXPA 4DV2L 1YJWA 3HOZH 1EYDA 4K6LA 1NCVA 2SNSA 1ZXTA 1ENFA 1O78A 2HDMA 4JBWA 1CSPA 2UUAQ 4FXDA 4IPDA 1SR3A 4K14A 4XYQA 1WJJA 4QUFA 1XMOL 3HOYH 4LF4L 3K81C 3GTLH 4HCEA 2KJXA 3A0JA 1EYCA 2RQXA 2AQ2B 3OMGA 2JN4A 5EBDA 3IAYA 3D6CA 4JCVE 1KABA 3EBEA 3OHXC 5CR3A 1JJ2A 1YHBA 3STBD 4KJOA 1WTQA 3HGBA 4IUPA 1HH2P 4KN4C 5IE8A 1TS4A 4LF4Q 2ICIA 1PYWD 2B2UC 3J80i 4QF4A 1V43A 5LMNL 1PRTB 4A3EH 4LUZA 1WI5A 1LT6D 2OCEA 3J7A5 1W6KA 5EGTA 1E2WA 2F0DA 4KI0A 2JA6G 1NR4A 4R4OA 4A3EB 3CCMA 1VQDA 1TWCB 4R4IA 1JE5A 1EZ8A 5FKAC 1EIFA 1BOSA 4ZAIA 1X65A 4K5WA 1XMOQ 2AUJD 5EKKA 1WFQA 3KF6A 1GHJA 4BY7G 3GTQH 1TY0A 3UDFA 3VYSA 3A5ZB 3K0XA 2CWPA 3KDFA 2ZXOA 1ASZA 2G5DA 2Q2UA 5IYBG 5A2QL 2I5MX 4FO2A 3U4ZA 4DKAC 1HPCA 2QEXA 2QDBA 1TVXA 3MEHA 2XWJB 3MFYA 3NWTA 4M1UB 5D65A 1XXGA 1XMQL 1AZQA 4DK1A 1FVIA 1H9KA 2IW3A 3KFUA 2NUCA 4OO1G 1VQNA 2M2LA 4QCLA 3UI2A 3V96A 3J81i 2IX0A 2HIVA 1PTOF 1B53A 1EFID 2R6GA 5ELBA 1XJVA 1EOVA 3MXPA 4HJ8A 3HKSA 2HHHL 1NTGA 4JI7Q 1O80A 3ONAB 2DJFC 1C9OA 1BBWA 1EWCA 2Q8RE 5IWAL 5C44B 3F2BA 1K0RA 5AJ3Q 3M7NA 3MFGA 3FHWA 4LF6L 4EX5A 3NWSA 4NP5A 2K6AA 1D8LA 1HJPA 5IYCG 2Z9HA 1SNQA 3DEPA 1OTCA 4V0BA 4DN4M 3S1MB 1SRUA 1Q3LA 3CMAA 1ONLA 3E6ZX 1VCIA 1G8ZD 5COYA 1II3A 1HNZL 1HZBA 1RKNA 1FNWA 4HN7A 3HOZB 3S2DB 3M4OB 3IFDA 4DR2Q 4JI8L 1ILPA 2LS01 1E1TA 2A8VA 4RAUC 1YEZA 3FVQA 5EJWA 3GTOH 5EQ0A 1KHIA 2F0HA 4TVAB 4FP5D 2ZTDA 4IPHA 1SNCA 1VQKA 3I4NH 3FEWX 2F4VQ 2CW0D 1VQPA 4DV1Q 3L2PA 4DR6L 2K7VA 4DA2A 3X3MA 1KDAA 4A3IB 3D0FA 3CD6A 4G4KA 4JI2L 2JA7H 3PO3G 2ZT9C 4DUZQ 3KOJA 4B3TQ 1FJGL 5DEHA 2KECA 2CQAA 2JK8A 1HZ9A 3GTMH 4A3BH 1Z7TA 3MEFA 1XPOA 1I3QB 4P74A 2VQFQ 3MHBA 2Q2TA 3OTOQ 1WTVA 1B9MA 2I5HA 1B4OA 3T16A 1L1OC 3NE5B 4P75A 3CCUA 5IOCA 3K80C 1AP0A 3HOVG 1OO9B 4A3MB 4YHHQ 3A74A 1UNSA 4KK7A 1QUQA 1SE2A 3PO2B 1C4QA 3CF5A 4EVOA 3VDYA 1F2LA 2D0PA 4QL5A 3H0GH 5JJLA 2HD3A 3AEVA 4LF5L 3FKIB 1EFWA 4KKUA 4HIKA 1G6ZA 4HMJA 3NELA 5LMUQ 4JI0L 2NVXH 4A3BG 2EE1A 4XDXA 1LO5D 2EY2A 4B3RL 4X3UA 1WD1A 1N36L 2YTVA 4LWCA 1TIID 3BDCA 5KGUA 1Q8KA 1VQCA 4WJ4A 1MKHA 1X55A 1M8AA 1KXLA 2V4DA 2MPMA 5C3EB 1GUWA 4XIGS 1FNVA 4JI3Q 2JA5H 4EQNA 1S5BD 4TSSA 4GKKL 1VQAA 5GAHC 3MXNB 2ES2A 2Y0SB 2WACA 3ULLA 3CXCA 4JV5Q 4F7XA 4CKEA 2A69D 2F0MA 4C2MB 1E0BA 3N6RA 1J5EL 2FHTA 2DN8A 3K8AA 2HQLA 3U58A 4PZ8A 2WAQG 1GUNA 3JC66 1K9MC 1UEBA 1IL2A 5HGQA 2R7ZG 4HJ7A 3I55A 3KLSX 4L6TB 1STGA 4N8X1 5J3BA 4HJAA 2TSSA 1V1QA 2LFNA 3M4QA 3SGIA 3K59A 4OXPA 4CJ1B 1ML0D 3SK5A 4B3SQ 3UDIA 2NYZD 1MHWC 1EZ6A 1EEID 4JI2Q 5CMDA 1JJCB 1BUVT 1CA5A 2E74C 1OXVA 2R7ZB 2Q2HA 1X54A 2XNAC 1K8MA 4R9WA 3S1NB 1VQGA 1MGSA 4JOIA 5I9PA 1QZGA 1VMPA 2O5IC 3E9HA 1EUJA 1NAPA 3EA6A 2Z1CA 4ZUIA 3SDZA 1ET9A 3H3VC 1E2VA 4RGNA 4C3JB 1R9TH 3PGZA 3OW7A 1F77A 4JG2A 2EIFA 4GKJQ 4C3IB 1SE8A 3CCJA 2AWNA 3J81c 3HKZG 5J1ZA 1VQHA 2VY3A 5E3FA 2E5LQ 5C3EG 3F1ZA 2D62A 4XQJA 3D8GA 4HAEA 3TREA 1G6PA 3DLLA 3PF4A 4FF1A 5IGFA 2F1MA 3CRLC 4DV7Q 4Y7NH 5AJ3L 1EY7A 2JA8G 2EYMA 3VA5A 3CCRA 2EZVA 4B3RQ 5IP9G 1B3AA 5IT9E 5CBAE 1L1OA 3BDLA 4BBSB 4K5VA 3CCEA 4J6HA 2RCFA 2EPBA 2FJ2A 1HNXL 1Y8PB 3I4MH 1V1PB 1IBLL 4PMCA 1I94Q 2F0NA 2VZAA 4YCVA 3PCOB 4KTAA 4GNXA 3NUCA 4X62Q 1G91A 2VUMH 3K5OA 4HR7B 2D2CC 2PMZE 2A19A 1ET6A 4DAPA 4BBRH 1WTRA 1X3GA 1H9SB 3SK8A 1E24A 1VQEA 1Z6HA 2OEOA 2PNRC 3PIOA 2R3ZA 2MP1A 2XIWA 1H9SA 1UE5A 5A2QE 1V8QA 4K0KL 1BO0A 3FMCA 4ABNA 1NBWA 1L1OB 3VR3A 4OONA 1JORA 2I0QA 1ENAA 4BBRB 3CC4A 5FOBB 3R8BA 2RF4A 5ELDA 2OWOA 2QF7A 5FJ8H 2NVYB 4DK3C 3PQIA 3T13A 1KAWA 4X66L 3VYTA 2RCNA 4J1MA 1STAA 1TY2A 4PMWA 3HOWH 5CC4A 4EQPA 3IFTA 1XTDA 1VS0A 3K0YA 1AW7A 3A8IE 2F0PA 4CDDC 1VQ5A 4ILWA 4KHZA 1E3PA 2HIXA 1LTAD 5CV7A 2NTSA 2F4VL 2EOTA 1F9QA 1ZYRD 3MTSA 5M3MG 3BVGA 3RZOB 4POGA 1AE3A 5C44G 3LNNA 1HNWQ 4R4TA 4KHVA 3SE0A 2A69C 1ENCA 4IFDG 1QNUA 4LFAQ 3V2TA 2NVTB 4IUNA 2VL6A 3S1MH 5E7NA 3ULJA 1N33L 2IHEA 5IYDH 1EIHA 4JI8Q 1K0SA 1Q12A 1OXTA 1A6XA 5FLXc 4A93B 1N8RC 2E2IH 4DNRB 1X3EA 1AFPA 1HNZQ 3MXUA 1PVOA 4J8QA 1WYDA 3PIO3 1KRSA 3J81E 4C1NK 1BKBA 4C56C 3AFPA 4LFBQ 4A3DG 5IT9L 3KYHC 2F0WA 5T1GA 2NZHA 2N3SA 4RHSA 3I4NB 4RGOS 1YBYA 3PUXA 3WWVA 2JA9A 4CHTB 4JI7L 1D2BA 1TS3A 2EJFC 1N34Q 3ND9A 1YHQA 2PI2E 2E76C 2UXDL 1NE3A 3KBXA 2K52A 3UE0A 2OT2A 5J22A 3BYYB 1A3TA 1VQ9A 1B2TA 2UUBQ 1QB5D 1NUCA 1RTNA 2EYHA 3K7AB 1KAAA 3EVQA 1YZ6A 2UUCQ 3S14H 2MJ8A 4ZRZA 1Q8IA 4A75A 2ZTCA 2ALYB 2XN9C 4C3HB 3TBIB 3K7AH 3FP9A 1IBML 1DCZA 2I07B 3S14B 4NW2A 2ENBA 3E0JA 2A6EC 3HS0C 1A63A 3T1HL 2WAQB 1Y8OB 1HHVA 3G6EA 1EY4A 3K6OA 3AFQA 5ELNA 2KCNA 3C3LA 3EROA 1SYGA 3R93A 5C4ZA 1I6HB 4UHVA 3T53B 4A3CH 3PUVA 1FGBD 1N33Q 4N9PA 2KOLA 4DAMA 2RA4A 2WINB 2VUMG 1I5FA 1LTBD 3MA2B 4PQXA 3IRBA 3M4PA 1N9WA 4BWGB 1SNOA 1Z47A 1SMYC 5GQOA 3HOYB 3J80E 1L0YB 1A62A 3KF8A 1EU3A 3CQZH 3H09A 5IT9c 1QILA 5NUCA 1BCPD 3SR1A 2YV5A 5I6YA 3S2HH 2Z6KC 3GTPB 1X6OA 2RVLA 3ERSX 2LY7A 1U4LA 2F0LA 1KDCA 3OIPA 4G57A 1DM0B 2F52A 4AYBB 1STHA 1PYSB 3W5OA 5FLXL 2R92B 1A2TA 1CM9A 2UUAL 1K73C 3I3CA 4A93H 3G71A 3QOJA 1VQLA 4IFDI 5C3XA 3HOXG 3K5MA 1IL8A 2PYKA 5KNDA 3T51B 2HCIA 3S1QH 5GADC 1WTHA 5BR8L 2BE5C 2LKVA 4X62L 4G7ZC 1EWIA 3A7LA 1Y1WB 5T1IA 1SFOH 5E4WC 1E1OA 4H7BA 2NN6H 1JWMD 1DXMA 4GN3B 3HOVB 5J39A 4H13C 1CTMA 5D3DA 4FF2A 3BVZA 2PW7A 2XRSD 3BS1A 4Q0FA 1STYA 3DWAA 1CA6A 2L12A 1LTID 2ICEC 4DV6L 5C0XH 2IL8A 2DY8A 3KLRA 3JAML 1R4PB 4A3DH 1UE7A 4R8NA 3AU7A 4N8FA 3RR5A 4DV3L 1I94L 4DV7L 1D5XC 3H91A 3S15H 1CHPD 1J9OA 4C3HG 2VXWA 3CCSA 3EJIA 1LT3D 1YNND 3P7JA 1S3OA 4TRDA 2L4NA 3M85A 2H4OA 3NENA 4LFCQ 3OWFA 5IYBH 1BF4A 5JPMC 1ESFA 1FD7D 1FGUA 2DUDA 1I4XA 2NBFA 3PMFA 4K8JA 2K50A 5JJKA 2B2UA 1NJIC 3TRZA 3J81j 1D7QA 1IYVA 1JOKA 4H0LC 2EJMA 3DHQA 3UE1A 2JXMB 1DGSA 4X65Q 1EY5A 4LW1A 5DAUA 4CKCA 2F0IA 2ZM6L 3PIPA 4CJ0B 2F0UA 4PNYA 1SXTA 4P73A 4S3SA 4I65A 4JBMA 4UPAA 5DNFA 4CDCC 4JI5L 5C4JH 1DJRD 1I50B 2M9VA 4BXXH 3W1BA 1SNDA 1TXYA 2UXCQ 1Y1VH 1O7LA 2X69A 4YIJA 4BBSG 4DR1L 1T9HA 1D5ZC 4IFDJ 2KCMA 2EYJA 4M8AA 3CAMA 4OO1I 1Y8NB 2JSOA 1F2ZA 4KD4A 3J7YW 4JI6Q 2NTTA 1Y14B 3KF8B 3CC7A 4KMUC 4PZ7A 4A3FH 3SK6A 2QW7A 5ELCA 3TQYA 4JI6L 1PH1A 4G7HC 1PV4A 2RDFA 4IOAA 1K3BC 3VR5A 1V1OA 2HUGA 3MXNA 3GTKH 4EGVA 4RKLA 5ELEA 2NZOA 4MHEA 3Q0AA 5C0XJ 1CKOA 3P20A 1GD7A 3I7FA 2IX1A 5G3LD 4LMQD 1SROA 5JVH3 1BCPC 5I2YA 1GUGA 4GLAC 5K36H 1CHQD 1EY0A 3MAQA 3M9BA 1T5XD 4DAVA 1LT5D 1ICWA 5TSSA 2N88A 2Y0SE 1T5EA 3A56A 1HUMA 4BY7H 1N36Q 2A68C 3MC0B 2BDOA 4FF4A 3TS0A 2D0OA 4A3CG 1CUKA 4LFCL 3RN2A 1VF7A 1WCMH 3I72A 4LF5Q 5HGTA 3GDEA 1VQIA 1JMCA 1G2SA 3ULPA 1CI3M 3HKZE 2WB1B 5JEAJ 2ZTEA 3PO3B 4DR4L 5ELFA 2FMCA 1F9RA 3GTMB 3VA7A 2BCOA 1WTXA 2F03A 2SNMA 1C8CA 1JCKB 4UP7A 3S1QB 1I3QH 4R4CA 5IP7H 2JA5B 3TP6A 2L11A 3KLWA 5CV5A 1CQVA 2L15A 4GS3A 1Y1WH 5JAVA 4BBRG 4FXGC 1SE4A 2ZXPA 3WOFA 4JI1Q 5M9OA 3M4YA 3QOLA 3DM3A 3VYUA 2JA6H 2E2DC 2F0VA 3GTGB 1GVPA 4DR5Q 2KCTA 4XXEA 2B2YA 3U50C 3TP5A 3R3OA 3AMUA 3JAME 1HUNA 5M3FH 1EQTA 1XWEA 4KKSA 1PH3A 4LNQA 4HJ5A 4NXNQ 3H0GB 3C1EA 4B3TL 1SLJA 2EQSA 2ZXRA 2E2IB 2A74C 4NPSA 4IO9A 2EY5A 5M3FB 3T1YQ 1GOZA 2H5XA 4TKOB 1RL2A 3TZDA 5M5YH 1PTOH 3QR8A 1YITA 4OX9L 2SOBA 2CKZB 2F0SA 2KEDA 4A3BB 3D31A 4OIKA 4DAYA 1NR2A 3MXGA 4UP9A 2B29A 1WOCA 2DY7A 4L8JA 2A6ED 5C4XG 4FVMA 1XYIA 1PHJA 1BCPB 3F2UA 4OGQC 5C3EH 4JI5Q 1DOKA 2AUKA 1KRTA 3GTQB 4BA2I 2MQHA 3J7AF 4DV1L 2IHFA 1ZKOA 3Q8DA 3QJYA 4YCWA 5EKLA 1UE6A 2K32A 4MZ9A 1O7ZA 4X65L 3DMUA 1EIGA 2KHJA 4L63B 1HR0Q 5M5WB 5IGEA 2KBNA 1CT1D 2K4KA 2KVMA 3OOCA 2VUMB 3HOUG 4IN3A 5I6WA 5KNCA 3JAMi 3QG1A 1JOOA 1S40A 3UDXA 3GTLB 2O4XA 5M5WH 2CQOA 2NWGA 3T4AC 2EDGA 4RCNA 1A2UA 3TN2A 4GOPA 3T56B 1PFBA 1PH2A 1VQBA 3MZ5A 1QUQB 3BZKA 3QO2A 4UY8C 4P71A 1HZAA 1SE3A 3HZXA 3S9WA 2K03A 1V9PA 1GO3E 2VQEQ 3AB9A 4A3MG 3TDQA 2Q8IB 2UUCL 1LUZA 3DWPA 2HHHQ 2KENA 3HEJA 1ZEQX 1QG7A 5IP7G 4A3KH 5M3FG 4NMZA 4QIWB 1EYAA 4KY7A 2R61A 2B2WA 1XMQQ 2CW0C 4GZYC 2PQEA 4QY7A 2G9HD 1H9JA 2F4IA 5BR8Q 1E22A 1O7YA 2EYFA 4NB3A 3L7ZC 1I4QA 4B08A 2YTXA 4X3SA 3HKZB 4B3ML 1S5CD 1EQRA 1A15A 1SDFA 2R93B 5C6AA 1W6JA 1PZID 4LFBL 5C3WA 4IFDH 4A3FB 3P1HA 1E7ZA 2Z0SA 1QOHA 2Z8LA 2PZUA 1HFGA 4YCUA 2MNAA 1GUTA 2XRQD 1S5FD 4POFA 2N49A 4Y7NB 1YI2A 3HOYG 2RDHA 4A3KG 3HG9A 4RA8A 3SVMA 4LFAL 4QB4A 1YJ9A 3HOUH 3E9IA 1HCZA 3HRZC 1FL0A 3AYHB 4QJFA 1TQOA 2R92G 1J6QA 3FKIG 3M3YH 1BNZA 2MO1A 3A54A 3N52A 4DR7Q 1K8OA 2MHVA 4ZLTF 1AEXA 