3ULLA

Human mitochondrial single-stranded dna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
106
Chain Sequence
LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human mitochondrial single-stranded DNA binding protein at 2.4 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords DNA BINDING PROTEIN
total genus 14
structure length 106
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ullA00
4A93H 3PUZA 3ULLA 5FLXc 4RG1A 4QL5A 4UP8A 3AYHB 4A3IG 2EXDA 4JI7Q 4PZ8A 5H1SE 4JI4Q 5IYDH 4AH6A 1VQBA 1E22A 4Y52H 3PCOB 1VQNA 4YY3L 1Q81C 4JBMA 1QUQB 1WI5A 4LWCA 2I5MX 1VQMA 1FL0A 1YBYA 4A3IH 5C4XG 2PQAA 4DR5L 1SROA 4LFBQ 3K0XA 3ZJYC 4A3GG 1VQ7A 2FXQA 1RIPA 3KDFB 3GO5A 3J81c 3U50C 3J81j 2E2JH 1XPUA 1MKHA 2PI2A 4PZ6A 1K3RA 3GD7A 1YEZA 5DLQE 4GKJQ 4OX9L 1LUZA 1TWFH 2NZHA 4UP9A 1PH2A 4LF5L 3HOUG 2OTJA 4JV5L 2WB1G 2YTXA 4XIGS 2QA4A 1YIJA 4R4OA 2R6GA 4FDBA 1FVIA 5FJ8H 3UDFA 1VCIA 3PGZA 4JI6Q 5JEAG 2MO0A 4LFBL 2K4KA 5EAYA 1HZAA 3BJUA 4DR2L 4POGA 1X3EA 2H5XA 2VL6A 4DUZQ 4GKKQ 3FHWA 3HKZG 4A76A 4DR1Q 2NVQH 2WFWA 1K0RA 3GTJH 1VQ9A 3D0FA 1B8AA 4GN4B 4JI4L 3BZCA 5IE8A 1Y1WG 2GN5A 3EIVA 3J80i 3CCEA 4APVA 4GLXA 1OXVA 2MFIA 3T1YQ 1PV4A 3HOYH 4BY1G 3HKSA 1Q12A 4P71A 1K9MC 1XNRL 2R93G 3W1GA 1S3OA 5GAHC 1VQJA 3TREA 2B63H 4IFDI 4OWTB 3J81i 1P16A 4JYAL 1VQAA 3G71A 4JV5Q 4X6AH 1C7YA 4LF5Q 2UUAL 1TWCH 2L15A 3UE1A 3PUVA 5M5YH 3S1MH 3SGIA 2KHIA 4GKJL 1VQ4A 3GTKH 3S1QH 5JJLA 1I6HH 4JI1L 1L1OC 4JI5L 1K8GA 2BA0A 4KLKA 3DLLA 3ERSX 4YHHL 2VS1A 4X62Q 1MJEA 4AQYL 1HR0L 1Q1EA 4LFCQ 1HNZQ 1MIUA 4EQ5A 4A3FH 2I5HA 4L5TA 3CPWA 3CCRA 1LM0A 4DNIA 5K36G 1Y1WH 1SRUA 1K73C 4MNOA 4YY3Q 3I4MG 5ELNA 1N36L 3F1ZA 1K83H 1XMQL 2CQOA 4LF6Q 1TWHH 3CCUA 1O7IA 4GN5A 2RHSB 3HOXH 4LUOA 3TS2A 3I55A 4GOPC 3RLOA 1X56A 1UE1A 4C3IH 2JEBI 1XTDA 4IPHA 3M7NA 1JMCA 1N32L 4HIMA 2ID0A 3OW2A 3HOZH 2R7DA 3A0JA 1J5EL 4HIKA 2JA8G 4YWLA 1IBLQ 4JI0L 3I4NG 2WAQG 3CAMA 5J3BA 1Z47A 2IHEA 3CCJA 5IYBH 1BBUA 4JG2A 1XPRA 1AE3A 3HOYG 3U4VA 4DAMA 4IPDA 4LF9L 3PO2G 2D0PA 3GTGH 3PSIA 1B70B 3UE0A 4LUZA 1CKOA 3M4PA 1WFQA 4A75A 3H3VH 4HIDA 3GTQH 3TEHB 1D7QA 1YHAA 5M5WH 3KDFA 3I56A 1PYSB 1J6QA 1FGUA 2CWPA 4R4TA 4UP7A 1HNZL 4O2DA 3OYYA 1SN8A 4NB3A 5IYDG 1KAWA 4NPSA 5C0XJ 3J80c 1SE8A 3ER0A 3IRBA 4IFDG 3A74A 1YHBA 3AFQA 3KJPA 1PH1A 1K8AC 4BA2I 2EQSA 2C35B 2Z6KA 1WCMH 2WP8J 3PF5A 1JB7A 1E1OA 4IJHA 3ULJA 4A3CH 1G6PA 1AH9A 4YCUA 3PUYA 4DR3L 3UDIA 1X3FA 1XNQL 4X66L 4HJ8A 3H0GG 2GVAA 4A3GH 4UPAA 2UUBL 2ZTEA 1A62A 1SR3A 3TS0A 3GTMH 1PH6A 2BH8A 1VQHA 1G291 2K5VA 3HKZE 5IYBG 1IBML 4B3SQ 4DR6Q 2VQEL 2F52A 4DUYQ 2KBNA 5C44G 5GAEC 1VQPA 2Y0SG 4IOAA 4A3JG 2VUMG 2ZTDA 3W5OA 4QQBX 4B3ML 3K81C 1I94Q 3OTOQ 4OO1I 1L2FA 4DUZL 4JBJA 4DR2Q 4QGUA 5LMUL 2CFMA 1N34Q 4A3KH 2E8GA 5M3MH 3S2DH 4JI6L 4IFDJ 2WB1E 1VQCA 1CKMA 1VQOA 4LFAQ 4GNXA 3I4MH 2MNAA 2A1AA 4ALPA 3J7A5 1KHIA 5HGQA 4DV2L 3BZKA 3CCLA 2XGTA 1NTGA 1NBWA 1OXSC 2JJQA 4Y7NH 4C3JH 3RN2A 1PH3A 1N33Q 4C2MH 4POFA 3CF5A 3CC2A 1BKBA 4JBKA 4UY8C 1QVGA 1KC8C 1Y1VH 4X65Q 1EQQA 2UUCL 2ZM6L 2DUDA 2E5LQ 2UU9Q 3CCVA 4DR5Q 3RR5A 5FLMH 5FLMG 2AWNA 2Z0SA 3H3VI 1OXTA 2MO1A 4JBWA 1EYGA 2R92H 4LF4L 1NMGA 3CPFA 1IBKQ 3MXNB 4P73A 4IPGA 4JI8L 1EIFA 2OQ0A 3AQQA 1XJVA 3GTOH 3S16H 1KIXA 4DK3C 1PH4A 4K0KQ 3D31A 2K50A 2GVBA 3S1RH 3NELA 5M3FG 3HOWG 1SMXA 3L2PA 4DV1L 4PG3A 1JJ2A 4JI2L 3MEFA 4GS3A 2UXDL 4TQUS 3F2DA 1JE5A 4OWXB 4LF8Q 4DV0L 1I5FA 4B3RL 3RNUA 2HHHQ 4B3TQ 2VW9A 1GM5A 1Q7YC 1PH8A 3E9HA 1EWIA 3UDXA 1V9PA 3H15A 2JA6H 4R4IA 2Q2IA 2HHHL 3CC7A 4DV6Q 1PA6A 3G48A 4H02A 2JA7H 3GTLH 2PI2E 2B3GA 2RHQB 1WJJA 3M4QA 3RN5A 2NVXH 3TRZA 1HNWL 1KD1C 4KHZA 3T1HL 4OONA 5C3EG 4GOPB 2R7ZH 3PF4A 3KYHC 4A3DH 4L5RC 4X64L 1NY4A 3DM3A 2CWAA 3HFZB 4JI8Q 2KCMA 4BBRG 1PHJA 1HNXL 2E2HH 4A3MG 4LF4Q 1Q1BA 4A3EH 4JI3L 4BY7H 1L1OB 3PUXA 1XMOL 5JJKA 1TXYA 1UWVA 3L0OA 4L5QA 2UU9L 4BBSG 4QY7A 1PH5A 4BA1I 1YJNA 5IP7H 3HOVH 1JT8A 1FJGL 4X65L 3M3YH 4LF7L 1LYLA 3LGJA 2JA7G 4NXNL 3ULPA 4KHPL 4JC0A 4JOIC 2YTVA 4DV4Q 2HQLA 2ZJQA 1HZCA 4DV5L 3HOVG 2BH2A 2IHFA 3M9BA 1QVCA 1UE7A 4DR4Q 4BXXG 4RMFA 4LFAL 1A8VA 5AJ3L 3RLFA 1QZHA 1OXUA 4A3MH 5E7NA 4GOPA 5IT9c 3PV0A 2PNHA 1OXXK 1RL2A 4L5SA 4NXML 3PO3G 2JE6I 5GROA 3CXCA 1GD7A 4R1JA 3S17H 4DR7L 3JC66 4AIMA 1YNXA 3STBD 4DUYL 3KJOA 1X9NA 2F4VQ 2HIVA 1UEBA 2K14A 3K7UC 4DV7Q 1QUQA 3RZDH 2JA8H 2UXCQ 3U58A 1ASZA 4HJ9A 3HOZG 1E3PA 3K8AA 1HH2P 4A3LG 4WJ4A 2Y0SE 2UUBQ 1BBWA 1IZ6A 3I4OA 5BR8L 3E9IA 1BVSA 1R9TH 5IP9H 2VQFL 1NMFA 1PFSA 2K75A 1V1QA 4DR3Q 1XNQQ 3HOXG 1VQEA 2JA5H 4DV4L 4YWMA 2NN6I 1EQRA 1VQFA 2OQKA 3A5UA 1VQ6A 3NEMA 2ASBA 3TQYA 2VQFQ 1UE5A 2DGYA 2AWOA 1H95A 1D8LA 3AEVA 1UE6A 4A3DG 4O0AA 2JK8A 3M85A 1V43A 5JEAJ 1KRSA 4A3FG 2LXJA 4JOIA 4DV7L 2UXCL 2N49A 2JA5G 2XTIA 1VQ8A 1HNXQ 2A19A 1CKNA 4QJFA 4DK6C 2OWOA 4DR7Q 2I5LX 4X64Q 2Z6KC 1TWAH 1I50H 2AKWB 1P8LA 4LUVA 4DKAC 3JAMc 4P72A 1PH7A 3S15H 1PVOA 1N8RC 3T1HQ 4NXMQ 2KCTA 3KOJA 4HJAA 3F2BA 5LMNQ 1EUJA 2UXBL 1Y1VG 5IWAQ 1Q46A 2AHOB 1Q82C 1VQGA 1YVCA 4P75A 3FKIH 4AYBE 4OXPA 4DR4L 2HIXA 1YJWA 3RZOH 4HJ7A 4BY1H 1E7ZA 4OO1G 3EBEA 3PO3H 5GADC 4ME3A 3K80C 3CP0A 2KENA 3FKIG 4R4QA 5GQOA 3UDGA 1IBLL 4A3CG 4DV0Q 1GVPA 4B3RQ 1A63A 3L7ZC 4LF7Q 1PH9A 3G6EA 2QGQA 3STBC 1N32Q 2NVYH 2UXDQ 1VQDA 2WAQE 1EOVA 4EX5A 4A3LH 1HZ9A 1Z9FA 2NZOA 1T9HA 4KI0A 1XMOQ 4OWWB 1EFWA 5ELOA 4DV3L 2K5NA 4GNXC 2CCZA 4K0KL 1YHQA 1CSPA 3F8TA 3U4ZA 4A3JH 2VUMH 2AMCB 1VQKA 3CMAA 5IP7G 1IBKL 4LNQA 3B6YA 4DV3Q 4BBSH 2HT1A 2YYZA 3J7ZC 4LFCL 1C9OA 1EIYB 3KFUA 4A3EG 1HR0Q 4JCVE 4BY7G 3AFPA 1HNWQ 3PIOA 2ZM6Q 1NE3A 5C0XG 4YHHQ 3NENA 3H0GH 3CCMA 2ES2A 2N3SA 4YCVA 2UUCQ 4A3BG 3KF6A 4BBRH 2LXKA 4DV6L 2R7FA 4JI1Q 1JJGA 2K5HA 5IY0A 4AYBG 2NVTH 4P74A 4IJLA 5M3MG 2ZJPA 1S72A 1QZGA 2Q2TA 5C4XH 2A8VA 1WYDA 1KRTA 3CW2C 4JYAQ 1C0AA 1I3QH 2I0QA 3CQZH 4LF8L 1XNRQ 4LW1A 4GLVB 3S1NH 3KF8B 2YV5A 5IWAL 2IY5B 4YCWA 4GLAC 1DGSA 2IT1A 5C44H 1SFOH 3GTPH 2UXBQ 5LMNL 2RF4A 3T1YL 3F2CA 3RLNA 4JI2Q 2K52A 5LMNW 5LMUQ 4DV1Q 1L0WA 2CKZB 1N34L 4IPCA 1IL2A 2F3IA 1JJCB 1CKNB 3GDEA 3ICEA 4B3MQ 2N78A 1MJCA 3I7FA 2IX1A 4DPGA 3S24A 1CSQA 2Q2HA 2VNUD 5M5XH 1M1KC 4C3HH 1VQIA 4A3BH 4DR1L 2BA1A 1L1OA 1U0LA 3A5ZB 1G51A 4B3SL 1IBMQ 4DR6L 5JJIA 4GKKL 2NN6G 5M3FH 3HOWH 1X55A 1U5KA 2D62A 2E5LL 2VY3A 4A4IA 2ZTCA 1PYBA 4X66Q 5C0XI 2VZAA 3I2ZA 3KF6B 3S14H 1E24A 1A0IA 1N33L 2V1CC 3K7AH 4HJ5A 1X3GA 2QEXA 1M90C 2JA6G 1B7YB 1VS0A 4DV2Q 2Q2UA 1X54A 5BR8Q 2EIFA 3CC4A 1E1TA 4OX9Q 1W3SA 2JQOA 4GN3B 4IOCA 4PMWA 2PMZE 3JAMi 3WWVA 3M4OH 2F4VL 1YITA 3CD6A 1KXLA 3PO2H 2JEAI 3OTOL 1I94L 2IX0A 2R7ZG 2D0OA 4PZ7A 2PQAB 5C3EH 2OCEA 3E0EA 1SLJA 4YWKA 1IXRA 1YJ9A 2VQEQ 2R92G 1GKHA 4A3KG 5AJ3Q 1X65A 3BU2A 1Q86C 3I4NH 4JI7L 1YZ6A 3S2HH 1LTLA 1HJPA 4MZ9A 1AE2A 3FP9A 3CCSA 1N9WA 4DAYB 5IYCG 5IYCH 2ALYB 2JA9A 3G4SA 4HIOA 5FJ8G 1Q8KA 4XTCS 4MTNA 3PIPA 4DV5Q 2OTLA 4WJ3M 1X6OA 2MQHA 2YTYA 1TWGH 4QIWE 3CCQA 1HZBA 4GNXB 3VDYA 4NXNQ 2B63G 4KHPQ 1J5EQ 1KL9A 1IYJB 1FJGQ 5HY6A 2E2IH 4JI3Q 2N8NA 3KLWA 1W2BA 1KQSA 1XMQQ 4LF6L 5IP9G 1N36Q 2ATWA 5C4JH 4R4CA 4TVAB 2ZJRA 4IO9A 1ASYA 1QVFA 4AQYQ 2KHJA 4X62L 3PUWA 1XPOA 2R93H 4JI5Q 1WOCA 3Q8DA 4LF9Q 2LSSA 5GAGC 3CMEA 1YI2A 3NBHB 3HOUH 1Y14B 4A93G 4J15A 2UUAQ 1VQ5A 1OTCA 1VQLA 1CUKA 1NJIC 1S40A 1GO3E 4B3TL 2RCNA 3EN2A 3W1BA 2B29A 1HR0W 2YU9H 4JI0Q 4BXXH 1WCMG
chains in the Genus database with same CATH superfamily
1ENCA 4A93H 4RG1A 1T5XD 3AYHB 3PQIA 3X3NA 5CR3A 2EXDA 4IFDH 2PNRC 4A3JB 1LACA 2VUMB 5CV8A 1VQNA 1WI5A 2I5MX 3R2TA 4K14A 2EZVA 2PQAA 3ZJYC 1TWFB 2FXQA 1GUGA 2E2JH 1MKHA 2IWHA 1K3RA 3GD7A 1PH2A 1MGSA 4AYBB 3BDOA 2A73B 2HUGA 3VA5A 5A35A 2QA4A 2R6GA 5FJ8H 4LFBL 3KLSX 5EAYA 4DR2L 1X3EA 2H5XA 2EPBA 3DHQA 3ND9A 3HKZG 2EJGC 5I2YA 4DR1Q 2L55A 1K0RA 1TVXA 1EWCA 3FVQA 4K5WA 3CCEA 4APVA 2A68D 1VMPA 4PV1C 4UDUC 3T1YQ 1PV4A 1CHQD 4BY1G 3HOUB 2EOTA 1SJHD 1XNRL 2A69D 3J81i 3PUVA 4O1NA 4GKJL 3S1QH 1I6HH 4JI1L 4TRDA 2F0GA 3NE5B 4YHHL 2VS1A 3TSSA 3S17B 2B2WC 2Z8LA 1WTXA 2NVTB 1L0XB 2I5HA 3JAML 5K36G 5ELNA 4C3HG 3HS0C 4KJOA 4LF6Q 5ELEA 1FYCA 2ICEC 1R4QB 4BBSB 4LUOA 2XVSA 4H13C 1BR9A 4C3IH 2JEBI 1IYVA 2DJGC 1JMCA 1U4RA 1J5EL 1IBLQ 4JI0L 4JG2A 4UHVA 1AE3A 3HOYG 2PW5A 4LF9L 3PSIA 1B70B 4LUZA 1CKOA 4CKCA 5I9PA 1GUOA 5KYIA 1D7QA 1YHAA 1PYSB 4PQXA 1F2YA 3NPPA 4UP7A 5ELDA 1CK1A 3NQIA 3HGBA 1SN8A 4NB3A 3W2DA 4FF1A 1EIGA 1E2VA 4HTHA 3K5NA 1YHBA 1RF2D 3AFQA 2NYZD 1K8AC 1HRJA 2WP8J 1E1OA 4IJHA 1G6PA 3TZDA 4A3CH 2BE5C 3PUYA 2YU9B 3VYSA 4HJ8A 1PZKD 2GVAA 2XWJB 2Q8TA 1C4QA 3S16B 2JA5B 1VQHA 4B3SQ 3G7LA 2A69C 3OMGA 1VQPA 4QQBX 4HAEA 4C3IG 4B3ML 1I94Q 1L2FA 4JBJA 4BS9A 3KF8A 2CFMA 4RFBA 3S2DH 4IFDJ 4LK1C 3QWNA 1ET9A 3EROA 1XTCD 1OO9B 3BS1A 1KHIA 5HGQA 3CCLA 2JJQA 1YNNC 1NBWA 4C2MH 4POFA 3MXGA 4CDEC 3A8JE 1KC8C 1SSOA 2WKCA 4XDXA 2DUDA 3BVGA 2UU9Q 2Z0SA 4CJ2C 4JBWA 1EYGA 4LF4L 1NMGA 2A74C 4R9WA 1WD0A 3ITPA 2X69A 4JI8L 2N88A 4H7BA 2DY8A 3GTOH 1KIXA 1PH4A 4BY7B 1ENAA 3HOWG 1IHZA 1SMXA 3SK5A 3MEFA 4A3BB 1VF5C 2UXDL 2FFKB 1D1KA 4TQUS 1IW7D 1JE5A 1I5FA 2K32A 3W3AA 4B3TQ 1GM5A 1V9PA 3H15A 1BCPD 2Q2IA 1TWCB 2HHHL 1S5ED 1PA6A 2JA7H 3TN2A 2DNEA 1WJJA 2H1EA 3TP8A 3TRZA 4G7OC 1HNWL 1CZGA 1EY0A 1S5FD 5C3EG 3QOLA 1EL0A 4A3DH 5DM73 4X64L 4RHRA 3HFZB 3NK9A 3FPPA 1HNXL 4A3MG 3SK6A 5CGKA 4A3EH 5JJKA 3J7YW 2AQ1B 1PH5A 4X65L 5ISRA 3M3YH 4NXNL 3HOZB 3MXUA 2B2TC 3I70A 3MC0B 2IHFA 5EBDA 1UE7A 1LTRD 4RMFA 1TS2A 1XXGA 