3ULLA

Human mitochondrial single-stranded dna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
106
Chain Sequence
LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BINDING PROTEIN
publication title Crystal structure of human mitochondrial single-stranded DNA binding protein at 2.4 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 14
structure length 106
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ullA00
3T1YL 3CPFA 3F2DA 1YIJA 2LXKA 1XNQL 1VQEA 3J81j 3ICEA 3M4OH 4L5QA 4GNXC 2IHEA 1KL9A 4P74A 4YWMA 1HH2P 2AKWB 3ULJA 3ZJYC 5GAGC 4X65Q 2UU9Q 3CCQA 3UDFA 4H02A 4X66Q 1VQPA 5JEAG 1UE6A 5FJ8H 4GKJL 1PH6A 2JA6G 3PF4A 3CCLA 2ATWA 2E5LQ 4A3DH 4OO1I 1K3RA 2Q2HA 2K5VA 1I6HH 2I0QA 5M3FG 4GOPA 4QL5A 3F1ZA 4PZ7A 1HNWQ 4BY7H 4A3JG 1N32L 4JYAQ 1CUKA 2EQSA 2Q2IA 3A5ZB 1CKOA 1HNZL 4DR1Q 4MTNA 1N34Q 1CSPA 2IX1A 2JEAI 5IYBH 3M4PA 1VQ4A 1BBWA 2WFWA 3MXNB 4DR4Q 2UXDQ 4A3GH 1PH3A 3HOYG 1VQFA 1I50H 4A3CG 1U0LA 3KLWA 5IYDH 1HNXQ 1EIFA 3B6YA 2A19A 3ERSX 4AYBE 5C44H 3HKZE 3PUYA 2UUBQ 4IFDI 4DUZQ 1E22A 4A76A 4IO9A 1C9OA 3OYYA 2UUAL 2KHJA 4C3IH 4POGA 1NTGA 1CSQA 2R93H 2WP8J 1QVGA 2PNHA 5M5XH 3TS2A 1OXVA 3RLFA 4DR2Q 2B63H 5AJ3Q 1P8LA 2NN6G 5M5YH 2VQEL 2YTVA 4ALPA 4OWWB 2QA4A 3M9BA 3AYHB 1EFWA 1XPUA 3T1HQ 4JV5Q 1I94L 4X65L 2UU9L 4X66L 1XNRQ 3GTOH 2K75A 2BA1A 2BA0A 1V43A 5IT9c 1N36Q 4K0KL 3PIPA 4WJ4A 2CCZA 3GTLH 1WFQA 1WYDA 3FHWA 3AFQA 3L0OA 1FJGL 4A3DG 4LFBL 4QQBX 1H95A 2Y0SE 3AFPA 2UUCQ 4NXMQ 3EN2A 3K81C 4PG3A 5IP7H 5M3MH 1IBLL 1WCMH 1GO3E 4YWLA 3H15A 4DR1L 3LGJA 3D31A 1N34L 2R92H 3S2HH 1Y14B 2CWPA 1R9TH 5JEAJ 1QUQB 4DKAC 4GLAC 4PZ8A 4PMWA 2Z6KA 4HJAA 2UXDL 4GNXB 1E1OA 2AWNA 3BZCA 4JI7L 1KRTA 1KIXA 1KXLA 5FLMH 2N78A 4HJ8A 3NENA 5IYDG 4YHHL 5C44G 1LTLA 3PUVA 4L5RC 2CQOA 3GTKH 2NVTH 1JT8A 2UUBL 3RR5A 5JJLA 4DUZL 1TWFH 4O2DA 2AHOB 3U4VA 1HZ9A 2EIFA 1BVSA 3T1YQ 2ZTEA 1Y1WH 4UP8A 1VQMA 1L1OA 1CKNB 1XNQQ 3RZOH 4EQ5A 4BBSH 4UP7A 4YWKA 2YV5A 5IWAL 2MO1A 4DR2L 3S1RH 2B63G 3GTPH 4X62L 1T9HA 2I5LX 4LF6L 2DGYA 4JI5L 3AEVA 1HJPA 4LWCA 4B3MQ 4LFCL 3A0JA 4A3LH 3S1QH 4Y52H 1G291 2R6GA 3RNUA 1PH2A 3I4NH 3L2PA 2AMCB 2MQHA 3F8TA 2HIXA 1B8AA 4KLKA 2JA5H 1XNRL 2K5HA 2LXJA 1N36L 1YVCA 3DLLA 4JBWA 5EAYA 4AQYL 1JJCB 1PFSA 4IJLA 4A3KH 2ZJPA 2ES2A 3HOVH 4DR5L 1X6OA 2I5HA 4YCUA 1X9NA 4NXML 5M3MG 5IP7G 1X3EA 4OO1G 3UDXA 3H3VI 2NZHA 2BH2A 3D0FA 1A62A 2F52A 1S72A 1VQBA 4IPGA 2HHHL 1YBYA 3J81i 1XPRA 3PUZA 3PUWA 1JB7A 3CCMA 4JBKA 4GN5A 2JE6I 2K4KA 4TQUS 4JI8L 3J81c 4DV7Q 4LF5Q 1D8LA 2NVYH 4RMFA 2UUAQ 2ASBA 3GTJH 2R7ZG 5GQOA 1IYJB 1VQJA 1E7ZA 2HIVA 4OONA 4WJ3M 1N9WA 1IBML 3A5UA 3J7ZC 4O0AA 2CKZB 1XJVA 1K9MC 4P72A 1Y1WG 2VQEQ 1VQLA 1VQGA 1VQAA 4KI0A 1EUJA 4P73A 4GN4B 1I94Q 1J6QA 3L7ZC 4R4IA 1X56A 4IFDG 1FGUA 2GN5A 2CWAA 2ZTDA 2WB1G 3KF8B 4B3ML 4LNQA 4DV6Q 1OTCA 1I3QH 1IBKL 1FL0A 1K83H 4XTCS 3I4NG 4K0KQ 2KCMA 3G48A 2JA5G 1FJGQ 3RLOA 3CXCA 4LFBQ 2I5MX 2D0PA 1Q8KA 2F3IA 1YJWA 1EQRA 1CKNA 1J5EQ 5C0XI 4A3BG 1YITA 3FP9A 1SE8A 3PGZA 4A3KG 1IXRA 1IBLQ 4IOCA 4B3RQ 3HOVG 3NELA 3RN5A 1JMCA 1PH9A 3S15H 4POFA 3HOXH 1PH4A 4DUYQ 4JI0L 2D0OA 1C7YA 1TXYA 1YJNA 1PHJA 4BA2I 4JI7Q 2R7DA 1UEBA 4R1JA 4Y7NH 1EYGA 4C3HH 2D62A 4YHHQ 1WI5A 2VS1A 1Y1VH 4BBRH 1QZHA 1UE5A 4A3IG 2YTXA 2K50A 4DV7L 3F2BA 4GLXA 1HR0W 1KRSA 3A74A 4LF5L 2UXBQ 4GOPC 4JI4Q 1G6PA 2PI2A 2B3GA 3BZKA 5IWAQ 4LUVA 4X62Q 3S14H 4LF6Q 2K5NA 1A8VA 3KDFA 3KOJA 4UP9A 5H1SE 4GN3B 3FKIH 1NJIC 1VQ9A 4JI5Q 2UXCQ 4DAYB 1YHAA 3HKZG 1YEZA 3IRBA 4DV4L 4R4QA 3F2CA 2PI2E 5M5WH 4HJ7A 3U58A 1N33Q 1GM5A 2VNUD 1NBWA 1YJ9A 1IL2A 5FJ8G 4DV6L 1E24A 1NMGA 3MEFA 2K14A 2NZOA 4AQYQ 4EX5A 3NEMA 1QVCA 1K0RA 1VQIA 3CC2A 3KFUA 2JA8H 4JI3L 4UPAA 1J5EL 4DR5Q 3TREA 1HR0Q 4BY7G 4DR6Q 1Z47A 5C4JH 3S17H 4A4IA 4B3RL 4OX9Q 4ME3A 4IFDJ 5LMNW 5IYBG 4LFAQ 4AH6A 2HHHQ 2HT1A 3HOZH 2KENA 4DUYL 2ZTCA 3I2ZA 4NPSA 3S24A 3KF6B 4DV5Q 3PO3H 1MJEA 2Y0SG 4A3GG 1DGSA 1TWAH 4JI8Q 3PIOA 1YHBA 4DV1L 3ULPA 3SGIA 1HZAA 2QEXA 2XGTA 2VW9A 2E8GA 4BA1I 1EWIA 1Y1VG 4BBRG 4B3TQ 4GKKL 4LF8Q 4HIOA 4DR3L 5C4XH 2GVBA 4LUZA 1IBMQ 1AE2A 2UXBL 1U5KA 4JI4L 4LFCQ 2R7FA 4B3SL 2R93G 4IPHA 4DV2Q 3CW2C 5LMUQ 2AWOA 2MFIA 1Q1EA 2PQAB 3S1NH 1A0IA 1V1QA 2UXCL 1SMXA 3FKIG 1C0AA 4A75A 2Z6KC 3I56A 1PH7A 1IBKQ 4A3MH 4JG2A 5LMNQ 3M7NA 3S2DH 3EBEA 1N33L 3HOWH 2OQ0A 3UE0A 3OTOQ 2KBNA 4OXPA 4TVAB 1PYBA 2VL6A 3NBHB 3TQYA 5C3EH 3G71A 1B70B 3GTMH 1A63A 2ZM6Q 1JJGA 1W3SA 4KHPL 3J7A5 3G4SA 2JA8G 3STBC 3BU2A 1L1OC 3UDGA 2OQKA 4P71A 3J80i 4GOPB 4DR6L 1HR0L 1BBUA 3S16H 4DK3C 1PVOA 4HIKA 3U4ZA 3CC7A 4JI0Q 1WCMG 3J80c 2ZJRA 1BKBA 1X3GA 2N8NA 2H5XA 2PMZE 4L5SA 4OX9L 2R92G 2VUMH 5C0XG 4YCVA 2KCTA 4LFAL 4BXXH 2GVAA 4X6AH 2N49A 5BR8Q 4C3JH 3HOZG 1YNXA 3ULLA 1KC8C 1X55A 1GD7A 3PO3G 2OCEA 4DV5L 1SROA 2JQOA 3CAMA 1Q46A 5IP9H 3K8AA 5FLMG 5M3FH 2C35B 3RLNA 1KHIA 4FDBA 2E2JH 4B3TL 4BY1H 4LF8L 2L15A 3I55A 5C4XG 3W1BA 4LF7L 4R4CA 1TWGH 1VQOA 2JA7H 3GDEA 3G6EA 1WOCA 2V1CC 3DM3A 4BBSG 4YCWA 4DV2L 1QUQA 1YHQA 2OTLA 5LMUL 3KF6A 2HQLA 1X3FA 4DV4Q 1UWVA 4DNIA 4GNXA 1PV4A 1K8AC 4LF9L 2CFMA 1SRUA 2E2IH 2BH8A 2YYZA 2ALYB 3EIVA 2MO0A 3CCVA 1VS0A 2WAQG 5DLQE 4A3LG 2ZJQA 4A3MG 5GROA 1OXTA 5LMNL 2MNAA 2F4VL 1WJJA 2N3SA 3HOWG 5JJKA 2OWOA 2NVQH 3GTGH 1VQ7A 1GKHA 2ID0A 3OTOL 1KAWA 2IHFA 4JI3Q 1PH8A 1MKHA 2IX0A 2JK8A 4OWXB 2ZM6L 5FLXc 4JI2Q 4DV3L 3W5OA 4LF4Q 3CCUA 3CCJA 1QVFA 2VQFL 1Q81C 4YY3L 3S1MH 3M3YH 2LSSA 4A3FH 1N8RC 2JA9A 1KQSA 2VUMG 1SN8A 4NB3A 3H0GH 5GAEC 4BXXG 4DV1Q 1CKMA 4XIGS 1VQ6A 5BR8L 1LUZA 3M85A 1OXSC 2KHIA 4JOIA 4DPGA 3H3VH 1YZ6A 4GKKQ 1VQNA 4DR3Q 4QGUA 5IP9G 1G51A 4B3SQ 3TEHB 4BY1G 3PSIA 1RL2A 3K7UC 4MNOA 1Q12A 3UDIA 5GADC 3M4QA 4KHZA 2JA7G 4NXNQ 4A93H 1FVIA 3CQZH 5C0XJ 1L1OB 4DV0L 5K36G 4AYBG 2NVXH 3GO5A 1O7IA 4AIMA 3KJOA 2OTJA 1OXXK 4LUOA 1PA6A 1D7QA 1OXUA 4JBJA 1YI2A 4L5TA 1XTDA 2Z0SA 3K7AH 4JOIC 1XMOL 4JI1Q 1KD1C 1NMFA 2YTYA 2RHSB 4J15A 4DR7Q 1TWHH 1HZBA 4KHPQ 4HIMA 1S40A 1NY4A 4QY7A 4P75A 1Q82C 2A8VA 4C2MH 2E2HH 1IZ6A 2QGQA 4MZ9A 4RG1A 4JI2L 5ELNA 4QIWE 1L0WA 1MJCA 4R4OA 4LF4L 1VQHA 2RF4A 1UE7A 2VZAA 1E3PA 3HOXG 3PO2H 4A3FG 4DR7L 3K80C 1PH1A 3H0GG 4APVA 4JC0A 3HKSA 2RCNA 4JI6Q 2K52A 2JJQA 3PCOB 3W1GA 4GLVB 3KJPA 3JAMi 4HJ5A 1VQ8A 2DUDA 1X65A 5E7NA 1Q1BA 5HGQA 1VQKA 2E5LL 1X54A 3E9HA 3I7FA 3JAMc 3CD6A 3VDYA 4LF7Q 1AH9A 1PYSB 3U50C 1AE3A 3K0XA 1HNWL 4JYAL 3GD7A 4PZ6A 4X64Q 4DAMA 4A93G 4LF9Q 3PV0A 4NXNL 4LW1A 1RIPA 1VQ5A 1LYLA 2A1AA 1NE3A 4A3EH 1EOVA 3UE1A 2RHQB 1K8GA 3KYHC 3CPWA 3CCRA 4DR4L 1K73C 2VY3A 4R4TA 3I4MH 2IT1A 3HOUH 2F4VQ 1TWCH 4HJ9A 1GVPA 3STBD 2R7ZH 1EIYB 1M1KC 2NN6I 4IPDA 1E1TA 4IPCA 4JI1L 1HNXL 1VQCA 4IOAA 4JCVE 5IYCH 1XMQQ 4DV3Q 4UY8C 2YU9H 1Q7YC 2Q2UA 1UE1A 3GTQH 2VQFQ 4YY3Q 2EXDA 5AJ3L 2JEBI 4OWTB 3WWVA 1QZGA 3PF5A 3PO2G 4GKJQ 3T1HL 3CF5A 3CCEA 4JV5L 2JA6H 3CC4A 1I5FA 1W2BA 4JI6L 1SLJA 4DK6C 4JBMA 1JE5A 5JJIA 1L2FA 4A3BH 3OW2A 1MIUA 1Z9FA 1P16A 5IE8A 4HIDA 3RZDH 3TRZA 1N32Q 4A3JH 3CMAA 3E0EA 2IY5B 1LM0A 3CP0A 4QJFA 1HNZQ 1V9PA 1SFOH 3I4OA 2UUCL 3PUXA 4DV0Q 1VQDA 1HZCA 1SR3A 3RN2A 4GS3A 1JJ2A 4X64L 1ASYA 5ELOA 2FXQA 3TS0A 1B7YB 4IJHA 4A3EG 3HOYH 3HFZB 3KDFB 5GAHC 1XPOA 4A3CH 1XMOQ 1PH5A 3AQQA 2Q2TA 1VCIA 3ER0A 3I4MG 4A3IH 3HOUG 1S3OA 3E9IA 3CMEA 5J3BA 3CCSA 2B29A 3JC66 5HY6A 2WB1E 3BJUA 5C3EG 3Q8DA 1EQQA 2WAQE 5IY0A 5IYCG 2XTIA 1Q86C 1XMQL 1M90C 2PQAA 1ASZA
chains in the Genus database with same CATH superfamily