5C4JB 3I56A 1HQMC 1SEBD 2RHQB 4DF7A 3NTHA 5DM73 1B1ZA 2IY5B 5KRUA 2L1BA 4GNXC 1WTWA 2NN6I 1X3PA 2OQ0A 3ERQA 1WTOA 1PA6A 1MJEA 5LL6S 1AH9A 3K57A 4ODGA 4K8IA 4DR3L 4O0AA 2X6GA 3CKIB 1QVGA 3ND8A 1KDBA 4DV0Q 2NVYH 3RD4A 2AHOB 1GHKA 1NMFA 4FXKC 2UUBL 1SYBA 4K6DA 3D4WA 4OO1H 5I4DA 4P72A 2B63H 2CWAA 2L55A 2K14A 4F88A 3S17B 1BBUA 3C1FA 3I4LA 4K2KA 5CGKA 2QKIC 4CJ2C 2FINB 1IBLQ 3P75A 2WB1G 5CV8A 1PYBA 1L0WA 3WDNA 2WAQE 3I4OA 1HNXQ 3PO2H 4RCOA 5HY6A 5LHY1 3SXHA 1VDZA 4DV4L 4YWMA 2PQAA 1YNJD 2WIIB 4HJ9A 1JE4A 1SYEA 3GV3A 3L9AX 1KNEA 3U9OA 2VQEL 4ME3A 3KJPA 3OYYA 1Q1BA 1TWAB 4IPGA 4H44C 4KN7C 4O42A 4XTCS 1NNXA 2JJQA 3WOEA 1TS2A 1MBYA 1OXUA 1X32A 5C4XH 1IYUA 2A6HD 3D4RA 4QIWE 3H3VH 5JOBA 2QILA 3RLOA 1HXYD 3HOWB 1EWHA 1PRTF 2GVAA 2YYZA 2QA4A 1KL9A 3EIVA 3CCLA 3I4NG 1RODA 1YHAA 4GKJL 3PUWA 1K8GA 3GD7A 5EPKA 1CKMA 2NVXB 5K5PA 4F8MA 1HR0L 1KLGD 1LTLA 3RZDH 4C3JG 3BG3A 1XTCD 3BJUA 1NY4A 1S5ED 3G6JB 1XNRQ 2E2HH 4JPBW 1TWCH 1WVLA 1D5MC 3LWUA 1I6VC 4OL7A 2KQ3A 3S2HB 4AIMA 1S4ZA 1OXXK 4OWWB 3NXWA 1LABA 5EPJA 2HDLA 3IKJA 3GTGH 2LMCB 2JEBI 1LYLA 1FR3A 2KA7A 4A3JB 2SDFA 2B3GA 3S16B 4C1NI 2OF1A 4MTKA 1BVSA 1UAPA 4A3GB 3KLSA 3I91A 4K0KQ 2JA8B 2AWOA 1BQQT 4PG3A 2X6LA 1SMYD 2QGQA 2G9DA 1VQMA 2CFMA 4NKLA 4NXML 2AKWB 4JYAQ 1BR9A 3PV0A 3S16H 1CKNB 4A3LH 1M4VA 3BZDB 3CC2A 2EYLA 5K36G 1PTOB 2CHBD 1IZ6A 2JQOA 4XT1B 3E3XA 1TKWB 3I90A 4OELB 4OIJA 4Q5VA 1OXSC 1I6HH 2YTYA 5FK9C 4LF8Q 2B2VC 1AE2A 4DR5L 3I70A 2NVTH 1GUSA 2B2TC 2K5NA 3CW2C 2CCZA 4BY1B 4BA1I 1RF2D 3FDTA 2WKCA 3OSOA 4RKBA 4DNTB 3CMEA 1GXDC 4OHJA 1DZ1A 1YVCA 3FPUB 4IUTA 3GTOB 4C3IH 4X3KA 1STNA 4A3DB 4G7OC 1PH8A 1JQYD 3H15A 1JOQA 4DR4Q 3Q22A 4HMIA 1HA5A 1PTOD 5JVG3 1TT2A 3ZYYX 3G4SA 1XX8A 2K5HA 4LF9Q 2NN6G 4X64L 2NVQH 4HIOA 3D3RA 2UU9L 1F2YA 1EY9A 4DNIA 2K1BA 1GJXA 4CDFC 5FLXE 2E5LL 1EQQA 2JA8H 1WCMG 1RIPA 4KKTA 5M5YB 5C0XG 1RHPA 3OPOA 2KEEA 1MSHA 5EKIA 4JW0A 2K04A 2JA5G 4RMFA 1IBKL 4O1NA 1XPRA 1KNAA 4L5SA 2RKSA 1Z9FA 1LTSD 1TU2B 1Y1WG 3DEOA 3BVMA 3H94A 2B2YC 5BN5A 3K7UC 3GQBA 4RFBA 3I4MB 4Z9CB 3G7LA 4ULLA 4X6AH 3GO5A 1KC8C 2K33A 3I2ZA 4JK1C 3R2IA 1X56A 4A3IG 2ZJRA 1TWHH 2IX3A 3HOXH 3F2CA 1SYFA 1RTOA 1DONA 1TWGB 2EYPA 5DM63 4UDUC 2HQEA 3C2PA 1TWFH 3NQTA 4FDBA 2IT1A 5GAGC 4GLXA 4KHPQ 1HA6A 2Q8TA 4K2LA 5IGDA 1K3RA 1H9MA 4X3TA 1NSNS 3JAMc 5D3IB 2O5JC 5IODA 1VQ4A 1JJGA 5H1SE 5D14A 2K5VA 1PRTC 4KV6A 4E6IA 4KY5A 2PO4A 3SEBA 2GVBA 1A8VA 1YNNC 4DR1Q 3BU2A 1ICFB 3GTKB 5C4HA 1Q81C 2R93G 3LX0A 1LLRD 5CYUA 1EL0A 3EFXD 4DK0A 1PDQA 2JE6I 4RH6A 4HEDA 1QZHA 4JI4Q 1XPUA 4DK6C 4JI3L 3RZDB 4B9XA 4AYBG 1LACA 3GTPH 4YY3L 5L37A 4X64Q 4LF9L 4EQOA 2E2HB 1JC7A 2ATWA 2PPBC 4HCSA 2IJ0A 1CSQA 1G2TA 2K5WA 4DV3Q 1G291 2QEJC 5KYLA 2XGTA 2LXJA 4U673 4NDXA 3CCQA 5FLMH 5CORA 1Q1EA 2PMZB 1CFMA 5M5XB 1C7YA 1CK1A 2EJGC 1HTPA 5G3LF 4C2MH 2JYOA 4DV6Q 3NHHA 4JI0Q 2BDNA 4DV4Q 4ALPA 4JVZA 1WCMB 1WTPA 1BCPF 4ZUJA 5KYIA 4L5RC 1KQSA 3X3NA 4R1JA 1DD2A 2EVBA 1ILQA 1SFOB 1UEAB 4MNOA 4UP8A 1QWYA 2AQ1B 1U4RA 3E0EA 4A3EG 3PO2G 2K75A 2B2VA 3I73A 3KK7A 4HSVA 2Z6KA 4RG1A 1PTOC 1FNUA 5EAYA 4DV0L 3BDOA 1X3QA 1Y69U 4OEMB 2B63B 3NTKA 1Y1VB 3E5SA 3QB3A 3C46A 4GOPB 1PFSA 1ASYA 1W2BA 1FYCA 1ESRA 2F3VA 2A73B 1RD9D 5IGBA 3NPPA 3M3YB 3L0OA 3GP7A 2A1AA 3TP8A 1RCVD 3VYRA 4QMGA 3RN5A 3D4DA 4ZYSA 5LL6X 4DUZL 2N8NA 1I4PA 3TP7A 1A3UA 2PW5A 2L5TA 1JWUD 1VQ8A 2XSCA 3CCVA 2V1CC 1MI2A 1XNRL 1TWGH 2H1EA 3PUYA 5IYDG 3GTJB 5E4XA 3CU7A 4WFN3 3FKIH 2DNCA 1XNQL 1LV9A 2ASBA 2WB1E 4DR2L 3Q6SA 1D1IA 2K05A 2TMPA 1B70B 3PUZA 2A6HC 3Q24A 1IW7C 5EPLA 2L0CA 5I9OA 4QQBX 3NEMA 1YNJC 1QVCA 1LM0A 1W3SA 3CPWA 2PZTA 3ER0A 1IW7D 3IL8A 2BA0A 1JB3A 4LF6Q 3KF6B 2C9OA 2UXBQ 2VW9A 4DV2Q 2RDGA 3F8TA 4GOPC 1STEA 5IWAQ 2D5DA 4BY1G 1EY6A 3S1RB 1B3QA 4AYBE 1X9NA 4QUCA 3QIAA 1M90C 4DAYB 5EBCA 2B2TA 1M1KC 2J0TD 1GUOA 2EXDA 3L3OC 1YJNA 2R93H 1BDOA 3H0GG 3KUPA 4LUOA 1PFMA 2RSOA 3LWEA 1JICA 1IKLA 1CQFA 1IBMQ 4BXXG 1I4RA 1U0LA 3MVVA 4IUUA 2Z6BA 2F3IA 1Y1VG 1N34L 3J81L 1EY8A 3I8ZA 1D6EC 2R92H 2PNHA 2ZJPA 2BH2A 1U4MA 2F0QA 2MO0A 4IPCA 2M00A 4DPGA 5BN3A 3KBGA 4OWXB 1AN8A 3NBHB 3OWEB 3PIP3 4ZKCB 2YU9B 2EXZA 3K5NA 4GLVB 3SK4A 3HOWG 5JJZA 4JBJA 4AQYL 2UXDQ 1O7IA 5LMNW 4BBSH 2F0OA 4O2DA 2ZJQA 4ZKBB 4XYOA 3DWQA 2E75C 1QE6A 2YU9H 1C48A 1EU4A 2JA7G 5ISRA 5DLQE 3D6WA 3HOVH 1VQ7A 1B44D 4ME5A 5KNBA 2I5LX 1A3VA 4DR7L 1HFNA 3S2DH 2UXBL 5FO7B 1XNQQ 1PZKD 4WORA 3KDFB 4YWKA 2XWBB 5LMNQ 1BBXC 4A4IA 3EN2A 1SYDA 3LGJA 3OMCA 3J7ZC 2QCPX 3BZCA 5KIXA 2LXKA 4A3IH 1S5DD 3G48A 4L5TA 4P2CB 4RHRA 1PMRA 4QGUA 1PH6A 4WJWA 2CH4A 2JA6B 3GV6A 4FNFA 3Q23A 2F0GA 3U4VA 4FYDA 5F2DA 1HNWL 2E8GA 1SSOA 1I50H 1MSGA 3S24A 5IIFA 4OX9Q 2OTLA 3STBC 1JT8A 4CBVA 5I2XA 1SN8A 5IY0A 4B3MQ 2R7FA 1PH4A 2IWHA 3URYA 2PZWA 5C0XI 2BA1A 4LUVA 4IUQA 1MD2D 4DXGA 2EY1A 4X66Q 1ZYRC 1TWAH 1PH9A 4RGMA 4EQ5A 1GKHA 1N32Q 5M5XH 1K8AC 2J7ZA 1P16A 5IGGA 3A5UA 4APVA 3H3VI 1KD1C 4DXFA 4XQNA 1K28A 3S1RH 1BXTA 2R7DA 4KJNA 3VR2A 4JI1L 2CVRA 4IJHA 1SJED 2BE5D 3PO3H 5GROA 4L5QA 2SEBD 2KCCA 2ID0A 4IURA 2JA7B 3F2DA 1EYGA 5M3MH 3NBHA 4PV1C 2NB0A 2HT1A 2JEAI 1LT4D 3HOZG 3OIQA 4HTHA 5BN4A 4A3KB 2KUMA 3S17H 1PLFA 4B9WA 1EEFD 4I7ZC 4GNXB 1PZJD 4DUYL 1KTKA 1IXRA 3ICEA 2WKDA 2D9UA 1STBA 1Q82C 1WD0A 1F9PA 1VMCA 4JI4L 2AQ3B 1MIUA 1IYJB 4V190 4R8IA 3RNUA 3PF5A 1R4QB 2RSNA 1CKNA 1B8AA 4ZQ3A 1IHZA 2Q2IA 5IP9H 1P8LA 1D1KA 5FLMG 4XQQA 2DGYA 1YNXA 4YY3Q 5JJIA 1MJCA 1SYCA 5C4XB 2BH8A 4I7AA 2P5ZX 2PCFB 3GTJH 4IOCA 1L0XB 1JB7A 3J7AV 2RBMA 4KHPL 3K5LA 4K5XA 4R4QA 3PSIA 5KEEA 1JR0D 3MWYW 5AFWA 1PRTD 2KHSA 1I4GA 2FFKB 4DV5L 1AZPA 4BY1H 4LK1C 1RDPD 3VR6A 3RUZA 4CDEC 4ID6A 4HIMA 3T1YL 5FO8B 1YIJA 5FO9B 3HP3A 4JC0A 4IUVA 3S1NH 1DYQA 2AMCB 3S15B 1EQVA 4NXNL 3NSWA 4U68A 1PXUA 2LSSA 4B3SL 1UE1A 2CH4W 3TZUA 1UUPA 4A3FG 4XT3B 3RLNA 2PQAB 1J5EQ 1IBKQ 4MIUA 5C5MA 4DU9A 2XVSA 4C3JH 1R9TB 2F0TA 2B63G 3NTIA 3B6YA 2UXCL 3DM1A 2B39A 3TSSA 5A35A 4KD3A 4GKKQ 1LTGD 3NQIA 4HSPA 3W1GA 3AQQA 3W3AA 1SNPA 4LF7Q 2VB2X 4GN4B 4MTNA 5C44H 4HIDA 2ZM6Q 3DXJC 2UU9Q 4IZ8A 1HQRD 2B2WC 3ITPA 2FMMA 3CHBD 1VF5C 5JPNC 1GM5A 3J80c 3I4MG 2XTIA 1LTTD 1HR0W 2K5DA 3NP8A 3TS2A 2PI2A 4JV5L 3RMHA 3HOUB 2GN5A 2WV6D 1KIXA 1QJOA 1KLUD 4IJLA 4RGTA 3W2DA 4WJ3M 5C5LA 1B9NA 5GAEC 3A7AB 4YWLA 3NBIA 3TEHB 2HCCA 5M3MB 1L2FA 3M7GA 1TR5A 5IGCA 2VB3X 4WRDA 3SHLA 5FJ8G 1H95A 1Q86C 4LF8L 4F87A 4A93G 2E2JB 1IKMA 5JEAG 1VQJA 1EIYB 1TWFB 2F0KA 2B8FA 3CQZB 4A3JH 2F0JA 1QVFA 4H02A 4LF7L 2E2JH 4LAAA 2Y0SG 4JYAL 4Y52H 4N9TA 4NXMQ 1UWVA 5LMUL 4A3GG 2MGSA 2A5HA 4C3IG 1DOLA 4AH6A 1SBBB 1H9RA 1Q90A 3J80L 2VQFL 4J15A 1SNMA 1F9SA 3K58A 2DNEA 4ZK9B 3ZJYC
chains in the Genus database with same CATH topology
4YY3L 3TREA 1PH3A 4X64Q 1G6PA 4LF9L 4LNQA 4HJ5A 3UDGA 4NXNQ 3DLLA 4B3TL 1SLJA 2ATWA 2EQSA 3PF4A 4YHHL 3CP0A 2VNUD 1CSQA 4NPSA 4IO9A 1C0AA 4DV7Q 3T1YQ 2H5XA 1NMGA 4Y7NH 5AJ3L 1G291 4DV3Q 4DR6Q 2XGTA 2LXJA 1RL2A 2JA8G 5M5YH 3CCRA 1YITA 3CCQA 5FLMH 4DV5Q 1Q1EA 4KLKA 4OX9L 4B3RQ 2CKZB 3OTOL 2WFWA 5IP9G 1C7YA 4A3LG 3D31A 1L1OA 4C2MH 3RZOH 4DV6Q 3CCEA 1SMXA 4JI0Q 4DV4Q 2WP8J 4ALPA 4L5RC 4UP9A 1PH7A 1KQSA 1HNXL 2B29A 4A3GH 1WOCA 5C4XG 4R1JA 1FJGQ 1Q46A 3I4MH 1IBLL 1PHJA 5C3EH 4JI5Q 4MNOA 1KRTA 4BA2I 4UP8A 1I94Q 2MQHA 3E0EA 4A3EG 2OQKA 2VZAA 4YCVA 4DV1L 3PO2G 2K75A 2IHFA 4PZ6A 2C35B 3PCOB 3Q8DA 4GNXA 1PH5A 4YCWA 5ELOA 4X62Q 1UE6A 2Z6KA 2VUMH 4MZ9A 4RG1A 4X65L 1VQOA 1U5KA 5EAYA 2PMZE 2OTJA 2A19A 4DV0L 2KHJA 1HR0Q 4BBRH 1X3GA 2KBNA 1B7YB 1E24A 1VQEA 2K4KA 3PIOA 3HOUG 1UE5A 4K0KL 4A76A 3JAMi 1NBWA 1L1OB 4OONA 1S40A 3UDXA 2I0QA 4GOPB 5M5WH 1PFSA 3CC4A 1ASYA 1W2BA 2CQOA 2RF4A 2OWOA 5FJ8H 2FXQA 4GOPA 1PH2A 4DK3C 3T1HQ 3L0OA 1VQBA 2RHSB 1KAWA 2A1AA 4X66L 2RCNA 1X3FA 4DUYQ 1QUQB 3BZKA 4PMWA 3HOWH 4A3MH 3RN5A 3RLFA 4DUZL 4UY8C 4AQYQ 1XTDA 2N8NA 1VS0A 4P71A 3M4OH 1HZAA 1VQ5A 3OW2A 1V9PA 1VQ6A 4KHZA 1E3PA 1GO3E 1Q7YC 1VQ8A 2VQEQ 4A3MG 2HIXA 2F4VL 3CCVA 2V1CC 2UUCL 1XNRL 1TWGH 3PUYA 1LUZA 5IYDG 5M3MG 4POGA 1AE3A 5C44G 2HHHQ 1HNWQ 2KENA 4R4TA 2KHIA 4IFDG 4LFAQ 3FKIH 1VQFA 2MFIA 2VL6A 4JBKA 3S1MH 3KJOA 4TQUS 5E7NA 3ULJA 1XNQL 1N33L 2IHEA 2VS1A 4C3HH 1HZCA 4JI8Q 5IP7G 2WB1E 1Q12A 4DR2L 4A3JG 4A3KH 1S72A 2ASBA 1OXTA 5FLXc 5M3FG 1B70B 4GN5A 3PUZA 1N8RC 2E2IH 1A0IA 1X3EA 1XMQQ 1HNZQ 1N32L 1PVOA 4QQBX 1G51A 1WYDA 4QY7A 3NEMA 3HFZB 3CPFA 1QVCA 1KRSA 1LM0A 1W3SA 1BKBA 4JOIC 