1E2ZA 1OXUA 4BBRB 3D6WA 1EY8A 4OHJA 3EVQA 1UNSA 2J7ZA 4L5SA 5C5MA 3TDQA 3LNNA 1EEID 2HDMA 4CDFC 2D2CC 2K03A 4ZRZA 4R1JA 3A8KE 3R2IA 1X9NA 2F4VQ 4C1NI 1UEBA 4DV7Q 3C46A 3K8AA 1O7YA 1SMYC 3LX0A 4A3LG 2UUBQ 1IZ6A 3T13A 1R9TH 2B63B 1PFSA 4DR3Q 1SJED 2OQKA 3A5UA 4C56C 3TQYA 3VA7A 2DGYA 2AWOA 1H95A 3AEVA 5K36H 3PO3B 3MZ5A 2JSOA 2XTIA 2Q8IB 5BN5A 1HNXQ 1CKNA 4QJFA 4DR7Q 2I5LX 2NVXB 1F77A 2Y0SB 4X64Q 1TWAH 2AKWB 2F0JA 4OIJA 2AUKA 1N8RC 2KCTA 5JJZA 4HJAA 3F2BA 1SNDA 2B2UA 1B53A 5EKLA 2AHOB 1VQGA 1YNJD 2C9OA 1GHKA 1F9PA 2HIXA 4HJ7A 4BY1H 3PO3H 4S3SA 5ELCA 3NSWA 4B9WA 5KNCA 2KENA 4R4QA 3S1RB 5D3IB 5L37A 3L7ZC 4LF7Q 2J0TD 3K58A 4A3LH 4NP5A 4OWWB 4KI0A 5E3FA 4DK1A 3OWFA 5ELOA 4DV3L 1EOTA 2CCZA 1E2WA 3NWTA 1VQKA 4LNQA 1EWHA 3BDCA 4LFCL 1C9OA 1HR0Q 3AFPA 1SYCA 5JVG3 3PIOA 1NE3A 4J8QA 3CCMA 4EVOA 1STYA 3CU7A 3KLRA 4DV6L 1H9RA 1SE3A 2WB1B 5FLXE 1EY5A 1I3QH 4LF8L 2YV5A 3L3OC 2RF4A 3OSOA 4DV1Q 3J7AV 4Q0FA 5EJWA 2F3IA 3GDEA 4B3MQ 1MJCA 1AFPA 2NUCA 1DZ1A 3A5ZB 3MEHA 1G51A 1IBMQ 2PO4A 4YIJA 3MFYA 1S5DD 2WV6D 3K6OA 2KEDA 3OWEB 1PMRA 1JB3A 5BN4A 2V1CC 4QMGA 3K5OA 3BZDB 1E1TA 1TS5A 4GN3B 1ICFB 3T16A 1KABA 2PMZE 5CBAE 1W6JA 2F4VL 3KLSA 1LT6D 2E2JB 2R7ZG 4PZ7A 3SHLA 1SLJA 2P5ZX 3Q22A 1IXRA 1YJ9A 1HPCA 4A3KG 1X65A 4G57A 4JI7L 3S2HH 4KD3A 4ILWA 1N9WA 1LV9A 5IYCG 2WAQB 3R3OA 2FMMA 3T4AC 2OTLA 4WJ3M 2NVYB 2JP1A 3CCQA 3VDYA 4NXNQ 4NW2A 1IYJB 4A93B 3OHXC 2DJFC 3BG3A 2TSSA 4HCEA 1HCZA 4LF6L 3URYA 5IP9G 2K6AA 1B3AA 2R61A 2KHSA 1BCPF 4IO9A 4FYDA 4L63B 5KYLA 5EPKA 4ZLTF 2KHJA 1WTWA 3PUWA 2R93H 5CV5A 3Q8DA 4XT3B 5GAGC 2EXZA 1YI2A 2EYFA 1Y14B 5DM63 3ND8A 2CW0D 2EVBA 1OTCA 1V1PB 3E3XA 4K8JA 2J4XA 2NBFA 1S40A 2RCNA 4BXXH 3PUZA 4X3SA 3PIP3 4JI7Q 4IURA 3VR3A 5HGTA 1DYQA 4AH6A 4QF4A 1VQBA 1E22A 1QUQB 4PMCA 1YBYA 4A3IH 3I73A 4K6DA 1ILQA 4A3GG 3WOFA 1Y1WB 3A55A 1STAA 2EY1A 5DLQE 3HG9A 2K5DA 4LF5L 5M3MB 4JV5L 4DGZA 4XIGS 4I7ZC 4A3IB 4ZCKA 1U4LA 5C4HA 1F9SA 1BCPB 4XYOA 2K4KA 4FXGC 4GKKQ 3DWAA 4A76A 2C5CA 1TY2A 4CBVA 3D8GA 3D0FA 1B8AA 3OMCA 4FXKC 4CGYB 2XSCA 5IT9E 1BXTA 3EIVA 3J80i 4GLXA 1OXVA 5M9OA 2X6LA 5CC4A 5M5XB 4P71A 4RCOA 4V0BA 2B63H 4OWTB 1VQAA 3G71A 1C7YA 4LF5Q 1I6HB 3U9OA 3UE1A 2JA6B 1CA5A 3GTKH 3WDNA 1GXDC 3I4NB 4KY6A 1K8GA 3DLLA 3C1EA 2CVRA 1JQYD 1HR0L 2F03A 1HNZQ 2B2VC 3CPWA 2CW0C 4DNIA 5EGTA 4DXFA 4IUNA 1D5XC 2AUJD 2DY7A 1F2LA 1EEFD 5IGBA 1O7IA 4GN5A 2RHSB 4OEMB 1B3QA 2EYJA 1K0SA 4GOPC 5ELFA 1EY6A 2KCCA 2F4IA 2RDGA 4ID6A 1XTDA 4IPHA 1A3UA 2PQEA 3HRZC 4HIMA 1D5ZC 3HOZH 1O7ZA 3OOCA 4HIKA 2LS01 4YWLA 3KBXA 2WIIB 1AW7A 2MHVA 3HP3A 1BBUA 2QEJC 4HMJA 4KY5A 4ZAIA 1DD2A 3DEOA 2A68C 3A54A 3PO2G 1I4GA 1QCBD 2RBMA 1NUCA 1ZXTA 3OIQA 4A75A 4HIDA 3TEHB 2PMZB 2PZWA 4MHEA 3KDFA 1BBXC 2HQEA 2CWPA 2NWGA 3IKJA 3LWEA 4QUCA 5C44B 1E0BA 4UAIA 5C6AA 2MGSA 1RTNA 2RDFA 1SE8A 1MI2A 2AQ3B 4IFDG 2XN9C 1BQQT 4IUTA 3KJPA 1PH1A 1O7LA 5I4DA 2C35B 3J80L 5IGDA 3QJYA 3SK4A 3ULJA 1VF7A 2VB2X 4B08A 1XNQL 4HR7B 1X3FA 3UDIA 4X66L 3H0GG 4A3GH 4UPAA 2Z9HA 5IGGA 2O2LD 2ZTEA 2UUBL 1A62A 1SR3A 4CHTB 3GTMH 2BH8A 3KUPA 1G291 5IYBG 5GAEC 3I4LA 4KMUC 4A3JG 2VUMG 2EY6A 3W5OA 3NTIA 1H9KA 3RZDB 4OO1I 4DR2Q 1I3QB 5LMUL 1N34Q 4A3KH 1Y1VB 1XWEA 3VR2A 4JI6L 2WB1E 1H9SA 3O13A 4FXDA 4LFAQ 3VR4A 4GNXA 3J7A5 2A1AA 3GTGB 2O5JC 1DOLA 1PTOF 4DV2L 3BZKA 1OXSC 4Y7NH 1PH3A 4KKSA 3CC2A 1D2BA 5T1IA 4JBKA 4UY8C 1Y1VH 1EQQA 2UUCL 5C3XA 1ICWA 2JXMB 5KNDA 1L0YB 1ET6A 1OXTA 2MO1A 2R92H 3CPFA 1QNKA 2OQ0A 1XJVA 1HXYD 1KNEA 4DK3C 3S1RH 3NELA 3L2PA 4DV1L 1RKNA 1JOKA 3BYTB 2A6HD 2K04A 4DV0L 4B3RL 3RNUA 2HHHQ 2K28A 1PH8A 3UDXA 2JA6H 2E76C 4CJ1B 5FO7B 3CQZB 2H4OA 3GTLH 3Q6SA 2B3GA 1I50B 2RHQB 3GP7A 2NZ1D 3M4QA 4ZYSA 3RN5A 2AQ2B 2NVXH 3C3LA 2R7ZH 1KLUD 4L5RC 4JI8Q 2EY5A 2L9HA 4ZKBB 4C3HB 2NVQB 1LABA 1XMOL 5CV4A 1UWVA 3VYRA 4L5QA 2UU9L 1YJNA 3GV3A 1B44D 2G5DA 5EQ0A 2PZUA 4JC0A 4TKOB 4DV4Q 3A7LA 4V190 3HOVG 3M9BA 1QVCA 5CMDA 1GUWA 2F0UA 1IYUA 1A8VA 2BDOA 4C3JB 1GUSA 5AJ3L 3RLFA 4GOPA 1MBYA 2CH4A 2PNHA 3RMHA 1OXXK 3PO3G 4NXML 4GZYC 5GROA 3FEWX 3S17H 2BCOA 4XXEA 3KJOA 2HIVA 2UXCQ 1D5MC 1QUQA 3U58A 1TWAB 1E3PA 2CHBD 4WJ4A 1A3VA 3I4OA 3M3YB 5BR8L 2KCNA 4RA8A 4DV4L 2K5WA 1EQRA 2F0OA 1HQMC 2EYMA 1VQFA 2XRSD 3NEMA 1HUNA 4G7HC 1UE5A 3C1FA 3EQLC 2B8GA 3M85A 1KRSA 1RDPD 1B1ZA 4G7ZC 4A3FG 4JOIA 4DV7L 4KTAA 1VQ8A 3DEPA 4DK6C 4M8AA 2LMCB 1I50H 3S15H 4P72A 1PVOA 5E1FA 1RTOA 3NP8A 3KOJA 3J81L 3TZUA 1EUJA 3FRPB 4C1NK 5C5LA 1Q82C 1KTKA 3Q0AA 1CQVA 4AYBE 1YJWA 3DM1A 4IALA 1SNPA 2A5HA 2B2TA 5GADC 3K80C 1WD1A 3U9SA 4DV0Q 4B3RQ 3G6EA 2NVYH 1B9NA 1VQDA 4DF7A 1T9HA 4RGMA 1EFWA 5JEAH 4GNXC 1NR4A 5I9OA 1CSPA 3F8TA 2AMCB 3NWSA 1IBKL 1TT2A 2OEOA 2XIWA 2YYZA 3J7ZC 3KFUA 5IIFA 3H94A 4A3EG 4WORA 1UUPA 2ZM6Q 2ES2A 1GUTA 2KOLA 2LXKA 2K5QA 1JJGA 3FKIB 2K5HA 5LL6S 4AYBG 4DN4M 1QWYA 2PCFB 1S72A 2NB0A 2F0SA 1C0AA 1BO0A 2I0QA 3CQZH 1WTOA 2QW7A 4GLVB 4L6TB 1PZJD 3S1NH 1JE4A 3G6JB 3NXWA 4YCWA 4GLAC 1DGSA 4CKEA 3J80E 5TSSA 3T1YL 3TMEA 5LMUQ 1N34L 1JORA 2FJ2A 4IPCA 3TBIB 5NUCA 3ICEA 4DPGA 3S24A 2NTSA 2Q2HA 1VQIA 4A3BH 4DR1L 2QDLA 1L1OA 5IGFA 4DR6L 3QO2A 5K5PA 3HOWH 1G2SA 4I7AA 2D62A 2XRQD 2VY3A 4A4IA 2ZTCA 2R92B 4X66Q 3I2ZA 3S14H 3S1NB 1A0IA 1M4VA 1K8OA 1NNXA 2Z4HA 1X3GA 2QEXA 1M90C 1PRTF 1VS0A 3NQTA 2Q2UA 1A2TA 4MIUA 1MHWC 5I6WA 1W3SA 2JQOA 4K6LA 1PRTC 4PMWA 3JAMi 3QOJA 1V1OA 1QG7A 1TIID 3CD6A 3PO2H 4DAYA 1I94L 2IX0A 5D3DA 1SYBA 3F2UA 5C3EH 4JVZA 1V8QA 4KKUA 4KHVA 3A7AB 4WFN3 2FINB 1Q86C 2MJ8A 1DOMA 1LTLA 4XQJA 4MZ9A 1H9JA 1AE2A 3FP9A 5C3WA 2JA9A 1Q8KA 4MTNA 3PIPA 2MQHA 2RKSA 4DAVA 1HZBA 4GNXB 1PFBA 1A15A 1I6VC 4N9TA 1KL9A 1X3QA 4K5VA 3NBIA 2A6EC 4IN3A 1Q3LA 2B39A 2F0DA 2N8NA 3KLWA 1KQSA 5IGCA 1BUVT 1JR0D 1EFID 1B4OA 1PFNA 2TMPA 2OT2A 4H0LC 3GTKB 1QVFA 1I4HA 1NR2A 3Q24A 1WTVA 4JI5Q 1WOCA 1LT4D 4XQNA 3RD4A 2EYLA 3HOUH 3DMUA 4J15A 1F9RA 2UUAQ 5EPJA 2O5IC 4XYQA 1DONA 3MXPA 4U673 2B8FA 2WKDA 4DNRB 3ULLA 5FLXc 3PIO3 3QB3A 5H1SE 3BYYB 4JI4Q 1AP0A 1GHJA 1TKWB 2WACA 4CJ0B 1Q81C 4HEDA 2G9DA 1XYIA 3VYTA 3T56B 1HTLD 5C4XG 3NTKA 1SROA 5M5WB 2QILA 1ESFA 1VQ7A 1CI3M 3KDFB 1J9OA 1SYFA 3J81c 3U50C 3J81j 1U9RA 4EGVA 4PZ6A 4GKJQ 1PFMA 4OX9L 2F0QA 1TWFH 2NZHA 4UP9A 1EZ8A 5J39A 3HOUG 2OTJA 2WB1G 1D6EC 1EY7A 4RKLA 1SEBD 1SXTA 3UDFA 1VCIA 2K1BA 3PGZA 4JI6Q 4OELB 3R93A 1JCKB 2VL6A 1TY0A 3FHWA 2F0KA 2NVQH 2WFWA 3GTJH 1VQ9A 2ICIA 3BZCA 5M3FB 2GN5A 3HOYH 1QILA 3HKSA 4CKBA 4I65A 3BVMA 1K9MC 2R93G 3W1GA 1S3OA 1T5EA 4IFDI 1SNOA 1EZ6A 4JYAL 4X6AH 1P16A 1SE2A 1SNCA 3QIAA 3GV6A 3SGIA 1VQ4A 5JJLA 2EJFC 2LKVA 1L1OC 4EQOA 2BA0A 2SDFA 1QE6A 3I91A 1SYEA 1MJEA 1Q1EA 1TR5A 1MIUA 5HURA 3CCRA 1K28A 3PO2B 1LM0A 1HFNA 1Y1WH 1SRUA 1K73C 3I4MG 1N36L 1BF4A 5CBEE 1XMQL 4R8NA 1TWHH 1BCPC 1PYWD 3CCUA 1PTOB 3HOXH 3I55A 4IUPA 3IL8A 1K8MA 1MSHA 2ID0A 1LTAD 2JA8G 2RSNA 3CAMA 1Z47A 2IHEA 3CCJA 1STNA 1XPRA 1TS4A 3CRLC 3U4VA 4DAMA 4IPDA 2D0PA 3GTGH 1JOQA 3UE0A 2F0LA 3M4PA 1FNWA 1WFQA 2KUMA 3IFTA 3GTQH 3V05A 1Q90A 3I56A 5CORA 3GTPB 1WTQA 1HNZL 4O2DA 3OYYA 2E2DC 5IYDG 4EQNA 1KAWA 2L1BA 4NPSA 4HMIA 4RGNA 3J80c 1KLGD 3IRBA 4HCSA 3A74A 5A2QE 3GTMB 4BA2I 5JVH3 2EQSA 1WCMH 2F0IA 3PF5A 1JB7A 1HA6A 4N9PA 2EY2A 3K0YA 4R8IA 1STHA 1AH9A 1ZYRD 4B9XA 4LMQD 3GTOB 5G3LF 1IBML 2VQEL 2F52A 3NBHA 5LL6X 5IT9L 2Y0SG 1II3A 1LTSD 2JYOA 2PPBC 4BWGB 1G8ZD 3K81C 2F1MA 4DUZL 1D1IA 1PTOD 1FGBD 4QCLA 4K5XA 2RQXA 3I4MH 4K2LA 3OW7A 2MNAA 1MD2D 4ALPA 3I90A 3AU7A 3PMFA 2F0WA 1XPUA 2XGTA 2SEBD 1F2MA 3Q23A 1QVGA 3S2DB 3DWQA 2E5LQ 5EKKA 3CCVA 4DR5Q 3KBGA 3RR5A 3CRKC 5FLMG 3NUCA 4C3IB 2EJMA 5FLMH 1QB5D 4F8MA 2IW3A 4IPGA 1EIFA 3AQQA 4K0KQ 3S16H 5BN3A 3ERQA 2IJ0A 4BY1B 1Y8OB 4OWXB 5KGUA 2VW9A 1Q7YC 1EWIA 4KD4A 3I8ZA 4R4IA 2EYPA 2MPMA 1EU3A 4H02A 4NDXA 5G3LD 1LT5D 1JWMD 4KHZA 4WJWA 3T1HL 4OIKA 4KKTA 3PF4A 1S4ZA 2OXPA 3HOWB 3DM3A 4BBRG 1PHJA 4QUFA 1U4MA 2E2HH 3AB9A 5FO9B 4JI3L 3SK8A 1TXYA 3L0OA 4BBSG 4WRDA 3D6CA 4BA1I 3HOVH 1JT8A 1FJGL 1LYLA 2E74C 2JA7G 1GUNA 3AMUA 3ULPA 2ENBA 2YTVA 4RWSC 2HQLA 2ZJQA 4DV5L 1DCZA 5CV7A 3MA2B 2NN6H 4LFAL 2XWBB 1NAPA 5E7NA 5IT9c 1A3TA 1B9MA 4A3MB 3NHHA 4CDCC 3CXCA 4AIMA 1YNXA 2RCFA 3STBD 4DUYL 3FMCA 2K14A 1ONLA 3RZDH 2JA8H 1JWUD 4HJ9A 3S14B 3S9WA 2Y0SE 1BBWA 3IAYA 4N8X1 1BVSA 2CH4W 2KA7A 3V2TA 1XNQQ 3HOXG 1VQEA 1KAAA 4FF4A 2VQFQ 1D8LA 4A3DG 3J81E 3EJIA 4F87A 2JK8A 5JEAJ 2UXCL 4IUQA 2JA5G 2D9UA 2A19A 3H3VC 2OWOA 2G9HD 3JAME 4N8FA 4DKAC 3JAMc 2DNCA 1PH7A 3UI2A 4LJZC 3T1HQ 4NXMQ 3J7AF 1JOOA 3S15B 5LMNQ 1EIHA 1Y1VG 1F2ZA 1Q46A 1YVCA 3FKIH 4DR4L 2IPKD 3RZOH 3GTQB 4RHSA 3EBEA 1NCVA 1JICA 2B2YA 3CP0A 4A3CG 5GQOA 1PDQA 1DJRD 1GVPA 3EFXD 1PH9A 1N32Q 3STBC 1RHPA 2UXDQ 4DU9A 3HZXA 2WAQE 4EX5A 3V96A 1Z9FA 2ZXRA 1XMOQ 2RVLA 2EDGA 2ZXPA 2K5NA 2ZT9C 4K0KL 1EQTA 1B2TA 4A3JH 2VUMH 1G6ZA 3CMAA 5IP7G 3B6YA 4DV3Q 1SE4A 1G91A 2HT1A 4FVMA 3TP7A 4BY7G 3NENA 3H0GH 4A3BG 2N3SA 4YCVA 3KF6A 5IGEA 1EYDA 5IY0A 1QZGA 5C4XH 5E4WC 1WYDA 1KRTA 2L4NA 3CW2C 4FP5D 3X3MA 5IODA 1V1PA 2PZTA 4LW1A 1FR3A 1SFOH 2CQAA 3GTPH 2SOBA 5LMNL 4JI2Q 2K52A 3WOEA 1S5CD 4ZUIA 2N78A 3MHBA 3I7FA 1WTRA 2IX1A 1M1KC 4C3HH 2E2HB 4B3SL 5JJIA 4GKKL 5M3FH 1PRTD 3CHBD 1A6XA 3GTJB 1PYBA 5C0XI 3D4WA 1FNVA 2K01A 1BNZA 1E24A 1N33L 4HJ5A 2NTTA 1B7YB 4DV2Q 2L12A 1X54A 3CC4A 2O4XA 4ZUJA 4FF2A 4IOCA 1Q8IA 3K59A 3KK7A 2BDNA 4HN7A 3WWVA 1YITA 4OGQC 1LO5D 1SYDA 3QR8A 5JOBA 2JEAI 3OTOL 3H91A 2D0OA 2PQAB 2OCEA 4LAAA 3E0EA 1RD9D 1HTPA 3BU2A 3SVMA 