4LJZC 3K58A 2WACA 2NN6H 1VQEA 4PNYA 1MHWC 3M4OH 4L5QA 1LO5D 5GAGC 3SHLA 5K5PA 2UU9Q 4WFN3 4XT3B 2PO4A 3DWQA 2ZXOA 2ATWA 1QNKA 2NYZD 3NQIA 4PZ7A 3M4YA 3D3RA 1N32L 1CUKA 2EQSA 5EKKA 3D8GA 3FVQA 4DR1Q 4MTNA 1TWHB 4N9TA 1N34Q 1CSPA 5COYA 1GUGA 3MXNB 2F0KA 1PH3A 1BCPF 3C2PA 3HOYG 2K1BA 1HNXQ 1CK1A 3B6YA 3VYRA 2UUBQ 3T53B 3VA7A 1PFNA 2PNHA 4TKOB 1C48A 5M5XH 2F0IA 3PIO3 5I9PA 5AJ3Q 1P8LA 2NN6G 2VQEL 2L1BA 4RGTA 1EFWA 3RD4A 1I94L 3VYUA 4X66L 5M9OA 1BBXC 1XNRQ 2H4OA 2K75A 4A3EB 4K0KL 1KLGD 4K5VA 4WJ4A 3PMFA 1WFQA 1WYDA 2F0FA 5LL6X 5E3FA 3P75A 1TWCB 2A5HA 1IYUA 1TY0A 5M3MH 2K03A 4OO1H 3GTKB 1V1PB 3GV6A 1ZKOA 2LS01 3D31A 2R92H 3S2HH 2C9OA 3BYYB 1R9TH 4KY5A 1ML0D 4DKAC 4PMWA 2Z6KA 1STGA 4GNXB 1HCZA 4H0LC 2EOTA 4MN3A 2DY7A 2IJ0A 3NENA 4IUUA 3Q0AA 2K7VA 2JA5B 2IX3A 1HZ9A 1VQMA 1Y1WH 4EQ5A 3S1RH 2MO1A 4K6DA 3A8JE 4JI5L 2G9HD 1HJPA 1SFOB 1R4QB 1B53A 4Y52H 1S5CD 4ABNA 3I4NH 1S5ED 4KLKA 1A2TA 3DHQA 2HDLA 1N36L 1YVCA 5EAYA 4AQYL 2ZJPA 5EJWA 2EYOA 5M3MG 3J7YW 4OO1G 3H3VI 3GTPB 3OMGA 2BH2A 1BCPC 1TY2A 1S72A 1VQBA 4XQQA 1QILA 3M4OB 1TS3A 2JE6I 4HAEA 2K4KA 4WRDA 5CORA 5D3DA 2L0CA 1JOKA 2NVYH 2F0LA 2ASBA 1F9SA 1IYJB 1VQJA 5A2QE 4OONA 1R4PB 4G7OC 4MTKA 1XJVA 1VQLA 4P72A 1Y1WG 1MGSA 4BWGB 5DNFA 5FOBB 3L7ZC 4R4IA 4S3SA 2A6ED 2ZTDA 2FMCA 1EZ6A 1IBKL 5CV7A 1FL0A 1K83H 4XTCS 5C5MA 3I4NG 2KCMA 3G48A 4LFBQ 2D0PA 1CKNA 1J5EQ 4A3BG 1B1ZA 5A35A 3N6RA 3PGZA 5D14A 3IKJA 4B3RQ 4DGZA 3RN5A 3T16A 3IL8A 4POFA 5M5XB 1PHJA 2R7DA 2F0UA 5BN5A 4YHHQ 2VS1A 4BBRH 1RDPD 1UE5A 5ELFA 3VA5A 5CMDA 2LY7A 4GOPC 4FF1A 2B2YC 1G6PA 5ELCA 5IWAQ 4LUVA 2EDGA 3FPUB 1A8VA 3KDFA 2M00A 4GN3B 3HKZG 5EPLA 4HJ7A 1VMCA 2EY5A 1X3QA 1ZEQX 1NBWA 1GHKA 2R92B 2DNEA 3S2HB 5FJ8G 4DV6L 1R9TB 4EX5A 3DEPA 1VQIA 4XQNA 3KFUA 2XWBB 1F2ZA 1JWUD 3E0JA 3T4AC 5C4JH 4FF3A 2XWJB 4CJ1B 5IGGA 4OX9Q 5C0XH 4LFAQ 4U68A 4AH6A 3Q24A 1IKLA 2RKSA 3HOZH 1ICFB 3PO3H 4A3GG 1YHBA 3ULPA 3X3NA 5I9OA 1HZAA 2AQ3B 2VW9A 3H3VC 4BBRG 3MXPA 2MGSA 4LF8Q 5C4XH 1EWCA 4LUZA 3I4NB 1U5KA 4IZ8A 3VYSA 4JI4L 2R7FA 4DV2Q 2MFIA 1RTOA 1Q1EA 3S1NH 2CW0C 2UXCL 3I56A 3QG1A 3TSSA 1N33L 3OTOQ 3NPPA 3MA2B 3RUZA 3TQYA 1EY0A 3G4SA 3STBC 4K2KA 4CGYB 4JPBW 2NVYB 2WIIB 2BDOA 2XSCA 2HUGA 3S16H 1EQVA 3U4ZA 2FHTA 4JI0Q 2ZJRA 3J80c 2N8NA 4L5SA 5C0XG 4YCVA 1QNUA 5CBAE 3HOZG 1AEXA 1WTOA 3PO3G 2R61A 4AYBB 4DV5L 3AB9A 3HKZB 3CAMA 2ICEC 3K8AA 2E2IB 5C4XG 1K83B 2SNMA 3W1BA 4LF7L 2LMCB 2PQEA 1DOLA 3J81E 3GTGB 1EZ8A 4BBSG 2OTLA 3NP8A 1QUQA 5LMUL 5JPNC 1UWVA 4DNIA 1ONLA 2CFMA 2BH8A 4QUFA 4JK1C 3W2DA 2F4VL 4UHVA 3JAML 1KAWA 1PH8A 1STHA 1PTOH 2Z6BA 4JI2Q 4BBRB 1LTSD 2PYKA 1CI3M 2QF7A 4YY3L 2LSSA 4KD3A 4HSPA 3CHBD 1AW7A 1SYEA 3OIPA 1VQ6A 1LUZA 3BDLA 4ZQ3A 4JOIA 1M4VA 1YZ6A 4GKKQ 4KKTA 4XT1B 3I3CA 4QF4A 1EYDA 4UDUC 1G51A 3TEHB 4RCNA 1SNDA 3MFYA 4NXNQ 1FVIA 5C0XJ 1L1OB 2NVXH 3GO5A 1O7IA 1OXXK 4LUOA 5C4JB 1QG7A 2A69D 4ZCKA 1XMOL 1PTOD 3HOZB 3PO3B 1HZBA 1Y8PB 3VYTA 1LTTD 2QCPX 3MXGA 1K8MA 4R8NA 4C2MH 2E2HH 4FO2A 4MZ9A 3I4LA 3SK8A 1DXMA 1L0WA 4R4OA 1H9SB 1VQHA 1E3PA 3HOXG 3PO2H 4GLVB 3KJPA 3DMUA 2P5ZX 1RCVD 3E9HA 5J1ZA 1O7LA 4L8JA 3CD6A 3OHXC 1PYSB 2F0MA 3A8KE 3K0XA 1U4LA 3GD7A 3K5LA 4LF9Q 1H9KA 1JE4A 1LYLA 5FO9B 3UE1A 3CPWA 3S16B 3KLRA 3CCRA 4R9WA 2B2VC 2R7ZH 4JI1L 1HNXL 1VQCA 1RTNA 1DZ1A 2E76C 1U4PA 5EGTA 1FR3A 2A6HC 4N8X1 1LABA 2X69A 2EXDA 4ULLA 4A3JB 5AJ3L 1B3AA 4OWTB 1SSOA 3PO2G 3CF5A 3CCEA 3VR5A 1RJTA 2JA6H 3NSWA 1PDQA 1L2FA 3MAQA 1MIUA 1P16A 3RZDH 2SDFA 2V4DA 3PUXA 3BVMA 4DV0Q 2SNSA 3SK5A 3RN2A 1JJ2A 4HEDA 1PTOB 3F2UA 2BE5D 4A3CH 1TIID 3ER0A 2H1EA 3HGBA 4NMZA 4A3IH 3CMEA 5KNBA 3IAYA 4C1NI 1Q86C 1M90C 5IY0A 3K7AH 4CJ0B 2PQAA 1ASZA 2RDFA 2ZXPA 2IHEA 2RSNA 1HH2P 5CBEE 4X65Q 4G57A 5EPKA 5FLXE 3CCQA 3UDFA 1VQPA 1HA5A 3NTKA 1A3VA 4CKEA 1PH6A 2JA6G 3PF4A 1WTRA 1LT4D 1SNPA 2A6EC 2Q2HA 2MJ8A 1I6HH 4GOPA 2B2YA 3T13A 4QL5A 3F1ZA 1HNWQ 2AQ2B 1HNZL 4P2CB 2IX1A 2B2UC 1F2YA 3M4PA 1MI2A 1VQ4A 4C2MB 4DR4Q 1A6XA 2M9VA 3N52A 4IUVA 1DOKA 3EA6A 4RCOA 5ISRA 4A3CG 1STYA 2R3ZA 3MXUA 3R2TA 4L63B 2A19A 5FO7B 4F7XA 4IFDI 4DUZQ 1S4ZA 4POGA 1NTGA 4DK0A 1OXVA 3RLFA 4DR2Q 3CRKC 2PMZB 4KV6A 1WTVA 5M5YH 2YTVA 2Q8IB 4OWWB 3M7GA 3L9AX 1XX8A 3VR2A 3M9BA 3AYHB 2CH4W 4J8QA 4DAPA 1II3A 1ZXTA 1X32A 5IT9c 1V43A 4LFBL 3AFQA 4QQBX 4ODGA 3BG3A 3I73A 4DF7A 2Y0SE 3AFPA 4B08A 2B2TA 4NXMQ 2R7ZB 3K81C 1A3UA 4CDDC 2A73B 4DNRB 4PMBA 5NUCA 4ID6A 1AP0A 1SXTA 2CWPA 4R8IA 3R93A 1U9RA 3TP6A 4PZ8A 2UXDL 1E1OA 2AWNA 3BZCA 2QW7A 1KXLA 2N78A 4YHHL 3PUVA 3GTKH 2NVTH 2JA6B 1BUVT 2FMMA 1LTBD 5JJLA 1X3PA 1BVSA 2QEJC 2ZTEA 3E3XA 1XNQQ 3RZOH 5D65A 4YWKA 2F0PA 5G3LD 5IWAL 3RZDB 2DGYA 3AEVA 4B3MQ 2TSSA 3J7AF 1UNSA 1PH2A 3L2PA 2AMCB 2JA5H 2HIXA 2JYOA 2EY2A 1Q3LA 2K5QA 3E5SA 1JJCB 4IJLA 4A3KH 2KEDA 1DONA 4A3IB 3HOVH 4N9PA 1JORA 2Z4HA 1LTID 4J6HA 4FF2A 5DAUA 1X3EA 4I7AA 3UDXA 1GOZA 1HPCA 3D0FA 3K7AB 1A62A 4IUTA 2RQXA 1EEID 3SVMA 4OL7A 4FXGC 3J81c 4B9XA 4DV7Q 1BNZA 4LF5Q 2NZ1D 1CA6A 1E0BA 1V1PA 1WD0A 4WJ3M 1ICWA 3A5UA 4HCEA 4OEMB 4QIWB 1STEA 1K9MC 1I6HB 1AZQA 1VQAA 2RDHA 5JOBA 2F0SA 1G6ZA 4GN4B 3NK9A 1QOHA 3KF8B 1I3QH 5I4DA 1YNND 2JA5G 5CYUA 3RLOA 1SBBB 2I5MX 2Y0SB 1Q8KA 2F3IA 4KK7A 2FINB 4HR7B 3H6MA 1EYAA 3FP9A 4NDXA 5CR3A 4A3KG 2TMPA 4IOCA 2K01A 3HOVG 2QDBA 1KNEA 3NELA 1J9OA 4IURA 4DUYQ 4JI0L 3TN2A 3BDCA 1HFGA 3MZ5A 4N8FA 1QCBD 2XNAC 1B50A 4RHSA 5M5YB 4Y7NH 1UEBA 4R1JA 1RHPA 4C3HH 2D62A 1HQMC 1WI5A 3FMCA 3K6OA 4K5WA 3F2BA 4GLXA 1HR0W 1KRSA 2UXBQ 1SE4A 3ND9A 2B3GA 3NE5B 4FF4A 1JOOA 4X62Q 5KIXA 3J80L 4LF6Q 2N55A 4UP9A 1VQ9A 1J8IA 4DAYB 3IRBA 3U58A 4DFAA 4I7ZC 2VNUD 1YJ9A 3QO2A 1E24A 1NMGA 2ENBA 4PV1C 3SEBA 3NEMA 1QVCA 2L55A 3CC2A 2A69C 4OELB 1HR0Q 3WDNA 3S17H 4F88A 2NVTB 1PFMA 4K8IA 1EIHA 3RZOB 2L12A 1PZJD 1EFID 2AQ1B 1TR5A 1DGSA 4JI8Q 3K57A 3SGIA 2B2VA 4CKBA 1FGBD 1LTRD 4C3HG 2E8GA 1EY8A 4BA1I 4B3TQ 2WAQB 4GKKL 3SXHA 1ESRA 2GVBA 1IBMQ 1AE2A 3MWYW 2K6AA 3S9WA 5AFWA 2JP1A 4IPHA 4XYQA 1GJXA 2AWOA 4RAUC 4A3KB 2IW3A 1A0IA 1WTPA 3HOVB 2F0WA 4A3MH 2MHVA 5CV8A 3HOWH 2OQ0A 3VR3A 2KBNA 4OXPA 1PYBA 3NTHA 4ZUIA 5C3EH 3G71A 2Q8TA 1CQFA 3GTMH 2ZM6Q 1SJED 3J7A5 4EVOA 3BU2A 1NCVA 3UDGA 2FFKB 4DR6L 1BBUA 1PMRA 1PZKD 1IYVA 4HIKA 3URYA 1DD2A 2VUMH 2E74C 2R92G 1WTQA 3Q23A 4X6AH 5BR8Q 5HGTA 3ULLA 4DK1A 1STNA 1X55A 2OCEA 2DN8A 1Y8NB 5M3FH 2K28A 3RLNA 4FDBA 4MHEA 1I3QB 5LL6S 1RD9D 1C8CA 3DM3A 4YCWA 1YHQA 5K36H 2HQLA 4DV4Q 1PV4A 1K8AC 4LF9L 2E2IH 2ALYB 3EIVA 2MO0A 3CCVA 4X3SA 4A3MG 3M3YB 1OXTA 5LMNL 1W6JA 2WV6D 2XRSD 1WJJA 3HOWG 3GTGH 2ID0A 2BE5C 2JK8A 4Y7NB 3G7LA 4NKLA 4C3HB 5FLXc 3A7LA 2F0QA 2EXZA 4TSSA 3W5OA 5IGEA 3CCJA 3GP7A 2B2UA 2N88A 2VUMG 3MHBA 4DV1Q 1CKMA 3D4WA 4XIGS 4KJNA 2KHIA 1H9MA 2RA4A 4DR3Q 4DAVA 4KJOA 3BVZA 1FNWA 3K7UC 2D2CC 2ZXRA 3C3LA 3M4QA 5I6YA 4A93H 1KLUD 4DV0L 5K36G 4AYBG 4AIMA 2OTJA 3S17B 2CVRA 1NMFA 2QILA 2Z4IA 4H13C 4Q5VA 2EVBA 1NY4A 4QY7A 1Q82C 3FPPA 2A8VA 3BVGA 4RH6A 2QGQA 3E6ZX 3MTSA 5ELNA 2Q8RE 5T1IA 4LF4L 2HQEA 4HMJA 4OIJA 1UE7A 1PH1A 2A68D 3A7AB 4JI6Q 1G91A 2RCNA 5CV4A 4FP5D 2JJQA 3A54A 3JAMi 4HJ5A 2DUDA 1VQ8A 4O42A 1Q1BA 1VQKA 2AUKA 4A3MB 2RVLA 1AH9A 3U50C 3HOWB 1HNWL 4ZYSA 4UAIA 2RSOA 1G8ZD 5C3EB 4X64Q 3J7AV 3HRZC 4KN4C 3GTMB 4A93G 4H7BA 1RIPA 1F9RA 2A1AA 1D5MC 1NE3A 5IGDA 3EJIA 1K8GA 5I6WA 4DR4L 2VY3A 4R4TA 2JSOA 3HOUH 1BF4A 2DJGC 1NR4A 4HJ9A 2VUMB 3QB3A 4FXKC 2NN6I 1E1TA 4IPCA 2O5JC 4JCVE 4KKSA 5E4XA 5IYCH 1XMQQ 2YU9H 1UE1A 3GTQH 2VQFQ 1TT2A 2EJMA 5M3FB 2F0VA 1F9PA 2NTTA 1KAAA 3OWFA 1BOSA 3Q22A 5KYLA 3KBGA 3OW2A 1ZYRD 1FNVA 3TRZA 1N32Q 4A3JH 3CMAA 3E0EA 3HS0C 1LM0A 2B8GA 1V9PA 5JVH3 1VQDA 1HZCA 1SR3A 5ELOA 3FEWX 3TS0A 2A74C 1B7YB 4CDFC 4OHJA 3KDFB 2OEOA 1PH5A 5IT9L 3AQQA 4KY7A 3HOUG 1S3OA 5DEHA 2MUYA 5J3BA 2B29A 2WB1E 1SAPA 3Q8DA 5IYCG 1KNAA 3V05A 3WOFA 3CPFA 1JC7A 1EY7A 1EIGA 2LXKA 1XNQL 3ICEA 4GNXC 4YWMA 4P74A 3SE0A 3ULJA 4DR7Q 1O7YA 4X66Q 2F0JA 3D4DA 4A93B 2XIWA 2SOBA 3NBHA 5IGBA 4GKJL 1E2ZA 1NAPA 3H91A 1WVLA 2E5LQ 4OO1I 1K3RA 1BR9A 2I0QA 4BY7H 1YNNC 4A3JG 3A5ZB 2Q2IA 5BN3A 2KCNA 1CKOA 4KD4A 4KKUA 5FO8B 5IYBH 4E6IA 1BBWA 2IPKD 1VQFA 1KDCA 1QB5D 1I50H 1AN8A 3KLWA 5IYDH 3ERSX 3C46A 1SYBA 5JVG3 1C9OA 3OYYA 4ILWA 2KHJA 4C3IH 3GTOB 2KUMA 1CSQA 2R93H 2WP8J 3NTIA 5KRUA 2F0GA 4ZLTF 2K32A 1LTGD 3A8IE 4KN7C 2QA4A 2BCOA 3NUCA 3T1HQ 1CHPD 4JV5Q 4KY6A 5DM73 2UU9L 3EVQA 2BA1A 2BA0A 3J81L 1N36Q 1EWHA 3OMCA 3HOUB 1I4RA 2UUCQ 3EN2A 4PG3A 3TP5A 5IP7H 3TP7A 1STBA 4RFBA 1WCMH 1GO3E 1C4QA 3LGJA 4DR1L 1N34L 2PPBC 2XN9C 3CU7A 3NXWA 2YU9B 1QUQB 3GTQB 4GLAC 1MBYA 1VF7A 1KIXA 5FLMH 4HJ8A 5IYDG 1LTLA 4OIKA 1JT8A 4V190 2UUBL 2AHOB 3U4VA 2EIFA 4IALA 3HEJA 4C3IG 3T1YQ 4UP8A 2E75C 3K5MA 1JB3A 2J0TD 1ENCA 4DA2A 4UP7A 5ELBA 4X62L 1T9HA 2I5LX 4RKBA 4LF6L 1S5DD 4LWCA 1Q8IA 3A0JA 4A3LH 1G291 2NUCA 3RNUA 2NTSA 2MQHA 1XNRL 1B8AA 1HQRD 4RGMA 2LXJA 3DLLA 1PFSA 2F0TA 2F0NA 2ES2A 4FYDA 1BQQT 4CBVA 1X6OA 2I5HA 4YCUA 4OGQC 5IP7G 3GTJB 5KGUA 2J7ZA 3OW7A 2F1MA 5ELEA 2NZHA 2KA7A 2LKVA 3CKIB 4IPGA 2PZTA 1XPRA 3PUWA 1JB7A 4JBKA 4JI8L 1D8LA 2UUAQ 2R7ZG 4J1MA 1XXGA 3NQTA 5GQOA 1A15A 1SNQA 1N9WA 1IBML 3U9SA 3J7ZC 4O0AA 5IGCA 2CKZB 4IQZA 1UUPA 1VQGA 4KI0A 1EUJA 4BY7B 3QR8A 1FGUA 2CWAA 4EQOA 1KDBA 