1K83H 3AFPA 4OWTB 2N78A 5BR8Q 3CPWA 3ER0A 4LFBQ 1E22A 2R7ZH 4NB3A 4A3DG 2BA0A 3KYHC 5IYCH 4LF6Q 3L7ZC 3KF6B 2YTXA 2NZHA 4DR3Q 4DV2L 2UXBQ 2N3SA 1YJWA 4B3ML 2VW9A 4DV2Q 1EQRA 3F8TA 4GOPC 3HOZH 1YBYA 5IWAQ 4JBWA 3PUXA 1CSPA 4BY1G 2UUAQ 3WWVA 2JA9A 4AYBE 1X9NA 4LFBL 4IPDA 4JI7L 1SR3A 1M90C 1WJJA 1XMOL 3HOYH 4DAYB 4LF4L 3K81C 3GTLH 1M1KC 1E7ZA 2Z0SA 4YCUA 2EXDA 1N34Q 1YJNA 3A0JA 2R93H 2MNAA 3H0GG 4LUOA 1YHQA 2PI2E 4JCVE 2N49A 4POFA 1YI2A 3HOYG 1IBMQ 2UXDL 1NE3A 4A3KG 2K52A 3UE0A 4BXXG 3EBEA 1U0LA 1JJ2A 2F3IA 1Y1VG 1YHBA 3STBD 1N34L 1VQ9A 1HH2P 4LFAL 5IE8A 2R92H 2PNHA 2ZJPA 2UUBQ 1YJ9A 4LF4Q 2BH2A 3J80i 1V43A 1YZ6A 5LMNL 3HOUH 2MO0A 3E9IA 4IPCA 2UUCQ 5IYDH 4DPGA 4A3EH 3S14H 4LUZA 1WI5A 1FL0A 3AYHB 4QJFA 2OCEA 2R92G 1J6QA 3FKIG 4OWXB 3M3YH 3NBHB 3J7A5 2MO1A 4DR7Q 4A75A 2ZTCA 4GLVB 2ALYB 3K7AH 3HOWG 3FP9A 4KI0A 4JBJA 4AQYL 1IBML 2JA6G 1O7IA 5LMNW 2UXDQ 4BBSH 3I56A 4R4OA 4O2DA 3CCMA 1VQDA 2ZJQA 2RHQB 4R4IA 1A63A 1JE5A 3T1HL 2YU9H 1EIFA 2JA7G 3G6EA 5DLQE 1X65A 3AFQA 5ELNA 1XMOQ 2IY5B 3HOVH 4GNXC 1WFQA 3KF6A 1VQ7A 2NN6I 3GTQH 4BY7G 2OQ0A 3UDFA 1PA6A 1MJEA 2I5LX 3A5ZB 1AH9A 4DR7L 4A3CH 3PUVA 3K0XA 2CWPA 1N33Q 3S2DH 3KDFA 2UXBL 1XNQQ 4DR3L 1ASZA 4O0AA 4DAMA 2Q2UA 5IYBG 1QVGA 3KDFB 4YWKA 4DV0Q 5LMNQ 1I5FA 2VUMG 2NVYH 4A4IA 2AHOB 3IRBA 3M4PA 2I5MX 1N9WA 1NMFA 3U4ZA 4DKAC 2UUBL 3EN2A 2QEXA 1Z47A 5GQOA 3LGJA 1A62A 4P72A 2B63H 2CWAA 3J7ZC 3CQZH 2K14A 5IT9c 1BBUA 1XMQL 3BZCA 1IBLQ 1FVIA 2YV5A 3KFUA 2LXKA 2WB1G 1PYBA 1L0WA 4A3IH 3S2HH 2Z6KC 3G48A 1X6OA 3ERSX 4L5TA 1VQNA 2WAQE 4OO1G 3I4OA 1HNXQ 1PH6A 4QGUA 3J81i 3PO2H 2IX0A 2HIVA 5HY6A 2F52A 4DV4L 1XJVA 2R6GA 4YWMA 2PQAA 3U4VA 1EOVA 4HJ8A 4HJ9A 3HKSA 1PYSB 2HHHL 1HNWL 1NTGA 3W5OA 4JI7Q 2E8GA 1I50H 1C9OA 3S24A 1BBWA 2UUAL 4OX9Q 2OTLA 1K73C 3STBC 1JT8A 5IWAL 3F2BA 2VQEL 4ME3A 4A93H 1SN8A 5IY0A 1K0RA 3KJPA 3G71A 2R7FA 3OYYA 1Q1BA 4IPGA 5AJ3Q 1PH4A 1VQLA 4B3MQ 3M7NA 4IFDI 3FHWA 3HOXG 4LF6L 4EX5A 4XTCS 1D8LA 1HJPA 2JJQA 5IYCG 5C0XI 3S1QH 1OTCA 2BA1A 4LUVA 5BR8L 5GADC 4X62L 1OXUA 4X66Q 5C4XH 1SRUA 3CMAA 1TWAH 1EWIA 1VCIA 1PH9A 4EQ5A 1SFOH 1GKHA 1HNZL 4QIWE 5M5XH 1E1OA 1K8AC 3RLOA 3H3VH 1N32Q 1P16A 1HZBA 4GN3B 4APVA 3A5UA 2GVAA 2YYZA 2QA4A 1KL9A 3H3VI 3EIVA 1KD1C 3CCLA 3I4NG 4DR2Q 4JI8L 1YHAA 3S1RH 3PUWA 2R7DA 4GKJL 1K8GA 3GD7A 1CKMA 1E1TA 4JI1L 4IJHA 2A8VA 1HR0L 4DV6L 1YEZA 3GTOH 3PO3H 1LTLA 5GROA 3RZDH 1KHIA 4L5QA 4TVAB 2ID0A 4A3DH 1UE7A 3BJUA 2ZTDA 4IPHA 1NY4A 3F2DA 1EYGA 5M3MH 1VQKA 1XNRQ 2E2HH 3I4NH 1TWCH 2F4VQ 1VQPA 3RR5A 4DV1Q 3L2PA 4DR6L 4DV3L 1I94L 2HT1A 2JEAI 3S17H 4DV7L 3HOZG 4AIMA 3D0FA 3S15H 3CD6A 4JI2L 1OXXK 4OWWB 2JA7H 4B3TQ 4DUZQ 3KOJA 3CCSA 4GNXB 1FJGL 3PO3G 4DUYL 1IXRA 1HZ9A 2JK8A 1S3OA 3GTGH 3GTMH 3ICEA 1Q82C 4A3BH 2JEBI 1LYLA 3M85A 3MEFA 3NENA 1XPOA 4JI4L 4LFCQ 5IYBH 1MIUA 1IYJB 4P74A 1FGUA 2DUDA 2VQFQ 2B3GA 5JJKA 2K50A 2Q2TA 3OTOQ 1BVSA 4K0KQ 1NJIC 3TRZA 2I5HA 3RNUA 2AWOA 1L1OC 4PG3A 3J81j 3PF5A 4P75A 2QGQA 3CCUA 1CKNA 1B8AA 1D7QA 3K80C 1VQMA 2CFMA 3HOVG 4NXML 2AKWB 4JYAQ 3PV0A 4YHHQ 3S16H 1CKNB 2Q2IA 5IP9H 4A3LH 3UE1A 1DGSA 3A74A 1P8LA 4X65Q 5FLMG 4LW1A 3CC2A 1QUQA 5K36G 2DGYA 1YNXA 4YY3Q 3PIPA 2ZM6L 1IZ6A 5JJIA 2JQOA 3CF5A 4P73A 1MJCA 4JBMA 2BH8A 4UPAA 1I6HH 3GTJH 3VDYA 4JI5L 1OXSC 5C4JH 2YTYA 2D0PA 4LF8Q 4QL5A 1AE2A 3H0GH 4IOCA 1JB7A 4KHPL 4DR5L 5JJLA 4BXXH 3AEVA 3W1BA 4LF5L 2NVTH 1TXYA 2UXCQ 1EFWA 4HIKA 1Y1VH 2K5NA 3CW2C 3PSIA 4R4QA 2CCZA 3NELA 4DR1L 4BBSG 4BA1I 1T9HA 5LMUQ 4JI0L 4IFDJ 3CMEA 2KCMA 2NVXH 4A3BG 1YVCA 3CAMA 4C3IH 1N36L 4B3RL 4OO1I 4DV5L 2YTVA 4LWCA 4BY1H 4JI6Q 1PH8A 1Y14B 3H15A 1Q8KA 4HIMA 3KF8B 3CC7A 1VQCA 3T1YL 4DR4Q 4WJ4A 1MKHA 4PZ7A 4A3FH 1X55A 3G4SA 1YIJA 4JC0A 3S1NH 2AMCB 2K5HA 3TQYA 4JI6L 4NXNL 1KXLA 1PH1A 4LF9Q 2NN6G 4X64L 2NVQH 4HIOA 2UU9L 2LSSA 1PV4A 4B3SL 4DNIA 1UE1A 4XIGS 4IOAA 4A3FG 4JI3Q 2JA5H 3RLNA 3GTKH 2PQAB 1J5EQ 1IBKQ 2E5LL 1EQQA 2NZOA 4GKKL 1VQAA 4C3JH 1WCMG 5GAHC 1RIPA 3MXNB 2ES2A 2B63G 3B6YA 2JA8H 2UXCL 5C0XG 5C0XJ 1CKOA 3ULLA 1GD7A 3I7FA 3CXCA 2IX1A 4JV5Q 4GKKQ 1SROA 2JA5G 4RMFA 3W1GA 3AQQA 1J5EL 1IBKL 1XPRA 3K8AA 4LF7Q 2HQLA 4L5SA 4GN4B 4GLAC 3U58A 1Z9FA 4MTNA 4PZ8A 5C44H 2WAQG 2ZM6Q 4HIDA 1Y1WG 2UU9Q 3JC66 1GM5A 1UEBA 3M9BA 3K7UC 1K9MC 3J80c 1IL2A 3I4MG 5HGQA 2R7ZG 4HJ7A 2XTIA 3I55A 4X6AH 3GO5A 1KC8C 3I2ZA 1HR0W 1X56A 5J3BA 3TS2A 2Y0SE 2PI2A 4A3IG 4JV5L 2ZJRA 4HJAA 2GN5A 4BY7H 1TWHH 3HOXH 1KIXA 4IJLA 1N36Q 4WJ3M 3F2CA 5GAEC 3TS0A 1V1QA 2D0OA 4YWLA 4A3CG 3M4QA 3TEHB 1CUKA 3SGIA 4LFCL 4OXPA 1L2FA 3RN2A 4B3SQ 1TWFH 3UDIA 4FDBA 1WCMH 2IT1A 4LF5Q 5GAGC 3GDEA 4GLXA 1VQIA 5FJ8G 4JI2Q 1Q86C 1JMCA 1JJCB 3ULPA 4KHPQ 1H95A 3HKZE 4LF8L 1OXVA 2ZTEA 2Q2HA 1X54A 5JEAJ 4A93G 4DR4L 5JEAG 1VQGA 1VQJA 1EIYB 4JOIA 1K3RA 1QZGA 4UP7A 3JAMc 1VQ4A 1I3QH 3E9HA 1EUJA 2K5VA 4R4CA 5IP7H 5H1SE 4A3JH 1JJGA 1QVFA 3KLWA 2L15A 4GS3A 4H02A 1Y1WH 4BBRG 2E2JH 4LF7L 2GVBA 1A8VA 2Y0SG 1R9TH 3PGZA 4JYAL 4Y52H 4NXMQ 1UWVA 5LMUL 4JI1Q 4DR1Q 3BU2A 4A3GG 4JG2A 2EIFA 1Q81C 2R93G 3DM3A 4GKJQ 2JA6H 1SE8A 3CCJA 1GVPA 2AWNA 3HKZG 3J81c 4AH6A 1VQHA 4DR5Q 2VY3A 2KCTA 2JE6I 2VQFL 3U50C 2E5LQ 4J15A 5C3EG 1QZHA 4JI4Q 1XPUA 3F1ZA 4DK6C 2D62A 4JI3L 5M3FH 4AYBG 3GTPH 3ZJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 L;  3TRE A;  1PH3 A;  4X64 Q;  1G6P A;  4LF9 L;  4LNQ A;  4HJ5 A;  3UDG A;  4NXN Q;  3DLL A;  4B3T L;  1SLJ A;  2ATW A;  2EQS A;  3PF4 A;  4YHH L;  3CP0 A;  2VNU D;  1CSQ A;  4NPS A;  4IO9 A;  1C0A A;  4DV7 Q;  3T1Y Q;  2H5X A;  1NMG A;  4Y7N H;  5AJ3 L;  1G29 1;  4DV3 Q;  4DR6 Q;  2XGT A;  2LXJ A;  1RL2 A;  2JA8 G;  5M5Y H;  3CCR A;  1YIT A;  3CCQ A;  5FLM H;  4DV5 Q;  1Q1E A;  4KLK A;  4OX9 L;  4B3R Q;  2CKZ B;  3OTO L;  2WFW A;  5IP9 G;  1C7Y A;  4A3L G;  3D31 A;  1L1O A;  4C2M H;  3RZO H;  4DV6 Q;  3CCE A;  1SMX A;  4JI0 Q;  4DV4 Q;  2WP8 J;  4ALP A;  4L5R C;  4UP9 A;  1PH7 A;  1KQS A;  1HNX L;  2B29 A;  4A3G H;  1WOC A;  5C4X G;  4R1J A;  1FJG Q;  1Q46 A;  3I4M H;  1IBL L;  1PHJ A;  5C3E H;  4JI5 Q;  4MNO A;  1KRT A;  4BA2 I;  4UP8 A;  1I94 Q;  2MQH A;  3E0E A;  4A3E G;  2OQK A;  2VZA A;  4YCV A;  4DV1 L;  3PO2 G;  2K75 A;  2IHF A;  4PZ6 A;  2C35 B;  3PCO B;  3Q8D A;  4GNX A;  1PH5 A;  4YCW A;  5ELO A;  4X62 Q;  1UE6 A;  2Z6K A;  2VUM H;  4MZ9 A;  4RG1 A;  4X65 L;  1VQO A;  1U5K A;  5EAY A;  2PMZ E;  2OTJ A;  2A19 A;  4DV0 L;  2KHJ A;  1HR0 Q;  4BBR H;  1X3G A;  2KBN A;  1B7Y B;  1E24 A;  1VQE A;  2K4K A;  3PIO A;  3HOU G;  1UE5 A;  4K0K L;  4A76 A;  3JAM i;  1NBW A;  1L1O B;  4OON A;  1S40 A;  3UDX A;  2I0Q A;  4GOP B;  5M5W H;  1PFS A;  3CC4 A;  1ASY A;  1W2B A;  2CQO A;  2RF4 A;  2OWO A;  5FJ8 H;  2FXQ A;  4GOP A;  1PH2 A;  4DK3 C;  3T1H Q;  3L0O A;  1VQB A;  2RHS B;  1KAW A;  2A1A A;  4X66 L;  2RCN A;  1X3F A;  4DUY Q;  1QUQ B;  3BZK A;  4PMW A;  3HOW H;  4A3M H;  3RN5 A;  3RLF A;  4DUZ L;  4UY8 C;  4AQY Q;  1XTD A;  2N8N A;  1VS0 A;  4P71 A;  3M4O H;  1HZA A;  1VQ5 A;  3OW2 A;  1V9P A;  1VQ6 A;  4KHZ A;  1E3P A;  1GO3 E;  1Q7Y C;  1VQ8 A;  2VQE Q;  4A3M G;  2HIX A;  2F4V L;  3CCV A;  2V1C C;  2UUC L;  1XNR L;  1TWG H;  3PUY A;  1LUZ A;  5IYD G;  5M3M G;  4POG A;  1AE3 A;  5C44 G;  2HHH Q;  1HNW Q;  2KEN A;  4R4T A;  2KHI A;  4IFD G;  4LFA Q;  3FKI H;  1VQF A;  2MFI A;  2VL6 A;  4JBK A;  3S1M H;  3KJO A;  4TQU S;  5E7N A;  3ULJ A;  1XNQ L;  1N33 L;  2IHE A;  2VS1 A;  4C3H H;  1HZC A;  4JI8 Q;  5IP7 G;  2WB1 E;  1Q12 A;  4DR2 L;  4A3J G;  4A3K H;  1S72 A;  2ASB A;  1OXT A;  5FLX c;  5M3F G;  1B70 B;  4GN5 A;  3PUZ A;  1N8R C;  2E2I H;  1A0I A;  1X3E A;  1XMQ Q;  1HNZ Q;  1N32 L;  1PVO A;  4QQB X;  1G51 A;  1WYD A;  4QY7 A;  3NEM A;  3HFZ B;  3CPF A;  1QVC A;  1KRS A;  1LM0 A;  1W3S A;  1BKB A;  4JOI C;  1K83 H;  3AFP A;  4OWT B;  2N78 A;  5BR8 Q;  3CPW A;  3ER0 A;  4LFB Q;  1E22 A;  2R7Z H;  4NB3 A;  4A3D G;  2BA0 A;  3KYH C;  5IYC H;  4LF6 Q;  3L7Z C;  3KF6 B;  2YTX A;  2NZH A;  4DR3 Q;  4DV2 L;  2UXB Q;  2N3S A;  1YJW A;  4B3M L;  2VW9 A;  4DV2 Q;  1EQR A;  3F8T A;  4GOP C;  3HOZ H;  1YBY A;  5IWA Q;  4JBW A;  3PUX A;  1CSP A;  4BY1 G;  2UUA Q;  3WWV A;  2JA9 A;  4AYB E;  1X9N A;  4LFB L;  4IPD A;  4JI7 L;  1SR3 A;  1M90 C;  1WJJ A;  1XMO L;  3HOY H;  4DAY B;  4LF4 L;  3K81 C;  3GTL H;  1M1K C;  1E7Z A;  2Z0S A;  4YCU A;  2EXD