1STEA 1YZ6A 1HJPA 4KK7A 1CQFA 2HDLA 3TS2A 4HIOA 4DAYB 3G4SA 5FJ8G 4XTCS 4DV5Q 2QDBA 4E6IA 2F0FA 1I4PA 1U4PA 2YTYA 2B63G 1EYCA 2MP1A 1J5EQ 2KVMA 1NSNS 1FJGQ 1QOHA 5DAUA 1UEAB 1PTOC 1JC7A 2R7ZB 1STBA 4JI3Q 5LHY1 3BDLA 1ESRA 4A3FB 1XMQQ 1YNND 1CHPD 1Y8NB 2D5DA 1N36Q 2ATWA 4RKBA 3GTLB 3MAQA 3TP6A 5C4JH 4R4CA 4HSPA 2ZJRA 4KN7C 3QG1A 2KEEA 4DNTB 5C4XB 3MVVA 3ONAB 3NBHB 4O42A 4A93G 3A8IE 2M9VA 4FO2A 1C8CA 1VQLA 1NJIC 4DAPA 1GO3E 4B3TL 3W1BA 1HR0W 2B29A 2HCIA 1WCMG 1LTGD 4DXGA 3K57A 4UP8A 4QL5A 1K3BC 4A3IG 4PZ8A 2B2WA 5IYDH 1STGA 4Y52H 3PCOB 4YY3L 4JBMA 4KY7A 4LWCA 2VB3X 2B2YC 1VQMA 1FL0A 4DR5L 3SDZA 4LFBQ 4F7XA 1K83B 3K0XA 4DFAA 4Y7NB 1RIPA 2L5TA 1WTPA 3GO5A 3T51B 2PI2A 5AFWA 1YEZA 2HD3A 1O78A 3R8BA 1LUZA 2PYKA 3SEBA 2YTXA 4XT1B 2R93B 2B2VA 1YIJA 1VDZA 4R4OA 4FDBA 1FVIA 2F0HA 5JEAG 2MO0A 1RODA 1HZAA 4X3TA 3BJUA 2Z1CA 2ZXOA 4DUZQ 4POGA 4K2KA 4GN4B 4A3GB 4DK0A 4JI4L 5IE8A 1Y1WG 2MFIA 4X3KA 1GOZA 1CTMA 1FD7D 1Q12A 5KIXA 3VR5A 5J1ZA 5GAHC 4ABNA 1VQJA 1EYAA 3TREA 4ZKCB 4JV5Q 2UUAL 1KDAA 1SAPA 1TWCH 2L15A 5M5YH 3S1MH 2KHIA 3S2HB 4ME5A 3EA6A 4JI5L 4KLKA 1AEXA 3ERSX 3HKZB 4X62Q 4AQYL 2E75C 4LFCQ 4EQ5A 4A3FH 4L5TA 3P20A 1IKLA 4QB4A 4JPBW 4MNOA 4YY3Q 4F88A 1F9QA 3F1ZA 1K83H 2CQOA 1LTBD 4PMBA 5J22A 3CKIB 3RLOA 1X56A 1UE1A 2M2LA 3M7NA 1N32L 3OW2A 2R7DA 3A0JA 4FF3A 1KNAA 3I4NG 2WAQG 5J3BA 5IYBH 1ILPA 3E6ZX 1HQRD 1TS3A 1X32A 5E4XA 1VMCA 1QJOA 2WINB 5KRUA 2R3ZA 1SMYD 3H3VH 2K05A 4JK1C 3M4OB 5M5WH 1J6QA 1LTTD 2F0EA 1FGUA 5I6YA 4R4TA 1S5BD 4M1UB 1G2TA 1C48A 1PRTB 5C0XJ 3E0JA 3ER0A 4G4KA 5ELBA 4L8JA 1MSGA 2F3VA 4IQZA 5KNBA 2Z6KA 4HSVA 3HOYB 4J6HA 1O80A 4YCUA 4DR3L 2FHTA 4PNYA 2SNSA 4OO1H 4XQQA 3TS0A 1PH6A 3HKZE 2K5VA 4QIWB 4DR6Q 4DUYQ 2KBNA 5C44G 4IOAA 2DN8A 3DWPA 2ZTDA 1DOKA 5JPMC 3OTOQ 1EY9A 2Q8RE 4QGUA 2E8GA 5M3MH 2JN4A 2V4DA 2EYHA 1VQCA 1CKMA 2EE1A 3D4RA 1VQOA 1Y69U 2A6ED 1EU4A 2K7VA 3H6MA 5C0XH 4RCNA 3H0GB 1NTGA 1CFMA 4C3JH 3RN2A 5COYA 1N33Q 3CF5A 1BKBA 5FK9C 3DXJC 3M4YA 4ODGA 4X65Q 2L11A 2ZM6L 1LLRD 2AWNA 3C2PA 3H3VI 1TQOA 5DNFA 1Y8PB 3OPOA 1IBKQ 3MXNB 2BE5D 4P73A 1CM9A 2Z6BA 3D31A 2K50A 1IL8A 3SE0A 4A3EB 2GVBA 1IKMA 5M3FG 1JJ2A 4PG3A 4JI2L 4NKLA 4GS3A 3F2DA 2F0PA 4LF8Q 3P75A 5FO8B 3I72A 5T1GA 3E9HA 3MTSA 1ZEQX 2RA4A 1SFOB 1PXUA 3S1QB 4DA2A 2HCCA 3CC7A 4DV6Q 3G48A 2PI2E 3SR1A 4J1MA 4CDDC 3MXNA 3FPUB 5FLXL 1KD1C 5F2DA 2OF1A 4OONA 4GOPB 4ZQ3A 1SBBB 2QKIC 3KYHC 1DM0B 3P1HA 1NY4A 2CWAA 2IL8A 2KCMA 2KJXA 1AZQA 4LF4Q 5D14A 1Q1BA 2F0NA 4Q5VA 4BY7H 4TSSA 1L1OB 3PUXA 1ENFA 1Z7TA 4QY7A 1A2UA 2B2UC 5IP7H 3FDTA 1H9MA 4LF7L 3LGJA 1LT3D 2M00A 1CZWA 4KHPL 2SNMA 2F0VA 2Z4IA 4JOIC 2JA8B 1HZCA 4KJNA 2BH2A 2RDHA 4DR4Q 4H44C 5C3EB 1TWHB 4BXXG 3BVZA 5D65A 1QZHA 1J8IA 4A3MH 1SNQA 3PV0A 1SDFA 1RL2A 2JE6I 4U68A 2BOSA 1HUMA 1GD7A 5A2QL 1EQVA 4DR7L 3JC66 4EQPA 2KQ3A 5EKIA 3D4DA 2VXWA 3K7UC 1BDOA 1ASZA 3HOZG 3S1MB 1HH2P 4FNFA 4RH6A 5M5YB 4IZ8A 5CV6A 2PW7A 2RSOA 3T53B 3E9IA 3HOVB 1I4XA 5IP9H 2VQFL 1NMFA 2K75A 1V1QA 2QF7A 2JA5H 4YWMA 1RCVD 2LY7A 2NN6I 3HEJA 4C3JG 2ASBA 1VQ6A 5I2XA 1UAPA 3GQBA 1TU2B 1UE6A 4NMZA 3A56A 4O0AA 1I4QA 1V43A 1CA6A 2LXJA 3NTHA 1HFGA 2N49A 2F0MA 5DEHA 2Z6KC 4LUVA 1P8LA 1B50A 3VYUA 2EYOA 5C4JB 1GJXA 3L9AX 5EBCA 2UXBL 5IWAQ 4C2MB 1WVLA 3LWUA 4P75A 4ZK9B 4OXPA 3OIPA 1CT1D 4IUVA 2E2IB 5IOCA 1E7ZA 4OO1G 5CV9A 4ME3A 3FKIG 3UDGA 1IBLL 1W6KA 2L0CA 1TWGB 2QGQA 1QNUA 3DUZA 1ZKOA 1R9TB 1YNJC 1EOVA 1HZ9A 1KDCA 2NZOA 1YHQA 5CYUA 3I3CA 2GA4B 4ULLA 3RUZA 3U4ZA 3K5LA 2F3WA 2KECA 3N52A 4IUUA 4X3UA 4BBSH 3IFDA 1EIYB 1ZYRC 4JCVE 1HNWQ 4YHHQ 5C0XG 1A63A 2UUCQ 4BBRH 2R7FA 4JI1Q 1HA5A 2NVTH 4P74A 4IJLA 5M3MG 2ZJPA 2Q2TA 5JAVA 2A8VA 5FOBB 4JYAQ 1EY4A 4KN4C 3VR6A 2LFNA 3K7AB 1XNRQ 2IY5B 3KF8B 5IWAL 2FMCA 2IT1A 5C44H 2UXBQ 3F2CA 3RLNA 5LMNW 2QCPX 1L0WA 2CKZB 4K8IA 1IL2A 1JJCB 1CKNB 3N6RA 2MUYA 1CSQA 2VNUD 3MWYW 3E5SA 5EPLA 5M5XH 1JWSD 2BA1A 2K33A 1U0LA 5KEEA 3H09A 1FNUA 2NN6G 1BOSA 1X55A 1U5KA 3TP5A 2E5LL 1SYGA 2VZAA 5JPNC 3KF6B 3ZYYX 2IX3A 3K7AH 4P2CB 2JA7B 2JA6G 3MFGA 1ML0D 5BR8Q 4OX9Q 2EIFA 1Z6HA 2X6GA 3M4OH 2I07B 4Z9CB 1KXLA 1IW7C 3I4MB 4YWKA 1HHVA 5C4ZA 2VQEQ 2R92G 1GKHA 5AJ3Q 3I4NH 4MN3A 3CCSA 5IYCH 1PLFA 2ALYB 1LTID 1X6OA 4RGOS 4QIWE 1TWGH 1XX8A 4KHPQ 1PTOH 1X3PA 3HOXB 5HY6A 3D3RA 4A3DB 2E2IH 1RJTA 3RZOB 1R4PB 1WCMB 1W2BA 3K5MA 4MTKA 4RGTA 1DXMA 4RAUC 4A3KB 1H9SB 4TVAB 3M7GA 1ASYA 4AQYQ 4X62L 2XNAC 4KV6A 1XPOA 1AZPA 2I46A 4LF9Q 2N55A 2LSSA 1SNMA 3P7JA 3CMEA 1PZID 1KDBA 4JW0A 1VQ5A 1CUKA 3SXHA 1AN8A 1M8AA 2F0TA 3EN2A 4JI0Q 1I4RA 1WTHA 2YU9H 4OL7A 5FKAC 2A6HC
chains in the Genus database with same CATH topology
4A93H 3PUZA 3ULLA 5FLXc 4RG1A 4QL5A 4UP8A 3AYHB 4A3IG 2EXDA 4JI7Q 4PZ8A 5H1SE 4JI4Q 5IYDH 4AH6A 1VQBA 1E22A 4Y52H 3PCOB 1VQNA 4YY3L 1Q81C 4JBMA 1QUQB 1WI5A 4LWCA 2I5MX 1VQMA 1FL0A 1YBYA 4A3IH 5C4XG 2PQAA 4DR5L 1SROA 4LFBQ 3K0XA 3ZJYC 4A3GG 1VQ7A 2FXQA 1RIPA 3KDFB 3GO5A 3J81c 3U50C 3J81j 2E2JH 1XPUA 1MKHA 2PI2A 4PZ6A 1K3RA 3GD7A 1YEZA 5DLQE 4GKJQ 4OX9L 1LUZA 1TWFH 2NZHA 4UP9A 1PH2A 4LF5L 3HOUG 2OTJA 4JV5L 2WB1G 2YTXA 4XIGS 2QA4A 1YIJA 4R4OA 2R6GA 4FDBA 1FVIA 5FJ8H 3UDFA 1VCIA 3PGZA 4JI6Q 5JEAG 2MO0A 4LFBL 2K4KA 5EAYA 1HZAA 3BJUA 4DR2L 4POGA 1X3EA 2H5XA 2VL6A 4DUZQ 4GKKQ 3FHWA 3HKZG 4A76A 4DR1Q 2NVQH 2WFWA 1K0RA 3GTJH 1VQ9A 3D0FA 1B8AA 4GN4B 4JI4L 3BZCA 5IE8A 1Y1WG 2GN5A 3EIVA 3J80i 3CCEA 4APVA 4GLXA 1OXVA 2MFIA 3T1YQ 1PV4A 3HOYH 4BY1G 3HKSA 1Q12A 4P71A 1K9MC 1XNRL 2R93G 3W1GA 1S3OA 5GAHC 1VQJA 3TREA 2B63H 4IFDI 4OWTB 3J81i 1P16A 4JYAL 1VQAA 3G71A 4JV5Q 4X6AH 1C7YA 4LF5Q 2UUAL 1TWCH 2L15A 3UE1A 3PUVA 5M5YH 3S1MH 3SGIA 2KHIA 4GKJL 1VQ4A 3GTKH 3S1QH 5JJLA 1I6HH 4JI1L 1L1OC 4JI5L 1K8GA 2BA0A 4KLKA 3DLLA 3ERSX 4YHHL 2VS1A 4X62Q 1MJEA 4AQYL 1HR0L 1Q1EA 4LFCQ 1HNZQ 1MIUA 4EQ5A 4A3FH 2I5HA 4L5TA 3CPWA 3CCRA 1LM0A 4DNIA 5K36G 1Y1WH 1SRUA 1K73C 4MNOA 4YY3Q 3I4MG 5ELNA 1N36L 3F1ZA 1K83H 1XMQL 2CQOA 4LF6Q 1TWHH 3CCUA 1O7IA 4GN5A 2RHSB 3HOXH 4LUOA 3TS2A 3I55A 4GOPC 3RLOA 1X56A 1UE1A 4C3IH 2JEBI 1XTDA 4IPHA 3M7NA 1JMCA 1N32L 4HIMA 2ID0A 3OW2A 3HOZH 2R7DA 3A0JA 1J5EL 4HIKA 2JA8G 4YWLA 1IBLQ 4JI0L 3I4NG 2WAQG 3CAMA 5J3BA 1Z47A 2IHEA 3CCJA 5IYBH 1BBUA 4JG2A 1XPRA 1AE3A 3HOYG 3U4VA 4DAMA 4IPDA 4LF9L 3PO2G 2D0PA 3GTGH 3PSIA 1B70B 3UE0A 4LUZA 1CKOA 3M4PA 1WFQA 4A75A 3H3VH 4HIDA 3GTQH 3TEHB 1D7QA 1YHAA 5M5WH 3KDFA 3I56A 1PYSB 1J6QA 1FGUA 2CWPA 4R4TA 4UP7A 1HNZL 4O2DA 3OYYA 1SN8A 4NB3A 5IYDG 1KAWA 4NPSA 5C0XJ 3J80c 1SE8A 3ER0A 3IRBA 4IFDG 3A74A 1YHBA 3AFQA 3KJPA 1PH1A 1K8AC 4BA2I 2EQSA 2C35B 2Z6KA 1WCMH 2WP8J 3PF5A 1JB7A 1E1OA 4IJHA 3ULJA 4A3CH 1G6PA 1AH9A 4YCUA 3PUYA 4DR3L 3UDIA 1X3FA 1XNQL 4X66L 4HJ8A 3H0GG 2GVAA 4A3GH 4UPAA 2UUBL 2ZTEA 1A62A 1SR3A 3TS0A 3GTMH 1PH6A 2BH8A 1VQHA 1G291 2K5VA 3HKZE 5IYBG 1IBML 4B3SQ 4DR6Q 2VQEL 2F52A 4DUYQ 2KBNA 5C44G 5GAEC 1VQPA 2Y0SG 4IOAA 4A3JG 2VUMG 2ZTDA 3W5OA 4QQBX 4B3ML 3K81C 1I94Q 3OTOQ 4OO1I 1L2FA 4DUZL 4JBJA 4DR2Q 4QGUA 5LMUL 2CFMA 1N34Q 4A3KH 2E8GA 5M3MH 3S2DH 4JI6L 4IFDJ 2WB1E 1VQCA 1CKMA 1VQOA 4LFAQ 4GNXA 3I4MH 2MNAA 2A1AA 4ALPA 3J7A5 1KHIA 5HGQA 4DV2L 3BZKA 3CCLA 2XGTA 1NTGA 1NBWA 1OXSC 2JJQA 4Y7NH 4C3JH 3RN2A 1PH3A 1N33Q 4C2MH 4POFA 3CF5A 3CC2A 1BKBA 4JBKA 4UY8C 1QVGA 1KC8C 1Y1VH 4X65Q 1EQQA 2UUCL 2ZM6L 2DUDA 2E5LQ 2UU9Q 3CCVA 4DR5Q 3RR5A 5FLMH 5FLMG 2AWNA 2Z0SA 3H3VI 1OXTA 2MO1A 4JBWA 1EYGA 2R92H 4LF4L 1NMGA 3CPFA 1IBKQ 3MXNB 4P73A 4IPGA 4JI8L 1EIFA 2OQ0A 3AQQA 1XJVA 3GTOH 3S16H 1KIXA 4DK3C 1PH4A 4K0KQ 3D31A 2K50A 2GVBA 3S1RH 3NELA 5M3FG 3HOWG 1SMXA 3L2PA 4DV1L 4PG3A 1JJ2A 4JI2L 3MEFA 4GS3A 2UXDL 4TQUS 3F2DA 1JE5A 4OWXB 4LF8Q 4DV0L 1I5FA 4B3RL 3RNUA 2HHHQ 4B3TQ 2VW9A 1GM5A 1Q7YC 1PH8A 3E9HA 1EWIA 3UDXA 1V9PA 3H15A 2JA6H 4R4IA 2Q2IA 2HHHL 3CC7A 4DV6Q 1PA6A 3G48A 4H02A 2JA7H 3GTLH 2PI2E 2B3GA 2RHQB 1WJJA 3M4QA 3RN5A 2NVXH 3TRZA 1HNWL 1KD1C 4KHZA 3T1HL 4OONA 5C3EG 4GOPB 2R7ZH 3PF4A 3KYHC 4A3DH 4L5RC 4X64L 1NY4A 3DM3A 2CWAA 3HFZB 4JI8Q 2KCMA 4BBRG 1PHJA 1HNXL 2E2HH 4A3MG 4LF4Q 1Q1BA 4A3EH 4JI3L 4BY7H 1L1OB 3PUXA 1XMOL 5JJKA 1TXYA 1UWVA 3L0OA 4L5QA 2UU9L 4BBSG 4QY7A 1PH5A 4BA1I 1YJNA 5IP7H 3HOVH 1JT8A 1FJGL 4X65L 3M3YH 4LF7L 1LYLA 3LGJA 2JA7G 4NXNL 3ULPA 4KHPL 4JC0A 4JOIC 2YTVA 4DV4Q 2HQLA 2ZJQA 1HZCA 4DV5L 3HOVG 2BH2A 2IHFA 3M9BA 1QVCA 1UE7A 4DR4Q 4BXXG 4RMFA 4LFAL 1A8VA 5AJ3L 3RLFA 1QZHA 1OXUA 4A3MH 5E7NA 4GOPA 5IT9c 3PV0A 2PNHA 1OXXK 1RL2A 4L5SA 4NXML 3PO3G 2JE6I 5GROA 3CXCA 1GD7A 4R1JA 3S17H 4DR7L 3JC66 4AIMA 1YNXA 3STBD 4DUYL 3KJOA 1X9NA 2F4VQ 2HIVA 1UEBA 2K14A 3K7UC 4DV7Q 1QUQA 3RZDH 2JA8H 2UXCQ 3U58A 1ASZA 4HJ9A 3HOZG 1E3PA 3K8AA 1HH2P 4A3LG 4WJ4A 2Y0SE 2UUBQ 1BBWA 1IZ6A 3I4OA 5BR8L 3E9IA 1BVSA 1R9TH 5IP9H 2VQFL 1NMFA 1PFSA 2K75A 1V1QA 4DR3Q 1XNQQ 3HOXG 1VQEA 2JA5H 4DV4L 4YWMA 2NN6I 1EQRA 1VQFA 2OQKA 3A5UA 1VQ6A 3NEMA 2ASBA 3TQYA 2VQFQ 1UE5A 2DGYA 2AWOA 1H95A 1D8LA 3AEVA 1UE6A 4A3DG 4O0AA 2JK8A 3M85A 1V43A 5JEAJ 1KRSA 4A3FG 2LXJA 4JOIA 4DV7L 2UXCL 2N49A 2JA5G 2XTIA 1VQ8A 1HNXQ 2A19A 1CKNA 4QJFA 4DK6C 2OWOA 4DR7Q 2I5LX 4X64Q 2Z6KC 1TWAH 1I50H 2AKWB 1P8LA 4LUVA 4DKAC 3JAMc 4P72A 1PH7A 3S15H 1PVOA 1N8RC 3T1HQ 4NXMQ 2KCTA 3KOJA 4HJAA 3F2BA 5LMNQ 1EUJA 2UXBL 1Y1VG 5IWAQ 1Q46A 2AHOB 1Q82C 1VQGA 1YVCA 4P75A 3FKIH 4AYBE 4OXPA 4DR4L 2HIXA 1YJWA 3RZOH 4HJ7A 4BY1H 1E7ZA 4OO1G 3EBEA 3PO3H 5GADC 4ME3A 3K80C 3CP0A 2KENA 3FKIG 4R4QA 5GQOA 3UDGA 1IBLL 4A3CG 4DV0Q 1GVPA 4B3RQ 1A63A 