2EY1A 4DV6Q 1W6KA 5C3WA 1TS2A 1FJGQ 1CFMA 1YJWA 1K0SA 5C0XI 1I50B 2KQ3A 1SE8A 1IBLQ 1Y1VB 3C1FA 1JMCA 1EOTA 1PH9A 5C5LA 4C3IB 1HRJA 1TQOA 2R93B 2L5TA 1C7YA 1TXYA 1H9JA 4DU9A 1K28A 4CDEC 4JI7Q 1I4PA 3FKIB 1EYGA 1HFNA 1QZHA 1O80A 4A3IG 2YTXA 2K50A 4JI4Q 1CZGA 4BS9A 1G2TA 1CQVA 5C6AA 1HUMA 5I2YA 4CJ2C 1AZPA 1O7ZA 3S14H 3KOJA 2RCFA 2UXCQ 1NJIC 1D5XC 1D1KA 1YHAA 3NBIA 3T56B 4DV4L 4LFCQ 4R4QA 3FRPB 5I2XA 2IWHA 1WCMB 1WTWA 1GM5A 1N33Q 1BCPB 1IL2A 2EJFC 3MEFA 2K14A 3MVVA 2NZOA 1F2LA 3I8ZA 2QDLA 1K0RA 1TU2B 2JA8H 1SYCA 3LWUA 1J5EL 4DR5Q 2E2DC 3TREA 1DJRD 1Z47A 2F4IA 5EKLA 4XQJA 3V96A 4B3RL 2EE1A 4ME3A 3P1HA 2EZVA 1OO9B 5CV5A 2HHHQ 2KENA 2CQAA 2ZTCA 3I2ZA 4NPSA 3S24A 3KF6B 4DV5Q 3LWEA 1MJEA 2VXWA 2Y0SG 3PIOA 4DV1L 3DWAA 4K8JA 2QEXA 2XGTA 1EWIA 2A68C 4FNFA 4DR3L 5IIFA 1A2UA 4MIUA 5FLXL 3H94A 4O1NA 3CW2C 4WORA 2KCCA 5LMUQ 3MXNA 2PQAB 1E2VA 1U4MA 1B2TA 1I4GA 2L4NA 2O2LD 1C0AA 1B9MA 3MC0B 1PH7A 3NHHA 4JG2A 3S2DH 3EBEA 2KOLA 4TVAB 2B2WC 4K6LA 4C3JB 1GUNA 1NUCA 1B70B 1HXYD 1A63A 1JJGA 1W3SA 2JA8G 1L1OC 4P71A 1IW7D 3J80i 4GOPB 5EBDA 1PVOA 4DK3C 1PTOF 4QB4A 2E2JB 1TVXA 3BS1A 4JW0A 4OX9L 2K05A 4LFAL 4BXXH 3NWTA 1BDOA 2JA7B 2N49A 1YNXA 2O4XA 1GD7A 2EYLA 3R8BA 3ND8A 3SK4A 2JQOA 3J80E 1Q46A 2C35B 1KHIA 4FXDA 4BY1H 5C4HA 4LF8L 3I55A 3I91A 1SE2A 1VQOA 3GDEA 3G6EA 2NVQB 1K3BC 1SMYD 4DV2L 1ZYRC 3DEOA 4GNXA 1T5EA 1LACA 1SRUA 4KHVA 2YYZA 1VS0A 2WAQG 5DLQE 4F8MA 3HP3A 3H0GB 1GUOA 3K59A 1VQ7A 3OTOL 2EY6A 4JI3Q 1O78A 4XDXA 1PRTD 2IX0A 4OWXB 1S5BD 1XWEA 4ZRZA 2Z9HA 1QVFA 2VQFL 3M3YH 2JA9A 1SN8A 3P20A 1EU4A 4NB3A 5KYIA 4BXXG 3S14B 3CQZB 1B3QA 1I4XA 4DPGA 4C1NK 2X6GA 4QGUA 5LHY1 1FD7D 1Z7TA 1M8AA 4B3SQ 4BY1G 4FVMA 1HUNA 1KDAA 2WKCA 2MP1A 2JA8B 1HHVA 4NP5A 3KJOA 1PA6A 2HDMA 2EYMA 4EGVA 1XTDA 2Z0SA 4JOIC 4XXEA 1ESFA 4JI1Q 2G9DA 5DM63 3IFDA 3CRLC 4KHPQ 3O13A 4X3KA 4P75A 5J39A 1PTOC 1IZ6A 4JI2L 3T51B 4DN4M 2RF4A 2VZAA 3Q6SA 1SNMA 4DR7L 1GXDC 4APVA 1ENFA 4JC0A 3DUZA 5KNDA 3PCOB 4LK1C 4PMCA 2OT2A 3BYTB 1RODA 5E7NA 1KTKA 2E5LL 1X54A 2WINB 5JPMC 4EQNA 3I4MB 3S2DB 4ZAIA 2MPMA 5J22A 1TS5A 4IUPA 3PV0A 4NXNL 4LW1A 3TZUA 1VQ5A 1PRTB 1Y69U 1K73C 1SE3A 1GVPA 1EIYB 2K33A 1M1KC 2A6HD 4IOAA 3KLSX 1LTAD 2EJGC 4DV3Q 4UY8C 4TRDA 3D6WA 3QJYA 4BY1B 5CC4A 2JEBI 3EFXD 1VDZA 1QZGA 5JEAH 1IKMA 3T1HL 2F0HA 4JV5L 3TP8A 1GHJA 2VB3X 1W2BA 1SLJA 4DK6C 2HCCA 1JE5A 3HOYB 4A3BH 4ZKBB 3KBXA 1Z9FA 5IE8A 2Z1CA 4K14A 4HIDA 2IY5B 5JAVA 3X3MA 3CP0A 1HNZQ 1SDFA 2XVSA 2UUCL 2KVMA 1STAA 1ASYA 2FXQA 1A3TA 1ILQA 1VMPA 4IJHA 3HG9A 4IUQA 3HFZB 1XPOA 2NWGA 1JCKB 1QE6A 4Z9CB 1CM9A 2DJFC 3BDOA 1CT1D 3BJUA 3HZXA 1I4QA 2PZUA 1YNJD 5C3EG 1EQQA 1JICA 3R3OA 4RGNA 3T1YL 4LMQD 3F2DA 1RKNA 1YIJA 3J81j 5CV6A 3ZYYX 4DXFA 1MSGA 1KL9A 2AKWB 3ZJYC 1EU3A 3MEHA 4H02A 2X6LA 5EQ0A 5JEAG 1UE6A 2HCIA 5FJ8H 3TDQA 2GA4B 2D5DA 5G3LF 1JWMD 3CCLA 3NWSA 4A3DH 1D2BA 1EL0A 2K5VA 5TSSA 2J4XA 4ZKCB 5M3FG 4JYAQ 1ET9A 1JQYD 5L37A 2JEAI 3SK6A 2UXDQ 2WFWA 4A3GH 4RA8A 1U0LA 4G7ZC 5IOCA 1EIFA 1SYGA 4AYBE 5C44H 1MSHA 3HKZE 3PUYA 2D9UA 1E22A 4A76A 4IO9A 2UUAL 5ELDA 5CV9A 4RWSC 1QVGA 3EROA 3TS2A 2B63H 3WOEA 4ALPA 3TBIB 3W3AA 1XPUA 4DNTB 5M3MB 1V8QA 1F9QA 4X65L 5A2QL 5KEEA 3DWPA 2HD3A 4JVZA 3KUPA 3GTOH 1EY9A 3PIPA 2CCZA 3GTLH 3KK7A 3D4RA 5EBCA 3FHWA 1FJGL 3L0OA 4DXGA 4A3DG 2OF1A 1H95A 2CH4A 2EYHA 2F0DA 3VR6A 1MD2D 5IT9E 1IL8A 1IBLL 1SYFA 4B9WA 5E4WC 4YWLA 3H15A 3PQIA 1Y14B 3JAME 1BXTA 1Y1WB 1PRTF 5JEAJ 4HJAA 3S1RB 1L0YB 4JI7L 1KRTA 4GZYC 2PW7A 2RBMA 2B2WA 5C44G 4L5RC 2CQOA 3RR5A 4DUZL 1TWFH 4O2DA 2B2TC 1L1OA 1CKNB 4X3TA 2XRQD 4BBSH 4A3BB 2YV5A 4F87A 2B63G 4DR2L 4CKCA 4IFDH 2QKIC 1JOQA 2C5CA 4LFCL 3S1QH 2R6GA 1DCZA 5F2DA 1EY4A 3UI2A 3F8TA 1QJOA 2K5HA 4ZK9B 3LNNA 4JBWA 1H9SA 4DR5L 1X9NA 4NXML 3A55A 3SR1A 1E2WA 2VB2X 3I90A 1U4RA 4M1UB 4HTHA 2F52A 1IW7C 2HHHL 1YBYA 3J81i 3PUZA 1WTHA 1DM0B 3VR4A 4GN5A 3CCMA 1XYIA 1D6EC 4TQUS 3I72A 4RMFA 4X3UA 3GTJH 2G5DA 1E7ZA 1PXUA 2HIVA 2F0OA 1HTLD 4A3DB 2VQEQ 4P73A 2L9HA 4IFDG 1I94Q 1J6QA 1EY6A 1X56A 3MFGA 2GN5A 1SMYC 1G2SA 1SJHD 2WB1G 4LNQA 4B3ML 2PZWA 2F03A 1OTCA 4K2LA 3OPOA 4K0KQ 2ZT9C 2ICIA 3CXCA 4A3GB 1EQRA 3L3OC 1YITA 1HA6A 1IXRA 1B9NA 5C44B 5IGFA 1AFPA 3I70A 1PRTC 3HOXH 3S15H 1PH4A 2D0OA 4KTAA 1YJNA 3DXJC 1CZWA 1SEBD 2B63B 4BA2I 5D3IB 1FNUA 3QIAA 1B4OA 1PZID 1Y1VH 4DV7L 1S5FD 3A74A 4LF5L 4HCSA 1GUSA 1EYCA 4PQXA 3OOCA 5C3XA 2PI2A 3GTLB 3BZKA 4QUCA 3FDTA 3P7JA 2EPBA 2K5NA 4JI5Q 5H1SE 1DYQA 3FKIH 5EKIA 3PIP3 2F3WA 4EQPA 1YEZA 3K5NA 4ME5A 3F2CA 2K04A 1F77A 2KECA 2PI2E 5M5WH 1D5ZC 1ILPA 3V2TA 3TZDA 3OIQA 4AQYQ 1LV9A 2OXPA 2EYFA 4JI3L 4UPAA 4DR6Q 4BY7G 2B8FA 4KMUC 5BN4A 4A4IA 4QMGA 5C4XB 4IFDJ 5LMNW 1TWFB 5IYBG 4XYOA 2HT1A 4DUYL 4BBSB 1TWAH 1TS4A 1T5XD 3S1NB 1DOMA 1UAPA 2KJXA 3K5OA 2WB1B 1Y1VG 1LT6D 3R2IA 4HIOA 4HN7A 3S1QB 2UXBL 1LT3D 4B3SL 3KLSA 2R93G 1TKWB 2BOSA 1V1QA 1SMXA 3FKIG 4A75A 2Z6KC 1IBKQ 3A56A 5LMNQ 3M7NA 3UE0A 2BDNA 4RGOS 3NBHB 2VL6A 1SNCA 4KHPL 1BCPD 2DNCA 2K5DA 5T1GA 2OQKA 1HR0L 1PLFA 3CC7A 1WCMG 1BKBA 1X3GA 2H5XA 2PMZE 1NSNS 2KCTA 2GVAA 4C3JH 2CHBD 1KC8C 1ENAA 1L0XB 3QOJA 4CHTB 4YIJA 1WTXA 1SROA 1ET6A 4G7HC 2JXMB 5IP9H 1B44D 5FLMG 1CTMA 2E2JH 4B3TL 2L15A 3ITPA 4R4CA 1TWGH 2EYJA 2JA7H 1RF2D 1WOCA 2V1CC 5C4ZA 2PNRC 3KF6A 3TMEA 1X3FA 4IUNA 1SYDA 3U9OA 3EQLC 4V0BA 4RKLA 5HURA 1XTCD 4QCLA 1I4HA 4A3LG 2ZJQA 3S15B 3HOXB 5GROA 3OSOA 2MNAA 1H9RA 5JJKA 1D1IA 2N3SA 5CGKA 2OWOA 2NVQH 1LLRD 1GKHA 2IHFA 1MKHA 4L6TB 3G6JB 2ZM6L 1QWYA 4DV3L 1BO0A 4LF4Q 3CCUA 1NNXA 1Q81C 2WKDA 1YNJC 4LAAA 3S1MH 2LFNA 4A3FH 4RHRA 3LX0A 4M8AA 1N8RC 1KQSA 5GAEC 3H0GH 2PCFB 4IN3A 4C3JG 5BR8L 3M85A 1OXSC 3H3VH 2NVXB 1VQNA 5M5WB 5IP9G 1F2MA 3ERQA 4ZUJA 1KABA 3PSIA 1RL2A 1SNOA 4MNOA 1Q12A 3UDIA 5GADC 2JN4A 4KHZA 2JA7G 2DY8A 5JJZA 3CQZH 4C56C 1EY5A 2E2HB 2L11A 1D7QA 4U673 1OXUA 4JBJA 1YI2A 4L5TA 3DM1A 1VF5C 1EEFD 4NW2A 1KD1C 2RDGA 3PO2B 2YTYA 2RHSB 4J15A 4Q0FA 1TWHH 3C1EA 1HTPA 4HIMA 1S40A 1WD1A 1TWAB 3H09A 1EQTA 2PW5A 3AU7A 4RG1A 1Q90A 4QIWE 1MJCA 3KF8A 1NR2A 3RMHA 2F3VA 4A3FG 1Y8OB 3K0YA 3K80C 3H0GG 2F0EA 3OWEB 1LT5D 3HKSA 2K52A 3W1GA 5IODA 2AUJD 1X65A 2Z8LA 5HGQA 3I7FA 3JAMc 3VDYA 4LF7Q 1JWSD 1AE3A 2CW0D 2IL8A 2M2LA 1CA5A 4JYAL 4PZ6A 3AMUA 4DAMA 1UEAB 2B39A 4A3EH 3GQBA 1EOVA 2RHQB 2FJ2A 1PFBA 2NB0A 3KYHC 3ONAB 3BZDB 4H44C 1IHZA 3I4MH 2IT1A 3QOLA 2F4VQ 1TWCH 2KHSA 3STBD 1GUTA 1K8OA 4IPDA 5EPJA 2SEBD 3IFTA 1PYWD 1JR0D 1Q7YC 2O5IC 2Q2UA 5FKAC 4DAYA 4YY3Q 4WJWA 5E1FA 5FK9C 1CHQD 1TWGB 3WWVA 2NBFA 3PF5A 4GKJQ 1V1OA 3CC4A 4CDCC 1I5FA 4JI6L 1I6VC 4JBMA 5JJIA 3D6CA 3GV3A 4QJFA 2K5WA 4I65A 1SFOH 3I4OA 4K5XA 1FYCA 4GS3A 4X64L 4G4KA 2EYPA 4HMIA 4HSVA 2KEEA 4A3EG 3HOYH 5KNCA 5GAHC 3SDZA 3QWNA 1XMOQ 2I07B 1VCIA 2Q2TA 3S1MB 3I4MG 4A3FB 3E9IA 2I46A 1GUWA 3CCSA 3JC66 5HY6A 3GTPH 2WAQE 2XTIA 1XMQL 1Z6HA
chains in the Genus database with same CATH topology
3T1YL 3CPFA 3F2DA 1YIJA 2LXKA 1XNQL 1VQEA 3J81j 3ICEA 3M4OH 4L5QA 4GNXC 2IHEA 1KL9A 4P74A 4YWMA 1HH2P 2AKWB 3ULJA 3ZJYC 5GAGC 4X65Q 2UU9Q 3CCQA 3UDFA 4H02A 4X66Q 1VQPA 5JEAG 1UE6A 5FJ8H 4GKJL 1PH6A 2JA6G 3PF4A 3CCLA 2ATWA 2E5LQ 4A3DH 4OO1I 1K3RA 2Q2HA 2K5VA 1I6HH 2I0QA 5M3FG 4GOPA 4QL5A 3F1ZA 4PZ7A 1HNWQ 4BY7H 4A3JG 1N32L 4JYAQ 1CUKA 2EQSA 2Q2IA 3A5ZB 1CKOA 1HNZL 4DR1Q 4MTNA 1N34Q 1CSPA 2IX1A 2JEAI 5IYBH 3M4PA 1VQ4A 1BBWA 2WFWA 3MXNB 4DR4Q 2UXDQ 4A3GH 1PH3A 3HOYG 1VQFA 1I50H 4A3CG 1U0LA 3KLWA 5IYDH 1HNXQ 1EIFA 3B6YA 2A19A 3ERSX 4AYBE 5C44H 3HKZE 3PUYA 2UUBQ 4IFDI 4DUZQ 1E22A 4A76A 4IO9A 1C9OA 3OYYA 2UUAL 2KHJA 4C3IH 4POGA 1NTGA 1CSQA 2R93H 2WP8J 1QVGA 2PNHA 5M5XH 3TS2A 1OXVA 3RLFA 4DR2Q 2B63H 5AJ3Q 1P8LA 2NN6G 5M5YH 2VQEL 2YTVA 4ALPA 4OWWB 2QA4A 3M9BA 3AYHB 1EFWA 1XPUA 3T1HQ 4JV5Q 1I94L 4X65L 2UU9L 4X66L 1XNRQ 3GTOH 2K75A 2BA1A 2BA0A 1V43A 5IT9c 1N36Q 4K0KL 3PIPA 4WJ4A 2CCZA 3GTLH 1WFQA 1WYDA 3FHWA 3AFQA 3L0OA 1FJGL 4A3DG 4LFBL 4QQBX 1H95A 2Y0SE 3AFPA 2UUCQ 4NXMQ 3EN2A 3K81C 4PG3A 5IP7H 5M3MH 1IBLL 1WCMH 1GO3E 4YWLA 3H15A 4DR1L 3LGJA 3D31A 1N34L 2R92H 3S2HH 1Y14B 2CWPA 1R9TH 5JEAJ 1QUQB 4DKAC 4GLAC 4PZ8A 4PMWA 2Z6KA 4HJAA 2UXDL 4GNXB 1E1OA 2AWNA 3BZCA 4JI7L 1KRTA 1KIXA 1KXLA 5FLMH 2N78A 4HJ8A 3NENA 5IYDG 4YHHL 5C44G 1LTLA 3PUVA 4L5RC 2CQOA 3GTKH 2NVTH 1JT8A 2UUBL 3RR5A 5JJLA 4DUZL 1TWFH 4O2DA 2AHOB 3U4VA 1HZ9A 