A;  1N34 Q;  1YJN A;  3A0J A;  2R93 H;  2MNA A;  3H0G G;  4LUO A;  1YHQ A;  2PI2 E;  4JCV E;  2N49 A;  4POF A;  1YI2 A;  3HOY G;  1IBM Q;  2UXD L;  1NE3 A;  4A3K G;  2K52 A;  3UE0 A;  4BXX G;  3EBE A;  1U0L A;  1JJ2 A;  2F3I A;  1Y1V G;  1YHB A;  3STB D;  1N34 L;  1VQ9 A;  1HH2 P;  4LFA L;  5IE8 A;  2R92 H;  2PNH A;  2ZJP A;  2UUB Q;  1YJ9 A;  4LF4 Q;  2BH2 A;  3J80 i;  1V43 A;  1YZ6 A;  5LMN L;  3HOU H;  2MO0 A;  3E9I A;  4IPC A;  2UUC Q;  5IYD H;  4DPG A;  4A3E H;  3S14 H;  4LUZ A;  1WI5 A;  1FL0 A;  3AYH B;  4QJF A;  2OCE A;  2R92 G;  1J6Q A;  3FKI G;  4OWX B;  3M3Y H;  3NBH B;  3J7A 5;  2MO1 A;  4DR7 Q;  4A75 A;  2ZTC A;  4GLV B;  2ALY B;  3K7A H;  3HOW G;  3FP9 A;  4KI0 A;  4JBJ A;  4AQY L;  1IBM L;  2JA6 G;  1O7I A;  5LMN W;  2UXD Q;  4BBS H;  3I56 A;  4R4O A;  4O2D A;  3CCM A;  1VQD A;  2ZJQ A;  2RHQ B;  4R4I A;  1A63 A;  1JE5 A;  3T1H L;  2YU9 H;  1EIF A;  2JA7 G;  3G6E A;  5DLQ E;  1X65 A;  3AFQ A;  5ELN A;  1XMO Q;  2IY5 B;  3HOV H;  4GNX C;  1WFQ A;  3KF6 A;  1VQ7 A;  2NN6 I;  3GTQ H;  4BY7 G;  2OQ0 A;  3UDF A;  1PA6 A;  1MJE A;  2I5L X;  3A5Z B;  1AH9 A;  4DR7 L;  4A3C H;  3PUV A;  3K0X A;  2CWP A;  1N33 Q;  3S2D H;  3KDF A;  2UXB L;  1XNQ Q;  4DR3 L;  1ASZ A;  4O0A A;  4DAM A;  2Q2U A;  5IYB G;  1QVG A;  3KDF B;  4YWK A;  4DV0 Q;  5LMN Q;  1I5F A;  2VUM G;  2NVY H;  4A4I A;  2AHO B;  3IRB A;  3M4P A;  2I5M X;  1N9W A;  1NMF A;  3U4Z A;  4DKA C;  2UUB L;  3EN2 A;  2QEX A;  1Z47 A;  5GQO A;  3LGJ A;  1A62 A;  4P72 A;  2B63 H;  2CWA A;  3J7Z C;  3CQZ H;  2K14 A;  5IT9 c;  1BBU A;  1XMQ L;  3BZC A;  1IBL Q;  1FVI A;  2YV5 A;  3KFU A;  2LXK A;  2WB1 G;  1PYB A;  1L0W A;  4A3I H;  3S2H H;  2Z6K C;  3G48 A;  1X6O A;  3ERS X;  4L5T A;  1VQN A;  2WAQ E;  4OO1 G;  3I4O A;  1HNX Q;  1PH6 A;  4QGU A;  3J81 i;  3PO2 H;  2IX0 A;  2HIV A;  5HY6 A;  2F52 A;  4DV4 L;  1XJV A;  2R6G A;  4YWM A;  2PQA A;  3U4V A;  1EOV A;  4HJ8 A;  4HJ9 A;  3HKS A;  1PYS B;  2HHH L;  1HNW L;  1NTG A;  3W5O A;  4JI7 Q;  2E8G A;  1I50 H;  1C9O A;  3S24 A;  1BBW A;  2UUA L;  4OX9 Q;  2OTL A;  1K73 C;  3STB C;  1JT8 A;  5IWA L;  3F2B A;  2VQE L;  4ME3 A;  4A93 H;  1SN8 A;  5IY0 A;  1K0R A;  3KJP A;  3G71 A;  2R7F A;  3OYY A;  1Q1B A;  4IPG A;  5AJ3 Q;  1PH4 A;  1VQL A;  4B3M Q;  3M7N A;  4IFD I;  3FHW A;  3HOX G;  4LF6 L;  4EX5 A;  4XTC S;  1D8L A;  1HJP A;  2JJQ A;  5IYC G;  5C0X I;  3S1Q H;  1OTC A;  2BA1 A;  4LUV A;  5BR8 L;  5GAD C;  4X62 L;  1OXU A;  4X66 Q;  5C4X H;  1SRU A;  3CMA A;  1TWA H;  1EWI A;  1VCI A;  1PH9 A;  4EQ5 A;  1SFO H;  1GKH A;  1HNZ L;  4QIW E;  5M5X H;  1E1O A;  1K8A C;  3RLO A;  3H3V H;  1N32 Q;  1P16 A;  1HZB A;  4GN3 B;  4APV A;  3A5U A;  2GVA A;  2YYZ A;  2QA4 A;  1KL9 A;  3H3V I;  3EIV A;  1KD1 C;  3CCL A;  3I4N G;  4DR2 Q;  4JI8 L;  1YHA A;  3S1R H;  3PUW A;  2R7D A;  4GKJ L;  1K8G A;  3GD7 A;  1CKM A;  1E1T A;  4JI1 L;  4IJH A;  2A8V A;  1HR0 L;  4DV6 L;  1YEZ A;  3GTO H;  3PO3 H;  1LTL A;  5GRO A;  3RZD H;  1KHI A;  4L5Q A;  4TVA B;  2ID0 A;  4A3D H;  1UE7 A;  3BJU A;  2ZTD A;  4IPH A;  1NY4 A;  3F2D A;  1EYG A;  5M3M H;  1VQK A;  1XNR Q;  2E2H H;  3I4N H;  1TWC H;  2F4V Q;  1VQP A;  3RR5 A;  4DV1 Q;  3L2P A;  4DR6 L;  4DV3 L;  1I94 L;  2HT1 A;  2JEA I;  3S17 H;  4DV7 L;  3HOZ G;  4AIM A;  3D0F A;  3S15 H;  3CD6 A;  4JI2 L;  1OXX K;  4OWW B;  2JA7 H;  4B3T Q;  4DUZ Q;  3KOJ A;  3CCS A;  4GNX B;  1FJG L;  3PO3 G;  4DUY L;  1IXR A;  1HZ9 A;  2JK8 A;  1S3O A;  3GTG H;  3GTM H;  3ICE A;  1Q82 C;  4A3B H;  2JEB I;  1LYL A;  3M85 A;  3MEF A;  3NEN A;  1XPO A;  4JI4 L;  4LFC Q;  5IYB H;  1MIU A;  1IYJ B;  4P74 A;  1FGU A;  2DUD A;  2VQF Q;  2B3G A;  5JJK A;  2K50 A;  2Q2T A;  3OTO Q;  1BVS A;  4K0K Q;  1NJI C;  3TRZ A;  2I5H A;  3RNU A;  2AWO A;  1L1O C;  4PG3 A;  3J81 j;  3PF5 A;  4P75 A;  2QGQ A;  3CCU A;  1CKN A;  1B8A A;  1D7Q A;  3K80 C;  1VQM A;  2CFM A;  3HOV G;  4NXM L;  2AKW B;  4JYA Q;  3PV0 A;  4YHH Q;  3S16 H;  1CKN B;  2Q2I A;  5IP9 H;  4A3L H;  3UE1 A;  1DGS A;  3A74 A;  1P8L A;  4X65 Q;  5FLM G;  4LW1 A;  3CC2 A;  1QUQ A;  5K36 G;  2DGY A;  1YNX A;  4YY3 Q;  3PIP A;  2ZM6 L;  1IZ6 A;  5JJI A;  2JQO A;  3CF5 A;  4P73 A;  1MJC A;  4JBM A;  2BH8 A;  4UPA A;  1I6H H;  3GTJ H;  3VDY A;  4JI5 L;  1OXS C;  5C4J H;  2YTY A;  2D0P A;  4LF8 Q;  4QL5 A;  1AE2 A;  3H0G H;  4IOC A;  1JB7 A;  4KHP L;  4DR5 L;  5JJL A;  4BXX H;  3AEV A;  3W1B A;  4LF5 L;  2NVT H;  1TXY A;  2UXC Q;  1EFW A;  4HIK A;  1Y1V H;  2K5N A;  3CW2 C;  3PSI A;  4R4Q A;  2CCZ A;  3NEL A;  4DR1 L;  4BBS G;  4BA1 I;  1T9H A;  5LMU Q;  4JI0 L;  4IFD J;  3CME A;  2KCM A;  2NVX H;  4A3B G;  1YVC A;  3CAM A;  4C3I H;  1N36 L;  4B3R L;  4OO1 I;  4DV5 L;  2YTV A;  4LWC A;  4BY1 H;  4JI6 Q;  1PH8 A;  1Y14 B;  3H15 A;  1Q8K A;  4HIM A;  3KF8 B;  3CC7 A;  1VQC A;  3T1Y L;  4DR4 Q;  4WJ4 A;  1MKH A;  4PZ7 A;  4A3F H;  1X55 A;  3G4S A;  1YIJ A;  4JC0 A;  3S1N H;  2AMC B;  2K5H A;  3TQY A;  4JI6 L;  4NXN L;  1KXL A;  1PH1 A;  4LF9 Q;  2NN6 G;  4X64 L;  2NVQ H;  4HIO A;  2UU9 L;  2LSS A;  1PV4 A;  4B3S L;  4DNI A;  1UE1 A;  4XIG S;  4IOA A;  4A3F G;  4JI3 Q;  2JA5 H;  3RLN A;  3GTK H;  2PQA B;  1J5E Q;  1IBK Q;  2E5L L;  1EQQ A;  2NZO A;  4GKK L;  1VQA A;  4C3J H;  1WCM G;  5GAH C;  1RIP A;  3MXN B;  2ES2 A;  2B63 G;  3B6Y A;  2JA8 H;  2UXC L;  5C0X G;  5C0X J;  1CKO A;  3ULL A;  1GD7 A;  3I7F A;  3CXC A;  2IX1 A;  4JV5 Q;  4GKK Q;  1SRO A;  2JA5 G;  4RMF A;  3W1G A;  3AQQ A;  1J5E L;  1IBK L;  1XPR A;  3K8A A;  4LF7 Q;  2HQL A;  4L5S A;  4GN4 B;  4GLA C;  3U58 A;  1Z9F A;  4MTN A;  4PZ8 A;  5C44 H;  2WAQ G;  2ZM6 Q;  4HID A;  1Y1W G;  2UU9 Q;  3JC6 6;  1GM5 A;  1UEB A;  3M9B A;  3K7U C;  1K9M C;  3J80 c;  1IL2 A;  3I4M G;  5HGQ A;  2R7Z G;  4HJ7 A;  2XTI A;  3I55 A;  4X6A H;  3GO5 A;  1KC8 C;  3I2Z A;  1HR0 W;  1X56 A;  5J3B A;  3TS2 A;  2Y0S E;  2PI2 A;  4A3I G;  4JV5 L;  2ZJR A;  4HJA A;  2GN5 A;  4BY7 H;  1TWH H;  3HOX H;  1KIX A;  4IJL A;  1N36 Q;  4WJ3 M;  3F2C A;  5GAE C;  3TS0 A;  1V1Q A;  2D0O A;  4YWL A;  4A3C G;  3M4Q A;  3TEH B;  1CUK A;  3SGI A;  4LFC L;  4OXP A;  1L2F A;  3RN2 A;  4B3S Q;  1TWF H;  3UDI A;  4FDB A;  1WCM H;  2IT1 A;  4LF5 Q;  5GAG C;  3GDE A;  4GLX A;  1VQI A;  5FJ8 G;  4JI2 Q;  1Q86 C;  1JMC A;  1JJC B;  3ULP A;  4KHP Q;  1H95 A;  3HKZ E;  4LF8 L;  1OXV A;  2ZTE A;  2Q2H A;  1X54 A;  5JEA J;  4A93 G;  4DR4 L;  5JEA G;  1VQG A;  1VQJ A;  1EIY B;  4JOI A;  1K3R A;  1QZG A;  4UP7 A;  3JAM c;  1VQ4 A;  1I3Q H;  3E9H A;  1EUJ A;  2K5V A;  4R4C A;  5IP7 H;  5H1S E;  4A3J H;  1JJG A;  1QVF A;  3KLW A;  2L15 A;  4GS3 A;  4H02 A;  1Y1W H;  4BBR G;  2E2J H;  4LF7 L;  2GVB A;  1A8V A;  2Y0S G;  1R9T H;  3PGZ A;  4JYA L;  4Y52 H;  4NXM Q;  1UWV A;  5LMU L;  4JI1 Q;  4DR1 Q;  3BU2 A;  4A3G G;  4JG2 A;  2EIF A;  1Q81 C;  2R93 G;  3DM3 A;  4GKJ Q;  2JA6 H;  1SE8 A;  3CCJ A;  1GVP A;  2AWN A;  3HKZ G;  3J81 c;  4AH6 A;  1VQH A;  4DR5 Q;  2VY3 A;  2KCT A;  2JE6 I;  2VQF L;  3U50 C;  2E5L Q;  4J15 A;  5C3E G;  1QZH A;  4JI4 Q;  1XPU A;  3F1Z A;  4DK6 C;  2D62 A;  4JI3 L;  5M3F H;  4AYB G;  3GTP H;  3ZJY C; 
#chains in the Genus database with same CATH topology