3L7ZC 4LF7Q 1PH9A 3G6EA 2QGQA 3STBC 1N32Q 2NVYH 2UXDQ 1VQDA 2WAQE 1EOVA 4EX5A 4A3LH 1HZ9A 1Z9FA 2NZOA 1T9HA 4KI0A 1XMOQ 4OWWB 1EFWA 5ELOA 4DV3L 2K5NA 4GNXC 2CCZA 4K0KL 1YHQA 1CSPA 3F8TA 3U4ZA 4A3JH 2VUMH 2AMCB 1VQKA 3CMAA 5IP7G 1IBKL 4LNQA 3B6YA 4DV3Q 4BBSH 2HT1A 2YYZA 3J7ZC 4LFCL 1C9OA 1EIYB 3KFUA 4A3EG 1HR0Q 4JCVE 4BY7G 3AFPA 1HNWQ 3PIOA 2ZM6Q 1NE3A 5C0XG 4YHHQ 3NENA 3H0GH 3CCMA 2ES2A 2N3SA 4YCVA 2UUCQ 4A3BG 3KF6A 4BBRH 2LXKA 4DV6L 2R7FA 4JI1Q 1JJGA 2K5HA 5IY0A 4AYBG 2NVTH 4P74A 4IJLA 5M3MG 2ZJPA 1S72A 1QZGA 2Q2TA 5C4XH 2A8VA 1WYDA 1KRTA 3CW2C 4JYAQ 1C0AA 1I3QH 2I0QA 3CQZH 4LF8L 1XNRQ 4LW1A 4GLVB 3S1NH 3KF8B 2YV5A 5IWAL 2IY5B 4YCWA 4GLAC 1DGSA 2IT1A 5C44H 1SFOH 3GTPH 2UXBQ 5LMNL 2RF4A 3T1YL 3F2CA 3RLNA 4JI2Q 2K52A 5LMNW 5LMUQ 4DV1Q 1L0WA 2CKZB 1N34L 4IPCA 1IL2A 2F3IA 1JJCB 1CKNB 3GDEA 3ICEA 4B3MQ 2N78A 1MJCA 3I7FA 2IX1A 4DPGA 3S24A 1CSQA 2Q2HA 2VNUD 5M5XH 1M1KC 4C3HH 1VQIA 4A3BH 4DR1L 2BA1A 1L1OA 1U0LA 3A5ZB 1G51A 4B3SL 1IBMQ 4DR6L 5JJIA 4GKKL 2NN6G 5M3FH 3HOWH 1X55A 1U5KA 2D62A 2E5LL 2VY3A 4A4IA 2ZTCA 1PYBA 4X66Q 5C0XI 2VZAA 3I2ZA 3KF6B 3S14H 1E24A 1A0IA 1N33L 2V1CC 3K7AH 4HJ5A 1X3GA 2QEXA 1M90C 2JA6G 1B7YB 1VS0A 4DV2Q 2Q2UA 1X54A 5BR8Q 2EIFA 3CC4A 1E1TA 4OX9Q 1W3SA 2JQOA 4GN3B 4IOCA 4PMWA 2PMZE 3JAMi 3WWVA 3M4OH 2F4VL 1YITA 3CD6A 1KXLA 3PO2H 2JEAI 3OTOL 1I94L 2IX0A 2R7ZG 2D0OA 4PZ7A 2PQAB 5C3EH 2OCEA 3E0EA 1SLJA 4YWKA 1IXRA 1YJ9A 2VQEQ 2R92G 1GKHA 4A3KG 5AJ3Q 1X65A 3BU2A 1Q86C 3I4NH 4JI7L 1YZ6A 3S2HH 1LTLA 1HJPA 4MZ9A 1AE2A 3FP9A 3CCSA 1N9WA 4DAYB 5IYCG 5IYCH 2ALYB 2JA9A 3G4SA 4HIOA 5FJ8G 1Q8KA 4XTCS 4MTNA 3PIPA 4DV5Q 2OTLA 4WJ3M 1X6OA 2MQHA 2YTYA 1TWGH 4QIWE 3CCQA 1HZBA 4GNXB 3VDYA 4NXNQ 2B63G 4KHPQ 1J5EQ 1KL9A 1IYJB 1FJGQ 5HY6A 2E2IH 4JI3Q 2N8NA 3KLWA 1W2BA 1KQSA 1XMQQ 4LF6L 5IP9G 1N36Q 2ATWA 5C4JH 4R4CA 4TVAB 2ZJRA 4IO9A 1ASYA 1QVFA 4AQYQ 2KHJA 4X62L 3PUWA 1XPOA 2R93H 4JI5Q 1WOCA 3Q8DA 4LF9Q 2LSSA 5GAGC 3CMEA 1YI2A 3NBHB 3HOUH 1Y14B 4A93G 4J15A 2UUAQ 1VQ5A 1OTCA 1VQLA 1CUKA 1NJIC 1S40A 1GO3E 4B3TL 2RCNA 3EN2A 3W1BA 2B29A 1HR0W 2YU9H 4JI0Q 4BXXH 1WCMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A93 H;  3PUZ A;  3ULL A;  5FLX c;  4RG1 A;  4QL5 A;  4UP8 A;  3AYH B;  4A3I G;  2EXD A;  4JI7 Q;  4PZ8 A;  5H1S E;  4JI4 Q;  5IYD H;  4AH6 A;  1VQB A;  1E22 A;  4Y52 H;  3PCO B;  1VQN A;  4YY3 L;  1Q81 C;  4JBM A;  1QUQ B;  1WI5 A;  4LWC A;  2I5M X;  1VQM A;  1FL0 A;  1YBY A;  4A3I H;  5C4X G;  2PQA A;  4DR5 L;  1SRO A;  4LFB Q;  3K0X A;  3ZJY C;  4A3G G;  1VQ7 A;  2FXQ A;  1RIP A;  3KDF B;  3GO5 A;  3J81 c;  3U50 C;  3J81 j;  2E2J H;  1XPU A;  1MKH A;  2PI2 A;  4PZ6 A;  1K3R A;  3GD7 A;  1YEZ A;  5DLQ E;  4GKJ Q;  4OX9 L;  1LUZ A;  1TWF H;  2NZH A;  4UP9 A;  1PH2 A;  4LF5 L;  3HOU G;  2OTJ A;  4JV5 L;  2WB1 G;  2YTX A;  4XIG S;  2QA4 A;  1YIJ A;  4R4O A;  2R6G A;  4FDB A;  1FVI A;  5FJ8 H;  3UDF A;  1VCI A;  3PGZ A;  4JI6 Q;  5JEA G;  2MO0 A;  4LFB L;  2K4K A;  5EAY A;  1HZA A;  3BJU A;  4DR2 L;  4POG A;  1X3E A;  2H5X A;  2VL6 A;  4DUZ Q;  4GKK Q;  3FHW A;  3HKZ G;  4A76 A;  4DR1 Q;  2NVQ H;  2WFW A;  1K0R A;  3GTJ H;  1VQ9 A;  3D0F A;  1B8A A;  4GN4 B;  4JI4 L;  3BZC A;  5IE8 A;  1Y1W G;  2GN5 A;  3EIV A;  3J80 i;  3CCE A;  4APV A;  4GLX A;  1OXV A;  2MFI A;  3T1Y Q;  1PV4 A;  3HOY H;  4BY1 G;  3HKS A;  1Q12 A;  4P71 A;  1K9M C;  1XNR L;  2R93 G;  3W1G A;  1S3O A;  5GAH C;  1VQJ A;  3TRE A;  2B63 H;  4IFD I;  4OWT B;  3J81 i;  1P16 A;  4JYA L;  1VQA A;  3G71 A;  4JV5 Q;  4X6A H;  1C7Y A;  4LF5 Q;  2UUA L;  1TWC H;  2L15 A;  3UE1 A;  3PUV A;  5M5Y H;  3S1M H;  3SGI A;  2KHI A;  4GKJ L;  1VQ4 A;  3GTK H;  3S1Q H;  5JJL A;  1I6H H;  4JI1 L;  1L1O C;  4JI5 L;  1K8G A;  2BA0 A;  4KLK A;  3DLL A;  3ERS X;  4YHH L;  2VS1 A;  4X62 Q;  1MJE A;  4AQY L;  1HR0 L;  1Q1E A;  4LFC Q;  1HNZ Q;  1MIU A;  4EQ5 A;  4A3F H;  2I5H A;  4L5T A;  3CPW A;  3CCR A;  1LM0 A;  4DNI A;  5K36 G;  1Y1W H;  1SRU A;  1K73 C;  4MNO A;  4YY3 Q;  3I4M G;  5ELN A;  1N36 L;  3F1Z A;  1K83 H;  1XMQ L;  2CQO A;  4LF6 Q;  1TWH H;  3CCU A;  1O7I A;  4GN5 A;  2RHS B;  3HOX H;  4LUO A;  3TS2 A;  3I55 A;  4GOP C;  3RLO A;  1X56 A;  1UE1 A;  4C3I H;  2JEB I;  1XTD A;  4IPH A;  3M7N A;  1JMC A;  1N32 L;  4HIM A;  2ID0 A;  3OW2 A;  3HOZ H;  2R7D A;  3A0J A;  1J5E L;  4HIK A;  2JA8 G;  4YWL A;  1IBL Q;  4JI0 L;  3I4N G;  2WAQ G;  3CAM A;  5J3B A;  1Z47 A;  2IHE A;  3CCJ A;  5IYB H;  1BBU A;  4JG2 A;  1XPR A;  1AE3 A;  3HOY G;  3U4V A;  4DAM A;  4IPD A;  4LF9 L;  3PO2 G;  2D0P A;  3GTG H;  3PSI A;  1B70 B;  3UE0 A;  4LUZ A;  1CKO A;  3M4P A;  1WFQ A;  4A75 A;  3H3V H;  4HID A;  3GTQ H;  3TEH B;  1D7Q A;  1YHA A;  5M5W H;  3KDF A;  3I56 A;  1PYS B;  1J6Q A;  1FGU A;  2CWP A;  4R4T A;  4UP7 A;  1HNZ L;  4O2D A;  3OYY A;  1SN8 A;  4NB3 A;  5IYD G;  1KAW A;  4NPS A;  5C0X J;  3J80 c;  1SE8 A;  3ER0 A;  3IRB A;  4IFD G;  3A74 A;  1YHB A;  3AFQ A;  3KJP A;  1PH1 A;  1K8A C;  4BA2 I;  2EQS A;  2C35 B;  2Z6K A;  1WCM H;  2WP8 J;  3PF5 A;  1JB7 A;  1E1O A;  4IJH A;  3ULJ A;  4A3C H;  1G6P A;  1AH9 A;  4YCU A;  3PUY A;  4DR3 L;  3UDI A;  1X3F A;  1XNQ L;  4X66 L;  4HJ8 A;  3H0G G;  2GVA A;  4A3G H;  4UPA A;  2UUB L;  2ZTE A;  1A62 A;  1SR3 A;  3TS0 A;  3GTM H;  1PH6 A;  2BH8 A;  1VQH A;  1G29 1;  2K5V A;  3HKZ E;  5IYB G;  1IBM L;  4B3S Q;  4DR6 Q;  2VQE L;  2F52 A;  4DUY Q;  2KBN A;  5C44 G;  5GAE C;  1VQP A;  2Y0S G;  4IOA A;  4A3J G;  2VUM G;  2ZTD A;  3W5O A;  4QQB X;  4B3M L;  3K81 C;  1I94 Q;  3OTO Q;  4OO1 I;  1L2F A;  4DUZ L;  4JBJ A;  4DR2 Q;  4QGU A;  5LMU L;  2CFM A;  1N34 Q;  4A3K H;  2E8G A;  5M3M H;  3S2D H;  4JI6 L;  4IFD J;  2WB1 E;  1VQC A;  1CKM A;  1VQO A;  4LFA Q;  4GNX A;  3I4M H;  2MNA A;  2A1A A;  4ALP A;  3J7A 5;  1KHI A;  5HGQ A;  4DV2 L;  3BZK A;  3CCL A;  2XGT A;  1NTG A;  1NBW A;  1OXS C;  2JJQ A;  4Y7N H;  4C3J H;  3RN2 A;  1PH3 A;  1N33 Q;  4C2M H;  4POF A;  3CF5 A;  3CC2 A;  1BKB A;  4JBK A;  4UY8 C;  1QVG A;  1KC8 C;  1Y1V H;  4X65 Q;  1EQQ A;  2UUC L;  2ZM6 L;  2DUD A;  2E5L Q;  2UU9 Q;  3CCV A;  4DR5 Q;  3RR5 A;  5FLM H;  5FLM G;  2AWN A;  2Z0S A;  3H3V I;  1OXT A;  2MO1 A;  4JBW A;  1EYG A;  2R92 H;  4LF4 L;  1NMG A;  3CPF A;  1IBK Q;  3MXN B;  4P73 A;  4IPG A;  4JI8 L;  1EIF A;  2OQ0 A;  3AQQ A;  1XJV A;  3GTO H;  3S16 H;  1KIX A;  4DK3 C;  1PH4 A;  4K0K Q;  3D31 A;  2K50 A;  2GVB A;  3S1R H;  3NEL A;  5M3F G;  3HOW G;  1SMX A;  3L2P A;  4DV1 L;  4PG3 A;  1JJ2 A;  4JI2 L;  3MEF A;  4GS3 A;  2UXD L;  4TQU S;  3F2D A;  1JE5 A;  4OWX B;  4LF8 Q;  4DV0 L;  1I5F A;  4B3R L;  3RNU A;  2HHH Q;  4B3T Q;  2VW9 A;  1GM5 A;  1Q7Y C;  1PH8 A;  3E9H A;  1EWI A;  3UDX A;  1V9P A;  3H15 A;  2JA6 H;  4R4I A;  2Q2I A;  2HHH L;  3CC7 A;  4DV6 Q;  1PA6 A;  3G48 A;  4H02 A;  2JA7 H;  3GTL H;  2PI2 E;  2B3G A;  2RHQ B;  1WJJ A;  3M4Q A;  3RN5 A;  2NVX H;  3TRZ A;  1HNW L;  1KD1 C;  4KHZ A;  3T1H L;  4OON A;  5C3E G;  4GOP B;  2R7Z H;  3PF4 A;  3KYH C;  4A3D H;  4L5R C;  4X64 L;  1NY4 A;  3DM3 A;  2CWA A;  3HFZ B;  4JI8 Q;  2KCM A;  4BBR G;  1PHJ A;  1HNX L;  2E2H H;  4A3M G;  4LF4 Q;  1Q1B A;  4A3E H;  4JI3 L;  4BY7 H;  1L1O B;  3PUX A;  1XMO L;  5JJK A;  1TXY A;  1UWV A;  3L0O A;  4L5Q A;  2UU9 L;  4BBS G;  4QY7 A;  1PH5 A;  4BA1 I;  1YJN A;  5IP7 H;  3HOV H;  1JT8 A;  1FJG L;  4X65 L;  3M3Y H;  4LF7 L;  1LYL A;  3LGJ A;  2JA7 G;  4NXN L;  3ULP A;  4KHP L;  4JC0 A;  4JOI C;  2YTV A;  4DV4 Q;  2HQL A;  2ZJQ A;  1HZC A;  4DV5 L;  3HOV G;  2BH2 A;  2IHF A;  3M9B A;  1QVC A;  1UE7 A;  4DR4 Q;  4BXX G;  4RMF A;  4LFA L;  1A8V A;  5AJ3 L;  3RLF A;  1QZH A;  1OXU A;  4A3M H;  5E7N A;  4GOP A;  5IT9 c;  3PV0 A;  2PNH A;  1OXX K;  1RL2 A;  4L5S A;  4NXM L;  3PO3 G;  2JE6 I;  5GRO A;  3CXC A;  1GD7 A;  4R1J A;  3S17 H;  4DR7 L;  3JC6 6;  4AIM A;  1YNX A;  3STB D;  4DUY L;  3KJO A;  1X9N A;  2F4V Q;  2HIV A;  1UEB A;  2K14 A;  3K7U C;  4DV7 Q;  1QUQ A;  3RZD H;  2JA8 H;  2UXC Q;  3U58 A;  1ASZ A;  4HJ9 A;  3HOZ G;  1E3P A;  3K8A A;  1HH2 P;  4A3L G;  4WJ4 A;  2Y0S E;  2UUB Q;  1BBW A;  1IZ6 A;  3I4O A;  5BR8 L;  3E9I A;  1BVS A;  1R9T H;  5IP9 H;  2VQF L;  1NMF A;  1PFS A;  2K75 A;  1V1Q A;  4DR3 Q;  1XNQ Q;  3HOX G;  1VQE A;  2JA5 H;  4DV4 L;  4YWM A;  2NN6 I;  1EQR A;  1VQF A;  2OQK A;  3A5U A;  1VQ6 A;  3NEM A;  2ASB A;  3TQY A;  2VQF Q;  1UE5 A;  2DGY A;  2AWO A;  1H95 A;  1D8L A;  3AEV A;  1UE6 A;  4A3D G;  4O0A A;  2JK8 A;  3M85 A;  1V43 A;  5JEA J;  1KRS A;  4A3F G;  2LXJ A;  4JOI A;  4DV7 L;  2UXC L;  2N49 A;  2JA5 G;  2XTI A;  1VQ8 A;  1HNX Q;  2A19 A;  1CKN A;  4QJF A;  4DK6 C;  2OWO A;  4DR7 Q;  2I5L X;  4X64 Q;  2Z6K C;  1TWA H;  1I50 H;  2AKW B;  1P8L A;  4LUV A;  4DKA C;  3JAM c;  4P72 A;  1PH7 A;  3S15 H;  1PVO A;  1N8R C;  3T1H Q;  4NXM Q;  2KCT A;  3KOJ A;  4HJA A;  3F2B A;  5LMN Q;  1EUJ A;  2UXB L;  1Y1V G;  5IWA Q;  1Q46 A;  2AHO B;  1Q82 C;  1VQG A;  1YVC A;  4P75 A;  3FKI H;  4AYB E;  4OXP A;  4DR4 L;  2HIX A;  1YJW A;  3RZO H;  4HJ7 A;  4BY1 H;  1E7Z A;  4OO1 G;  3EBE A;  3PO3 H;  5GAD C;  4ME3 A;  3K80 C;  3CP0 A;  2KEN A;  3FKI G;  4R4Q A;  5GQO A;  3UDG A;  1IBL L;  4A3C G;  4DV0 Q;  1GVP A;  4B3R Q;  1A63 A;  3L7Z C;  4LF7 Q;  1PH9 A;  3G6E A;  2QGQ A;  3STB C;  1N32 Q;  2NVY