2EIFA 1BVSA 3T1YQ 2ZTEA 1Y1WH 4UP8A 1VQMA 1L1OA 1CKNB 1XNQQ 3RZOH 4EQ5A 4BBSH 4UP7A 4YWKA 2YV5A 5IWAL 2MO1A 4DR2L 3S1RH 2B63G 3GTPH 4X62L 1T9HA 2I5LX 4LF6L 2DGYA 4JI5L 3AEVA 1HJPA 4LWCA 4B3MQ 4LFCL 3A0JA 4A3LH 3S1QH 4Y52H 1G291 2R6GA 3RNUA 1PH2A 3I4NH 3L2PA 2AMCB 2MQHA 3F8TA 2HIXA 1B8AA 4KLKA 2JA5H 1XNRL 2K5HA 2LXJA 1N36L 1YVCA 3DLLA 4JBWA 5EAYA 4AQYL 1JJCB 1PFSA 4IJLA 4A3KH 2ZJPA 2ES2A 3HOVH 4DR5L 1X6OA 2I5HA 4YCUA 1X9NA 4NXML 5M3MG 5IP7G 1X3EA 4OO1G 3UDXA 3H3VI 2NZHA 2BH2A 3D0FA 1A62A 2F52A 1S72A 1VQBA 4IPGA 2HHHL 1YBYA 3J81i 1XPRA 3PUZA 3PUWA 1JB7A 3CCMA 4JBKA 4GN5A 2JE6I 2K4KA 4TQUS 4JI8L 3J81c 4DV7Q 4LF5Q 1D8LA 2NVYH 4RMFA 2UUAQ 2ASBA 3GTJH 2R7ZG 5GQOA 1IYJB 1VQJA 1E7ZA 2HIVA 4OONA 4WJ3M 1N9WA 1IBML 3A5UA 3J7ZC 4O0AA 2CKZB 1XJVA 1K9MC 4P72A 1Y1WG 2VQEQ 1VQLA 1VQGA 1VQAA 4KI0A 1EUJA 4P73A 4GN4B 1I94Q 1J6QA 3L7ZC 4R4IA 1X56A 4IFDG 1FGUA 2GN5A 2CWAA 2ZTDA 2WB1G 3KF8B 4B3ML 4LNQA 4DV6Q 1OTCA 1I3QH 1IBKL 1FL0A 1K83H 4XTCS 3I4NG 4K0KQ 2KCMA 3G48A 2JA5G 1FJGQ 3RLOA 3CXCA 4LFBQ 2I5MX 2D0PA 1Q8KA 2F3IA 1YJWA 1EQRA 1CKNA 1J5EQ 5C0XI 4A3BG 1YITA 3FP9A 1SE8A 3PGZA 4A3KG 1IXRA 1IBLQ 4IOCA 4B3RQ 3HOVG 3NELA 3RN5A 1JMCA 1PH9A 3S15H 4POFA 3HOXH 1PH4A 4DUYQ 4JI0L 2D0OA 1C7YA 1TXYA 1YJNA 1PHJA 4BA2I 4JI7Q 2R7DA 1UEBA 4R1JA 4Y7NH 1EYGA 4C3HH 2D62A 4YHHQ 1WI5A 2VS1A 1Y1VH 4BBRH 1QZHA 1UE5A 4A3IG 2YTXA 2K50A 4DV7L 3F2BA 4GLXA 1HR0W 1KRSA 3A74A 4LF5L 2UXBQ 4GOPC 4JI4Q 1G6PA 2PI2A 2B3GA 3BZKA 5IWAQ 4LUVA 4X62Q 3S14H 4LF6Q 2K5NA 1A8VA 3KDFA 3KOJA 4UP9A 5H1SE 4GN3B 3FKIH 1NJIC 1VQ9A 4JI5Q 2UXCQ 4DAYB 1YHAA 3HKZG 1YEZA 3IRBA 4DV4L 4R4QA 3F2CA 2PI2E 5M5WH 4HJ7A 3U58A 1N33Q 1GM5A 2VNUD 1NBWA 1YJ9A 1IL2A 5FJ8G 4DV6L 1E24A 1NMGA 3MEFA 2K14A 2NZOA 4AQYQ 4EX5A 3NEMA 1QVCA 1K0RA 1VQIA 3CC2A 3KFUA 2JA8H 4JI3L 4UPAA 1J5EL 4DR5Q 3TREA 1HR0Q 4BY7G 4DR6Q 1Z47A 5C4JH 3S17H 4A4IA 4B3RL 4OX9Q 4ME3A 4IFDJ 5LMNW 5IYBG 4LFAQ 4AH6A 2HHHQ 2HT1A 3HOZH 2KENA 4DUYL 2ZTCA 3I2ZA 4NPSA 3S24A 3KF6B 4DV5Q 3PO3H 1MJEA 2Y0SG 4A3GG 1DGSA 1TWAH 4JI8Q 3PIOA 1YHBA 4DV1L 3ULPA 3SGIA 1HZAA 2QEXA 2XGTA 2VW9A 2E8GA 4BA1I 1EWIA 1Y1VG 4BBRG 4B3TQ 4GKKL 4LF8Q 4HIOA 4DR3L 5C4XH 2GVBA 4LUZA 1IBMQ 1AE2A 2UXBL 1U5KA 4JI4L 4LFCQ 2R7FA 4B3SL 2R93G 4IPHA 4DV2Q 3CW2C 5LMUQ 2AWOA 2MFIA 1Q1EA 2PQAB 3S1NH 1A0IA 1V1QA 2UXCL 1SMXA 3FKIG 1C0AA 4A75A 2Z6KC 3I56A 1PH7A 1IBKQ 4A3MH 4JG2A 5LMNQ 3M7NA 3S2DH 3EBEA 1N33L 3HOWH 2OQ0A 3UE0A 3OTOQ 2KBNA 4OXPA 4TVAB 1PYBA 2VL6A 3NBHB 3TQYA 5C3EH 3G71A 1B70B 3GTMH 1A63A 2ZM6Q 1JJGA 1W3SA 4KHPL 3J7A5 3G4SA 2JA8G 3STBC 3BU2A 1L1OC 3UDGA 2OQKA 4P71A 3J80i 4GOPB 4DR6L 1HR0L 1BBUA 3S16H 4DK3C 1PVOA 4HIKA 3U4ZA 3CC7A 4JI0Q 1WCMG 3J80c 2ZJRA 1BKBA 1X3GA 2N8NA 2H5XA 2PMZE 4L5SA 4OX9L 2R92G 2VUMH 5C0XG 4YCVA 2KCTA 4LFAL 4BXXH 2GVAA 4X6AH 2N49A 5BR8Q 4C3JH 3HOZG 1YNXA 3ULLA 1KC8C 1X55A 1GD7A 3PO3G 2OCEA 4DV5L 1SROA 2JQOA 3CAMA 1Q46A 5IP9H 3K8AA 5FLMG 5M3FH 2C35B 3RLNA 1KHIA 4FDBA 2E2JH 4B3TL 4BY1H 4LF8L 2L15A 3I55A 5C4XG 3W1BA 4LF7L 4R4CA 1TWGH 1VQOA 2JA7H 3GDEA 3G6EA 1WOCA 2V1CC 3DM3A 4BBSG 4YCWA 4DV2L 1QUQA 1YHQA 2OTLA 5LMUL 3KF6A 2HQLA 1X3FA 4DV4Q 1UWVA 4DNIA 4GNXA 1PV4A 1K8AC 4LF9L 2CFMA 1SRUA 2E2IH 2BH8A 2YYZA 2ALYB 3EIVA 2MO0A 3CCVA 1VS0A 2WAQG 5DLQE 4A3LG 2ZJQA 4A3MG 5GROA 1OXTA 5LMNL 2MNAA 2F4VL 1WJJA 2N3SA 3HOWG 5JJKA 2OWOA 2NVQH 3GTGH 1VQ7A 1GKHA 2ID0A 3OTOL 1KAWA 2IHFA 4JI3Q 1PH8A 1MKHA 2IX0A 2JK8A 4OWXB 2ZM6L 5FLXc 4JI2Q 4DV3L 3W5OA 4LF4Q 3CCUA 3CCJA 1QVFA 2VQFL 1Q81C 4YY3L 3S1MH 3M3YH 2LSSA 4A3FH 1N8RC 2JA9A 1KQSA 2VUMG 1SN8A 4NB3A 3H0GH 5GAEC 4BXXG 4DV1Q 1CKMA 4XIGS 1VQ6A 5BR8L 1LUZA 3M85A 1OXSC 2KHIA 4JOIA 4DPGA 3H3VH 1YZ6A 4GKKQ 1VQNA 4DR3Q 4QGUA 5IP9G 1G51A 4B3SQ 3TEHB 4BY1G 3PSIA 1RL2A 3K7UC 4MNOA 1Q12A 3UDIA 5GADC 3M4QA 4KHZA 2JA7G 4NXNQ 4A93H 1FVIA 3CQZH 5C0XJ 1L1OB 4DV0L 5K36G 4AYBG 2NVXH 3GO5A 1O7IA 4AIMA 3KJOA 2OTJA 1OXXK 4LUOA 1PA6A 1D7QA 1OXUA 4JBJA 1YI2A 4L5TA 1XTDA 2Z0SA 3K7AH 4JOIC 1XMOL 4JI1Q 1KD1C 1NMFA 2YTYA 2RHSB 4J15A 4DR7Q 1TWHH 1HZBA 4KHPQ 4HIMA 1S40A 1NY4A 4QY7A 4P75A 1Q82C 2A8VA 4C2MH 2E2HH 1IZ6A 2QGQA 4MZ9A 4RG1A 4JI2L 5ELNA 4QIWE 1L0WA 1MJCA 4R4OA 4LF4L 1VQHA 2RF4A 1UE7A 2VZAA 1E3PA 3HOXG 3PO2H 4A3FG 4DR7L 3K80C 1PH1A 3H0GG 4APVA 4JC0A 3HKSA 2RCNA 4JI6Q 2K52A 2JJQA 3PCOB 3W1GA 4GLVB 3KJPA 3JAMi 4HJ5A 1VQ8A 2DUDA 1X65A 5E7NA 1Q1BA 5HGQA 1VQKA 2E5LL 1X54A 3E9HA 3I7FA 3JAMc 3CD6A 3VDYA 4LF7Q 1AH9A 1PYSB 3U50C 1AE3A 3K0XA 1HNWL 4JYAL 3GD7A 4PZ6A 4X64Q 4DAMA 4A93G 4LF9Q 3PV0A 4NXNL 4LW1A 1RIPA 1VQ5A 1LYLA 2A1AA 1NE3A 4A3EH 1EOVA 3UE1A 2RHQB 1K8GA 3KYHC 3CPWA 3CCRA 4DR4L 1K73C 2VY3A 4R4TA 3I4MH 2IT1A 3HOUH 2F4VQ 1TWCH 4HJ9A 1GVPA 3STBD 2R7ZH 1EIYB 1M1KC 2NN6I 4IPDA 1E1TA 4IPCA 4JI1L 1HNXL 1VQCA 4IOAA 4JCVE 5IYCH 1XMQQ 4DV3Q 4UY8C 2YU9H 1Q7YC 2Q2UA 1UE1A 3GTQH 2VQFQ 4YY3Q 2EXDA 5AJ3L 2JEBI 4OWTB 3WWVA 1QZGA 3PF5A 3PO2G 4GKJQ 3T1HL 3CF5A 3CCEA 4JV5L 2JA6H 3CC4A 1I5FA 1W2BA 4JI6L 1SLJA 4DK6C 4JBMA 1JE5A 5JJIA 1L2FA 4A3BH 3OW2A 1MIUA 1Z9FA 1P16A 5IE8A 4HIDA 3RZDH 3TRZA 1N32Q 4A3JH 3CMAA 3E0EA 2IY5B 1LM0A 3CP0A 4QJFA 1HNZQ 1V9PA 1SFOH 3I4OA 2UUCL 3PUXA 4DV0Q 1VQDA 1HZCA 1SR3A 3RN2A 4GS3A 1JJ2A 4X64L 1ASYA 5ELOA 2FXQA 3TS0A 1B7YB 4IJHA 4A3EG 3HOYH 3HFZB 3KDFB 5GAHC 1XPOA 4A3CH 1XMOQ 1PH5A 3AQQA 2Q2TA 1VCIA 3ER0A 3I4MG 4A3IH 3HOUG 1S3OA 3E9IA 3CMEA 5J3BA 3CCSA 2B29A 3JC66 5HY6A 2WB1E 3BJUA 5C3EG 3Q8DA 1EQQA 2WAQE 5IY0A 5IYCG 2XTIA 1Q86C 1XMQL 1M90C 2PQAA 1ASZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y L;  3CPF A;  3F2D A;  1YIJ A;  2LXK A;  1XNQ L;  1VQE A;  3J81 j;  3ICE A;  3M4O H;  4L5Q A;  4GNX C;  2IHE A;  1KL9 A;  4P74 A;  4YWM A;  1HH2 P;  2AKW B;  3ULJ A;  3ZJY C;  5GAG C;  4X65 Q;  2UU9 Q;  3CCQ A;  3UDF A;  4H02 A;  4X66 Q;  1VQP A;  5JEA G;  1UE6 A;  5FJ8 H;  4GKJ L;  1PH6 A;  2JA6 G;  3PF4 A;  3CCL A;  2ATW A;  2E5L Q;  4A3D H;  4OO1 I;  1K3R A;  2Q2H A;  2K5V A;  1I6H H;  2I0Q A;  5M3F G;  4GOP A;  4QL5 A;  3F1Z A;  4PZ7 A;  1HNW Q;  4BY7 H;  4A3J G;  1N32 L;  4JYA Q;  1CUK A;  2EQS A;  2Q2I A;  3A5Z B;  1CKO A;  1HNZ L;  4DR1 Q;  4MTN A;  1N34 Q;  1CSP A;  2IX1 A;  2JEA I;  5IYB H;  3M4P A;  1VQ4 A;  1BBW A;  2WFW A;  3MXN B;  4DR4 Q;  2UXD Q;  4A3G H;  1PH3 A;  3HOY G;  1VQF A;  1I50 H;  4A3C G;  1U0L A;  3KLW A;  5IYD H;  1HNX Q;  1EIF A;  3B6Y A;  2A19 A;  3ERS X;  4AYB E;  5C44 H;  3HKZ E;  3PUY A;  2UUB Q;  4IFD I;  4DUZ Q;  1E22 A;  4A76 A;  4IO9 A;  1C9O A;  3OYY A;  2UUA L;  2KHJ A;  4C3I H;  4POG A;  1NTG A;  1CSQ A;  2R93 H;  2WP8 J;  1QVG A;  2PNH A;  5M5X H;  3TS2 A;  1OXV A;  3RLF A;  4DR2 Q;  2B63 H;  5AJ3 Q;  1P8L A;  2NN6 G;  5M5Y H;  2VQE L;  2YTV A;  4ALP A;  4OWW B;  2QA4 A;  3M9B A;  3AYH B;  1EFW A;  1XPU A;  3T1H Q;  4JV5 Q;  1I94 L;  4X65 L;  2UU9 L;  4X66 L;  1XNR Q;  3GTO H;  2K75 A;  2BA1 A;  2BA0 A;  1V43 A;  5IT9 c;  1N36 Q;  4K0K L;  3PIP A;  4WJ4 A;  2CCZ A;  3GTL H;  1WFQ A;  1WYD A;  3FHW A;  3AFQ A;  3L0O A;  1FJG L;  4A3D G;  4LFB L;  4QQB X;  1H95 A;  2Y0S E;  3AFP A;  2UUC Q;  4NXM Q;  3EN2 A;  3K81 C;  4PG3 A;  5IP7 H;  5M3M H;  1IBL L;  1WCM H;  1GO3 E;  4YWL A;  3H15 A;  4DR1 L;  3LGJ A;  3D31 A;  1N34 L;  2R92 H;  3S2H H;  1Y14 B;  2CWP A;  1R9T H;  5JEA J;  1QUQ B;  4DKA C;  4GLA C;  4PZ8 A;  4PMW A;  2Z6K A;  4HJA A;  2UXD L;  4GNX B;  1E1O A;  2AWN A;  3BZC A;  4JI7 L;  1KRT A;  1KIX A;  1KXL A;  5FLM H;  2N78 A;  4HJ8 A;  3NEN A;  5IYD G;  4YHH L;  5C44 G;  1LTL A;  3PUV A;  4L5R C;  2CQO A;  3GTK H;  2NVT H;  1JT8 A;  2UUB L;  3RR5 A;  5JJL A;  4DUZ L;  1TWF H;  4O2D A;  2AHO B;  3U4V A;  1HZ9 A;  2EIF A;  1BVS A;  3T1Y Q;  2ZTE A;  1Y1W H;  4UP8 A;  1VQM A;  1L1O A;  1CKN B;  1XNQ Q;  3RZO H;  4EQ5 A;  4BBS H;  4UP7 A;  4YWK A;  2YV5 A;  5IWA L;  2MO1 A;  4DR2 L;  3S1R H;  2B63 G;  3GTP H;  4X62 L;  1T9H A;  2I5L X;  4LF6 L;  2DGY A;  4JI5 L;  3AEV A;  1HJP A;  4LWC A;  4B3M Q;  4LFC L;  3A0J A;  4A3L H;  3S1Q H;  4Y52 H;  1G29 1;  2R6G A;  3RNU A;  1PH2 A;  3I4N H;  3L2P A;  2AMC B;  2MQH A;  3F8T A;  2HIX A;  1B8A A;  4KLK A;  2JA5 H;  1XNR L;  2K5H A;  2LXJ A;  1N36 L;  1YVC A;  3DLL A;  4JBW A;  5EAY A;  4AQY L;  1JJC B;  1PFS A;  4IJL A;  4A3K H;  2ZJP A;  2ES2 A;  3HOV H;  4DR5 