 1E2Z A;  2MUY A;  4FF3 A;  3UDG A;  4IAL A;  1CZG A;  1B50 A;  1QNK A;  4YHH L;  3CP0 A;  3QWN A;  2VNU D;  1HRJ A;  1JWS D;  1C0A A;  2EY6 A;  1NMG A;  1TWH B;  2JP1 A;  3HOX B;  4DR6 Q;  3U9S A;  3NK9 A;  3A55 A;  5CV4 A;  5HUR A;  4KLK A;  4DV5 Q;  3OTO L;  4ZCK A;  2WFW A;  4A3L G;  5CV9 A;  2F3W A;  3TME A;  2J4X A;  3RZO H;  1SMX A;  2IPK D;  2A68 D;  2WP8 J;  3FPP A;  1PH7 A;  3H6M A;  4A3G H;  1F2M A;  1EOT A;  1FJG Q;  1Q46 A;  2N55 A;  4DFA A;  2I46 A;  1U9R A;  2OQK A;  2GA4 B;  3O13 A;  4PZ6 A;  2C35 B;  2L9H A;  2K01 A;  1PH5 A;  5ELO A;  1SJH D;  1VQO A;  1U5K A;  3EQL C;  1QCB D;  2OTJ A;  1K83 B;  2K28 A;  3FRP B;  2Z4H A;  4CKB A;  1B7Y B;  2F0F A;  1PFN A;  4RWS C;  2Z4I A;  2BOS A;  1CZW A;  4A76 A;  2EYO A;  4PMB A;  4KY6 A;  4DGZ A;  2FXQ A;  2C5C A;  3T1H Q;  2RHS B;  1X3F A;  4IQZ A;  5JEA H;  4DUY Q;  1HTL D;  1RJT A;  1V1P A;  4MN3 A;  4A3M H;  3RLF A;  2QDL A;  4AQY Q;  5E1F A;  3M4O H;  3A8J E;  2DJG C;  2K5Q A;  3OW2 A;  3BYT B;  1VQ6 A;  1Q7Y C;  1I4H A;  3A8K E;  1J8I A;  2NVQ B;  2F0E A;  1U4P A;  5CV6 A;  4CGY B;  1SAP A;  2KHI A;  1VQF A;  2MFI A;  1TS5 A;  4JBK A;  3R2T A;  3KJO A;  4TQU S;  4BY7 B;  2VS1 A;  4C3H H;  1S72 A;  1HZC A;  4A3J G;  2B8G A;  3V05 A;  4UAI A;  3DUZ A;  4GN5 A;  1A0I A;  2NZ1 D;  1N32 L;  1DOM A;  4BS9 A;  3VR4 A;  1G51 A;  5CBE E;  1LTR D;  3HFZ B;  3CPF A;  4JOI C;  2O2L D;  1K83 H;  4OWT B;  2N78 A;  2R7Z H;  4LJZ C;  5IYC H;  4DR3 Q;  3CRK C;  2OXP A;  4DV2 L;  1YJW A;  3HOZ H;  1EYD A;  4K6L A;  1NCV A;  2SNS A;  1ZXT A;  1ENF A;  1O78 A;  2HDM A;  4JBW A;  1CSP A;  2UUA Q;  4FXD A;  4IPD A;  1SR3 A;  4K14 A;  4XYQ A;  1WJJ A;  4QUF A;  1XMO L;  3HOY H;  4LF4 L;  3K81 C;  3GTL H;  4HCE A;  2KJX A;  3A0J A;  1EYC A;  2RQX A;  2AQ2 B;  3OMG A;  2JN4 A;  5EBD A;  3IAY A;  3D6C A;  4JCV E;  1KAB A;  3EBE A;  3OHX C;  5CR3 A;  1JJ2 A;  1YHB A;  3STB D;  4KJO A;  1WTQ A;  3HGB A;  4IUP A;  1HH2 P;  4KN4 C;  5IE8 A;  1TS4 A;  4LF4 Q;  2ICI A;  1PYW D;  2B2U C;  3J80 i;  4QF4 A;  1V43 A;  5LMN L;  1PRT B;  4A3E H;  4LUZ A;  1WI5 A;  1LT6 D;  2OCE A;  3J7A 5;  1W6K A;  5EGT A;  1E2W A;  2F0D A;  4KI0 A;  2JA6 G;  1NR4 A;  4R4O A;  4A3E B;  3CCM A;  1VQD A;  1TWC B;  4R4I A;  1JE5 A;  1EZ8 A;  5FKA C;  1EIF A;  1BOS A;  4ZAI A;  1X65 A;  4K5W A;  1XMO Q;  2AUJ D;  5EKK A;  1WFQ A;  3KF6 A;  1GHJ A;  4BY7 G;  3GTQ H;  1TY0 A;  3UDF A;  3VYS A;  3A5Z B;  3K0X A;  2CWP A;  3KDF A;  2ZXO A;  1ASZ A;  2G5D A;  2Q2U A;  5IYB G;  5A2Q L;  2I5M X;  4FO2 A;  3U4Z A;  4DKA C;  1HPC A;  2QEX A;  2QDB A;  1TVX A;  3MEH A;  2XWJ B;  3MFY A;  3NWT A;  4M1U B;  5D65 A;  1XXG A;  1XMQ L;  1AZQ A;  4DK1 A;  1FVI A;  1H9K A;  2IW3 A;  3KFU A;  2NUC A;  4OO1 G;  1VQN A;  2M2L A;  4QCL A;  3UI2 A;  3V96 A;  3J81 i;  2IX0 A;  2HIV A;  1PTO F;  1B53 A;  1EFI D;  2R6G A;  5ELB A;  1XJV A;  1EOV A;  3MXP A;  4HJ8 A;  3HKS A;  2HHH L;  1NTG A;  4JI7 Q;  1O80 A;  3ONA B;  2DJF C;  1C9O A;  1BBW A;  1EWC A;  2Q8R E;  5IWA L;  5C44 B;  3F2B A;  1K0R A;  5AJ3 Q;  3M7N A;  3MFG A;  3FHW A;  4LF6 L;  4EX5 A;  3NWS A;  4NP5 A;  2K6A A;  1D8L A;  1HJP A;  5IYC G;  2Z9H A;  1SNQ A;  3DEP A;  1OTC A;  4V0B A;  4DN4 M;  3S1M B;  1SRU A;  1Q3L A;  3CMA A;  1ONL A;  3E6Z X;  1VCI A;  1G8Z D;  5COY A;  1II3 A;  1HNZ L;  1HZB A;  1RKN A;  1FNW A;  4HN7 A;  3HOZ B;  3S2D B;  3M4O B;  3IFD A;  4DR2 Q;  4JI8 L;  1ILP A;  2LS0 1;  1E1T A;  2A8V A;  4RAU C;  1YEZ A;  3FVQ A;  5EJW A;  3GTO H;  5EQ0 A;  1KHI A;  2F0H A;  4TVA B;  4FP5 D;  2ZTD A;  4IPH A;  1SNC A;  1VQK A;  3I4N H;  3FEW X;  2F4V Q;  2CW0 D;  1VQP A;  4DV1 Q;  3L2P A;  4DR6 L;  2K7V A;  4DA2 A;  3X3M A;  1KDA A;  4A3I B;  3D0F A;  3CD6 A;  4G4K A;  4JI2 L;  2JA7 H;  3PO3 G;  2ZT9 C;  4DUZ Q;  3KOJ A;  4B3T Q;  1FJG L;  5DEH A;  2KEC A;  2CQA A;  2JK8 A;  1HZ9 A;  3GTM H;  4A3B H;  1Z7T A;  3MEF A;  1XPO A;  1I3Q B;  4P74 A;  2VQF Q;  3MHB A;  2Q2T A;  3OTO Q;  1WTV A;  1B9M A;  2I5H A;  1B4O A;  3T16 A;  1L1O C;  3NE5 B;  4P75 A;  3CCU A;  5IOC A;  3K80 C;  1AP0 A;  3HOV G;  1OO9 B;  4A3M B;  4YHH Q;  3A74 A;  1UNS A;  4KK7 A;  1QUQ A;  1SE2 A;  3PO2 B;  1C4Q A;  3CF5 A;  4EVO A;  3VDY A;  1F2L A;  2D0P A;  4QL5 A;  3H0G H;  5JJL A;  2HD3 A;  3AEV A;  4LF5 L;  3FKI B;  1EFW A;  4KKU A;  4HIK A;  1G6Z A;  4HMJ A;  3NEL A;  5LMU Q;  4JI0 L;  2NVX H;  4A3B G;  2EE1 A;  4XDX A;  1LO5 D;  2EY2 A;  4B3R L;  4X3U A;  1WD1 A;  1N36 L;  2YTV A;  4LWC A;  1TII D;  3BDC A;  5KGU A;  1Q8K A;  1VQC A;  4WJ4 A;  1MKH A;  1X55 A;  1M8A A;  1KXL A;  2V4D A;  2MPM A;  5C3E B;  1GUW A;  4XIG S;  1FNV A;  4JI3 Q;  2JA5 H;  4EQN A;  1S5B D;  4TSS A;  4GKK L;  1VQA A;  5GAH C;  3MXN B;  2ES2 A;  2Y0S B;  2WAC A;  3ULL A;  3CXC A;  4JV5 Q;  4F7X A;  4CKE A;  2A69 D;  2F0M A;  4C2M B;  1E0B A;  3N6R A;  1J5E L;  2FHT A;  2DN8 A;  3K8A A;  2HQL A;  3U58 A;  4PZ8 A;  2WAQ G;  1GUN A;  3JC6 6;  1K9M C;  1UEB A;  1IL2 A;  5HGQ A;  2R7Z G;  4HJ7 A;  3I55 A;  3KLS X;  4L6T B;  1STG A;  4N8X 1;  5J3B A;  4HJA A;  2TSS A;  1V1Q A;  2LFN A;  3M4Q A;  3SGI A;  3K59 A;  4OXP A;  4CJ1 B;  1ML0 D;  3SK5 A;  4B3S Q;  3UDI A;  2NYZ D;  1MHW C;  1EZ6 A;  1EEI D;  4JI2 Q;  5CMD A;  1JJC B;  1BUV T;  1CA5 A;  2E74 C;  1OXV A;  2R7Z B;  2Q2H A;  1X54 A;  2XNA C;  1K8M A;  4R9W A;  3S1N B;  1VQG A;  1MGS A;  4JOI A;  5I9P A;  1QZG A;  1VMP A;  2O5I C;  3E9H A;  1EUJ A;  1NAP A;  3EA6 A;  2Z1C A;  4ZUI A;  3SDZ A;  1ET9 A;  3H3V C;  1E2V A;  4RGN A;  4C3J B;  1R9T H;  3PGZ A;  3OW7 A;  1F77 A;  4JG2 A;  2EIF A;  4GKJ Q;  4C3I B;  1SE8 A;  3CCJ A;  2AWN A;  3J81 c;  3HKZ G;  5J1Z A;  1VQH A;  2VY3 A;  5E3F A;  2E5L Q;  5C3E G;  3F1Z A;  2D62 A;  4XQJ A;  3D8G A;  4HAE A;  3TRE A;  1G6P A;  3DLL A;  3PF4 A;  4FF1 A;  5IGF A;  2F1M A;  3CRL C;  4DV7 Q;  4Y7N H;  5AJ3 L;  1EY7 A;  2JA8 G;  2EYM A;  3VA5 A;  3CCR A;  2EZV A;  4B3R Q;  5IP9 G;  1B3A A;  5IT9 E;  5CBA E;  1L1O A;  3BDL A;  4BBS B;  4K5V A;  3CCE A;  4J6H A;  2RCF A;  2EPB A;  2FJ2 A;  1HNX L;  1Y8P B;  3I4M H;  1V1P B;  1IBL L;  4PMC A;  1I94 Q;  2F0N A;  2VZA A;  4YCV A;  3PCO B;  4KTA A;  4GNX A;  3NUC A;  4X62 Q;  1G91 A;  2VUM H;  3K5O A;  4HR7 B;  2D2C C;  2PMZ E;  2A19 A;  1ET6 A;  4DAP A;  4BBR H;  1WTR A;  1X3G A;  1H9S B;  3SK8 A;  1E24 A;  1VQE A;  1Z6H A;  2OEO A;  2PNR C;  3PIO A;  2R3Z A;  2MP1 A;  2XIW A;  1H9S A;  1UE5 A;  5A2Q E;  1V8Q A;  4K0K L;  1BO0 A;  3FMC A;  4ABN A;  1NBW A;  1L1O B;  3VR3 A;  4OON A;  1JOR A;  2I0Q A;  1ENA A;  4BBR B;  3CC4 A;  5FOB B;  3R8B A;  2RF4 A;  5ELD A;  2OWO A;  2QF7 A;  5FJ8 H;  2NVY B;  4DK3 C;  3PQI A;  3T13 A;  1KAW A;  4X66 L;  3VYT A;  2RCN A;  4J1M A;  1STA A;  1TY2 A;  4PMW A;  3HOW H;  5CC4 A;  4EQP A;  3IFT A;  1XTD A;  1VS0 A;  3K0Y A;  1AW7 A;  3A8I E;  2F0P A;  4CDD C;  1VQ5 A;  4ILW A;  4KHZ A;  1E3P A;  2HIX A;  1LTA D;  5CV7 A;  2NTS A;  2F4V L;  2EOT A;  1F9Q A;  1ZYR D;  3MTS A;  5M3M G;  3BVG A;  3RZO B;  4POG A;  1AE3 A;  5C44 G;  3LNN A;  1HNW Q;  4R4T A;  4KHV A;  3SE0 A;  2A69 C;  1ENC A;  4IFD G;  1QNU A;  4LFA Q;  3V2T A;  2NVT B;  4IUN A;  2VL6 A;  3S1M H;  5E7N A;  3ULJ A;  1N33 L;  2IHE A;  5IYD H;  1EIH A;  4JI8 Q;  1K0S A;  1Q12 A;  1OXT A;  1A6X A;  5FLX c;  4A93 B;  1N8R C;  2E2I H;  4DNR B;  1X3E A;  1AFP A;  1HNZ Q;  3MXU A;  1PVO A;  4J8Q A;  1WYD A;  3PIO 3;  1KRS A;  3J81 E;  4C1N K;  1BKB A;  4C56 C;  3AFP A;  4LFB Q;  4A3D G;  5IT9 L;  3KYH C;  2F0W A;  5T1G A;  2NZH A;  2N3S A;  4RHS A;  3I4N B;  4RGO S;  1YBY A;  3PUX A;  3WWV A;  2JA9 A;  4CHT B;  4JI7 L;  1D2B A;  1TS3 A;  2EJF C;  1N34 Q;  3ND9 A;  1YHQ A;  2PI2 E;  2E76 C;  2UXD L;  1NE3 A;  3KBX A;  2K52 A;  3UE0 A;  2OT2 A;  5J22 A;  3BYY B;  1A3T A;  1VQ9 A;  1B2T A;  2UUB Q;  1QB5 D;  1NUC A;  1RTN A;  2EYH A;  3K7A B;  1KAA A;  3EVQ A;  1YZ6 A;  2UUC Q;  3S14 H;  2MJ8 A;  4ZRZ A;  1Q8I A;  4A75 A;  2ZTC A;  2ALY B;  2XN9 C;  4C3H B;  3TBI B;  3K7A H;  3FP9 A;  1IBM L;  1DCZ A;  2I07 B;  3S14 B;  4NW2 A;  2ENB A;  3E0J A;  2A6E C;  3HS0 C;  1A63 A;  3T1H L;  2WAQ B;  1Y8O B;  1HHV A;  3G6E A;  1EY4 A;  3K6O A;  3AFQ A;  5ELN A;  2KCN A;  3C3L A;  3ERO A;  1SYG A;  3R93 A;  5C4Z A;  1I6H B;  4UHV A;  3T53 B;  4A3C H;  3PUV A;  1FGB D;  1N33 Q;  4N9P A;  2KOL A;  4DAM A;  2RA4 A;  2WIN B;  2VUM G;  1I5F A;  1LTB D;  3MA2 B;  4PQX A;  3IRB A;  3M4P A;  1N9W A;  4BWG B;  1SNO A;  1Z47 A;  1SMY C;  5GQO A;  3HOY B;  3J80 E;  1L0Y B;  1A62 A;  3KF8 A;  1EU3 A;  3CQZ H;  3H09 A;  5IT9 c;  1QIL A;  5NUC A;  1BCP D;  3SR1 A;  2YV5 A;  5I6Y A;  3S2H H;  2Z6K C;  3GTP B;  1X6O A;  2RVL A;  3ERS X;  2LY7 A;  1U4L A;  2F0L A;  1KDC A;  3OIP A;  4G57 A;  1DM0 B;  2F52 A;  4AYB B;  1STH A;  1PYS B;  3W5O A;  5FLX L;  2R92 B;  1A2T A;  1CM9 A;  2UUA L;  1K73 C;  3I3C A;  4A93 H;  3G71 A;  3QOJ A;  1VQL A;  4IFD I;  5C3X A;  3HOX G;  3K5M A;  1IL8 A;  2PYK A;  5KND A;  3T51 B;  2HCI A;  3S1Q H;  5GAD C;  1WTH A;  5BR8 L;  2BE5 C;  2LKV A;  4X62 L;  4G7Z C;  1EWI A;  3A7L A;  1Y1W B;  5T1I A;  1SFO H;  5E4W C;  1E1O A;  4H7B A;  2NN6 H;  1JWM D;  1DXM A;  4GN3 B;  3HOV B;  5J39 A;  4H13 C;  1CTM A;  5D3D A;  4FF2 