H;  2UXD Q;  1VQD A;  2WAQ E;  1EOV A;  4EX5 A;  4A3L H;  1HZ9 A;  1Z9F A;  2NZO A;  1T9H A;  4KI0 A;  1XMO Q;  4OWW B;  1EFW A;  5ELO A;  4DV3 L;  2K5N A;  4GNX C;  2CCZ A;  4K0K L;  1YHQ A;  1CSP A;  3F8T A;  3U4Z A;  4A3J H;  2VUM H;  2AMC B;  1VQK A;  3CMA A;  5IP7 G;  1IBK L;  4LNQ A;  3B6Y A;  4DV3 Q;  4BBS H;  2HT1 A;  2YYZ A;  3J7Z C;  4LFC L;  1C9O A;  1EIY B;  3KFU A;  4A3E G;  1HR0 Q;  4JCV E;  4BY7 G;  3AFP A;  1HNW Q;  3PIO A;  2ZM6 Q;  1NE3 A;  5C0X G;  4YHH Q;  3NEN A;  3H0G H;  3CCM A;  2ES2 A;  2N3S A;  4YCV A;  2UUC Q;  4A3B G;  3KF6 A;  4BBR H;  2LXK A;  4DV6 L;  2R7F A;  4JI1 Q;  1JJG A;  2K5H A;  5IY0 A;  4AYB G;  2NVT H;  4P74 A;  4IJL A;  5M3M G;  2ZJP A;  1S72 A;  1QZG A;  2Q2T A;  5C4X H;  2A8V A;  1WYD A;  1KRT A;  3CW2 C;  4JYA Q;  1C0A A;  1I3Q H;  2I0Q A;  3CQZ H;  4LF8 L;  1XNR Q;  4LW1 A;  4GLV B;  3S1N H;  3KF8 B;  2YV5 A;  5IWA L;  2IY5 B;  4YCW A;  4GLA C;  1DGS A;  2IT1 A;  5C44 H;  1SFO H;  3GTP H;  2UXB Q;  5LMN L;  2RF4 A;  3T1Y L;  3F2C A;  3RLN A;  4JI2 Q;  2K52 A;  5LMN W;  5LMU Q;  4DV1 Q;  1L0W A;  2CKZ B;  1N34 L;  4IPC A;  1IL2 A;  2F3I A;  1JJC B;  1CKN B;  3GDE A;  3ICE A;  4B3M Q;  2N78 A;  1MJC A;  3I7F A;  2IX1 A;  4DPG A;  3S24 A;  1CSQ A;  2Q2H A;  2VNU D;  5M5X H;  1M1K C;  4C3H H;  1VQI A;  4A3B H;  4DR1 L;  2BA1 A;  1L1O A;  1U0L A;  3A5Z B;  1G51 A;  4B3S L;  1IBM Q;  4DR6 L;  5JJI A;  4GKK L;  2NN6 G;  5M3F H;  3HOW H;  1X55 A;  1U5K A;  2D62 A;  2E5L L;  2VY3 A;  4A4I A;  2ZTC A;  1PYB A;  4X66 Q;  5C0X I;  2VZA A;  3I2Z A;  3KF6 B;  3S14 H;  1E24 A;  1A0I A;  1N33 L;  2V1C C;  3K7A H;  4HJ5 A;  1X3G A;  2QEX A;  1M90 C;  2JA6 G;  1B7Y B;  1VS0 A;  4DV2 Q;  2Q2U A;  1X54 A;  5BR8 Q;  2EIF A;  3CC4 A;  1E1T A;  4OX9 Q;  1W3S A;  2JQO A;  4GN3 B;  4IOC A;  4PMW A;  2PMZ E;  3JAM i;  3WWV A;  3M4O H;  2F4V L;  1YIT A;  3CD6 A;  1KXL A;  3PO2 H;  2JEA I;  3OTO L;  1I94 L;  2IX0 A;  2R7Z G;  2D0O A;  4PZ7 A;  2PQA B;  5C3E H;  2OCE A;  3E0E A;  1SLJ A;  4YWK A;  1IXR A;  1YJ9 A;  2VQE Q;  2R92 G;  1GKH A;  4A3K G;  5AJ3 Q;  1X65 A;  3BU2 A;  1Q86 C;  3I4N H;  4JI7 L;  1YZ6 A;  3S2H H;  1LTL A;  1HJP A;  4MZ9 A;  1AE2 A;  3FP9 A;  3CCS A;  1N9W A;  4DAY B;  5IYC G;  5IYC H;  2ALY B;  2JA9 A;  3G4S A;  4HIO A;  5FJ8 G;  1Q8K A;  4XTC S;  4MTN A;  3PIP A;  4DV5 Q;  2OTL A;  4WJ3 M;  1X6O A;  2MQH A;  2YTY A;  1TWG H;  4QIW E;  3CCQ A;  1HZB A;  4GNX B;  3VDY A;  4NXN Q;  2B63 G;  4KHP Q;  1J5E Q;  1KL9 A;  1IYJ B;  1FJG Q;  5HY6 A;  2E2I H;  4JI3 Q;  2N8N A;  3KLW A;  1W2B A;  1KQS A;  1XMQ Q;  4LF6 L;  5IP9 G;  1N36 Q;  2ATW A;  5C4J H;  4R4C A;  4TVA B;  2ZJR A;  4IO9 A;  1ASY A;  1QVF A;  4AQY Q;  2KHJ A;  4X62 L;  3PUW A;  1XPO A;  2R93 H;  4JI5 Q;  1WOC A;  3Q8D A;  4LF9 Q;  2LSS A;  5GAG C;  3CME A;  1YI2 A;  3NBH B;  3HOU H;  1Y14 B;  4A93 G;  4J15 A;  2UUA Q;  1VQ5 A;  1OTC A;  1VQL A;  1CUK A;  1NJI C;  1S40 A;  1GO3 E;  4B3T L;  2RCN A;  3EN2 A;  3W1B A;  2B29 A;  1HR0 W;  2YU9 H;  4JI0 Q;  4BXX H;  1WCM G; 
#chains in the Genus database with same CATH topology
 1ENC A;  4A93 H;  4RG1 A;  1T5X D;  3AYH B;  3PQI A;  3X3N A;  5CR3 A;  2EXD A;  4IFD H;  2PNR C;  4A3J B;  1LAC A;  2VUM B;  5CV8 A;  1VQN A;  1WI5 A;  2I5M X;  3R2T A;  4K14 A;  2EZV A;  2PQA A;  3ZJY C;  1TWF B;  2FXQ A;  1GUG A;  2E2J H;  1MKH A;  2IWH A;  1K3R A;  3GD7 A;  1PH2 A;  1MGS A;  4AYB B;  3BDO A;  2A73 B;  2HUG A;  3VA5 A;  5A35 A;  2QA4 A;  2R6G A;  5FJ8 H;  4LFB L;  3KLS X;  5EAY A;  4DR2 L;  1X3E A;  2H5X A;  2EPB A;  3DHQ A;  3ND9 A;  3HKZ G;  2EJG C;  5I2Y A;  4DR1 Q;  2L55 A;  1K0R A;  1TVX A;  1EWC A;  3FVQ A;  4K5W A;  3CCE A;  4APV A;  2A68 D;  1VMP A;  4PV1 C;  4UDU C;  3T1Y Q;  1PV4 A;  1CHQ D;  4BY1 G;  3HOU B;  2EOT A;  1SJH D;  1XNR L;  2A69 D;  3J81 i;  3PUV A;  4O1N A;  4GKJ L;  3S1Q H;  1I6H H;  4JI1 L;  4TRD A;  2F0G A;  3NE5 B;  4YHH L;  2VS1 A;  3TSS A;  3S17 B;  2B2W C;  2Z8L A;  1WTX A;  2NVT B;  1L0X B;  2I5H A;  3JAM L;  5K36 G;  5ELN A;  4C3H G;  3HS0 C;  4KJO A;  4LF6 Q;  5ELE A;  1FYC A;  2ICE C;  1R4Q B;  4BBS B;  4LUO A;  2XVS A;  4H13 C;  1BR9 A;  4C3I H;  2JEB I;  1IYV A;  2DJG C;  1JMC A;  1U4R A;  1J5E L;  1IBL Q;  4JI0 L;  4JG2 A;  4UHV A;  1AE3 A;  3HOY G;  2PW5 A;  4LF9 L;  3PSI A;  1B70 B;  4LUZ A;  1CKO A;  4CKC A;  5I9P A;  1GUO A;  5KYI A;  1D7Q A;  1YHA A;  1PYS B;  4PQX A;  1F2Y A;  3NPP A;  4UP7 A;  5ELD A;  1CK1 A;  3NQI A;  3HGB A;  1SN8 A;  4NB3 A;  3W2D A;  4FF1 A;  1EIG A;  1E2V A;  4HTH A;  3K5N A;  1YHB A;  1RF2 D;  3AFQ A;  2NYZ D;  1K8A C;  1HRJ A;  2WP8 J;  1E1O A;  4IJH A;  1G6P A;  3TZD A;  4A3C H;  2BE5 C;  3PUY A;  2YU9 B;  3VYS A;  4HJ8 A;  1PZK D;  2GVA A;  2XWJ B;  2Q8T A;  1C4Q A;  3S16 B;  2JA5 B;  1VQH A;  4B3S Q;  3G7L A;  2A69 C;  3OMG A;  1VQP A;  4QQB X;  4HAE A;  4C3I G;  4B3M L;  1I94 Q;  1L2F A;  4JBJ A;  4BS9 A;  3KF8 A;  2CFM A;  4RFB A;  3S2D H;  4IFD J;  4LK1 C;  3QWN A;  1ET9 A;  3ERO A;  1XTC D;  1OO9 B;  3BS1 A;  1KHI A;  5HGQ A;  3CCL A;  2JJQ A;  1YNN C;  1NBW A;  4C2M H;  4POF A;  3MXG A;  4CDE C;  3A8J E;  1KC8 C;  1SSO A;  2WKC A;  4XDX A;  2DUD A;  3BVG A;  2UU9 Q;  2Z0S A;  4CJ2 C;  4JBW A;  1EYG A;  4LF4 L;  1NMG A;  2A74 C;  4R9W A;  1WD0 A;  3ITP A;  2X69 A;  4JI8 L;  2N88 A;  4H7B A;  2DY8 A;  3GTO H;  1KIX A;  1PH4 A;  4BY7 B;  1ENA A;  3HOW G;  1IHZ A;  1SMX A;  3SK5 A;  3MEF A;  4A3B B;  1VF5 C;  2UXD L;  2FFK B;  1D1K A;  4TQU S;  1IW7 D;  1JE5 A;  1I5F A;  2K32 A;  3W3A A;  4B3T Q;  1GM5 A;  1V9P A;  3H15 A;  1BCP D;  2Q2I A;  1TWC B;  2HHH L;  1S5E D;  1PA6 A;  2JA7 H;  3TN2 A;  2DNE A;  1WJJ A;  2H1E A;  3TP8 A;  3TRZ A;  4G7O C;  1HNW L;  1CZG A;  1EY0 A;  1S5F D;  5C3E G;  3QOL A;  1EL0 A;  4A3D H;  5DM7 3;  4X64 L;  4RHR A;  3HFZ B;  3NK9 A;  3FPP A;  1HNX L;  4A3M G;  3SK6 A;  5CGK A;  4A3E H;  5JJK A;  3J7Y W;  2AQ1 B;  1PH5 A;  4X65 L;  5ISR A;  3M3Y H;  4NXN L;  3HOZ B;  3MXU A;  2B2T C;  3I70 A;  3MC0 B;  2IHF A;  5EBD A;  1UE7 A;  1LTR D;  4RMF A;  1TS2 A;  1XXG A;  1E2Z A;  1OXU A;  4BBR B;  3D6W A;  1EY8 A;  4OHJ A;  3EVQ A;  1UNS A;  2J7Z A;  4L5S A;  5C5M A;  3TDQ A;  3LNN A;  1EEI D;  2HDM A;  4CDF C;  2D2C C;  2K03 A;  4ZRZ A;  4R1J A;  3A8K E;  3R2I A;  1X9N A;  2F4V Q;  4C1N I;  1UEB A;  4DV7 Q;  3C46 A;  3K8A A;  1O7Y A;  1SMY C;  3LX0 A;  4A3L G;  2UUB Q;  1IZ6 A;  3T13 A;  1R9T H;  2B63 B;  1PFS A;  4DR3 Q;  1SJE D;  2OQK A;  3A5U A;  4C56 C;  3TQY A;  3VA7 A;  2DGY A;  2AWO A;  1H95 A;  3AEV A;  5K36 H;  3PO3 B;  3MZ5 A;  2JSO A;  2XTI A;  2Q8I B;  5BN5 A;  1HNX Q;  1CKN A;  4QJF A;  4DR7 Q;  2I5L X;  2NVX B;  1F77 A;  2Y0S B;  4X64 Q;  1TWA H;  2AKW B;  2F0J A;  4OIJ A;  2AUK A;  1N8R C;  2KCT A;  5JJZ A;  4HJA A;  3F2B A;  1SND A;  2B2U A;  1B53 A;  5EKL A;  2AHO B;  1VQG A;  1YNJ D;  2C9O A;  1GHK A;  1F9P A;  2HIX A;  4HJ7 A;  4BY1 H;  3PO3 H;  4S3S A;  5ELC A;  3NSW A;  4B9W A;  5KNC A;  2KEN A;  4R4Q A;  3S1R B;  5D3I B;  5L37 A;  3L7Z C;  4LF7 Q;  2J0T D;  3K58 A;  4A3L H;  4NP5 A;  4OWW B;  4KI0 A;  5E3F A;  4DK1 A;  3OWF A;  5ELO A;  4DV3 L;  1EOT A;  2CCZ A;  1E2W A;  3NWT A;  1VQK A;  4LNQ A;  1EWH A;  3BDC A;  4LFC L;  1C9O A;  1HR0 Q;  3AFP A;  1SYC A;  5JVG 3;  3PIO A;  1NE3 A;  4J8Q A;  3CCM A;  4EVO A;  1STY A;  3CU7 A;  3KLR A;  4DV6 L;  1H9R A;  1SE3 A;  2WB1 B;  5FLX E;  1EY5 A;  1I3Q H;  4LF8 L;  2YV5 A;  3L3O C;  2RF4 A;  3OSO A;  4DV1 Q;  3J7A V;  4Q0F A;  5EJW A;  2F3I A;  3GDE A;  4B3M Q;  1MJC A;  1AFP A;  2NUC A;  1DZ1 A;  3A5Z B;  3MEH A;  1G51 A;  1IBM Q;  2PO4 A;  4YIJ A;  3MFY A;  1S5D D;  2WV6 D;  3K6O A;  2KED A;  3OWE B;  1PMR A;  1JB3 A;  5BN4 A;  2V1C C;  4QMG A;  3K5O A;  3BZD B;  1E1T A;  1TS5 A;  4GN3 B;  1ICF B;  3T16 A;  1KAB A;  2PMZ E;  5CBA E;  1W6J A;  2F4V L;  3KLS A;  1LT6 D;  2E2J B;  2R7Z G;  4PZ7 A;  3SHL A;  1SLJ A;  2P5Z X;  3Q22 A;  1IXR A;  1YJ9 A;  1HPC A;  4A3K G;  1X65 A;  4G57 A;  4JI7 L;  3S2H H;  4KD3 A;  4ILW A;  1N9W A;  1LV9 A;  5IYC G;  2WAQ B;  3R3O A;  2FMM A;  3T4A C;  2OTL A;  4WJ3 M;  2NVY B;  2JP1 A;  3CCQ A;  3VDY A;  4NXN Q;  4NW2 A;  1IYJ B;  4A93 B;  3OHX C;  2DJF C;  3BG3 A;  2TSS A;  4HCE A;  1HCZ A;  4LF6 L;  3URY A;  5IP9 G;  2K6A A;  1B3A A;  2R61 A;  2KHS A;  1BCP F;  4IO9 A;  4FYD A;  4L63 B;  5KYL A;  5EPK A;  4ZLT F;  2KHJ A;  1WTW A;  3PUW A;  2R93 H;  5CV5 A;  3Q8D A;  4XT3 B;  5GAG C;  2EXZ A;  1YI2 A;  2EYF A;  1Y14 B;  5DM6 3;  3ND8 A;  2CW0 D;  2EVB A;  1OTC A;  1V1P B;  3E3X A;  4K8J A;  2J4X A;  2NBF A;  1S40 A;  2RCN A;  4BXX H;  3PUZ A;  4X3S A;  3PIP 3;  4JI7 Q;  4IUR A;  3VR3 A;  5HGT A;  1DYQ A;  4AH6 A;  4QF4 A;  1VQB A;  1E22 A;  1QUQ B;  4PMC A;  1YBY A;  4A3I H;  3I73 A;  4K6D A;  1ILQ A;  4A3G G;  3WOF A;  1Y1W B;  3A55 A;  1STA A;  2EY1 A;  5DLQ E;  3HG9 A;  2K5D A;  4LF5 L;  5M3M B;  4JV5 L;  4DGZ A;  4XIG S;  4I7Z C;  4A3I B;  4ZCK A;  1U4L A;  5C4H A;  1F9S A;  1BCP B;  4XYO A;  2K4K A;  4FXG C;  4GKK Q;  3DWA A;  4A76 A;  2C5C A;  1TY2 A;  4CBV A;  3D8G A;  3D0F A;  1B8A A;  3OMC A;  4FXK C;  4CGY B;  2XSC A;  5IT9 E;  1BXT A;  3EIV A;  3J80 i;  4GLX A;  1OXV A;  5M9O A;  2X6L A;  5CC4 A;  5M5X B;  4P71 