L;  1X6O A;  2I5H A;  4YCU A;  1X9N A;  4NXM L;  5M3M G;  5IP7 G;  1X3E A;  4OO1 G;  3UDX A;  3H3V I;  2NZH A;  2BH2 A;  3D0F A;  1A62 A;  2F52 A;  1S72 A;  1VQB A;  4IPG A;  2HHH L;  1YBY A;  3J81 i;  1XPR A;  3PUZ A;  3PUW A;  1JB7 A;  3CCM A;  4JBK A;  4GN5 A;  2JE6 I;  2K4K A;  4TQU S;  4JI8 L;  3J81 c;  4DV7 Q;  4LF5 Q;  1D8L A;  2NVY H;  4RMF A;  2UUA Q;  2ASB A;  3GTJ H;  2R7Z G;  5GQO A;  1IYJ B;  1VQJ A;  1E7Z A;  2HIV A;  4OON A;  4WJ3 M;  1N9W A;  1IBM L;  3A5U A;  3J7Z C;  4O0A A;  2CKZ B;  1XJV A;  1K9M C;  4P72 A;  1Y1W G;  2VQE Q;  1VQL A;  1VQG A;  1VQA A;  4KI0 A;  1EUJ A;  4P73 A;  4GN4 B;  1I94 Q;  1J6Q A;  3L7Z C;  4R4I A;  1X56 A;  4IFD G;  1FGU A;  2GN5 A;  2CWA A;  2ZTD A;  2WB1 G;  3KF8 B;  4B3M L;  4LNQ A;  4DV6 Q;  1OTC A;  1I3Q H;  1IBK L;  1FL0 A;  1K83 H;  4XTC S;  3I4N G;  4K0K Q;  2KCM A;  3G48 A;  2JA5 G;  1FJG Q;  3RLO A;  3CXC A;  4LFB Q;  2I5M X;  2D0P A;  1Q8K A;  2F3I A;  1YJW A;  1EQR A;  1CKN A;  1J5E Q;  5C0X I;  4A3B G;  1YIT A;  3FP9 A;  1SE8 A;  3PGZ A;  4A3K G;  1IXR A;  1IBL Q;  4IOC A;  4B3R Q;  3HOV G;  3NEL A;  3RN5 A;  1JMC A;  1PH9 A;  3S15 H;  4POF A;  3HOX H;  1PH4 A;  4DUY Q;  4JI0 L;  2D0O A;  1C7Y A;  1TXY A;  1YJN A;  1PHJ A;  4BA2 I;  4JI7 Q;  2R7D A;  1UEB A;  4R1J A;  4Y7N H;  1EYG A;  4C3H H;  2D62 A;  4YHH Q;  1WI5 A;  2VS1 A;  1Y1V H;  4BBR H;  1QZH A;  1UE5 A;  4A3I G;  2YTX A;  2K50 A;  4DV7 L;  3F2B A;  4GLX A;  1HR0 W;  1KRS A;  3A74 A;  4LF5 L;  2UXB Q;  4GOP C;  4JI4 Q;  1G6P A;  2PI2 A;  2B3G A;  3BZK A;  5IWA Q;  4LUV A;  4X62 Q;  3S14 H;  4LF6 Q;  2K5N A;  1A8V A;  3KDF A;  3KOJ A;  4UP9 A;  5H1S E;  4GN3 B;  3FKI H;  1NJI C;  1VQ9 A;  4JI5 Q;  2UXC Q;  4DAY B;  1YHA A;  3HKZ G;  1YEZ A;  3IRB A;  4DV4 L;  4R4Q A;  3F2C A;  2PI2 E;  5M5W H;  4HJ7 A;  3U58 A;  1N33 Q;  1GM5 A;  2VNU D;  1NBW A;  1YJ9 A;  1IL2 A;  5FJ8 G;  4DV6 L;  1E24 A;  1NMG A;  3MEF A;  2K14 A;  2NZO A;  4AQY Q;  4EX5 A;  3NEM A;  1QVC A;  1K0R A;  1VQI A;  3CC2 A;  3KFU A;  2JA8 H;  4JI3 L;  4UPA A;  1J5E L;  4DR5 Q;  3TRE A;  1HR0 Q;  4BY7 G;  4DR6 Q;  1Z47 A;  5C4J H;  3S17 H;  4A4I A;  4B3R L;  4OX9 Q;  4ME3 A;  4IFD J;  5LMN W;  5IYB G;  4LFA Q;  4AH6 A;  2HHH Q;  2HT1 A;  3HOZ H;  2KEN A;  4DUY L;  2ZTC A;  3I2Z A;  4NPS A;  3S24 A;  3KF6 B;  4DV5 Q;  3PO3 H;  1MJE A;  2Y0S G;  4A3G G;  1DGS A;  1TWA H;  4JI8 Q;  3PIO A;  1YHB A;  4DV1 L;  3ULP A;  3SGI A;  1HZA A;  2QEX A;  2XGT A;  2VW9 A;  2E8G A;  4BA1 I;  1EWI A;  1Y1V G;  4BBR G;  4B3T Q;  4GKK L;  4LF8 Q;  4HIO A;  4DR3 L;  5C4X H;  2GVB A;  4LUZ A;  1IBM Q;  1AE2 A;  2UXB L;  1U5K A;  4JI4 L;  4LFC Q;  2R7F A;  4B3S L;  2R93 G;  4IPH A;  4DV2 Q;  3CW2 C;  5LMU Q;  2AWO A;  2MFI A;  1Q1E A;  2PQA B;  3S1N H;  1A0I A;  1V1Q A;  2UXC L;  1SMX A;  3FKI G;  1C0A A;  4A75 A;  2Z6K C;  3I56 A;  1PH7 A;  1IBK Q;  4A3M H;  4JG2 A;  5LMN Q;  3M7N A;  3S2D H;  3EBE A;  1N33 L;  3HOW H;  2OQ0 A;  3UE0 A;  3OTO Q;  2KBN A;  4OXP A;  4TVA B;  1PYB A;  2VL6 A;  3NBH B;  3TQY A;  5C3E H;  3G71 A;  1B70 B;  3GTM H;  1A63 A;  2ZM6 Q;  1JJG A;  1W3S A;  4KHP L;  3J7A 5;  3G4S A;  2JA8 G;  3STB C;  3BU2 A;  1L1O C;  3UDG A;  2OQK A;  4P71 A;  3J80 i;  4GOP B;  4DR6 L;  1HR0 L;  1BBU A;  3S16 H;  4DK3 C;  1PVO A;  4HIK A;  3U4Z A;  3CC7 A;  4JI0 Q;  1WCM G;  3J80 c;  2ZJR A;  1BKB A;  1X3G A;  2N8N A;  2H5X A;  2PMZ E;  4L5S A;  4OX9 L;  2R92 G;  2VUM H;  5C0X G;  4YCV A;  2KCT A;  4LFA L;  4BXX H;  2GVA A;  4X6A H;  2N49 A;  5BR8 Q;  4C3J H;  3HOZ G;  1YNX A;  3ULL A;  1KC8 C;  1X55 A;  1GD7 A;  3PO3 G;  2OCE A;  4DV5 L;  1SRO A;  2JQO A;  3CAM A;  1Q46 A;  5IP9 H;  3K8A A;  5FLM G;  5M3F H;  2C35 B;  3RLN A;  1KHI A;  4FDB A;  2E2J H;  4B3T L;  4BY1 H;  4LF8 L;  2L15 A;  3I55 A;  5C4X G;  3W1B A;  4LF7 L;  4R4C A;  1TWG H;  1VQO A;  2JA7 H;  3GDE A;  3G6E A;  1WOC A;  2V1C C;  3DM3 A;  4BBS G;  4YCW A;  4DV2 L;  1QUQ A;  1YHQ A;  2OTL A;  5LMU L;  3KF6 A;  2HQL A;  1X3F A;  4DV4 Q;  1UWV A;  4DNI A;  4GNX A;  1PV4 A;  1K8A C;  4LF9 L;  2CFM A;  1SRU A;  2E2I H;  2BH8 A;  2YYZ A;  2ALY B;  3EIV A;  2MO0 A;  3CCV A;  1VS0 A;  2WAQ G;  5DLQ E;  4A3L G;  2ZJQ A;  4A3M G;  5GRO A;  1OXT A;  5LMN L;  2MNA A;  2F4V L;  1WJJ A;  2N3S A;  3HOW G;  5JJK A;  2OWO A;  2NVQ H;  3GTG H;  1VQ7 A;  1GKH A;  2ID0 A;  3OTO L;  1KAW A;  2IHF A;  4JI3 Q;  1PH8 A;  1MKH A;  2IX0 A;  2JK8 A;  4OWX B;  2ZM6 L;  5FLX c;  4JI2 Q;  4DV3 L;  3W5O A;  4LF4 Q;  3CCU A;  3CCJ A;  1QVF A;  2VQF L;  1Q81 C;  4YY3 L;  3S1M H;  3M3Y H;  2LSS A;  4A3F H;  1N8R C;  2JA9 A;  1KQS A;  2VUM G;  1SN8 A;  4NB3 A;  3H0G H;  5GAE C;  4BXX G;  4DV1 Q;  1CKM A;  4XIG S;  1VQ6 A;  5BR8 L;  1LUZ A;  3M85 A;  1OXS C;  2KHI A;  4JOI A;  4DPG A;  3H3V H;  1YZ6 A;  4GKK Q;  1VQN A;  4DR3 Q;  4QGU A;  5IP9 G;  1G51 A;  4B3S Q;  3TEH B;  4BY1 G;  3PSI A;  1RL2 A;  3K7U C;  4MNO A;  1Q12 A;  3UDI A;  5GAD C;  3M4Q A;  4KHZ A;  2JA7 G;  4NXN Q;  4A93 H;  1FVI A;  3CQZ H;  5C0X J;  1L1O B;  4DV0 L;  5K36 G;  4AYB G;  2NVX H;  3GO5 A;  1O7I A;  4AIM A;  3KJO A;  2OTJ A;  1OXX K;  4LUO A;  1PA6 A;  1D7Q A;  1OXU A;  4JBJ A;  1YI2 A;  4L5T A;  1XTD A;  2Z0S A;  3K7A H;  4JOI C;  1XMO L;  4JI1 Q;  1KD1 C;  1NMF A;  2YTY A;  2RHS B;  4J15 A;  4DR7 Q;  1TWH H;  1HZB A;  4KHP Q;  4HIM A;  1S40 A;  1NY4 A;  4QY7 A;  4P75 A;  1Q82 C;  2A8V A;  4C2M H;  2E2H H;  1IZ6 A;  2QGQ A;  4MZ9 A;  4RG1 A;  4JI2 L;  5ELN A;  4QIW E;  1L0W A;  1MJC A;  4R4O A;  4LF4 L;  1VQH A;  2RF4 A;  1UE7 A;  2VZA A;  1E3P A;  3HOX G;  3PO2 H;  4A3F G;  4DR7 L;  3K80 C;  1PH1 A;  3H0G G;  4APV A;  4JC0 A;  3HKS A;  2RCN A;  4JI6 Q;  2K52 A;  2JJQ A;  3PCO B;  3W1G A;  4GLV B;  3KJP A;  3JAM i;  4HJ5 A;  1VQ8 A;  2DUD A;  1X65 A;  5E7N A;  1Q1B A;  5HGQ A;  1VQK A;  2E5L L;  1X54 A;  3E9H A;  3I7F A;  3JAM c;  3CD6 A;  3VDY A;  4LF7 Q;  1AH9 A;  1PYS B;  3U50 C;  1AE3 A;  3K0X A;  1HNW L;  4JYA L;  3GD7 A;  4PZ6 A;  4X64 Q;  4DAM A;  4A93 G;  4LF9 Q;  3PV0 A;  4NXN L;  4LW1 A;  1RIP A;  1VQ5 A;  1LYL A;  2A1A A;  1NE3 A;  4A3E H;  1EOV A;  3UE1 A;  2RHQ B;  1K8G A;  3KYH C;  3CPW A;  3CCR A;  4DR4 L;  1K73 C;  2VY3 A;  4R4T A;  3I4M H;  2IT1 A;  3HOU H;  2F4V Q;  1TWC H;  4HJ9 A;  1GVP A;  3STB D;  2R7Z H;  1EIY B;  1M1K C;  2NN6 I;  4IPD A;  1E1T A;  4IPC A;  4JI1 L;  1HNX L;  1VQC A;  4IOA A;  4JCV E;  5IYC H;  1XMQ Q;  4DV3 Q;  4UY8 C;  2YU9 H;  1Q7Y C;  2Q2U A;  1UE1 A;  3GTQ H;  2VQF Q;  4YY3 Q;  2EXD A;  5AJ3 L;  2JEB I;  4OWT B;  3WWV A;  1QZG A;  3PF5 A;  3PO2 G;  4GKJ Q;  3T1H L;  3CF5 A;  3CCE A;  4JV5 L;  2JA6 H;  3CC4 A;  1I5F A;  1W2B A;  4JI6 L;  1SLJ A;  4DK6 C;  4JBM A;  1JE5 A;  5JJI A;  1L2F A;  4A3B H;  3OW2 A;  1MIU A;  1Z9F A;  1P16 A;  5IE8 A;  4HID A;  3RZD H;  3TRZ A;  1N32 Q;  4A3J H;  3CMA A;  3E0E A;  2IY5 B;  1LM0 A;  3CP0 A;  4QJF A;  1HNZ Q;  1V9P A;  1SFO H;  3I4O A;  2UUC L;  3PUX A;  4DV0 Q;  1VQD A;  1HZC A;  1SR3 A;  3RN2 A;  4GS3 A;  1JJ2 A;  4X64 L;  1ASY A;  5ELO A;  2FXQ A;  3TS0 A;  1B7Y B;  4IJH A;  4A3E G;  3HOY H;  3HFZ B;  3KDF B;  5GAH C;  1XPO A;  4A3C H;  1XMO Q;  1PH5 A;  3AQQ A;  2Q2T A;  1VCI A;  3ER0 A;  3I4M G;  4A3I H;  3HOU G;  1S3O A;  3E9I A;  3CME A;  5J3B A;  3CCS A;  2B29 A;  3JC6 6;  5HY6 A;  2WB1 E;  3BJU A;  5C3E G;  3Q8D A;  1EQQ A;  2WAQ E;  5IY0 A;  5IYC G;  2XTI A;  1Q86 C;  1XMQ L;  1M90 C;  2PQA A;  1ASZ A; 
#chains in the Genus database with same CATH topology