A;  3BVZ A;  2PW7 A;  2XRS D;  3BS1 A;  4Q0F A;  1STY A;  3DWA A;  1CA6 A;  2L12 A;  1LTI D;  2ICE C;  4DV6 L;  5C0X H;  2IL8 A;  2DY8 A;  3KLR A;  3JAM L;  1R4P B;  4A3D H;  1UE7 A;  4R8N A;  3AU7 A;  4N8F A;  3RR5 A;  4DV3 L;  1I94 L;  4DV7 L;  1D5X C;  3H91 A;  3S15 H;  1CHP D;  1J9O A;  4C3H G;  2VXW A;  3CCS A;  3EJI A;  1LT3 D;  1YNN D;  3P7J A;  1S3O A;  4TRD A;  2L4N A;  3M85 A;  2H4O A;  3NEN A;  4LFC Q;  3OWF A;  5IYB H;  1BF4 A;  5JPM C;  1ESF A;  1FD7 D;  1FGU A;  2DUD A;  1I4X A;  2NBF A;  3PMF A;  4K8J A;  2K50 A;  5JJK A;  2B2U A;  1NJI C;  3TRZ A;  3J81 j;  1D7Q A;  1IYV A;  1JOK A;  4H0L C;  2EJM A;  3DHQ A;  3UE1 A;  2JXM B;  1DGS A;  4X65 Q;  1EY5 A;  4LW1 A;  5DAU A;  4CKC A;  2F0I A;  2ZM6 L;  3PIP A;  4CJ0 B;  2F0U A;  4PNY A;  1SXT A;  4P73 A;  4S3S A;  4I65 A;  4JBM A;  4UPA A;  5DNF A;  4CDC C;  4JI5 L;  5C4J H;  1DJR D;  1I50 B;  2M9V A;  4BXX H;  3W1B A;  1SND A;  1TXY A;  2UXC Q;  1Y1V H;  1O7L A;  2X69 A;  4YIJ A;  4BBS G;  4DR1 L;  1T9H A;  1D5Z C;  4IFD J;  2KCM A;  2EYJ A;  4M8A A;  3CAM A;  4OO1 I;  1Y8N B;  2JSO A;  1F2Z A;  4KD4 A;  3J7Y W;  4JI6 Q;  2NTT A;  1Y14 B;  3KF8 B;  3CC7 A;  4KMU C;  4PZ7 A;  4A3F H;  3SK6 A;  2QW7 A;  5ELC A;  3TQY A;  4JI6 L;  1PH1 A;  4G7H C;  1PV4 A;  2RDF A;  4IOA A;  1K3B C;  3VR5 A;  1V1O A;  2HUG A;  3MXN A;  3GTK H;  4EGV A;  4RKL A;  5ELE A;  2NZO A;  4MHE A;  3Q0A A;  5C0X J;  1CKO A;  3P20 A;  1GD7 A;  3I7F A;  2IX1 A;  5G3L D;  4LMQ D;  1SRO A;  5JVH 3;  1BCP C;  5I2Y A;  1GUG A;  4GLA C;  5K36 H;  1CHQ D;  1EY0 A;  3MAQ A;  3M9B A;  1T5X D;  4DAV A;  1LT5 D;  1ICW A;  5TSS A;  2N88 A;  2Y0S E;  1T5E A;  3A56 A;  1HUM A;  4BY7 H;  1N36 Q;  2A68 C;  3MC0 B;  2BDO A;  4FF4 A;  3TS0 A;  2D0O A;  4A3C G;  1CUK A;  4LFC L;  3RN2 A;  1VF7 A;  1WCM H;  3I72 A;  4LF5 Q;  5HGT A;  3GDE A;  1VQI A;  1JMC A;  1G2S A;  3ULP A;  1CI3 M;  3HKZ E;  2WB1 B;  5JEA J;  2ZTE A;  3PO3 B;  4DR4 L;  5ELF A;  2FMC A;  1F9R A;  3GTM B;  3VA7 A;  2BCO A;  1WTX A;  2F03 A;  2SNM A;  1C8C A;  1JCK B;  4UP7 A;  3S1Q B;  1I3Q H;  4R4C A;  5IP7 H;  2JA5 B;  3TP6 A;  2L11 A;  3KLW A;  5CV5 A;  1CQV A;  2L15 A;  4GS3 A;  1Y1W H;  5JAV A;  4BBR G;  4FXG C;  1SE4 A;  2ZXP A;  3WOF A;  4JI1 Q;  5M9O A;  3M4Y A;  3QOL A;  3DM3 A;  3VYU A;  2JA6 H;  2E2D C;  2F0V A;  3GTG B;  1GVP A;  4DR5 Q;  2KCT A;  4XXE A;  2B2Y A;  3U50 C;  3TP5 A;  3R3O A;  3AMU A;  3JAM E;  1HUN A;  5M3F H;  1EQT A;  1XWE A;  4KKS A;  1PH3 A;  4LNQ A;  4HJ5 A;  4NXN Q;  3H0G B;  3C1E A;  4B3T L;  1SLJ A;  2EQS A;  2ZXR A;  2E2I B;  2A74 C;  4NPS A;  4IO9 A;  2EY5 A;  5M3F B;  3T1Y Q;  1GOZ A;  2H5X A;  4TKO B;  1RL2 A;  3TZD A;  5M5Y H;  1PTO H;  3QR8 A;  1YIT A;  4OX9 L;  2SOB A;  2CKZ B;  2F0S A;  2KED A;  4A3B B;  3D31 A;  4OIK A;  4DAY A;  1NR2 A;  3MXG A;  4UP9 A;  2B29 A;  1WOC A;  2DY7 A;  4L8J A;  2A6E D;  5C4X G;  4FVM A;  1XYI A;  1PHJ A;  1BCP B;  3F2U A;  4OGQ C;  5C3E H;  4JI5 Q;  1DOK A;  2AUK A;  1KRT A;  3GTQ B;  4BA2 I;  2MQH A;  3J7A F;  4DV1 L;  2IHF A;  1ZKO A;  3Q8D A;  3QJY A;  4YCW A;  5EKL A;  1UE6 A;  2K32 A;  4MZ9 A;  1O7Z A;  4X65 L;  3DMU A;  1EIG A;  2KHJ A;  4L63 B;  1HR0 Q;  5M5W B;  5IGE A;  2KBN A;  1CT1 D;  2K4K A;  2KVM A;  3OOC A;  2VUM B;  3HOU G;  4IN3 A;  5I6W A;  5KNC A;  3JAM i;  3QG1 A;  1JOO A;  1S40 A;  3UDX A;  3GTL B;  2O4X A;  5M5W H;  2CQO A;  2NWG A;  3T4A C;  2EDG A;  4RCN A;  1A2U A;  3TN2 A;  4GOP A;  3T56 B;  1PFB A;  1PH2 A;  1VQB A;  3MZ5 A;  1QUQ B;  3BZK A;  3QO2 A;  4UY8 C;  4P71 A;  1HZA A;  1SE3 A;  3HZX A;  3S9W A;  2K03 A;  1V9P A;  1GO3 E;  2VQE Q;  3AB9 A;  4A3M G;  3TDQ A;  2Q8I B;  2UUC L;  1LUZ A;  3DWP A;  2HHH Q;  2KEN A;  3HEJ A;  1ZEQ X;  1QG7 A;  5IP7 G;  4A3K H;  5M3F G;  4NMZ A;  4QIW B;  1EYA A;  4KY7 A;  2R61 A;  2B2W A;  1XMQ Q;  2CW0 C;  4GZY C;  2PQE A;  4QY7 A;  2G9H D;  1H9J A;  2F4I A;  5BR8 Q;  1E22 A;  1O7Y A;  2EYF A;  4NB3 A;  3L7Z C;  1I4Q A;  4B08 A;  2YTX A;  4X3S A;  3HKZ B;  4B3M L;  1S5C D;  1EQR A;  1A15 A;  1SDF A;  2R93 B;  5C6A A;  1W6J A;  1PZI D;  4LFB L;  5C3W A;  4IFD H;  4A3F B;  3P1H A;  1E7Z A;  2Z0S A;  1QOH A;  2Z8L A;  2PZU A;  1HFG A;  4YCU A;  2MNA A;  1GUT A;  2XRQ D;  1S5F D;  4POF A;  2N49 A;  4Y7N B;  1YI2 A;  3HOY G;  2RDH A;  4A3K G;  3HG9 A;  4RA8 A;  3SVM A;  4LFA L;  4QB4 A;  1YJ9 A;  3HOU H;  3E9I A;  1HCZ A;  3HRZ C;  1FL0 A;  3AYH B;  4QJF A;  1TQO A;  2R92 G;  1J6Q A;  3FKI G;  3M3Y H;  1BNZ A;  2MO1 A;  3A54 A;  3N52 A;  4DR7 Q;  1K8O A;  2MHV A;  4ZLT F;  1AEX A;  5C4J B;  3I56 A;  1HQM C;  1SEB D;  2RHQ B;  4DF7 A;  3NTH A;  5DM7 3;  1B1Z A;  2IY5 B;  5KRU A;  2L1B A;  4GNX C;  1WTW A;  2NN6 I;  1X3P A;  2OQ0 A;  3ERQ A;  1WTO A;  1PA6 A;  1MJE A;  5LL6 S;  1AH9 A;  3K57 A;  4ODG A;  4K8I A;  4DR3 L;  4O0A A;  2X6G A;  3CKI B;  1QVG A;  3ND8 A;  1KDB A;  4DV0 Q;  2NVY H;  3RD4 A;  2AHO B;  1GHK A;  1NMF A;  4FXK C;  2UUB L;  1SYB A;  4K6D A;  3D4W A;  4OO1 H;  5I4D A;  4P72 A;  2B63 H;  2CWA A;  2L55 A;  2K14 A;  4F88 A;  3S17 B;  1BBU A;  3C1F A;  3I4L A;  4K2K A;  5CGK A;  2QKI C;  4CJ2 C;  2FIN B;  1IBL Q;  3P75 A;  2WB1 G;  5CV8 A;  1PYB A;  1L0W A;  3WDN A;  2WAQ E;  3I4O A;  1HNX Q;  3PO2 H;  4RCO A;  5HY6 A;  5LHY 1;  3SXH A;  1VDZ A;  4DV4 L;  4YWM A;  2PQA A;  1YNJ D;  2WII B;  4HJ9 A;  1JE4 A;  1SYE A;  3GV3 A;  3L9A X;  1KNE A;  3U9O A;  2VQE L;  4ME3 A;  3KJP A;  3OYY A;  1Q1B A;  1TWA B;  4IPG A;  4H44 C;  4KN7 C;  4O42 A;  4XTC S;  1NNX A;  2JJQ A;  3WOE A;  1TS2 A;  1MBY A;  1OXU A;  1X32 A;  5C4X H;  1IYU A;  2A6H D;  3D4R A;  4QIW E;  3H3V H;  5JOB A;  2QIL A;  3RLO A;  1HXY D;  3HOW B;  1EWH A;  1PRT F;  2GVA A;  2YYZ A;  2QA4 A;  1KL9 A;  3EIV A;  3CCL A;  3I4N G;  1ROD A;  1YHA A;  4GKJ L;  3PUW A;  1K8G A;  3GD7 A;  5EPK A;  1CKM A;  2NVX B;  5K5P A;  4F8M A;  1HR0 L;  1KLG D;  1LTL A;  3RZD H;  4C3J G;  3BG3 A;  1XTC D;  3BJU A;  1NY4 A;  1S5E D;  3G6J B;  1XNR Q;  2E2H H;  4JPB W;  1TWC H;  1WVL A;  1D5M C;  3LWU A;  1I6V C;  4OL7 A;  2KQ3 A;  3S2H B;  4AIM A;  1S4Z A;  1OXX K;  4OWW B;  3NXW A;  1LAB A;  5EPJ A;  2HDL A;  3IKJ A;  3GTG H;  2LMC B;  2JEB I;  1LYL A;  1FR3 A;  2KA7 A;  4A3J B;  2SDF A;  2B3G A;  3S16 B;  4C1N I;  2OF1 A;  4MTK A;  1BVS A;  1UAP A;  4A3G B;  3KLS A;  3I91 A;  4K0K Q;  2JA8 B;  2AWO A;  1BQQ T;  4PG3 A;  2X6L A;  1SMY D;  2QGQ A;  2G9D A;  1VQM A;  2CFM A;  4NKL A;  4NXM L;  2AKW B;  4JYA Q;  1BR9 A;  3PV0 A;  3S16 H;  1CKN B;  4A3L H;  1M4V A;  3BZD B;  3CC2 A;  2EYL A;  5K36 G;  1PTO B;  2CHB D;  1IZ6 A;  2JQO A;  4XT1 B;  3E3X A;  1TKW B;  3I90 A;  4OEL B;  4OIJ A;  4Q5V A;  1OXS C;  1I6H H;  2YTY A;  5FK9 C;  4LF8 Q;  2B2V C;  1AE2 A;  4DR5 L;  3I70 A;  2NVT H;  1GUS A;  2B2T C;  2K5N A;  3CW2 C;  2CCZ A;  4BY1 B;  4BA1 I;  1RF2 D;  3FDT A;  2WKC A;  3OSO A;  4RKB A;  4DNT B;  3CME A;  1GXD C;  4OHJ A;  1DZ1 A;  1YVC A;  3FPU B;  4IUT A;  3GTO B;  4C3I H;  4X3K A;  1STN A;  4A3D B;  4G7O C;  1PH8 A;  1JQY D;  3H15 A;  1JOQ A;  4DR4 Q;  3Q22 A;  4HMI A;  1HA5 A;  1PTO D;  5JVG 3;  1TT2 A;  3ZYY X;  3G4S A;  1XX8 A;  2K5H A;  4LF9 Q;  2NN6 G;  4X64 L;  2NVQ H;  4HIO A;  3D3R A;  2UU9 L;  1F2Y A;  1EY9 A;  4DNI A;  2K1B A;  1GJX A;  4CDF C;  5FLX E;  2E5L L;  1EQQ A;  2JA8 H;  1WCM G;  1RIP A;  4KKT A;  5M5Y B;  5C0X G;  1RHP A;  3OPO A;  2KEE A;  1MSH A;  5EKI A;  4JW0 A;  2K04 A;  2JA5 G;  4RMF A;  1IBK L;  4O1N A;  1XPR A;  1KNA A;  4L5S A;  2RKS A;  1Z9F A;  1LTS D;  1TU2 B;  1Y1W G;  3DEO A;  3BVM A;  3H94 A;  2B2Y C;  5BN5 A;  3K7U C;  3GQB A;  4RFB A;  3I4M B;  4Z9C B;  3G7L A;  4ULL A;  4X6A H;  3GO5 A;  1KC8 C;  2K33 A;  3I2Z A;  4JK1 C;  3R2I A;  1X56 A;  4A3I G;  2ZJR A;  1TWH H;  2IX3 A;  3HOX H;  3F2C A;  1SYF A;  1RTO A;  1DON A;  1TWG B;  2EYP A;  5DM6 3;  4UDU C;  2HQE A;  3C2P A;  1TWF H;  3NQT A;  4FDB A;  2IT1 A;  5GAG C;  4GLX A;  4KHP Q;  1HA6 A;  2Q8T A;  4K2L A;  5IGD A;  1K3R A;  1H9M A;  4X3T A;  1NSN S;  3JAM c;  5D3I B;  2O5J C;  5IOD A;  1VQ4 A;  1JJG A;  5H1S E;  5D14 A;  2K5V A;  1PRT C;  4KV6 A;  4E6I A;  4KY5 A;  2PO4 A;  3SEB A;  2GVB A;  1A8V A;  1YNN C;  4DR1 Q;  