A;  4RCO A;  4V0B A;  2B63 H;  4OWT B;  1VQA A;  3G71 A;  1C7Y A;  4LF5 Q;  1I6H B;  3U9O A;  3UE1 A;  2JA6 B;  1CA5 A;  3GTK H;  3WDN A;  1GXD C;  3I4N B;  4KY6 A;  1K8G A;  3DLL A;  3C1E A;  2CVR A;  1JQY D;  1HR0 L;  2F03 A;  1HNZ Q;  2B2V C;  3CPW A;  2CW0 C;  4DNI A;  5EGT A;  4DXF A;  4IUN A;  1D5X C;  2AUJ D;  2DY7 A;  1F2L A;  1EEF D;  5IGB A;  1O7I A;  4GN5 A;  2RHS B;  4OEM B;  1B3Q A;  2EYJ A;  1K0S A;  4GOP C;  5ELF A;  1EY6 A;  2KCC A;  2F4I A;  2RDG A;  4ID6 A;  1XTD A;  4IPH A;  1A3U A;  2PQE A;  3HRZ C;  4HIM A;  1D5Z C;  3HOZ H;  1O7Z A;  3OOC A;  4HIK A;  2LS0 1;  4YWL A;  3KBX A;  2WII B;  1AW7 A;  2MHV A;  3HP3 A;  1BBU A;  2QEJ C;  4HMJ A;  4KY5 A;  4ZAI A;  1DD2 A;  3DEO A;  2A68 C;  3A54 A;  3PO2 G;  1I4G A;  1QCB D;  2RBM A;  1NUC A;  1ZXT A;  3OIQ A;  4A75 A;  4HID A;  3TEH B;  2PMZ B;  2PZW A;  4MHE A;  3KDF A;  1BBX C;  2HQE A;  2CWP A;  2NWG A;  3IKJ A;  3LWE A;  4QUC A;  5C44 B;  1E0B A;  4UAI A;  5C6A A;  2MGS A;  1RTN A;  2RDF A;  1SE8 A;  1MI2 A;  2AQ3 B;  4IFD G;  2XN9 C;  1BQQ T;  4IUT A;  3KJP A;  1PH1 A;  1O7L A;  5I4D A;  2C35 B;  3J80 L;  5IGD A;  3QJY A;  3SK4 A;  3ULJ A;  1VF7 A;  2VB2 X;  4B08 A;  1XNQ L;  4HR7 B;  1X3F A;  3UDI A;  4X66 L;  3H0G G;  4A3G H;  4UPA A;  2Z9H A;  5IGG A;  2O2L D;  2ZTE A;  2UUB L;  1A62 A;  1SR3 A;  4CHT B;  3GTM H;  2BH8 A;  3KUP A;  1G29 1;  5IYB G;  5GAE C;  3I4L A;  4KMU C;  4A3J G;  2VUM G;  2EY6 A;  3W5O A;  3NTI A;  1H9K A;  3RZD B;  4OO1 I;  4DR2 Q;  1I3Q B;  5LMU L;  1N34 Q;  4A3K H;  1Y1V B;  1XWE A;  3VR2 A;  4JI6 L;  2WB1 E;  1H9S A;  3O13 A;  4FXD A;  4LFA Q;  3VR4 A;  4GNX A;  3J7A 5;  2A1A A;  3GTG B;  2O5J C;  1DOL A;  1PTO F;  4DV2 L;  3BZK A;  1OXS C;  4Y7N H;  1PH3 A;  4KKS A;  3CC2 A;  1D2B A;  5T1I A;  4JBK A;  4UY8 C;  1Y1V H;  1EQQ A;  2UUC L;  5C3X A;  1ICW A;  2JXM B;  5KND A;  1L0Y B;  1ET6 A;  1OXT A;  2MO1 A;  2R92 H;  3CPF A;  1QNK A;  2OQ0 A;  1XJV A;  1HXY D;  1KNE A;  4DK3 C;  3S1R H;  3NEL A;  3L2P A;  4DV1 L;  1RKN A;  1JOK A;  3BYT B;  2A6H D;  2K04 A;  4DV0 L;  4B3R L;  3RNU A;  2HHH Q;  2K28 A;  1PH8 A;  3UDX A;  2JA6 H;  2E76 C;  4CJ1 B;  5FO7 B;  3CQZ B;  2H4O A;  3GTL H;  3Q6S A;  2B3G A;  1I50 B;  2RHQ B;  3GP7 A;  2NZ1 D;  3M4Q A;  4ZYS A;  3RN5 A;  2AQ2 B;  2NVX H;  3C3L A;  2R7Z H;  1KLU D;  4L5R C;  4JI8 Q;  2EY5 A;  2L9H A;  4ZKB B;  4C3H B;  2NVQ B;  1LAB A;  1XMO L;  5CV4 A;  1UWV A;  3VYR A;  4L5Q A;  2UU9 L;  1YJN A;  3GV3 A;  1B44 D;  2G5D A;  5EQ0 A;  2PZU A;  4JC0 A;  4TKO B;  4DV4 Q;  3A7L A;  4V19 0;  3HOV G;  3M9B A;  1QVC A;  5CMD A;  1GUW A;  2F0U A;  1IYU A;  1A8V A;  2BDO A;  4C3J B;  1GUS A;  5AJ3 L;  3RLF A;  4GOP A;  1MBY A;  2CH4 A;  2PNH A;  3RMH A;  1OXX K;  3PO3 G;  4NXM L;  4GZY C;  5GRO A;  3FEW X;  3S17 H;  2BCO A;  4XXE A;  3KJO A;  2HIV A;  2UXC Q;  1D5M C;  1QUQ A;  3U58 A;  1TWA B;  1E3P A;  2CHB D;  4WJ4 A;  1A3V A;  3I4O A;  3M3Y B;  5BR8 L;  2KCN A;  4RA8 A;  4DV4 L;  2K5W A;  1EQR A;  2F0O A;  1HQM C;  2EYM A;  1VQF A;  2XRS D;  3NEM A;  1HUN A;  4G7H C;  1UE5 A;  3C1F A;  3EQL C;  2B8G A;  3M85 A;  1KRS A;  1RDP D;  1B1Z A;  4G7Z C;  4A3F G;  4JOI A;  4DV7 L;  4KTA A;  1VQ8 A;  3DEP A;  4DK6 C;  4M8A A;  2LMC B;  1I50 H;  3S15 H;  4P72 A;  1PVO A;  5E1F A;  1RTO A;  3NP8 A;  3KOJ A;  3J81 L;  3TZU A;  1EUJ A;  3FRP B;  4C1N K;  5C5L A;  1Q82 C;  1KTK A;  3Q0A A;  1CQV A;  4AYB E;  1YJW A;  3DM1 A;  4IAL A;  1SNP A;  2A5H A;  2B2T A;  5GAD C;  3K80 C;  1WD1 A;  3U9S A;  4DV0 Q;  4B3R Q;  3G6E A;  2NVY H;  1B9N A;  1VQD A;  4DF7 A;  1T9H A;  4RGM A;  1EFW A;  5JEA H;  4GNX C;  1NR4 A;  5I9O A;  1CSP A;  3F8T A;  2AMC B;  3NWS A;  1IBK L;  1TT2 A;  2OEO A;  2XIW A;  2YYZ A;  3J7Z C;  3KFU A;  5IIF A;  3H94 A;  4A3E G;  4WOR A;  1UUP A;  2ZM6 Q;  2ES2 A;  1GUT A;  2KOL A;  2LXK A;  2K5Q A;  1JJG A;  3FKI B;  2K5H A;  5LL6 S;  4AYB G;  4DN4 M;  1QWY A;  2PCF B;  1S72 A;  2NB0 A;  2F0S A;  1C0A A;  1BO0 A;  2I0Q A;  3CQZ H;  1WTO A;  2QW7 A;  4GLV B;  4L6T B;  1PZJ D;  3S1N H;  1JE4 A;  3G6J B;  3NXW A;  4YCW A;  4GLA C;  1DGS A;  4CKE A;  3J80 E;  5TSS A;  3T1Y L;  3TME A;  5LMU Q;  1N34 L;  1JOR A;  2FJ2 A;  4IPC A;  3TBI B;  5NUC A;  3ICE A;  4DPG A;  3S24 A;  2NTS A;  2Q2H A;  1VQI A;  4A3B H;  4DR1 L;  2QDL A;  1L1O A;  5IGF A;  4DR6 L;  3QO2 A;  5K5P A;  3HOW H;  1G2S A;  4I7A A;  2D62 A;  2XRQ D;  2VY3 A;  4A4I A;  2ZTC A;  2R92 B;  4X66 Q;  3I2Z A;  3S14 H;  3S1N B;  1A0I A;  1M4V A;  1K8O A;  1NNX A;  2Z4H A;  1X3G A;  2QEX A;  1M90 C;  1PRT F;  1VS0 A;  3NQT A;  2Q2U A;  1A2T A;  4MIU A;  1MHW C;  5I6W A;  1W3S A;  2JQO A;  4K6L A;  1PRT C;  4PMW A;  3JAM i;  3QOJ A;  1V1O A;  1QG7 A;  1TII D;  3CD6 A;  3PO2 H;  4DAY A;  1I94 L;  2IX0 A;  5D3D A;  1SYB A;  3F2U A;  5C3E H;  4JVZ A;  1V8Q A;  4KKU A;  4KHV A;  3A7A B;  4WFN 3;  2FIN B;  1Q86 C;  2MJ8 A;  1DOM A;  1LTL A;  4XQJ A;  4MZ9 A;  1H9J A;  1AE2 A;  3FP9 A;  5C3W A;  2JA9 A;  1Q8K A;  4MTN A;  3PIP A;  2MQH A;  2RKS A;  4DAV A;  1HZB A;  4GNX B;  1PFB A;  1A15 A;  1I6V C;  4N9T A;  1KL9 A;  1X3Q A;  4K5V A;  3NBI A;  2A6E C;  4IN3 A;  1Q3L A;  2B39 A;  2F0D A;  2N8N A;  3KLW A;  1KQS A;  5IGC A;  1BUV T;  1JR0 D;  1EFI D;  1B4O A;  1PFN A;  2TMP A;  2OT2 A;  4H0L C;  3GTK B;  1QVF A;  1I4H A;  1NR2 A;  3Q24 A;  1WTV A;  4JI5 Q;  1WOC A;  1LT4 D;  4XQN A;  3RD4 A;  2EYL A;  3HOU H;  3DMU A;  4J15 A;  1F9R A;  2UUA Q;  5EPJ A;  2O5I C;  4XYQ A;  1DON A;  3MXP A;  4U67 3;  2B8F A;  2WKD A;  4DNR B;  3ULL A;  5FLX c;  3PIO 3;  3QB3 A;  5H1S E;  3BYY B;  4JI4 Q;  1AP0 A;  1GHJ A;  1TKW B;  2WAC A;  4CJ0 B;  1Q81 C;  4HED A;  2G9D A;  1XYI A;  3VYT A;  3T56 B;  1HTL D;  5C4X G;  3NTK A;  1SRO A;  5M5W B;  2QIL A;  1ESF A;  1VQ7 A;  1CI3 M;  3KDF B;  1J9O A;  1SYF A;  3J81 c;  3U50 C;  3J81 j;  1U9R A;  4EGV A;  4PZ6 A;  4GKJ Q;  1PFM A;  4OX9 L;  2F0Q A;  1TWF H;  2NZH A;  4UP9 A;  1EZ8 A;  5J39 A;  3HOU G;  2OTJ A;  2WB1 G;  1D6E C;  1EY7 A;  4RKL A;  1SEB D;  1SXT A;  3UDF A;  1VCI A;  2K1B A;  3PGZ A;  4JI6 Q;  4OEL B;  3R93 A;  1JCK B;  2VL6 A;  1TY0 A;  3FHW A;  2F0K A;  2NVQ H;  2WFW A;  3GTJ H;  1VQ9 A;  2ICI A;  3BZC A;  5M3F B;  2GN5 A;  3HOY H;  1QIL A;  3HKS A;  4CKB A;  4I65 A;  3BVM A;  1K9M C;  2R93 G;  3W1G A;  1S3O A;  1T5E A;  4IFD I;  1SNO A;  1EZ6 A;  4JYA L;  4X6A H;  1P16 A;  1SE2 A;  1SNC A;  3QIA A;  3GV6 A;  3SGI A;  1VQ4 A;  5JJL A;  2EJF C;  2LKV A;  1L1O C;  4EQO A;  2BA0 A;  2SDF A;  1QE6 A;  3I91 A;  1SYE A;  1MJE A;  1Q1E A;  1TR5 A;  1MIU A;  5HUR A;  3CCR A;  1K28 A;  3PO2 B;  1LM0 A;  1HFN A;  1Y1W H;  1SRU A;  1K73 C;  3I4M G;  1N36 L;  1BF4 A;  5CBE E;  1XMQ L;  4R8N A;  1TWH H;  1BCP C;  1PYW D;  3CCU A;  1PTO B;  3HOX H;  3I55 A;  4IUP A;  3IL8 A;  1K8M A;  1MSH A;  2ID0 A;  1LTA D;  2JA8 G;  2RSN A;  3CAM A;  1Z47 A;  2IHE A;  3CCJ A;  1STN A;  1XPR A;  1TS4 A;  3CRL C;  3U4V A;  4DAM A;  4IPD A;  2D0P A;  3GTG H;  1JOQ A;  3UE0 A;  2F0L A;  3M4P A;  1FNW A;  1WFQ A;  2KUM A;  3IFT A;  3GTQ H;  3V05 A;  1Q90 A;  3I56 A;  5COR A;  3GTP B;  1WTQ A;  1HNZ L;  4O2D A;  3OYY A;  2E2D C;  5IYD G;  4EQN A;  1KAW A;  2L1B A;  4NPS A;  4HMI A;  4RGN A;  3J80 c;  1KLG D;  3IRB A;  4HCS A;  3A74 A;  5A2Q E;  3GTM B;  4BA2 I;  5JVH 3;  2EQS A;  1WCM H;  2F0I A;  3PF5 A;  1JB7 A;  1HA6 A;  4N9P A;  2EY2 A;  3K0Y A;  4R8I A;  1STH A;  1AH9 A;  1ZYR D;  4B9X A;  4LMQ D;  3GTO B;  5G3L F;  1IBM L;  2VQE L;  2F52 A;  3NBH A;  5LL6 X;  5IT9 L;  2Y0S G;  1II3 A;  1LTS D;  2JYO A;  2PPB C;  4BWG B;  1G8Z D;  3K81 C;  2F1M A;  4DUZ L;  1D1I A;  1PTO D;  1FGB D;  4QCL A;  4K5X A;  2RQX A;  3I4M H;  4K2L A;  3OW7 A;  2MNA A;  1MD2 D;  4ALP A;  3I90 A;  3AU7 A;  3PMF A;  2F0W A;  1XPU A;  2XGT A;  2SEB D;  1F2M A;  3Q23 A;  1QVG A;  3S2D B;  3DWQ A;  2E5L Q;  5EKK A;  3CCV A;  4DR5 Q;  3KBG A;  3RR5 A;  3CRK C;  5FLM G;  3NUC A;  4C3I B;  2EJM A;  5FLM H;  1QB5 D;  4F8M A;  2IW3 A;  4IPG A;  1EIF A;  3AQQ A;  4K0K Q;  3S16 H;  5BN3 A;  3ERQ A;  2IJ0 A;  4BY1 B;  1Y8O B;  4OWX B;  5KGU A;  2VW9 A;  1Q7Y C;  1EWI A;  4KD4 A;  3I8Z A;  4R4I A;  2EYP A;  2MPM A;  1EU3 A;  4H02 A;  4NDX A;  5G3L D;  1LT5 D;  1JWM D;  4KHZ A;  4WJW A;  3T1H L;  4OIK A;  4KKT A;  3PF4 A;  1S4Z A;  2OXP A;  3HOW B;  3DM3 A;  4BBR G;  1PHJ A;  4QUF A;  1U4M A;  2E2H H;  3AB9 A;  5FO9 B;  4JI3 L;  3SK8 A;  1TXY A;  3L0O A;  4BBS G;  4WRD A;  3D6C A;  4BA1 I;  3HOV H;  1JT8 A;  1FJG L;  1LYL A;  2E74 C;  2JA7 G;  1GUN A;  3AMU A;  3ULP A;  2ENB A;  2YTV A;  4RWS C;  2HQL A;  2ZJQ A;  4DV5 L;  1DCZ A;  5CV7 A;  3MA2 B;  2NN6 H;  4LFA L;  2XWB B;  1NAP A;  5E7N A;  5IT9 c;  1A3T A;  1B9M A;  4A3M B;  3NHH A;  4CDC C;  3CXC A;  4AIM A;  1YNX A;  2RCF A;  3STB D;  4DUY L;  3FMC A;  2K14 A;  1ONL A;  3RZD H;  2JA8 H;  1JWU D;  4HJ9 A;  3S14 B;  3S9W A;  2Y0S E;  1BBW A;  3IAY A;  4N8X 1;  1BVS A;  2CH4 W;  2KA7 A;  3V2T A;  1XNQ Q;  3HOX G;  1VQE A;  1KAA A;  4FF4 A;  2VQF Q;  1D8L A;  4A3D G;  3J81 E;  3EJI A;  4F87 A;  2JK8 A;  5JEA J;  2UXC L;  4IUQ A;  2JA5 G;  2D9U A;  2A19 A;  3H3V C;  2OWO A;  2G9H D;  3JAM E;  4N8F A;  4DKA C;  3JAM c;  2DNC A;  1PH7 A;  3UI2 A;  