 4LJZ C;  3K58 A;  2WAC A;  2NN6 H;  1VQE A;  4PNY A;  1MHW C;  3M4O H;  4L5Q A;  1LO5 D;  5GAG C;  3SHL A;  5K5P A;  2UU9 Q;  4WFN 3;  4XT3 B;  2PO4 A;  3DWQ A;  2ZXO A;  2ATW A;  1QNK A;  2NYZ D;  3NQI A;  4PZ7 A;  3M4Y A;  3D3R A;  1N32 L;  1CUK A;  2EQS A;  5EKK A;  3D8G A;  3FVQ A;  4DR1 Q;  4MTN A;  1TWH B;  4N9T A;  1N34 Q;  1CSP A;  5COY A;  1GUG A;  3MXN B;  2F0K A;  1PH3 A;  1BCP F;  3C2P A;  3HOY G;  2K1B A;  1HNX Q;  1CK1 A;  3B6Y A;  3VYR A;  2UUB Q;  3T53 B;  3VA7 A;  1PFN A;  2PNH A;  4TKO B;  1C48 A;  5M5X H;  2F0I A;  3PIO 3;  5I9P A;  5AJ3 Q;  1P8L A;  2NN6 G;  2VQE L;  2L1B A;  4RGT A;  1EFW A;  3RD4 A;  1I94 L;  3VYU A;  4X66 L;  5M9O A;  1BBX C;  1XNR Q;  2H4O A;  2K75 A;  4A3E B;  4K0K L;  1KLG D;  4K5V A;  4WJ4 A;  3PMF A;  1WFQ A;  1WYD A;  2F0F A;  5LL6 X;  5E3F A;  3P75 A;  1TWC B;  2A5H A;  1IYU A;  1TY0 A;  5M3M H;  2K03 A;  4OO1 H;  3GTK B;  1V1P B;  3GV6 A;  1ZKO A;  2LS0 1;  3D31 A;  2R92 H;  3S2H H;  2C9O A;  3BYY B;  1R9T H;  4KY5 A;  1ML0 D;  4DKA C;  4PMW A;  2Z6K A;  1STG A;  4GNX B;  1HCZ A;  4H0L C;  2EOT A;  4MN3 A;  2DY7 A;  2IJ0 A;  3NEN A;  4IUU A;  3Q0A A;  2K7V A;  2JA5 B;  2IX3 A;  1HZ9 A;  1VQM A;  1Y1W H;  4EQ5 A;  3S1R H;  2MO1 A;  4K6D A;  3A8J E;  4JI5 L;  2G9H D;  1HJP A;  1SFO B;  1R4Q B;  1B53 A;  4Y52 H;  1S5C D;  4ABN A;  3I4N H;  1S5E D;  4KLK A;  1A2T A;  3DHQ A;  2HDL A;  1N36 L;  1YVC A;  5EAY A;  4AQY L;  2ZJP A;  5EJW A;  2EYO A;  5M3M G;  3J7Y W;  4OO1 G;  3H3V I;  3GTP B;  3OMG A;  2BH2 A;  1BCP C;  1TY2 A;  1S72 A;  1VQB A;  4XQQ A;  1QIL A;  3M4O B;  1TS3 A;  2JE6 I;  4HAE A;  2K4K A;  4WRD A;  5COR A;  5D3D A;  2L0C A;  1JOK A;  2NVY H;  2F0L A;  2ASB A;  1F9S A;  1IYJ B;  1VQJ A;  5A2Q E;  4OON A;  1R4P B;  4G7O C;  4MTK A;  1XJV A;  1VQL A;  4P72 A;  1Y1W G;  1MGS A;  4BWG B;  5DNF A;  5FOB B;  3L7Z C;  4R4I A;  4S3S A;  2A6E D;  2ZTD A;  2FMC A;  1EZ6 A;  1IBK L;  5CV7 A;  1FL0 A;  1K83 H;  4XTC S;  5C5M A;  3I4N G;  2KCM A;  3G48 A;  4LFB Q;  2D0P A;  1CKN A;  1J5E Q;  4A3B G;  1B1Z A;  5A35 A;  3N6R A;  3PGZ A;  5D14 A;  3IKJ A;  4B3R Q;  4DGZ A;  3RN5 A;  3T16 A;  3IL8 A;  4POF A;  5M5X B;  1PHJ A;  2R7D A;  2F0U A;  5BN5 A;  4YHH Q;  2VS1 A;  4BBR H;  1RDP D;  1UE5 A;  5ELF A;  3VA5 A;  5CMD A;  2LY7 A;  4GOP C;  4FF1 A;  2B2Y C;  1G6P A;  5ELC A;  5IWA Q;  4LUV A;  2EDG A;  3FPU B;  1A8V A;  3KDF A;  2M00 A;  4GN3 B;  3HKZ G;  5EPL A;  4HJ7 A;  1VMC A;  2EY5 A;  1X3Q A;  1ZEQ X;  1NBW A;  1GHK A;  2R92 B;  2DNE A;  3S2H B;  5FJ8 G;  4DV6 L;  1R9T B;  4EX5 A;  3DEP A;  1VQI A;  4XQN A;  3KFU A;  2XWB B;  1F2Z A;  1JWU D;  3E0J A;  3T4A C;  5C4J H;  4FF3 A;  2XWJ B;  4CJ1 B;  5IGG A;  4OX9 Q;  5C0X H;  4LFA Q;  4U68 A;  4AH6 A;  3Q24 A;  1IKL A;  2RKS A;  3HOZ H;  1ICF B;  3PO3 H;  4A3G G;  1YHB A;  3ULP A;  3X3N A;  5I9O A;  1HZA A;  2AQ3 B;  2VW9 A;  3H3V C;  4BBR G;  3MXP A;  2MGS A;  4LF8 Q;  5C4X H;  1EWC A;  4LUZ A;  3I4N B;  1U5K A;  4IZ8 A;  3VYS A;  4JI4 L;  2R7F A;  4DV2 Q;  2MFI A;  1RTO A;  1Q1E A;  3S1N H;  2CW0 C;  2UXC L;  3I56 A;  3QG1 A;  3TSS A;  1N33 L;  3OTO Q;  3NPP A;  3MA2 B;  3RUZ A;  3TQY A;  1EY0 A;  3G4S A;  3STB C;  4K2K A;  4CGY B;  4JPB W;  2NVY B;  2WII B;  2BDO A;  2XSC A;  2HUG A;  3S16 H;  1EQV A;  3U4Z A;  2FHT A;  4JI0 Q;  2ZJR A;  3J80 c;  2N8N A;  4L5S A;  5C0X G;  4YCV A;  1QNU A;  5CBA E;  3HOZ G;  1AEX A;  1WTO A;  3PO3 G;  2R61 A;  4AYB B;  4DV5 L;  3AB9 A;  3HKZ B;  3CAM A;  2ICE C;  3K8A A;  2E2I B;  5C4X G;  1K83 B;  2SNM A;  3W1B A;  4LF7 L;  2LMC B;  2PQE A;  1DOL A;  3J81 E;  3GTG B;  1EZ8 A;  4BBS G;  2OTL A;  3NP8 A;  1QUQ A;  5LMU L;  5JPN C;  1UWV A;  4DNI A;  1ONL A;  2CFM A;  2BH8 A;  4QUF A;  4JK1 C;  3W2D A;  2F4V L;  4UHV A;  3JAM L;  1KAW A;  1PH8 A;  1STH A;  1PTO H;  2Z6B A;  4JI2 Q;  4BBR B;  1LTS D;  2PYK A;  1CI3 M;  2QF7 A;  4YY3 L;  2LSS A;  4KD3 A;  4HSP A;  3CHB D;  1AW7 A;  1SYE A;  3OIP A;  1VQ6 A;  1LUZ A;  3BDL A;  4ZQ3 A;  4JOI A;  1M4V A;  1YZ6 A;  4GKK Q;  4KKT A;  4XT1 B;  3I3C A;  4QF4 A;  1EYD A;  4UDU C;  1G51 A;  3TEH B;  4RCN A;  1SND A;  3MFY A;  4NXN Q;  1FVI A;  5C0X J;  1L1O B;  2NVX H;  3GO5 A;  1O7I A;  1OXX K;  4LUO A;  5C4J B;  1QG7 A;  2A69 D;  4ZCK A;  1XMO L;  1PTO D;  3HOZ B;  3PO3 B;  1HZB A;  1Y8P B;  3VYT A;  1LTT D;  2QCP X;  3MXG A;  1K8M A;  4R8N A;  4C2M H;  2E2H H;  4FO2 A;  4MZ9 A;  3I4L A;  3SK8 A;  1DXM A;  1L0W A;  4R4O A;  1H9S B;  1VQH A;  1E3P A;  3HOX G;  3PO2 H;  4GLV B;  3KJP A;  3DMU A;  2P5Z X;  1RCV D;  3E9H A;  5J1Z A;  1O7L A;  4L8J A;  3CD6 A;  3OHX C;  1PYS B;  2F0M A;  3A8K E;  3K0X A;  1U4L A;  3GD7 A;  3K5L A;  4LF9 Q;  1H9K A;  1JE4 A;  1LYL A;  5FO9 B;  3UE1 A;  3CPW A;  3S16 B;  3KLR A;  3CCR A;  4R9W A;  2B2V C;  2R7Z H;  4JI1 L;  1HNX L;  1VQC A;  1RTN A;  1DZ1 A;  2E76 C;  1U4P A;  5EGT A;  1FR3 A;  2A6H C;  4N8X 1;  1LAB A;  2X69 A;  2EXD A;  4ULL A;  4A3J B;  5AJ3 L;  1B3A A;  4OWT B;  1SSO A;  3PO2 G;  3CF5 A;  3CCE A;  3VR5 A;  1RJT A;  2JA6 H;  3NSW A;  1PDQ A;  1L2F A;  3MAQ A;  1MIU A;  1P16 A;  3RZD H;  2SDF A;  2V4D A;  3PUX A;  3BVM A;  4DV0 Q;  2SNS A;  3SK5 A;  3RN2 A;  1JJ2 A;  4HED A;  1PTO B;  3F2U A;  2BE5 D;  4A3C H;  1TII D;  3ER0 A;  2H1E A;  3HGB A;  4NMZ A;  4A3I H;  3CME A;  5KNB A;  3IAY A;  4C1N I;  1Q86 C;  1M90 C;  5IY0 A;  3K7A H;  4CJ0 B;  2PQA A;  1ASZ A;  2RDF A;  2ZXP A;  2IHE A;  2RSN A;  1HH2 P;  5CBE E;  4X65 Q;  4G57 A;  5EPK A;  5FLX E;  3CCQ A;  3UDF A;  1VQP A;  1HA5 A;  3NTK A;  1A3V A;  4CKE A;  1PH6 A;  2JA6 G;  3PF4 A;  1WTR A;  1LT4 D;  1SNP A;  2A6E C;  2Q2H A;  2MJ8 A;  1I6H H;  4GOP A;  2B2Y A;  3T13 A;  4QL5 A;  3F1Z A;  1HNW Q;  2AQ2 B;  1HNZ L;  4P2C B;  2IX1 A;  2B2U C;  1F2Y A;  3M4P A;  1MI2 A;  1VQ4 A;  4C2M B;  4DR4 Q;  1A6X A;  2M9V A;  3N52 A;  4IUV A;  1DOK A;  3EA6 A;  4RCO A;  5ISR A;  4A3C G;  1STY A;  2R3Z A;  3MXU A;  3R2T A;  4L63 B;  2A19 A;  5FO7 B;  4F7X A;  4IFD I;  4DUZ Q;  1S4Z A;  4POG A;  1NTG A;  4DK0 A;  1OXV A;  3RLF A;  4DR2 Q;  3CRK C;  2PMZ B;  4KV6 A;  1WTV A;  5M5Y H;  2YTV A;  2Q8I B;  4OWW B;  3M7G A;  3L9A X;  1XX8 A;  3VR2 A;  3M9B A;  3AYH B;  2CH4 W;  4J8Q A;  4DAP A;  1II3 A;  1ZXT A;  1X32 A;  5IT9 c;  1V43 A;  4LFB L;  3AFQ A;  4QQB X;  4ODG A;  3BG3 A;  3I73 A;  4DF7 A;  2Y0S E;  3AFP A;  4B08 A;  2B2T A;  4NXM Q;  2R7Z B;  3K81 C;  1A3U A;  4CDD C;  2A73 B;  4DNR B;  4PMB A;  5NUC A;  4ID6 A;  1AP0 A;  1SXT A;  2CWP A;  4R8I A;  3R93 A;  1U9R A;  3TP6 A;  4PZ8 A;  2UXD L;  1E1O A;  2AWN A;  3BZC A;  2QW7 A;  1KXL A;  2N78 A;  4YHH L;  3PUV A;  3GTK H;  2NVT H;  2JA6 B;  1BUV T;  2FMM A;  1LTB D;  5JJL A;  1X3P A;  1BVS A;  2QEJ C;  2ZTE A;  3E3X A;  1XNQ Q;  3RZO H;  5D65 A;  4YWK A;  2F0P A;  5G3L D;  5IWA L;  3RZD B;  2DGY A;  3AEV A;  4B3M Q;  2TSS A;  3J7A F;  1UNS A;  1PH2 A;  3L2P A;  2AMC B;  2JA5 H;  2HIX A;  2JYO A;  2EY2 A;  1Q3L A;  2K5Q A;  3E5S A;  1JJC B;  4IJL A;  4A3K H;  2KED A;  1DON A;  4A3I B;  3HOV H;  4N9P A;  1JOR A;  2Z4H A;  1LTI D;  4J6H A;  4FF2 A;  5DAU A;  1X3E A;  4I7A A;  3UDX A;  1GOZ A;  1HPC A;  3D0F A;  3K7A B;  1A62 A;  4IUT A;  2RQX A;  1EEI D;  3SVM A;  4OL7 A;  4FXG C;  3J81 c;  4B9X A;  4DV7 Q;  1BNZ A;  4LF5 Q;  2NZ1 D;  1CA6 A;  1E0B A;  1V1P A;  1WD0 A;  4WJ3 M;  1ICW A;  3A5U A;  4HCE A;  4OEM B;  4QIW B;  1STE A;  1K9M C;  1I6H B;  1AZQ A;  1VQA A;  2RDH A;  5JOB A;  2F0S A;  1G6Z A;  4GN4 B;  3NK9 A;  1QOH A;  3KF8 B;  1I3Q H;  5I4D A;  1YNN D;  2JA5 G;  5CYU A;  3RLO A;  1SBB B;  2I5M X;  2Y0S B;  1Q8K A;  2F3I A;  4KK7 A;  2FIN B;  4HR7 B;  3H6M A;  1EYA A;  3FP9 A;  4NDX A;  5CR3 A;  4A3K G;  2TMP A;  4IOC A;  2K01 A;  3HOV G;  2QDB A;  1KNE A;  3NEL A;  1J9O A;  4IUR A;  4DUY Q;  4JI0 L;  3TN2 A;  3BDC A;  1HFG A;  3MZ5 A;  4N8F A;  1QCB D;  2XNA C;  1B50 A;  4RHS A;  5M5Y B;  4Y7N H;  1UEB A;  4R1J A;  1RHP A;  4C3H H;  2D62 A;  1HQM C;  1WI5 A;  3FMC A;  3K6O A;  4K5W A;  3F2B A;  4GLX A;  1HR0 W;  1KRS A;  2UXB Q;  1SE4 A;  3ND9 A;  2B3G A;  3NE5 B;  4FF4 A;  1JOO A;  4X62 Q;  5KIX A;  3J80 L;  4LF6 Q;  2N55 A;  4UP9 A;  1VQ9 A;  1J8I A;  4DAY B;  3IRB A;  3U58 A;  4DFA A;  4I7Z C;  2VNU D;  1YJ9 A;  3QO2 A;  1E24 A;  1NMG A;  2ENB A;  4PV1 C;  3SEB A;  3NEM A;  1QVC A;  2L55 A;  3CC2 A;  2A69 C;  4OEL B;  1HR0 Q;  3WDN A;  3S17 H;  4F88 A;  2NVT B;  1PFM A;  4K8I A;  1EIH A;  3RZO B;  2L12 A;  1PZJ D;  1EFI D;  2AQ1 B;  1TR5 A;  1DGS A;  4JI8 Q;  3K57 A;  3SGI A;  2B2V A;  4CKB A;  1FGB D;  1LTR D;  4C3H G;  2E8G A;  1EY8 A;  4BA1 I;  4B3T Q;  2WAQ B;  4GKK L;  3SXH A;  1ESR A;  2GVB A;  1IBM Q;  1AE2 A;  3MWY W;  2K6A A;  3S9W A;  5AFW A;  2JP1 A;  4IPH A;  4XYQ A;  1GJX A;  2AWO A;  4RAU C;  4A3K B;  