3BU2 A;  1ICF B;  3GTK B;  5C4H A;  1Q81 C;  2R93 G;  3LX0 A;  1LLR D;  5CYU A;  1EL0 A;  3EFX D;  4DK0 A;  1PDQ A;  2JE6 I;  4RH6 A;  4HED A;  1QZH A;  4JI4 Q;  1XPU A;  4DK6 C;  4JI3 L;  3RZD B;  4B9X A;  4AYB G;  1LAC A;  3GTP H;  4YY3 L;  5L37 A;  4X64 Q;  4LF9 L;  4EQO A;  2E2H B;  1JC7 A;  2ATW A;  2PPB C;  4HCS A;  2IJ0 A;  1CSQ A;  1G2T A;  2K5W A;  4DV3 Q;  1G29 1;  2QEJ C;  5KYL A;  2XGT A;  2LXJ A;  4U67 3;  4NDX A;  3CCQ A;  5FLM H;  5COR A;  1Q1E A;  2PMZ B;  1CFM A;  5M5X B;  1C7Y A;  1CK1 A;  2EJG C;  1HTP A;  5G3L F;  4C2M H;  2JYO A;  4DV6 Q;  3NHH A;  4JI0 Q;  2BDN A;  4DV4 Q;  4ALP A;  4JVZ A;  1WCM B;  1WTP A;  1BCP F;  4ZUJ A;  5KYI A;  4L5R C;  1KQS A;  3X3N A;  4R1J A;  1DD2 A;  2EVB A;  1ILQ A;  1SFO B;  1UEA B;  4MNO A;  4UP8 A;  1QWY A;  2AQ1 B;  1U4R A;  3E0E A;  4A3E G;  3PO2 G;  2K75 A;  2B2V A;  3I73 A;  3KK7 A;  4HSV A;  2Z6K A;  4RG1 A;  1PTO C;  1FNU A;  5EAY A;  4DV0 L;  3BDO A;  1X3Q A;  1Y69 U;  4OEM B;  2B63 B;  3NTK A;  1Y1V B;  3E5S A;  3QB3 A;  3C46 A;  4GOP B;  1PFS A;  1ASY A;  1W2B A;  1FYC A;  1ESR A;  2F3V A;  2A73 B;  1RD9 D;  5IGB A;  3NPP A;  3M3Y B;  3L0O A;  3GP7 A;  2A1A A;  3TP8 A;  1RCV D;  3VYR A;  4QMG A;  3RN5 A;  3D4D A;  4ZYS A;  5LL6 X;  4DUZ L;  2N8N A;  1I4P A;  3TP7 A;  1A3U A;  2PW5 A;  2L5T A;  1JWU D;  1VQ8 A;  2XSC A;  3CCV A;  2V1C C;  1MI2 A;  1XNR L;  1TWG H;  2H1E A;  3PUY A;  5IYD G;  3GTJ B;  5E4X A;  3CU7 A;  4WFN 3;  3FKI H;  2DNC A;  1XNQ L;  1LV9 A;  2ASB A;  2WB1 E;  4DR2 L;  3Q6S A;  1D1I A;  2K05 A;  2TMP A;  1B70 B;  3PUZ A;  2A6H C;  3Q24 A;  1IW7 C;  5EPL A;  2L0C A;  5I9O A;  4QQB X;  3NEM A;  1YNJ C;  1QVC A;  1LM0 A;  1W3S A;  3CPW A;  2PZT A;  3ER0 A;  1IW7 D;  3IL8 A;  2BA0 A;  1JB3 A;  4LF6 Q;  3KF6 B;  2C9O A;  2UXB Q;  2VW9 A;  4DV2 Q;  2RDG A;  3F8T A;  4GOP C;  1STE A;  5IWA Q;  2D5D A;  4BY1 G;  1EY6 A;  3S1R B;  1B3Q A;  4AYB E;  1X9N A;  4QUC A;  3QIA A;  1M90 C;  4DAY B;  5EBC A;  2B2T A;  1M1K C;  2J0T D;  1GUO A;  2EXD A;  3L3O C;  1YJN A;  2R93 H;  1BDO A;  3H0G G;  3KUP A;  4LUO A;  1PFM A;  2RSO A;  3LWE A;  1JIC A;  1IKL A;  1CQF A;  1IBM Q;  4BXX G;  1I4R A;  1U0L A;  3MVV A;  4IUU A;  2Z6B A;  2F3I A;  1Y1V G;  1N34 L;  3J81 L;  1EY8 A;  3I8Z A;  1D6E C;  2R92 H;  2PNH A;  2ZJP A;  2BH2 A;  1U4M A;  2F0Q A;  2MO0 A;  4IPC A;  2M00 A;  4DPG A;  5BN3 A;  3KBG A;  4OWX B;  1AN8 A;  3NBH B;  3OWE B;  3PIP 3;  4ZKC B;  2YU9 B;  2EXZ A;  3K5N A;  4GLV B;  3SK4 A;  3HOW G;  5JJZ A;  4JBJ A;  4AQY L;  2UXD Q;  1O7I A;  5LMN W;  4BBS H;  2F0O A;  4O2D A;  2ZJQ A;  4ZKB B;  4XYO A;  3DWQ A;  2E75 C;  1QE6 A;  2YU9 H;  1C48 A;  1EU4 A;  2JA7 G;  5ISR A;  5DLQ E;  3D6W A;  3HOV H;  1VQ7 A;  1B44 D;  4ME5 A;  5KNB A;  2I5L X;  1A3V A;  4DR7 L;  1HFN A;  3S2D H;  2UXB L;  5FO7 B;  1XNQ Q;  1PZK D;  4WOR A;  3KDF B;  4YWK A;  2XWB B;  5LMN Q;  1BBX C;  4A4I A;  3EN2 A;  1SYD A;  3LGJ A;  3OMC A;  3J7Z C;  2QCP X;  3BZC A;  5KIX A;  2LXK A;  4A3I H;  1S5D D;  3G48 A;  4L5T A;  4P2C B;  4RHR A;  1PMR A;  4QGU A;  1PH6 A;  4WJW A;  2CH4 A;  2JA6 B;  3GV6 A;  4FNF A;  3Q23 A;  2F0G A;  3U4V A;  4FYD A;  5F2D A;  1HNW L;  2E8G A;  1SSO A;  1I50 H;  1MSG A;  3S24 A;  5IIF A;  4OX9 Q;  2OTL A;  3STB C;  1JT8 A;  4CBV A;  5I2X A;  1SN8 A;  5IY0 A;  4B3M Q;  2R7F A;  1PH4 A;  2IWH A;  3URY A;  2PZW A;  5C0X I;  2BA1 A;  4LUV A;  4IUQ A;  1MD2 D;  4DXG A;  2EY1 A;  4X66 Q;  1ZYR C;  1TWA H;  1PH9 A;  4RGM A;  4EQ5 A;  1GKH A;  1N32 Q;  5M5X H;  1K8A C;  2J7Z A;  1P16 A;  5IGG A;  3A5U A;  4APV A;  3H3V I;  1KD1 C;  4DXF A;  4XQN A;  1K28 A;  3S1R H;  1BXT A;  2R7D A;  4KJN A;  3VR2 A;  4JI1 L;  2CVR A;  4IJH A;  1SJE D;  2BE5 D;  3PO3 H;  5GRO A;  4L5Q A;  2SEB D;  2KCC A;  2ID0 A;  4IUR A;  2JA7 B;  3F2D A;  1EYG A;  5M3M H;  3NBH A;  4PV1 C;  2NB0 A;  2HT1 A;  2JEA I;  1LT4 D;  3HOZ G;  3OIQ A;  4HTH A;  5BN4 A;  4A3K B;  2KUM A;  3S17 H;  1PLF A;  4B9W A;  1EEF D;  4I7Z C;  4GNX B;  1PZJ D;  4DUY L;  1KTK A;  1IXR A;  3ICE A;  2WKD A;  2D9U A;  1STB A;  1Q82 C;  1WD0 A;  1F9P A;  1VMC A;  4JI4 L;  2AQ3 B;  1MIU A;  1IYJ B;  4V19 0;  4R8I A;  3RNU A;  3PF5 A;  1R4Q B;  2RSN A;  1CKN A;  1B8A A;  4ZQ3 A;  1IHZ A;  2Q2I A;  5IP9 H;  1P8L A;  1D1K A;  5FLM G;  4XQQ A;  2DGY A;  1YNX A;  4YY3 Q;  5JJI A;  1MJC A;  1SYC A;  5C4X B;  2BH8 A;  4I7A A;  2P5Z X;  2PCF B;  3GTJ H;  4IOC A;  1L0X B;  1JB7 A;  3J7A V;  2RBM A;  4KHP L;  3K5L A;  4K5X A;  4R4Q A;  3PSI A;  5KEE A;  1JR0 D;  3MWY W;  5AFW A;  1PRT D;  2KHS A;  1I4G A;  2FFK B;  4DV5 L;  1AZP A;  4BY1 H;  4LK1 C;  1RDP D;  3VR6 A;  3RUZ A;  4CDE C;  4ID6 A;  4HIM A;  3T1Y L;  5FO8 B;  1YIJ A;  5FO9 B;  3HP3 A;  4JC0 A;  4IUV A;  3S1N H;  1DYQ A;  2AMC B;  3S15 B;  1EQV A;  4NXN L;  3NSW A;  4U68 A;  1PXU A;  2LSS A;  4B3S L;  1UE1 A;  2CH4 W;  3TZU A;  1UUP A;  4A3F G;  4XT3 B;  3RLN A;  2PQA B;  1J5E Q;  1IBK Q;  4MIU A;  5C5M A;  4DU9 A;  2XVS A;  4C3J H;  1R9T B;  2F0T A;  2B63 G;  3NTI A;  3B6Y A;  2UXC L;  3DM1 A;  2B39 A;  3TSS A;  5A35 A;  4KD3 A;  4GKK Q;  1LTG D;  3NQI A;  4HSP A;  3W1G A;  3AQQ A;  3W3A A;  1SNP A;  4LF7 Q;  2VB2 X;  4GN4 B;  4MTN A;  5C44 H;  4HID A;  2ZM6 Q;  3DXJ C;  2UU9 Q;  4IZ8 A;  1HQR D;  2B2W C;  3ITP A;  2FMM A;  3CHB D;  1VF5 C;  5JPN C;  1GM5 A;  3J80 c;  3I4M G;  2XTI A;  1LTT D;  1HR0 W;  2K5D A;  3NP8 A;  3TS2 A;  2PI2 A;  4JV5 L;  3RMH A;  3HOU B;  2GN5 A;  2WV6 D;  1KIX A;  1QJO A;  1KLU D;  4IJL A;  4RGT A;  3W2D A;  4WJ3 M;  5C5L A;  1B9N A;  5GAE C;  3A7A B;  4YWL A;  3NBI A;  3TEH B;  2HCC A;  5M3M B;  1L2F A;  3M7G A;  1TR5 A;  5IGC A;  2VB3 X;  4WRD A;  3SHL A;  5FJ8 G;  1H95 A;  1Q86 C;  4LF8 L;  4F87 A;  4A93 G;  2E2J B;  1IKM A;  5JEA G;  1VQJ A;  1EIY B;  1TWF B;  2F0K A;  2B8F A;  3CQZ B;  4A3J H;  2F0J A;  1QVF A;  4H02 A;  4LF7 L;  2E2J H;  4LAA A;  2Y0S G;  4JYA L;  4Y52 H;  4N9T A;  4NXM Q;  1UWV A;  5LMU L;  4A3G G;  2MGS A;  2A5H A;  4C3I G;  1DOL A;  4AH6 A;  1SBB B;  1H9R A;  1Q90 A;  3J80 L;  2VQF L;  4J15 A;  1SNM A;  1F9S A;  3K58 A;  2DNE A;  4ZK9 B;  3ZJY C; 
#chains in the Genus database with same CATH homology
 4YY3 L;  3TRE A;  1PH3 A;  4X64 Q;  1G6P A;  4LF9 L;  4LNQ A;  4HJ5 A;  3UDG A;  4NXN Q;  3DLL A;  4B3T L;  1SLJ A;  2ATW A;  2EQS A;  3PF4 A;  4YHH L;  3CP0 A;  2VNU D;  1CSQ A;  4NPS A;  4IO9 A;  1C0A A;  4DV7 Q;  3T1Y Q;  2H5X A;  1NMG A;  4Y7N H;  5AJ3 L;  1G29 1;  4DV3 Q;  4DR6 Q;  2XGT A;  2LXJ A;  1RL2 A;  2JA8 G;  5M5Y H;  3CCR A;  1YIT A;  3CCQ A;  5FLM H;  4DV5 Q;  1Q1E A;  4KLK A;  4OX9 L;  4B3R Q;  2CKZ B;  3OTO L;  2WFW A;  5IP9 G;  1C7Y A;  4A3L G;  3D31 A;  1L1O A;  4C2M H;  3RZO H;  4DV6 Q;  3CCE A;  1SMX A;  4JI0 Q;  4DV4 Q;  2WP8 J;  4ALP A;  4L5R C;  4UP9 A;  1PH7 A;  1KQS A;  1HNX L;  2B29 A;  4A3G H;  1WOC A;  5C4X G;  4R1J A;  1FJG Q;  1Q46 A;  3I4M H;  1IBL L;  1PHJ A;  5C3E H;  4JI5 Q;  4MNO A;  1KRT A;  4BA2 I;  4UP8 A;  1I94 Q;  2MQH A;  3E0E A;  4A3E G;  2OQK A;  2VZA A;  4YCV A;  4DV1 L;  3PO2 G;  2K75 A;  2IHF A;  4PZ6 A;  2C35 B;  3PCO B;  3Q8D A;  4GNX A;  1PH5 A;  4YCW A;  5ELO A;  4X62 Q;  1UE6 A;  2Z6K A;  2VUM H;  4MZ9 A;  4RG1 A;  4X65 L;  1VQO A;  1U5K A;  5EAY A;  2PMZ E;  2OTJ A;  2A19 A;  4DV0 L;  2KHJ A;  1HR0 Q;  4BBR H;  1X3G A;  2KBN A;  1B7Y B;  1E24 A;  1VQE A;  2K4K A;  3PIO A;  3HOU G;  1UE5 A;  4K0K L;  4A76 A;  3JAM i;  1NBW A;  1L1O B;  4OON A;  1S40 A;  3UDX A;  2I0Q A;  4GOP B;  5M5W H;  1PFS A;  3CC4 A;  1ASY A;  1W2B A;  2CQO A;  2RF4 A;  2OWO A;  5FJ8 H;  2FXQ A;  4GOP A;  1PH2 A;  4DK3 C;  3T1H Q;  3L0O A;  1VQB A;  2RHS B;  1KAW A;  2A1A A;  4X66 L;  2RCN A;  1X3F A;  4DUY Q;  1QUQ B;  3BZK A;  4PMW A;  3HOW H;  4A3M H;  3RN5 A;  3RLF A;  4DUZ L;  4UY8 C;  4AQY Q;  1XTD A;  2N8N A;  1VS0 A;  4P71 A;  3M4O H;  1HZA A;  1VQ5 A;  3OW2 A;  1V9P A;  1VQ6 A;  4KHZ A;  1E3P A;  1GO3 E;  1Q7Y C;  1VQ8 A;  2VQE Q;  4A3M G;  2HIX A;  2F4V L;  3CCV A;  2V1C C;  2UUC L;  1XNR L;  1TWG H;  3PUY A;  1LUZ A;  5IYD G;  5M3M G;  4POG A;  1AE3 A;  5C44 G;  2HHH Q;  1HNW Q;  2KEN A;  4R4T A;  2KHI A;  4IFD G;  4LFA Q;  3FKI H;  1VQF A;  2MFI A;  