4LJZ C;  3T1H Q;  4NXM Q;  3J7A F;  1JOO A;  3S15 B;  5LMN Q;  1EIH A;  1Y1V G;  1F2Z A;  1Q46 A;  1YVC A;  3FKI H;  4DR4 L;  2IPK D;  3RZO H;  3GTQ B;  4RHS A;  3EBE A;  1NCV A;  1JIC A;  2B2Y A;  3CP0 A;  4A3C G;  5GQO A;  1PDQ A;  1DJR D;  1GVP A;  3EFX D;  1PH9 A;  1N32 Q;  3STB C;  1RHP A;  2UXD Q;  4DU9 A;  3HZX A;  2WAQ E;  4EX5 A;  3V96 A;  1Z9F A;  2ZXR A;  1XMO Q;  2RVL A;  2EDG A;  2ZXP A;  2K5N A;  2ZT9 C;  4K0K L;  1EQT A;  1B2T A;  4A3J H;  2VUM H;  1G6Z A;  3CMA A;  5IP7 G;  3B6Y A;  4DV3 Q;  1SE4 A;  1G91 A;  2HT1 A;  4FVM A;  3TP7 A;  4BY7 G;  3NEN A;  3H0G H;  4A3B G;  2N3S A;  4YCV A;  3KF6 A;  5IGE A;  1EYD A;  5IY0 A;  1QZG A;  5C4X H;  5E4W C;  1WYD A;  1KRT A;  2L4N A;  3CW2 C;  4FP5 D;  3X3M A;  5IOD A;  1V1P A;  2PZT A;  4LW1 A;  1FR3 A;  1SFO H;  2CQA A;  3GTP H;  2SOB A;  5LMN L;  4JI2 Q;  2K52 A;  3WOE A;  1S5C D;  4ZUI A;  2N78 A;  3MHB A;  3I7F A;  1WTR A;  2IX1 A;  1M1K C;  4C3H H;  2E2H B;  4B3S L;  5JJI A;  4GKK L;  5M3F H;  1PRT D;  3CHB D;  1A6X A;  3GTJ B;  1PYB A;  5C0X I;  3D4W A;  1FNV A;  2K01 A;  1BNZ A;  1E24 A;  1N33 L;  4HJ5 A;  2NTT A;  1B7Y B;  4DV2 Q;  2L12 A;  1X54 A;  3CC4 A;  2O4X A;  4ZUJ A;  4FF2 A;  4IOC A;  1Q8I A;  3K59 A;  3KK7 A;  2BDN A;  4HN7 A;  3WWV A;  1YIT A;  4OGQ C;  1LO5 D;  1SYD A;  3QR8 A;  5JOB A;  2JEA I;  3OTO L;  3H91 A;  2D0O A;  2PQA B;  2OCE A;  4LAA A;  3E0E A;  1RD9 D;  1HTP A;  3BU2 A;  3SVM A;  1STE A;  1YZ6 A;  1HJP A;  4KK7 A;  1CQF A;  2HDL A;  3TS2 A;  4HIO A;  4DAY B;  3G4S A;  5FJ8 G;  4XTC S;  4DV5 Q;  2QDB A;  4E6I A;  2F0F A;  1I4P A;  1U4P A;  2YTY A;  2B63 G;  1EYC A;  2MP1 A;  1J5E Q;  2KVM A;  1NSN S;  1FJG Q;  1QOH A;  5DAU A;  1UEA B;  1PTO C;  1JC7 A;  2R7Z B;  1STB A;  4JI3 Q;  5LHY 1;  3BDL A;  1ESR A;  4A3F B;  1XMQ Q;  1YNN D;  1CHP D;  1Y8N B;  2D5D A;  1N36 Q;  2ATW A;  4RKB A;  3GTL B;  3MAQ A;  3TP6 A;  5C4J H;  4R4C A;  4HSP A;  2ZJR A;  4KN7 C;  3QG1 A;  2KEE A;  4DNT B;  5C4X B;  3MVV A;  3ONA B;  3NBH B;  4O42 A;  4A93 G;  3A8I E;  2M9V A;  4FO2 A;  1C8C A;  1VQL A;  1NJI C;  4DAP A;  1GO3 E;  4B3T L;  3W1B A;  1HR0 W;  2B29 A;  2HCI A;  1WCM G;  1LTG D;  4DXG A;  3K57 A;  4UP8 A;  4QL5 A;  1K3B C;  4A3I G;  4PZ8 A;  2B2W A;  5IYD H;  1STG A;  4Y52 H;  3PCO B;  4YY3 L;  4JBM A;  4KY7 A;  4LWC A;  2VB3 X;  2B2Y C;  1VQM A;  1FL0 A;  4DR5 L;  3SDZ A;  4LFB Q;  4F7X A;  1K83 B;  3K0X A;  4DFA A;  4Y7N B;  1RIP A;  2L5T A;  1WTP A;  3GO5 A;  3T51 B;  2PI2 A;  5AFW A;  1YEZ A;  2HD3 A;  1O78 A;  3R8B A;  1LUZ A;  2PYK A;  3SEB A;  2YTX A;  4XT1 B;  2R93 B;  2B2V A;  1YIJ A;  1VDZ A;  4R4O A;  4FDB A;  1FVI A;  2F0H A;  5JEA G;  2MO0 A;  1ROD A;  1HZA A;  4X3T A;  3BJU A;  2Z1C A;  2ZXO A;  4DUZ Q;  4POG A;  4K2K A;  4GN4 B;  4A3G B;  4DK0 A;  4JI4 L;  5IE8 A;  1Y1W G;  2MFI A;  4X3K A;  1GOZ A;  1CTM A;  1FD7 D;  1Q12 A;  5KIX A;  3VR5 A;  5J1Z A;  5GAH C;  4ABN A;  1VQJ A;  1EYA A;  3TRE A;  4ZKC B;  4JV5 Q;  2UUA L;  1KDA A;  1SAP A;  1TWC H;  2L15 A;  5M5Y H;  3S1M H;  2KHI A;  3S2H B;  4ME5 A;  3EA6 A;  4JI5 L;  4KLK A;  1AEX A;  3ERS X;  3HKZ B;  4X62 Q;  4AQY L;  2E75 C;  4LFC Q;  4EQ5 A;  4A3F H;  4L5T A;  3P20 A;  1IKL A;  4QB4 A;  4JPB W;  4MNO A;  4YY3 Q;  4F88 A;  1F9Q A;  3F1Z A;  1K83 H;  2CQO A;  1LTB D;  4PMB A;  5J22 A;  3CKI B;  3RLO A;  1X56 A;  1UE1 A;  2M2L A;  3M7N A;  1N32 L;  3OW2 A;  2R7D A;  3A0J A;  4FF3 A;  1KNA A;  3I4N G;  2WAQ G;  5J3B A;  5IYB H;  1ILP A;  3E6Z X;  1HQR D;  1TS3 A;  1X32 A;  5E4X A;  1VMC A;  1QJO A;  2WIN B;  5KRU A;  2R3Z A;  1SMY D;  3H3V H;  2K05 A;  4JK1 C;  3M4O B;  5M5W H;  1J6Q A;  1LTT D;  2F0E A;  1FGU A;  5I6Y A;  4R4T A;  1S5B D;  4M1U B;  1G2T A;  1C48 A;  1PRT B;  5C0X J;  3E0J A;  3ER0 A;  4G4K A;  5ELB A;  4L8J A;  1MSG A;  2F3V A;  4IQZ A;  5KNB A;  2Z6K A;  4HSV A;  3HOY B;  4J6H A;  1O80 A;  4YCU A;  4DR3 L;  2FHT A;  4PNY A;  2SNS A;  4OO1 H;  4XQQ A;  3TS0 A;  1PH6 A;  3HKZ E;  2K5V A;  4QIW B;  4DR6 Q;  4DUY Q;  2KBN A;  5C44 G;  4IOA A;  2DN8 A;  3DWP A;  2ZTD A;  1DOK A;  5JPM C;  3OTO Q;  1EY9 A;  2Q8R E;  4QGU A;  2E8G A;  5M3M H;  2JN4 A;  2V4D A;  2EYH A;  1VQC A;  1CKM A;  2EE1 A;  3D4R A;  1VQO A;  1Y69 U;  2A6E D;  1EU4 A;  2K7V A;  3H6M A;  5C0X H;  4RCN A;  3H0G B;  1NTG A;  1CFM A;  4C3J H;  3RN2 A;  5COY A;  1N33 Q;  3CF5 A;  1BKB A;  5FK9 C;  3DXJ C;  3M4Y A;  4ODG A;  4X65 Q;  2L11 A;  2ZM6 L;  1LLR D;  2AWN A;  3C2P A;  3H3V I;  1TQO A;  5DNF A;  1Y8P B;  3OPO A;  1IBK Q;  3MXN B;  2BE5 D;  4P73 A;  1CM9 A;  2Z6B A;  3D31 A;  2K50 A;  1IL8 A;  3SE0 A;  4A3E B;  2GVB A;  1IKM A;  5M3F G;  1JJ2 A;  4PG3 A;  4JI2 L;  4NKL A;  4GS3 A;  3F2D A;  2F0P A;  4LF8 Q;  3P75 A;  5FO8 B;  3I72 A;  5T1G A;  3E9H A;  3MTS A;  1ZEQ X;  2RA4 A;  1SFO B;  1PXU A;  3S1Q B;  4DA2 A;  2HCC A;  3CC7 A;  4DV6 Q;  3G48 A;  2PI2 E;  3SR1 A;  4J1M A;  4CDD C;  3MXN A;  3FPU B;  5FLX L;  1KD1 C;  5F2D A;  2OF1 A;  4OON A;  4GOP B;  4ZQ3 A;  1SBB B;  2QKI C;  3KYH C;  1DM0 B;  3P1H A;  1NY4 A;  2CWA A;  2IL8 A;  2KCM A;  2KJX A;  1AZQ A;  4LF4 Q;  5D14 A;  1Q1B A;  2F0N A;  4Q5V A;  4BY7 H;  4TSS A;  1L1O B;  3PUX A;  1ENF A;  1Z7T A;  4QY7 A;  1A2U A;  2B2U C;  5IP7 H;  3FDT A;  1H9M A;  4LF7 L;  3LGJ A;  1LT3 D;  2M00 A;  1CZW A;  4KHP L;  2SNM A;  2F0V A;  2Z4I A;  4JOI C;  2JA8 B;  1HZC A;  4KJN A;  2BH2 A;  2RDH A;  4DR4 Q;  4H44 C;  5C3E B;  1TWH B;  4BXX G;  3BVZ A;  5D65 A;  1QZH A;  1J8I A;  4A3M H;  1SNQ A;  3PV0 A;  1SDF A;  1RL2 A;  2JE6 I;  4U68 A;  2BOS A;  1HUM A;  1GD7 A;  5A2Q L;  1EQV A;  4DR7 L;  3JC6 6;  4EQP A;  2KQ3 A;  5EKI A;  3D4D A;  2VXW A;  3K7U C;  1BDO A;  1ASZ A;  3HOZ G;  3S1M B;  1HH2 P;  4FNF A;  4RH6 A;  5M5Y B;  4IZ8 A;  5CV6 A;  2PW7 A;  2RSO A;  3T53 B;  3E9I A;  3HOV B;  1I4X A;  5IP9 H;  2VQF L;  1NMF A;  2K75 A;  1V1Q A;  2QF7 A;  2JA5 H;  4YWM A;  1RCV D;  2LY7 A;  2NN6 I;  3HEJ A;  4C3J G;  2ASB A;  1VQ6 A;  5I2X A;  1UAP A;  3GQB A;  1TU2 B;  1UE6 A;  4NMZ A;  3A56 A;  4O0A A;  1I4Q A;  1V43 A;  1CA6 A;  2LXJ A;  3NTH A;  1HFG A;  2N49 A;  2F0M A;  5DEH A;  2Z6K C;  4LUV A;  1P8L A;  1B50 A;  3VYU A;  2EYO A;  5C4J B;  1GJX A;  3L9A X;  5EBC A;  2UXB L;  5IWA Q;  4C2M B;  1WVL A;  3LWU A;  4P75 A;  4ZK9 B;  4OXP A;  3OIP A;  1CT1 D;  4IUV A;  2E2I B;  5IOC A;  1E7Z A;  4OO1 G;  5CV9 A;  4ME3 A;  3FKI G;  3UDG A;  1IBL L;  1W6K A;  2L0C A;  1TWG B;  2QGQ A;  1QNU A;  3DUZ A;  1ZKO A;  1R9T B;  1YNJ C;  1EOV A;  1HZ9 A;  1KDC A;  2NZO A;  1YHQ A;  5CYU A;  3I3C A;  2GA4 B;  4ULL A;  3RUZ A;  3U4Z A;  3K5L A;  2F3W A;  2KEC A;  3N52 A;  4IUU A;  4X3U A;  4BBS H;  3IFD A;  1EIY B;  1ZYR C;  4JCV E;  1HNW Q;  4YHH Q;  5C0X G;  1A63 A;  2UUC Q;  4BBR H;  2R7F A;  4JI1 Q;  1HA5 A;  2NVT H;  4P74 A;  4IJL A;  5M3M G;  2ZJP A;  2Q2T A;  5JAV A;  2A8V A;  5FOB B;  4JYA Q;  1EY4 A;  4KN4 C;  3VR6 A;  2LFN A;  3K7A B;  1XNR Q;  2IY5 B;  3KF8 B;  5IWA L;  2FMC A;  2IT1 A;  5C44 H;  2UXB Q;  3F2C A;  3RLN A;  5LMN W;  2QCP X;  1L0W A;  2CKZ B;  4K8I A;  1IL2 A;  1JJC B;  1CKN B;  3N6R A;  2MUY A;  1CSQ A;  2VNU D;  3MWY W;  3E5S A;  5EPL A;  5M5X H;  1JWS D;  2BA1 A;  2K33 A;  1U0L A;  5KEE A;  3H09 A;  1FNU A;  2NN6 G;  1BOS A;  1X55 A;  1U5K A;  3TP5 A;  2E5L L;  1SYG A;  2VZA A;  5JPN C;  3KF6 B;  3ZYY X;  2IX3 A;  3K7A H;  4P2C B;  2JA7 B;  2JA6 G;  3MFG A;  1ML0 D;  5BR8 Q;  4OX9 Q;  2EIF A;  1Z6H A;  2X6G A;  3M4O H;  2I07 B;  4Z9C B;  1KXL A;  1IW7 C;  3I4M B;  4YWK A;  1HHV A;  5C4Z A;  2VQE Q;  2R92 G;  1GKH A;  5AJ3 Q;  3I4N H;  4MN3 A;  3CCS A;  5IYC H;  1PLF A;  2ALY B;  1LTI D;  1X6O A;  4RGO S;  4QIW E;  1TWG H;  1XX8 A;  4KHP Q;  1PTO H;  1X3P A;  3HOX B;  5HY6 A;  3D3R A;  4A3D B;  2E2I H;  1RJT A;  3RZO B;  1R4P B;  1WCM B;  1W2B A;  3K5M A;  4MTK A;  4RGT A;  1DXM A;  4RAU C;  4A3K B;  1H9S B;  4TVA B;  3M7G A;  1ASY A;  4AQY Q;  4X62 L;  2XNA C;  4KV6 A;  1XPO A;  1AZP A;  2I46 A;  4LF9 Q;  2N55 A;  2LSS A;  1SNM A;  3P7J A;  3CME A;  1PZI D;  1KDB A;  4JW0 A;  1VQ5 A;  1CUK A;  3SXH A;  1AN8 A;  1M8A A;  2F0T A;  3EN2 A;  4JI0 Q;  1I4R A;  1WTH A;  2YU9 H;  4OL7 A;  5FKA C;  2A6H C; 
#chains in the Genus database with same CATH homology