2IW3 A;  1A0I A;  1WTP A;  3HOV B;  2F0W A;  4A3M H;  2MHV A;  5CV8 A;  3HOW H;  2OQ0 A;  3VR3 A;  2KBN A;  4OXP A;  1PYB A;  3NTH A;  4ZUI A;  5C3E H;  3G71 A;  2Q8T A;  1CQF A;  3GTM H;  2ZM6 Q;  1SJE D;  3J7A 5;  4EVO A;  3BU2 A;  1NCV A;  3UDG A;  2FFK B;  4DR6 L;  1BBU A;  1PMR A;  1PZK D;  1IYV A;  4HIK A;  3URY A;  1DD2 A;  2VUM H;  2E74 C;  2R92 G;  1WTQ A;  3Q23 A;  4X6A H;  5BR8 Q;  5HGT A;  3ULL A;  4DK1 A;  1STN A;  1X55 A;  2OCE A;  2DN8 A;  1Y8N B;  5M3F H;  2K28 A;  3RLN A;  4FDB A;  4MHE A;  1I3Q B;  5LL6 S;  1RD9 D;  1C8C A;  3DM3 A;  4YCW A;  1YHQ A;  5K36 H;  2HQL A;  4DV4 Q;  1PV4 A;  1K8A C;  4LF9 L;  2E2I H;  2ALY B;  3EIV A;  2MO0 A;  3CCV A;  4X3S A;  4A3M G;  3M3Y B;  1OXT A;  5LMN L;  1W6J A;  2WV6 D;  2XRS D;  1WJJ A;  3HOW G;  3GTG H;  2ID0 A;  2BE5 C;  2JK8 A;  4Y7N B;  3G7L A;  4NKL A;  4C3H B;  5FLX c;  3A7L A;  2F0Q A;  2EXZ A;  4TSS A;  3W5O A;  5IGE A;  3CCJ A;  3GP7 A;  2B2U A;  2N88 A;  2VUM G;  3MHB A;  4DV1 Q;  1CKM A;  3D4W A;  4XIG S;  4KJN A;  2KHI A;  1H9M A;  2RA4 A;  4DR3 Q;  4DAV A;  4KJO A;  3BVZ A;  1FNW A;  3K7U C;  2D2C C;  2ZXR A;  3C3L A;  3M4Q A;  5I6Y A;  4A93 H;  1KLU D;  4DV0 L;  5K36 G;  4AYB G;  4AIM A;  2OTJ A;  3S17 B;  2CVR A;  1NMF A;  2QIL A;  2Z4I A;  4H13 C;  4Q5V A;  2EVB A;  1NY4 A;  4QY7 A;  1Q82 C;  3FPP A;  2A8V A;  3BVG A;  4RH6 A;  2QGQ A;  3E6Z X;  3MTS A;  5ELN A;  2Q8R E;  5T1I A;  4LF4 L;  2HQE A;  4HMJ A;  4OIJ A;  1UE7 A;  1PH1 A;  2A68 D;  3A7A B;  4JI6 Q;  1G91 A;  2RCN A;  5CV4 A;  4FP5 D;  2JJQ A;  3A54 A;  3JAM i;  4HJ5 A;  2DUD A;  1VQ8 A;  4O42 A;  1Q1B A;  1VQK A;  2AUK A;  4A3M B;  2RVL A;  1AH9 A;  3U50 C;  3HOW B;  1HNW L;  4ZYS A;  4UAI A;  2RSO A;  1G8Z D;  5C3E B;  4X64 Q;  3J7A V;  3HRZ C;  4KN4 C;  3GTM B;  4A93 G;  4H7B A;  1RIP A;  1F9R A;  2A1A A;  1D5M C;  1NE3 A;  5IGD A;  3EJI A;  1K8G A;  5I6W A;  4DR4 L;  2VY3 A;  4R4T A;  2JSO A;  3HOU H;  1BF4 A;  2DJG C;  1NR4 A;  4HJ9 A;  2VUM B;  3QB3 A;  4FXK C;  2NN6 I;  1E1T A;  4IPC A;  2O5J C;  4JCV E;  4KKS A;  5E4X A;  5IYC H;  1XMQ Q;  2YU9 H;  1UE1 A;  3GTQ H;  2VQF Q;  1TT2 A;  2EJM A;  5M3F B;  2F0V A;  1F9P A;  2NTT A;  1KAA A;  3OWF A;  1BOS A;  3Q22 A;  5KYL A;  3KBG A;  3OW2 A;  1ZYR D;  1FNV A;  3TRZ A;  1N32 Q;  4A3J H;  3CMA A;  3E0E A;  3HS0 C;  1LM0 A;  2B8G A;  1V9P A;  5JVH 3;  1VQD A;  1HZC A;  1SR3 A;  5ELO A;  3FEW X;  3TS0 A;  2A74 C;  1B7Y B;  4CDF C;  4OHJ A;  3KDF B;  2OEO A;  1PH5 A;  5IT9 L;  3AQQ A;  4KY7 A;  3HOU G;  1S3O A;  5DEH A;  2MUY A;  5J3B A;  2B29 A;  2WB1 E;  1SAP A;  3Q8D A;  5IYC G;  1KNA A;  3V05 A;  3WOF A;  3CPF A;  1JC7 A;  1EY7 A;  1EIG A;  2LXK A;  1XNQ L;  3ICE A;  4GNX C;  4YWM A;  4P74 A;  3SE0 A;  3ULJ A;  4DR7 Q;  1O7Y A;  4X66 Q;  2F0J A;  3D4D A;  4A93 B;  2XIW A;  2SOB A;  3NBH A;  5IGB A;  4GKJ L;  1E2Z A;  1NAP A;  3H91 A;  1WVL A;  2E5L Q;  4OO1 I;  1K3R A;  1BR9 A;  2I0Q A;  4BY7 H;  1YNN C;  4A3J G;  3A5Z B;  2Q2I A;  5BN3 A;  2KCN A;  1CKO A;  4KD4 A;  4KKU A;  5FO8 B;  5IYB H;  4E6I A;  1BBW A;  2IPK D;  1VQF A;  1KDC A;  1QB5 D;  1I50 H;  1AN8 A;  3KLW A;  5IYD H;  3ERS X;  3C46 A;  1SYB A;  5JVG 3;  1C9O A;  3OYY A;  4ILW A;  2KHJ A;  4C3I H;  3GTO B;  2KUM A;  1CSQ A;  2R93 H;  2WP8 J;  3NTI A;  5KRU A;  2F0G A;  4ZLT F;  2K32 A;  1LTG D;  3A8I E;  4KN7 C;  2QA4 A;  2BCO A;  3NUC A;  3T1H Q;  1CHP D;  4JV5 Q;  4KY6 A;  5DM7 3;  2UU9 L;  3EVQ A;  2BA1 A;  2BA0 A;  3J81 L;  1N36 Q;  1EWH A;  3OMC A;  3HOU B;  1I4R A;  2UUC Q;  3EN2 A;  4PG3 A;  3TP5 A;  5IP7 H;  3TP7 A;  1STB A;  4RFB A;  1WCM H;  1GO3 E;  1C4Q A;  3LGJ A;  4DR1 L;  1N34 L;  2PPB C;  2XN9 C;  3CU7 A;  3NXW A;  2YU9 B;  1QUQ B;  3GTQ B;  4GLA C;  1MBY A;  1VF7 A;  1KIX A;  5FLM H;  4HJ8 A;  5IYD G;  1LTL A;  4OIK A;  1JT8 A;  4V19 0;  2UUB L;  2AHO B;  3U4V A;  2EIF A;  4IAL A;  3HEJ A;  4C3I G;  3T1Y Q;  4UP8 A;  2E75 C;  3K5M A;  1JB3 A;  2J0T D;  1ENC A;  4DA2 A;  4UP7 A;  5ELB A;  4X62 L;  1T9H A;  2I5L X;  4RKB A;  4LF6 L;  1S5D D;  4LWC A;  1Q8I A;  3A0J A;  4A3L H;  1G29 1;  2NUC A;  3RNU A;  2NTS A;  2MQH A;  1XNR L;  1B8A A;  1HQR D;  4RGM A;  2LXJ A;  3DLL A;  1PFS A;  2F0T A;  2F0N A;  2ES2 A;  4FYD A;  1BQQ T;  4CBV A;  1X6O A;  2I5H A;  4YCU A;  4OGQ C;  5IP7 G;  3GTJ B;  5KGU A;  2J7Z A;  3OW7 A;  2F1M A;  5ELE A;  2NZH A;  2KA7 A;  2LKV A;  3CKI B;  4IPG A;  2PZT A;  1XPR A;  3PUW A;  1JB7 A;  4JBK A;  4JI8 L;  1D8L A;  2UUA Q;  2R7Z G;  4J1M A;  1XXG A;  3NQT A;  5GQO A;  1A15 A;  1SNQ A;  1N9W A;  1IBM L;  3U9S A;  3J7Z C;  4O0A A;  5IGC A;  2CKZ B;  4IQZ A;  1UUP A;  1VQG A;  4KI0 A;  1EUJ A;  4BY7 B;  3QR8 A;  1FGU A;  2CWA A;  4EQO A;  1KDB A;  2EY1 A;  4DV6 Q;  1W6K A;  5C3W A;  1TS2 A;  1FJG Q;  1CFM A;  1YJW A;  1K0S A;  5C0X I;  1I50 B;  2KQ3 A;  1SE8 A;  1IBL Q;  1Y1V B;  3C1F A;  1JMC A;  1EOT A;  1PH9 A;  5C5L A;  4C3I B;  1HRJ A;  1TQO A;  2R93 B;  2L5T A;  1C7Y A;  1TXY A;  1H9J A;  4DU9 A;  1K28 A;  4CDE C;  4JI7 Q;  1I4P A;  3FKI B;  1EYG A;  1HFN A;  1QZH A;  1O80 A;  4A3I G;  2YTX A;  2K50 A;  4JI4 Q;  1CZG A;  4BS9 A;  1G2T A;  1CQV A;  5C6A A;  1HUM A;  5I2Y A;  4CJ2 C;  1AZP A;  1O7Z A;  3S14 H;  3KOJ A;  2RCF A;  2UXC Q;  1NJI C;  1D5X C;  1D1K A;  1YHA A;  3NBI A;  3T56 B;  4DV4 L;  4LFC Q;  4R4Q A;  3FRP B;  5I2X A;  2IWH A;  1WCM B;  1WTW A;  1GM5 A;  1N33 Q;  1BCP B;  1IL2 A;  2EJF C;  3MEF A;  2K14 A;  3MVV A;  2NZO A;  1F2L A;  3I8Z A;  2QDL A;  1K0R A;  1TU2 B;  2JA8 H;  1SYC A;  3LWU A;  1J5E L;  4DR5 Q;  2E2D C;  3TRE A;  1DJR D;  1Z47 A;  2F4I A;  5EKL A;  4XQJ A;  3V96 A;  4B3R L;  2EE1 A;  4ME3 A;  3P1H A;  2EZV A;  1OO9 B;  5CV5 A;  2HHH Q;  2KEN A;  2CQA A;  2ZTC A;  3I2Z A;  4NPS A;  3S24 A;  3KF6 B;  4DV5 Q;  3LWE A;  1MJE A;  2VXW A;  2Y0S G;  3PIO A;  4DV1 L;  3DWA A;  4K8J A;  2QEX A;  2XGT A;  1EWI A;  2A68 C;  4FNF A;  4DR3 L;  5IIF A;  1A2U A;  4MIU A;  5FLX L;  3H94 A;  4O1N A;  3CW2 C;  4WOR A;  2KCC A;  5LMU Q;  3MXN A;  2PQA B;  1E2V A;  1U4M A;  1B2T A;  1I4G A;  2L4N A;  2O2L D;  1C0A A;  1B9M A;  3MC0 B;  1PH7 A;  3NHH A;  4JG2 A;  3S2D H;  3EBE A;  2KOL A;  4TVA B;  2B2W C;  4K6L A;  4C3J B;  1GUN A;  1NUC A;  1B70 B;  1HXY D;  1A63 A;  1JJG A;  1W3S A;  2JA8 G;  1L1O C;  4P71 A;  1IW7 D;  3J80 i;  4GOP B;  5EBD A;  1PVO A;  4DK3 C;  1PTO F;  4QB4 A;  2E2J B;  1TVX A;  3BS1 A;  4JW0 A;  4OX9 L;  2K05 A;  4LFA L;  4BXX H;  3NWT A;  1BDO A;  2JA7 B;  2N49 A;  1YNX A;  2O4X A;  1GD7 A;  2EYL A;  3R8B A;  3ND8 A;  3SK4 A;  2JQO A;  3J80 E;  1Q46 A;  2C35 B;  1KHI A;  4FXD A;  4BY1 H;  5C4H A;  4LF8 L;  3I55 A;  3I91 A;  1SE2 A;  1VQO A;  3GDE A;  3G6E A;  2NVQ B;  1K3B C;  1SMY D;  4DV2 L;  1ZYR C;  3DEO A;  4GNX A;  1T5E A;  1LAC A;  1SRU A;  4KHV A;  2YYZ A;  1VS0 A;  2WAQ G;  5DLQ E;  4F8M A;  3HP3 A;  3H0G B;  1GUO A;  3K59 A;  1VQ7 A;  3OTO L;  2EY6 A;  4JI3 Q;  1O78 A;  4XDX A;  1PRT D;  2IX0 A;  4OWX B;  1S5B D;  1XWE A;  4ZRZ A;  2Z9H A;  1QVF A;  2VQF L;  3M3Y H;  2JA9 A;  1SN8 A;  3P20 A;  1EU4 A;  4NB3 A;  5KYI A;  4BXX G;  3S14 B;  3CQZ B;  1B3Q A;  1I4X A;  4DPG A;  4C1N K;  2X6G A;  4QGU A;  5LHY 1;  1FD7 D;  1Z7T A;  1M8A A;  4B3S Q;  4BY1 G;  4FVM A;  1HUN A;  1KDA A;  2WKC A;  2MP1 A;  2JA8 B;  1HHV A;  4NP5 A;  3KJO A;  1PA6 A;  2HDM A;  2EYM A;  4EGV A;  1XTD A;  2Z0S A;  4JOI C;  4XXE A;  1ESF A;  4JI1 Q;  2G9D A;  5DM6 3;  3IFD A;  3CRL C;  4KHP Q;  3O13 A;  4X3K A;  4P75 A;  5J39 A;  1PTO C;  1IZ6 A;  4JI2 L;  3T51 B;  4DN4 M;  2RF4 A;  2VZA A;  3Q6S A;  1SNM A;  4DR7 L;  1GXD C;  4APV A;  1ENF A;  4JC0 A;  3DUZ A;  5KND A;  3PCO B;  4LK1 C;  4PMC A;  2OT2 A;  3BYT B;  1ROD A;  5E7N A;  1KTK A;  2E5L L;  1X54 A;  2WIN B;  5JPM C;  4EQN A;  3I4M B;  3S2D B;  4ZAI A;  2MPM A;  5J22 A;  1TS5 A;  4IUP A;  3PV0 A;  4NXN L;  4LW1 A;  3TZU A;  1VQ5 A;  1PRT B;  1Y69 U;  1K73 C;  1SE3 A;  1GVP A;  1EIY B;  2K33 A;  1M1K C;  2A6H D;  4IOA A;  3KLS X;  1LTA D;  2EJG C;  4DV3 Q;  4UY8 C;  4TRD A;  3D6W A;  3QJY A;  4BY1 B;  5CC4 A;  2JEB I;  3EFX D;  1VDZ A;  1QZG A;  5JEA H;  1IKM A;  3T1H L;  