2VL6 A;  4JBK A;  3S1M H;  3KJO A;  4TQU S;  5E7N A;  3ULJ A;  1XNQ L;  1N33 L;  2IHE A;  2VS1 A;  4C3H H;  1HZC A;  4JI8 Q;  5IP7 G;  2WB1 E;  1Q12 A;  4DR2 L;  4A3J G;  4A3K H;  1S72 A;  2ASB A;  1OXT A;  5FLX c;  5M3F G;  1B70 B;  4GN5 A;  3PUZ A;  1N8R C;  2E2I H;  1A0I A;  1X3E A;  1XMQ Q;  1HNZ Q;  1N32 L;  1PVO A;  4QQB X;  1G51 A;  1WYD A;  4QY7 A;  3NEM A;  3HFZ B;  3CPF A;  1QVC A;  1KRS A;  1LM0 A;  1W3S A;  1BKB A;  4JOI C;  1K83 H;  3AFP A;  4OWT B;  2N78 A;  5BR8 Q;  3CPW A;  3ER0 A;  4LFB Q;  1E22 A;  2R7Z H;  4NB3 A;  4A3D G;  2BA0 A;  3KYH C;  5IYC H;  4LF6 Q;  3L7Z C;  3KF6 B;  2YTX A;  2NZH A;  4DR3 Q;  4DV2 L;  2UXB Q;  2N3S A;  1YJW A;  4B3M L;  2VW9 A;  4DV2 Q;  1EQR A;  3F8T A;  4GOP C;  3HOZ H;  1YBY A;  5IWA Q;  4JBW A;  3PUX A;  1CSP A;  4BY1 G;  2UUA Q;  3WWV A;  2JA9 A;  4AYB E;  1X9N A;  4LFB L;  4IPD A;  4JI7 L;  1SR3 A;  1M90 C;  1WJJ A;  1XMO L;  3HOY H;  4DAY B;  4LF4 L;  3K81 C;  3GTL H;  1M1K C;  1E7Z A;  2Z0S A;  4YCU A;  2EXD A;  1N34 Q;  1YJN A;  3A0J A;  2R93 H;  2MNA A;  3H0G G;  4LUO A;  1YHQ A;  2PI2 E;  4JCV E;  2N49 A;  4POF A;  1YI2 A;  3HOY G;  1IBM Q;  2UXD L;  1NE3 A;  4A3K G;  2K52 A;  3UE0 A;  4BXX G;  3EBE A;  1U0L A;  1JJ2 A;  2F3I A;  1Y1V G;  1YHB A;  3STB D;  1N34 L;  1VQ9 A;  1HH2 P;  4LFA L;  5IE8 A;  2R92 H;  2PNH A;  2ZJP A;  2UUB Q;  1YJ9 A;  4LF4 Q;  2BH2 A;  3J80 i;  1V43 A;  1YZ6 A;  5LMN L;  3HOU H;  2MO0 A;  3E9I A;  4IPC A;  2UUC Q;  5IYD H;  4DPG A;  4A3E H;  3S14 H;  4LUZ A;  1WI5 A;  1FL0 A;  3AYH B;  4QJF A;  2OCE A;  2R92 G;  1J6Q A;  3FKI G;  4OWX B;  3M3Y H;  3NBH B;  3J7A 5;  2MO1 A;  4DR7 Q;  4A75 A;  2ZTC A;  4GLV B;  2ALY B;  3K7A H;  3HOW G;  3FP9 A;  4KI0 A;  4JBJ A;  4AQY L;  1IBM L;  2JA6 G;  1O7I A;  5LMN W;  2UXD Q;  4BBS H;  3I56 A;  4R4O A;  4O2D A;  3CCM A;  1VQD A;  2ZJQ A;  2RHQ B;  4R4I A;  1A63 A;  1JE5 A;  3T1H L;  2YU9 H;  1EIF A;  2JA7 G;  3G6E A;  5DLQ E;  1X65 A;  3AFQ A;  5ELN A;  1XMO Q;  2IY5 B;  3HOV H;  4GNX C;  1WFQ A;  3KF6 A;  1VQ7 A;  2NN6 I;  3GTQ H;  4BY7 G;  2OQ0 A;  3UDF A;  1PA6 A;  1MJE A;  2I5L X;  3A5Z B;  1AH9 A;  4DR7 L;  4A3C H;  3PUV A;  3K0X A;  2CWP A;  1N33 Q;  3S2D H;  3KDF A;  2UXB L;  1XNQ Q;  4DR3 L;  1ASZ A;  4O0A A;  4DAM A;  2Q2U A;  5IYB G;  1QVG A;  3KDF B;  4YWK A;  4DV0 Q;  5LMN Q;  1I5F A;  2VUM G;  2NVY H;  4A4I A;  2AHO B;  3IRB A;  3M4P A;  2I5M X;  1N9W A;  1NMF A;  3U4Z A;  4DKA C;  2UUB L;  3EN2 A;  2QEX A;  1Z47 A;  5GQO A;  3LGJ A;  1A62 A;  4P72 A;  2B63 H;  2CWA A;  3J7Z C;  3CQZ H;  2K14 A;  5IT9 c;  1BBU A;  1XMQ L;  3BZC A;  1IBL Q;  1FVI A;  2YV5 A;  3KFU A;  2LXK A;  2WB1 G;  1PYB A;  1L0W A;  4A3I H;  3S2H H;  2Z6K C;  3G48 A;  1X6O A;  3ERS X;  4L5T A;  1VQN A;  2WAQ E;  4OO1 G;  3I4O A;  1HNX Q;  1PH6 A;  4QGU A;  3J81 i;  3PO2 H;  2IX0 A;  2HIV A;  5HY6 A;  2F52 A;  4DV4 L;  1XJV A;  2R6G A;  4YWM A;  2PQA A;  3U4V A;  1EOV A;  4HJ8 A;  4HJ9 A;  3HKS A;  1PYS B;  2HHH L;  1HNW L;  1NTG A;  3W5O A;  4JI7 Q;  2E8G A;  1I50 H;  1C9O A;  3S24 A;  1BBW A;  2UUA L;  4OX9 Q;  2OTL A;  1K73 C;  3STB C;  1JT8 A;  5IWA L;  3F2B A;  2VQE L;  4ME3 A;  4A93 H;  1SN8 A;  5IY0 A;  1K0R A;  3KJP A;  3G71 A;  2R7F A;  3OYY A;  1Q1B A;  4IPG A;  5AJ3 Q;  1PH4 A;  1VQL A;  4B3M Q;  3M7N A;  4IFD I;  3FHW A;  3HOX G;  4LF6 L;  4EX5 A;  4XTC S;  1D8L A;  1HJP A;  2JJQ A;  5IYC G;  5C0X I;  3S1Q H;  1OTC A;  2BA1 A;  4LUV A;  5BR8 L;  5GAD C;  4X62 L;  1OXU A;  4X66 Q;  5C4X H;  1SRU A;  3CMA A;  1TWA H;  1EWI A;  1VCI A;  1PH9 A;  4EQ5 A;  1SFO H;  1GKH A;  1HNZ L;  4QIW E;  5M5X H;  1E1O A;  1K8A C;  3RLO A;  3H3V H;  1N32 Q;  1P16 A;  1HZB A;  4GN3 B;  4APV A;  3A5U A;  2GVA A;  2YYZ A;  2QA4 A;  1KL9 A;  3H3V I;  3EIV A;  1KD1 C;  3CCL A;  3I4N G;  4DR2 Q;  4JI8 L;  1YHA A;  3S1R H;  3PUW A;  2R7D A;  4GKJ L;  1K8G A;  3GD7 A;  1CKM A;  1E1T A;  4JI1 L;  4IJH A;  2A8V A;  1HR0 L;  4DV6 L;  1YEZ A;  3GTO H;  3PO3 H;  1LTL A;  5GRO A;  3RZD H;  1KHI A;  4L5Q A;  4TVA B;  2ID0 A;  4A3D H;  1UE7 A;  3BJU A;  2ZTD A;  4IPH A;  1NY4 A;  3F2D A;  1EYG A;  5M3M H;  1VQK A;  1XNR Q;  2E2H H;  3I4N H;  1TWC H;  2F4V Q;  1VQP A;  3RR5 A;  4DV1 Q;  3L2P A;  4DR6 L;  4DV3 L;  1I94 L;  2HT1 A;  2JEA I;  3S17 H;  4DV7 L;  3HOZ G;  4AIM A;  3D0F A;  3S15 H;  3CD6 A;  4JI2 L;  1OXX K;  4OWW B;  2JA7 H;  4B3T Q;  4DUZ Q;  3KOJ A;  3CCS A;  4GNX B;  1FJG L;  3PO3 G;  4DUY L;  1IXR A;  1HZ9 A;  2JK8 A;  1S3O A;  3GTG H;  3GTM H;  3ICE A;  1Q82 C;  4A3B H;  2JEB I;  1LYL A;  3M85 A;  3MEF A;  3NEN A;  1XPO A;  4JI4 L;  4LFC Q;  5IYB H;  1MIU A;  1IYJ B;  4P74 A;  1FGU A;  2DUD A;  2VQF Q;  2B3G A;  5JJK A;  2K50 A;  2Q2T A;  3OTO Q;  1BVS A;  4K0K Q;  1NJI C;  3TRZ A;  2I5H A;  3RNU A;  2AWO A;  1L1O C;  4PG3 A;  3J81 j;  3PF5 A;  4P75 A;  2QGQ A;  3CCU A;  1CKN A;  1B8A A;  1D7Q A;  3K80 C;  1VQM A;  2CFM A;  3HOV G;  4NXM L;  2AKW B;  4JYA Q;  3PV0 A;  4YHH Q;  3S16 H;  1CKN B;  2Q2I A;  5IP9 H;  4A3L H;  3UE1 A;  1DGS A;  3A74 A;  1P8L A;  4X65 Q;  5FLM G;  4LW1 A;  3CC2 A;  1QUQ A;  5K36 G;  2DGY A;  1YNX A;  4YY3 Q;  3PIP A;  2ZM6 L;  1IZ6 A;  5JJI A;  2JQO A;  3CF5 A;  4P73 A;  1MJC A;  4JBM A;  2BH8 A;  4UPA A;  1I6H H;  3GTJ H;  3VDY A;  4JI5 L;  1OXS C;  5C4J H;  2YTY A;  2D0P A;  4LF8 Q;  4QL5 A;  1AE2 A;  3H0G H;  4IOC A;  1JB7 A;  4KHP L;  4DR5 L;  5JJL A;  4BXX H;  3AEV A;  3W1B A;  4LF5 L;  2NVT H;  1TXY A;  2UXC Q;  1EFW A;  4HIK A;  1Y1V H;  2K5N A;  3CW2 C;  3PSI A;  4R4Q A;  2CCZ A;  3NEL A;  4DR1 L;  4BBS G;  4BA1 I;  1T9H A;  5LMU Q;  4JI0 L;  4IFD J;  3CME A;  2KCM A;  2NVX H;  4A3B G;  1YVC A;  3CAM A;  4C3I H;  1N36 L;  4B3R L;  4OO1 I;  4DV5 L;  2YTV A;  4LWC A;  4BY1 H;  4JI6 Q;  1PH8 A;  1Y14 B;  3H15 A;  1Q8K A;  4HIM A;  3KF8 B;  3CC7 A;  1VQC A;  3T1Y L;  4DR4 Q;  4WJ4 A;  1MKH A;  4PZ7 A;  4A3F H;  1X55 A;  3G4S A;  1YIJ A;  4JC0 A;  3S1N H;  2AMC B;  2K5H A;  3TQY A;  4JI6 L;  4NXN L;  1KXL A;  1PH1 A;  4LF9 Q;  2NN6 G;  4X64 L;  2NVQ H;  4HIO A;  2UU9 L;  2LSS A;  1PV4 A;  4B3S L;  4DNI A;  1UE1 A;  4XIG S;  4IOA A;  4A3F G;  4JI3 Q;  2JA5 H;  3RLN A;  3GTK H;  2PQA B;  1J5E Q;  1IBK Q;  2E5L L;  1EQQ A;  2NZO A;  4GKK L;  1VQA A;  4C3J H;  1WCM G;  5GAH C;  1RIP A;  3MXN B;  2ES2 A;  2B63 G;  3B6Y A;  2JA8 H;  2UXC L;  5C0X G;  5C0X J;  1CKO A;  3ULL A;  1GD7 A;  3I7F A;  3CXC A;  2IX1 A;  4JV5 Q;  4GKK Q;  1SRO A;  2JA5 G;  4RMF A;  3W1G A;  3AQQ A;  1J5E L;  1IBK L;  1XPR A;  3K8A A;  4LF7 Q;  2HQL A;  4L5S A;  4GN4 B;  4GLA C;  3U58 A;  1Z9F A;  4MTN A;  4PZ8 A;  5C44 H;  2WAQ G;  2ZM6 Q;  4HID A;  1Y1W G;  2UU9 Q;  3JC6 6;  1GM5 A;  1UEB A;  3M9B A;  3K7U C;  1K9M C;  3J80 c;  1IL2 A;  3I4M G;  5HGQ A;  2R7Z G;  4HJ7 A;  2XTI A;  3I55 A;  4X6A H;  3GO5 A;  1KC8 C;  3I2Z A;  1HR0 W;  1X56 A;  5J3B A;  3TS2 A;  2Y0S E;  2PI2 A;  4A3I G;  4JV5 L;  2ZJR A;  4HJA A;  2GN5 A;  4BY7 H;  1TWH H;  3HOX H;  1KIX A;  4IJL A;  1N36 Q;  4WJ3 M;  3F2C A;  5GAE C;  3TS0 A;  1V1Q A;  2D0O A;  4YWL A;  4A3C G;  3M4Q A;  3TEH B;  1CUK A;  3SGI A;  4LFC L;  4OXP A;  1L2F A;  3RN2 A;  4B3S Q;  1TWF H;  3UDI A;  4FDB A;  1WCM H;  2IT1 A;  4LF5 Q;  5GAG C;  3GDE A;  4GLX A;  1VQI A;  5FJ8 G;  4JI2 Q;  1Q86 C;  1JMC A;  1JJC B;  3ULP A;  4KHP Q;  1H95 A;  3HKZ E;  4LF8 L;  1OXV A;  2ZTE A;  2Q2H A;  1X54 A;  5JEA J;  4A93 G;  4DR4 L;  5JEA G;  1VQG A;  1VQJ A;  1EIY B;  4JOI A;  1K3R A;  1QZG A;  4UP7 A;  3JAM c;  1VQ4 A;  1I3Q H;  3E9H A;  1EUJ A;  2K5V A;  4R4C A;  5IP7 H;  5H1S E;  4A3J H;  1JJG A;  1QVF A;  3KLW A;  2L15 A;  4GS3 A;  4H02 A;  1Y1W H;  4BBR G;  2E2J H;  4LF7 L;  2GVB A;  1A8V A;  2Y0S G;  1R9T H;  3PGZ A;  4JYA L;  4Y52 H;  4NXM Q;  1UWV A;  5LMU L;  4JI1 Q;  4DR1 Q;  3BU2 A;  4A3G G;  4JG2 A;  2EIF A;  1Q81 C;  2R93 G;  3DM3 A;  4GKJ Q;  2JA6 H;  1SE8 A;  3CCJ A;  1GVP A;  2AWN A;  3HKZ G;  3J81 c;  4AH6 A;  1VQH A;  4DR5 Q;  2VY3 A;  2KCT A;  2JE6 I;  2VQF L;  3U50 C;  2E5L Q;  4J15 A;  5C3E G;  1QZH A;  4JI4 Q;  1XPU A;  3F1Z A;  4DK6 C;  2D62 A;  4JI3 L;  5M3F H;  4AYB G;  3GTP H;  3ZJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...