 4A93 H;  3PUZ A;  3ULL A;  5FLX c;  4RG1 A;  4QL5 A;  4UP8 A;  3AYH B;  4A3I G;  2EXD A;  4JI7 Q;  4PZ8 A;  5H1S E;  4JI4 Q;  5IYD H;  4AH6 A;  1VQB A;  1E22 A;  4Y52 H;  3PCO B;  1VQN A;  4YY3 L;  1Q81 C;  4JBM A;  1QUQ B;  1WI5 A;  4LWC A;  2I5M X;  1VQM A;  1FL0 A;  1YBY A;  4A3I H;  5C4X G;  2PQA A;  4DR5 L;  1SRO A;  4LFB Q;  3K0X A;  3ZJY C;  4A3G G;  1VQ7 A;  2FXQ A;  1RIP A;  3KDF B;  3GO5 A;  3J81 c;  3U50 C;  3J81 j;  2E2J H;  1XPU A;  1MKH A;  2PI2 A;  4PZ6 A;  1K3R A;  3GD7 A;  1YEZ A;  5DLQ E;  4GKJ Q;  4OX9 L;  1LUZ A;  1TWF H;  2NZH A;  4UP9 A;  1PH2 A;  4LF5 L;  3HOU G;  2OTJ A;  4JV5 L;  2WB1 G;  2YTX A;  4XIG S;  2QA4 A;  1YIJ A;  4R4O A;  2R6G A;  4FDB A;  1FVI A;  5FJ8 H;  3UDF A;  1VCI A;  3PGZ A;  4JI6 Q;  5JEA G;  2MO0 A;  4LFB L;  2K4K A;  5EAY A;  1HZA A;  3BJU A;  4DR2 L;  4POG A;  1X3E A;  2H5X A;  2VL6 A;  4DUZ Q;  4GKK Q;  3FHW A;  3HKZ G;  4A76 A;  4DR1 Q;  2NVQ H;  2WFW A;  1K0R A;  3GTJ H;  1VQ9 A;  3D0F A;  1B8A A;  4GN4 B;  4JI4 L;  3BZC A;  5IE8 A;  1Y1W G;  2GN5 A;  3EIV A;  3J80 i;  3CCE A;  4APV A;  4GLX A;  1OXV A;  2MFI A;  3T1Y Q;  1PV4 A;  3HOY H;  4BY1 G;  3HKS A;  1Q12 A;  4P71 A;  1K9M C;  1XNR L;  2R93 G;  3W1G A;  1S3O A;  5GAH C;  1VQJ A;  3TRE A;  2B63 H;  4IFD I;  4OWT B;  3J81 i;  1P16 A;  4JYA L;  1VQA A;  3G71 A;  4JV5 Q;  4X6A H;  1C7Y A;  4LF5 Q;  2UUA L;  1TWC H;  2L15 A;  3UE1 A;  3PUV A;  5M5Y H;  3S1M H;  3SGI A;  2KHI A;  4GKJ L;  1VQ4 A;  3GTK H;  3S1Q H;  5JJL A;  1I6H H;  4JI1 L;  1L1O C;  4JI5 L;  1K8G A;  2BA0 A;  4KLK A;  3DLL A;  3ERS X;  4YHH L;  2VS1 A;  4X62 Q;  1MJE A;  4AQY L;  1HR0 L;  1Q1E A;  4LFC Q;  1HNZ Q;  1MIU A;  4EQ5 A;  4A3F H;  2I5H A;  4L5T A;  3CPW A;  3CCR A;  1LM0 A;  4DNI A;  5K36 G;  1Y1W H;  1SRU A;  1K73 C;  4MNO A;  4YY3 Q;  3I4M G;  5ELN A;  1N36 L;  3F1Z A;  1K83 H;  1XMQ L;  2CQO A;  4LF6 Q;  1TWH H;  3CCU A;  1O7I A;  4GN5 A;  2RHS B;  3HOX H;  4LUO A;  3TS2 A;  3I55 A;  4GOP C;  3RLO A;  1X56 A;  1UE1 A;  4C3I H;  2JEB I;  1XTD A;  4IPH A;  3M7N A;  1JMC A;  1N32 L;  4HIM A;  2ID0 A;  3OW2 A;  3HOZ H;  2R7D A;  3A0J A;  1J5E L;  4HIK A;  2JA8 G;  4YWL A;  1IBL Q;  4JI0 L;  3I4N G;  2WAQ G;  3CAM A;  5J3B A;  1Z47 A;  2IHE A;  3CCJ A;  5IYB H;  1BBU A;  4JG2 A;  1XPR A;  1AE3 A;  3HOY G;  3U4V A;  4DAM A;  4IPD A;  4LF9 L;  3PO2 G;  2D0P A;  3GTG H;  3PSI A;  1B70 B;  3UE0 A;  4LUZ A;  1CKO A;  3M4P A;  1WFQ A;  4A75 A;  3H3V H;  4HID A;  3GTQ H;  3TEH B;  1D7Q A;  1YHA A;  5M5W H;  3KDF A;  3I56 A;  1PYS B;  1J6Q A;  1FGU A;  2CWP A;  4R4T A;  4UP7 A;  1HNZ L;  4O2D A;  3OYY A;  1SN8 A;  4NB3 A;  5IYD G;  1KAW A;  4NPS A;  5C0X J;  3J80 c;  1SE8 A;  3ER0 A;  3IRB A;  4IFD G;  3A74 A;  1YHB A;  3AFQ A;  3KJP A;  1PH1 A;  1K8A C;  4BA2 I;  2EQS A;  2C35 B;  2Z6K A;  1WCM H;  2WP8 J;  3PF5 A;  1JB7 A;  1E1O A;  4IJH A;  3ULJ A;  4A3C H;  1G6P A;  1AH9 A;  4YCU A;  3PUY A;  4DR3 L;  3UDI A;  1X3F A;  1XNQ L;  4X66 L;  4HJ8 A;  3H0G G;  2GVA A;  4A3G H;  4UPA A;  2UUB L;  2ZTE A;  1A62 A;  1SR3 A;  3TS0 A;  3GTM H;  1PH6 A;  2BH8 A;  1VQH A;  1G29 1;  2K5V A;  3HKZ E;  5IYB G;  1IBM L;  4B3S Q;  4DR6 Q;  2VQE L;  2F52 A;  4DUY Q;  2KBN A;  5C44 G;  5GAE C;  1VQP A;  2Y0S G;  4IOA A;  4A3J G;  2VUM G;  2ZTD A;  3W5O A;  4QQB X;  4B3M L;  3K81 C;  1I94 Q;  3OTO Q;  4OO1 I;  1L2F A;  4DUZ L;  4JBJ A;  4DR2 Q;  4QGU A;  5LMU L;  2CFM A;  1N34 Q;  4A3K H;  2E8G A;  5M3M H;  3S2D H;  4JI6 L;  4IFD J;  2WB1 E;  1VQC A;  1CKM A;  1VQO A;  4LFA Q;  4GNX A;  3I4M H;  2MNA A;  2A1A A;  4ALP A;  3J7A 5;  1KHI A;  5HGQ A;  4DV2 L;  3BZK A;  3CCL A;  2XGT A;  1NTG A;  1NBW A;  1OXS C;  2JJQ A;  4Y7N H;  4C3J H;  3RN2 A;  1PH3 A;  1N33 Q;  4C2M H;  4POF A;  3CF5 A;  3CC2 A;  1BKB A;  4JBK A;  4UY8 C;  1QVG A;  1KC8 C;  1Y1V H;  4X65 Q;  1EQQ A;  2UUC L;  2ZM6 L;  2DUD A;  2E5L Q;  2UU9 Q;  3CCV A;  4DR5 Q;  3RR5 A;  5FLM H;  5FLM G;  2AWN A;  2Z0S A;  3H3V I;  1OXT A;  2MO1 A;  4JBW A;  1EYG A;  2R92 H;  4LF4 L;  1NMG A;  3CPF A;  1IBK Q;  3MXN B;  4P73 A;  4IPG A;  4JI8 L;  1EIF A;  2OQ0 A;  3AQQ A;  1XJV A;  3GTO H;  3S16 H;  1KIX A;  4DK3 C;  1PH4 A;  4K0K Q;  3D31 A;  2K50 A;  2GVB A;  3S1R H;  3NEL A;  5M3F G;  3HOW G;  1SMX A;  3L2P A;  4DV1 L;  4PG3 A;  1JJ2 A;  4JI2 L;  3MEF A;  4GS3 A;  2UXD L;  4TQU S;  3F2D A;  1JE5 A;  4OWX B;  4LF8 Q;  4DV0 L;  1I5F A;  4B3R L;  3RNU A;  2HHH Q;  4B3T Q;  2VW9 A;  1GM5 A;  1Q7Y C;  1PH8 A;  3E9H A;  1EWI A;  3UDX A;  1V9P A;  3H15 A;  2JA6 H;  4R4I A;  2Q2I A;  2HHH L;  3CC7 A;  4DV6 Q;  1PA6 A;  3G48 A;  4H02 A;  2JA7 H;  3GTL H;  2PI2 E;  2B3G A;  2RHQ B;  1WJJ A;  3M4Q A;  3RN5 A;  2NVX H;  3TRZ A;  1HNW L;  1KD1 C;  4KHZ A;  3T1H L;  4OON A;  5C3E G;  4GOP B;  2R7Z H;  3PF4 A;  3KYH C;  4A3D H;  4L5R C;  4X64 L;  1NY4 A;  3DM3 A;  2CWA A;  3HFZ B;  4JI8 Q;  2KCM A;  4BBR G;  1PHJ A;  1HNX L;  2E2H H;  4A3M G;  4LF4 Q;  1Q1B A;  4A3E H;  4JI3 L;  4BY7 H;  1L1O B;  3PUX A;  1XMO L;  5JJK A;  1TXY A;  1UWV A;  3L0O A;  4L5Q A;  2UU9 L;  4BBS G;  4QY7 A;  1PH5 A;  4BA1 I;  1YJN A;  5IP7 H;  3HOV H;  1JT8 A;  1FJG L;  4X65 L;  3M3Y H;  4LF7 L;  1LYL A;  3LGJ A;  2JA7 G;  4NXN L;  3ULP A;  4KHP L;  4JC0 A;  4JOI C;  2YTV A;  4DV4 Q;  2HQL A;  2ZJQ A;  1HZC A;  4DV5 L;  3HOV G;  2BH2 A;  2IHF A;  3M9B A;  1QVC A;  1UE7 A;  4DR4 Q;  4BXX G;  4RMF A;  4LFA L;  1A8V A;  5AJ3 L;  3RLF A;  1QZH A;  1OXU A;  4A3M H;  5E7N A;  4GOP A;  5IT9 c;  3PV0 A;  2PNH A;  1OXX K;  1RL2 A;  4L5S A;  4NXM L;  3PO3 G;  2JE6 I;  5GRO A;  3CXC A;  1GD7 A;  4R1J A;  3S17 H;  4DR7 L;  3JC6 6;  4AIM A;  1YNX A;  3STB D;  4DUY L;  3KJO A;  1X9N A;  2F4V Q;  2HIV A;  1UEB A;  2K14 A;  3K7U C;  4DV7 Q;  1QUQ A;  3RZD H;  2JA8 H;  2UXC Q;  3U58 A;  1ASZ A;  4HJ9 A;  3HOZ G;  1E3P A;  3K8A A;  1HH2 P;  4A3L G;  4WJ4 A;  2Y0S E;  2UUB Q;  1BBW A;  1IZ6 A;  3I4O A;  5BR8 L;  3E9I A;  1BVS A;  1R9T H;  5IP9 H;  2VQF L;  1NMF A;  1PFS A;  2K75 A;  1V1Q A;  4DR3 Q;  1XNQ Q;  3HOX G;  1VQE A;  2JA5 H;  4DV4 L;  4YWM A;  2NN6 I;  1EQR A;  1VQF A;  2OQK A;  3A5U A;  1VQ6 A;  3NEM A;  2ASB A;  3TQY A;  2VQF Q;  1UE5 A;  2DGY A;  2AWO A;  1H95 A;  1D8L A;  3AEV A;  1UE6 A;  4A3D G;  4O0A A;  2JK8 A;  3M85 A;  1V43 A;  5JEA J;  1KRS A;  4A3F G;  2LXJ A;  4JOI A;  4DV7 L;  2UXC L;  2N49 A;  2JA5 G;  2XTI A;  1VQ8 A;  1HNX Q;  2A19 A;  1CKN A;  4QJF A;  4DK6 C;  2OWO A;  4DR7 Q;  2I5L X;  4X64 Q;  2Z6K C;  1TWA H;  1I50 H;  2AKW B;  1P8L A;  4LUV A;  4DKA C;  3JAM c;  4P72 A;  1PH7 A;  3S15 H;  1PVO A;  1N8R C;  3T1H Q;  4NXM Q;  2KCT A;  3KOJ A;  4HJA A;  3F2B A;  5LMN Q;  1EUJ A;  2UXB L;  1Y1V G;  5IWA Q;  1Q46 A;  2AHO B;  1Q82 C;  1VQG A;  1YVC A;  4P75 A;  3FKI H;  4AYB E;  4OXP A;  4DR4 L;  2HIX A;  1YJW A;  3RZO H;  4HJ7 A;  4BY1 H;  1E7Z A;  4OO1 G;  3EBE A;  3PO3 H;  5GAD C;  4ME3 A;  3K80 C;  3CP0 A;  2KEN A;  3FKI G;  4R4Q A;  5GQO A;  3UDG A;  1IBL L;  4A3C G;  4DV0 Q;  1GVP A;  4B3R Q;  1A63 A;  3L7Z C;  4LF7 Q;  1PH9 A;  3G6E A;  2QGQ A;  3STB C;  1N32 Q;  2NVY H;  2UXD Q;  1VQD A;  2WAQ E;  1EOV A;  4EX5 A;  4A3L H;  1HZ9 A;  1Z9F A;  2NZO A;  1T9H A;  4KI0 A;  1XMO Q;  4OWW B;  1EFW A;  5ELO A;  4DV3 L;  2K5N A;  4GNX C;  2CCZ A;  4K0K L;  1YHQ A;  1CSP A;  3F8T A;  3U4Z A;  4A3J H;  2VUM H;  2AMC B;  1VQK A;  3CMA A;  5IP7 G;  1IBK L;  4LNQ A;  3B6Y A;  4DV3 Q;  4BBS H;  2HT1 A;  2YYZ A;  3J7Z C;  4LFC L;  1C9O A;  1EIY B;  3KFU A;  4A3E G;  1HR0 Q;  4JCV E;  4BY7 G;  3AFP A;  1HNW Q;  3PIO A;  2ZM6 Q;  1NE3 A;  5C0X G;  4YHH Q;  3NEN A;  3H0G H;  3CCM A;  2ES2 A;  2N3S A;  4YCV A;  2UUC Q;  4A3B G;  3KF6 A;  4BBR H;  2LXK A;  4DV6 L;  2R7F A;  4JI1 Q;  1JJG A;  2K5H A;  5IY0 A;  4AYB G;  2NVT H;  4P74 A;  4IJL A;  5M3M G;  2ZJP A;  1S72 A;  1QZG A;  2Q2T A;  5C4X H;  2A8V A;  1WYD A;  1KRT A;  3CW2 C;  4JYA Q;  1C0A A;  1I3Q H;  2I0Q A;  3CQZ H;  4LF8 L;  1XNR Q;  4LW1 A;  4GLV B;  3S1N H;  3KF8 B;  2YV5 A;  5IWA L;  2IY5 B;  4YCW A;  4GLA C;  1DGS A;  2IT1 A;  5C44 H;  1SFO H;  3GTP H;  2UXB Q;  5LMN L;  2RF4 A;  3T1Y L;  3F2C A;  3RLN A;  4JI2 Q;  2K52 A;  5LMN W;  5LMU Q;  4DV1 Q;  1L0W A;  2CKZ B;  1N34 L;  4IPC A;  1IL2 A;  2F3I A;  1JJC B;  1CKN B;  3GDE A;  3ICE A;  4B3M Q;  2N78 A;  1MJC A;  3I7F A;  2IX1 A;  4DPG A;  3S24 A;  1CSQ A;  2Q2H A;  2VNU D;  5M5X H;  1M1K C;  4C3H H;  1VQI A;  4A3B H;  4DR1 L;  2BA1 A;  1L1O A;  1U0L A;  3A5Z B;  1G51 A;  4B3S L;  1IBM Q;  4DR6 L;  5JJI A;  4GKK L;  2NN6 G;  5M3F H;  3HOW H;  1X55 A;  1U5K A;  2D62 A;  2E5L L;  2VY3 A;  4A4I A;  2ZTC A;  1PYB A;  4X66 Q;  5C0X I;  2VZA A;  3I2Z A;  3KF6 B;  3S14 H;  1E24 A;  1A0I A;  1N33 L;  2V1C C;  3K7A H;  4HJ5 A;  1X3G A;  2QEX A;  1M90 C;  2JA6 G;  1B7Y B;  1VS0 A;  4DV2 Q;  2Q2U A;  1X54 A;  5BR8 Q;  2EIF A;  3CC4 A;  1E1T A;  4OX9 Q;  1W3S A;  2JQO A;  4GN3 B;  4IOC A;  4PMW A;  2PMZ E;  3JAM i;  3WWV A;  3M4O H;  2F4V L;  1YIT A;  3CD6 A;  1KXL A;  3PO2 H;  2JEA I;  3OTO L;  1I94 L;  2IX0 A;  2R7Z G;  2D0O A;  4PZ7 A;  2PQA B;  5C3E H;  2OCE A;  3E0E A;  1SLJ A;  4YWK A;  1IXR A;  1YJ9 A;  2VQE Q;  2R92 G;  1GKH A;  4A3K G;  5AJ3 Q;  1X65 A;  3BU2 A;  1Q86 C;  3I4N H;  4JI7 L;  1YZ6 A;  3S2H H;  1LTL A;  1HJP A;  4MZ9 A;  1AE2 A;  3FP9 A;  3CCS A;  1N9W A;  4DAY B;  5IYC G;  5IYC H;  2ALY B;  2JA9 A;  3G4S A;  4HIO A;  5FJ8 G;  1Q8K A;  4XTC S;  4MTN A;  3PIP A;  4DV5 Q;  2OTL A;  4WJ3 M;  1X6O A;  2MQH A;  2YTY A;  1TWG H;  4QIW E;  3CCQ A;  1HZB A;  4GNX B;  3VDY A;  4NXN Q;  2B63 G;  4KHP Q;  1J5E Q;  1KL9 A;  1IYJ B;  1FJG Q;  5HY6 A;  2E2I H;  4JI3 Q;  2N8N A;  3KLW A;  1W2B A;  1KQS A;  1XMQ Q;  4LF6 L;  5IP9 G;  1N36 Q;  2ATW A;  5C4J H;  4R4C A;  4TVA B;  2ZJR A;  4IO9 A;  1ASY A;  1QVF A;  4AQY Q;  2KHJ A;  4X62 L;  3PUW A;  1XPO A;  2R93 H;  4JI5 Q;  1WOC A;  3Q8D A;  4LF9 Q;  2LSS A;  5GAG C;  3CME A;  1YI2 A;  3NBH B;  3HOU H;  1Y14 B;  4A93 G;  4J15 A;  2UUA Q;  1VQ5 A;  1OTC A;  1VQL A;  1CUK A;  1NJI C;  1S40 A;  1GO3 E;  4B3T L;  2RCN A;  3EN2 A;  3W1B A;  2B29 A;  1HR0 W;  2YU9 H;  4JI0 Q;  4BXX H;  1WCM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...