2F0H A;  4JV5 L;  3TP8 A;  1GHJ A;  2VB3 X;  1W2B A;  1SLJ A;  4DK6 C;  2HCC A;  1JE5 A;  3HOY B;  4A3B H;  4ZKB B;  3KBX A;  1Z9F A;  5IE8 A;  2Z1C A;  4K14 A;  4HID A;  2IY5 B;  5JAV A;  3X3M A;  3CP0 A;  1HNZ Q;  1SDF A;  2XVS A;  2UUC L;  2KVM A;  1STA A;  1ASY A;  2FXQ A;  1A3T A;  1ILQ A;  1VMP A;  4IJH A;  3HG9 A;  4IUQ A;  3HFZ B;  1XPO A;  2NWG A;  1JCK B;  1QE6 A;  4Z9C B;  1CM9 A;  2DJF C;  3BDO A;  1CT1 D;  3BJU A;  3HZX A;  1I4Q A;  2PZU A;  1YNJ D;  5C3E G;  1EQQ A;  1JIC A;  3R3O A;  4RGN A;  3T1Y L;  4LMQ D;  3F2D A;  1RKN A;  1YIJ A;  3J81 j;  5CV6 A;  3ZYY X;  4DXF A;  1MSG A;  1KL9 A;  2AKW B;  3ZJY C;  1EU3 A;  3MEH A;  4H02 A;  2X6L A;  5EQ0 A;  5JEA G;  1UE6 A;  2HCI A;  5FJ8 H;  3TDQ A;  2GA4 B;  2D5D A;  5G3L F;  1JWM D;  3CCL A;  3NWS A;  4A3D H;  1D2B A;  1EL0 A;  2K5V A;  5TSS A;  2J4X A;  4ZKC B;  5M3F G;  4JYA Q;  1ET9 A;  1JQY D;  5L37 A;  2JEA I;  3SK6 A;  2UXD Q;  2WFW A;  4A3G H;  4RA8 A;  1U0L A;  4G7Z C;  5IOC A;  1EIF A;  1SYG A;  4AYB E;  5C44 H;  1MSH A;  3HKZ E;  3PUY A;  2D9U A;  1E22 A;  4A76 A;  4IO9 A;  2UUA L;  5ELD A;  5CV9 A;  4RWS C;  1QVG A;  3ERO A;  3TS2 A;  2B63 H;  3WOE A;  4ALP A;  3TBI B;  3W3A A;  1XPU A;  4DNT B;  5M3M B;  1V8Q A;  1F9Q A;  4X65 L;  5A2Q L;  5KEE A;  3DWP A;  2HD3 A;  4JVZ A;  3KUP A;  3GTO H;  1EY9 A;  3PIP A;  2CCZ A;  3GTL H;  3KK7 A;  3D4R A;  5EBC A;  3FHW A;  1FJG L;  3L0O A;  4DXG A;  4A3D G;  2OF1 A;  1H95 A;  2CH4 A;  2EYH A;  2F0D A;  3VR6 A;  1MD2 D;  5IT9 E;  1IL8 A;  1IBL L;  1SYF A;  4B9W A;  5E4W C;  4YWL A;  3H15 A;  3PQI A;  1Y14 B;  3JAM E;  1BXT A;  1Y1W B;  1PRT F;  5JEA J;  4HJA A;  3S1R B;  1L0Y B;  4JI7 L;  1KRT A;  4GZY C;  2PW7 A;  2RBM A;  2B2W A;  5C44 G;  4L5R C;  2CQO A;  3RR5 A;  4DUZ L;  1TWF H;  4O2D A;  2B2T C;  1L1O A;  1CKN B;  4X3T A;  2XRQ D;  4BBS H;  4A3B B;  2YV5 A;  4F87 A;  2B63 G;  4DR2 L;  4CKC A;  4IFD H;  2QKI C;  1JOQ A;  2C5C A;  4LFC L;  3S1Q H;  2R6G A;  1DCZ A;  5F2D A;  1EY4 A;  3UI2 A;  3F8T A;  1QJO A;  2K5H A;  4ZK9 B;  3LNN A;  4JBW A;  1H9S A;  4DR5 L;  1X9N A;  4NXM L;  3A55 A;  3SR1 A;  1E2W A;  2VB2 X;  3I90 A;  1U4R A;  4M1U B;  4HTH A;  2F52 A;  1IW7 C;  2HHH L;  1YBY A;  3J81 i;  3PUZ A;  1WTH A;  1DM0 B;  3VR4 A;  4GN5 A;  3CCM A;  1XYI A;  1D6E C;  4TQU S;  3I72 A;  4RMF A;  4X3U A;  3GTJ H;  2G5D A;  1E7Z A;  1PXU A;  2HIV A;  2F0O A;  1HTL D;  4A3D B;  2VQE Q;  4P73 A;  2L9H A;  4IFD G;  1I94 Q;  1J6Q A;  1EY6 A;  1X56 A;  3MFG A;  2GN5 A;  1SMY C;  1G2S A;  1SJH D;  2WB1 G;  4LNQ A;  4B3M L;  2PZW A;  2F03 A;  1OTC A;  4K2L A;  3OPO A;  4K0K Q;  2ZT9 C;  2ICI A;  3CXC A;  4A3G B;  1EQR A;  3L3O C;  1YIT A;  1HA6 A;  1IXR A;  1B9N A;  5C44 B;  5IGF A;  1AFP A;  3I70 A;  1PRT C;  3HOX H;  3S15 H;  1PH4 A;  2D0O A;  4KTA A;  1YJN A;  3DXJ C;  1CZW A;  1SEB D;  2B63 B;  4BA2 I;  5D3I B;  1FNU A;  3QIA A;  1B4O A;  1PZI D;  1Y1V H;  4DV7 L;  1S5F D;  3A74 A;  4LF5 L;  4HCS A;  1GUS A;  1EYC A;  4PQX A;  3OOC A;  5C3X A;  2PI2 A;  3GTL B;  3BZK A;  4QUC A;  3FDT A;  3P7J A;  2EPB A;  2K5N A;  4JI5 Q;  5H1S E;  1DYQ A;  3FKI H;  5EKI A;  3PIP 3;  2F3W A;  4EQP A;  1YEZ A;  3K5N A;  4ME5 A;  3F2C A;  2K04 A;  1F77 A;  2KEC A;  2PI2 E;  5M5W H;  1D5Z C;  1ILP A;  3V2T A;  3TZD A;  3OIQ A;  4AQY Q;  1LV9 A;  2OXP A;  2EYF A;  4JI3 L;  4UPA A;  4DR6 Q;  4BY7 G;  2B8F A;  4KMU C;  5BN4 A;  4A4I A;  4QMG A;  5C4X B;  4IFD J;  5LMN W;  1TWF B;  5IYB G;  4XYO A;  2HT1 A;  4DUY L;  4BBS B;  1TWA H;  1TS4 A;  1T5X D;  3S1N B;  1DOM A;  1UAP A;  2KJX A;  3K5O A;  2WB1 B;  1Y1V G;  1LT6 D;  3R2I A;  4HIO A;  4HN7 A;  3S1Q B;  2UXB L;  1LT3 D;  4B3S L;  3KLS A;  2R93 G;  1TKW B;  2BOS A;  1V1Q A;  1SMX A;  3FKI G;  4A75 A;  2Z6K C;  1IBK Q;  3A56 A;  5LMN Q;  3M7N A;  3UE0 A;  2BDN A;  4RGO S;  3NBH B;  2VL6 A;  1SNC A;  4KHP L;  1BCP D;  2DNC A;  2K5D A;  5T1G A;  2OQK A;  1HR0 L;  1PLF A;  3CC7 A;  1WCM G;  1BKB A;  1X3G A;  2H5X A;  2PMZ E;  1NSN S;  2KCT A;  2GVA A;  4C3J H;  2CHB D;  1KC8 C;  1ENA A;  1L0X B;  3QOJ A;  4CHT B;  4YIJ A;  1WTX A;  1SRO A;  1ET6 A;  4G7H C;  2JXM B;  5IP9 H;  1B44 D;  5FLM G;  1CTM A;  2E2J H;  4B3T L;  2L15 A;  3ITP A;  4R4C A;  1TWG H;  2EYJ A;  2JA7 H;  1RF2 D;  1WOC A;  2V1C C;  5C4Z A;  2PNR C;  3KF6 A;  3TME A;  1X3F A;  4IUN A;  1SYD A;  3U9O A;  3EQL C;  4V0B A;  4RKL A;  5HUR A;  1XTC D;  4QCL A;  1I4H A;  4A3L G;  2ZJQ A;  3S15 B;  3HOX B;  5GRO A;  3OSO A;  2MNA A;  1H9R A;  5JJK A;  1D1I A;  2N3S A;  5CGK A;  2OWO A;  2NVQ H;  1LLR D;  1GKH A;  2IHF A;  1MKH A;  4L6T B;  3G6J B;  2ZM6 L;  1QWY A;  4DV3 L;  1BO0 A;  4LF4 Q;  3CCU A;  1NNX A;  1Q81 C;  2WKD A;  1YNJ C;  4LAA A;  3S1M H;  2LFN A;  4A3F H;  4RHR A;  3LX0 A;  4M8A A;  1N8R C;  1KQS A;  5GAE C;  3H0G H;  2PCF B;  4IN3 A;  4C3J G;  5BR8 L;  3M85 A;  1OXS C;  3H3V H;  2NVX B;  1VQN A;  5M5W B;  5IP9 G;  1F2M A;  3ERQ A;  4ZUJ A;  1KAB A;  3PSI A;  1RL2 A;  1SNO A;  4MNO A;  1Q12 A;  3UDI A;  5GAD C;  2JN4 A;  4KHZ A;  2JA7 G;  2DY8 A;  5JJZ A;  3CQZ H;  4C56 C;  1EY5 A;  2E2H B;  2L11 A;  1D7Q A;  4U67 3;  1OXU A;  4JBJ A;  1YI2 A;  4L5T A;  3DM1 A;  1VF5 C;  1EEF D;  4NW2 A;  1KD1 C;  2RDG A;  3PO2 B;  2YTY A;  2RHS B;  4J15 A;  4Q0F A;  1TWH H;  3C1E A;  1HTP A;  4HIM A;  1S40 A;  1WD1 A;  1TWA B;  3H09 A;  1EQT A;  2PW5 A;  3AU7 A;  4RG1 A;  1Q90 A;  4QIW E;  1MJC A;  3KF8 A;  1NR2 A;  3RMH A;  2F3V A;  4A3F G;  1Y8O B;  3K0Y A;  3K80 C;  3H0G G;  2F0E A;  3OWE B;  1LT5 D;  3HKS A;  2K52 A;  3W1G A;  5IOD A;  2AUJ D;  1X65 A;  2Z8L A;  5HGQ A;  3I7F A;  3JAM c;  3VDY A;  4LF7 Q;  1JWS D;  1AE3 A;  2CW0 D;  2IL8 A;  2M2L A;  1CA5 A;  4JYA L;  4PZ6 A;  3AMU A;  4DAM A;  1UEA B;  2B39 A;  4A3E H;  3GQB A;  1EOV A;  2RHQ B;  2FJ2 A;  1PFB A;  2NB0 A;  3KYH C;  3ONA B;  3BZD B;  4H44 C;  1IHZ A;  3I4M H;  2IT1 A;  3QOL A;  2F4V Q;  1TWC H;  2KHS A;  3STB D;  1GUT A;  1K8O A;  4IPD A;  5EPJ A;  2SEB D;  3IFT A;  1PYW D;  1JR0 D;  1Q7Y C;  2O5I C;  2Q2U A;  5FKA C;  4DAY A;  4YY3 Q;  4WJW A;  5E1F A;  5FK9 C;  1CHQ D;  1TWG B;  3WWV A;  2NBF A;  3PF5 A;  4GKJ Q;  1V1O A;  3CC4 A;  4CDC C;  1I5F A;  4JI6 L;  1I6V C;  4JBM A;  5JJI A;  3D6C A;  3GV3 A;  4QJF A;  2K5W A;  4I65 A;  1SFO H;  3I4O A;  4K5X A;  1FYC A;  4GS3 A;  4X64 L;  4G4K A;  2EYP A;  4HMI A;  4HSV A;  2KEE A;  4A3E G;  3HOY H;  5KNC A;  5GAH C;  3SDZ A;  3QWN A;  1XMO Q;  2I07 B;  1VCI A;  2Q2T A;  3S1M B;  3I4M G;  4A3F B;  3E9I A;  2I46 A;  1GUW A;  3CCS A;  3JC6 6;  5HY6 A;  3GTP H;  2WAQ E;  2XTI A;  1XMQ L;  1Z6H A; 
#chains in the Genus database with same CATH homology
 3T1Y L;  3CPF A;  3F2D A;  1YIJ A;  2LXK A;  1XNQ L;  1VQE A;  3J81 j;  3ICE A;  3M4O H;  4L5Q A;  4GNX C;  2IHE A;  1KL9 A;  4P74 A;  4YWM A;  1HH2 P;  2AKW B;  3ULJ A;  3ZJY C;  5GAG C;  4X65 Q;  2UU9 Q;  3CCQ A;  3UDF A;  4H02 A;  4X66 Q;  1VQP A;  5JEA G;  1UE6 A;  5FJ8 H;  4GKJ L;  1PH6 A;  2JA6 G;  3PF4 A;  3CCL A;  2ATW A;  2E5L Q;  4A3D H;  4OO1 I;  1K3R A;  2Q2H A;  2K5V A;  1I6H H;  2I0Q A;  5M3F G;  4GOP A;  4QL5 A;  3F1Z A;  4PZ7 A;  1HNW Q;  4BY7 H;  4A3J G;  1N32 L;  4JYA Q;  1CUK A;  2EQS A;  2Q2I A;  3A5Z B;  1CKO A;  1HNZ L;  4DR1 Q;  4MTN A;  1N34 Q;  1CSP A;  2IX1 A;  2JEA I;  5IYB H;  3M4P A;  1VQ4 A;  1BBW A;  2WFW A;  3MXN B;  4DR4 Q;  2UXD Q;  4A3G H;  1PH3 A;  3HOY G;  1VQF A;  1I50 H;  4A3C G;  1U0L A;  3KLW A;  5IYD H;  1HNX Q;  1EIF A;  3B6Y A;  2A19 A;  3ERS X;  4AYB E;  5C44 H;  3HKZ E;  3PUY A;  2UUB Q;  4IFD I;  4DUZ Q;  1E22 A;  4A76 A;  4IO9 A;  1C9O A;  3OYY A;  2UUA L;  2KHJ A;  4C3I H;  4POG A;  1NTG A;  1CSQ A;  2R93 H;  2WP8 J;  1QVG A;  2PNH A;  5M5X H;  3TS2 A;  1OXV A;  3RLF A;  4DR2 Q;  2B63 H;  5AJ3 Q;  1P8L A;  2NN6 G;  5M5Y H;  2VQE L;  2YTV A;  4ALP A;  4OWW B;  2QA4 A;  3M9B A;  3AYH B;  1EFW A;  1XPU A;  3T1H Q;  4JV5 Q;  1I94 L;  4X65 L;  2UU9 L;  4X66 L;  1XNR Q;  3GTO H;  2K75 A;  2BA1 A;  2BA0 A;  1V43 A;  5IT9 c;  1N36 Q;  4K0K L;  3PIP A;  4WJ4 A;  2CCZ A;  3GTL H;  1WFQ A;  1WYD A;  3FHW A;  3AFQ A;  3L0O A;  1FJG L;  4A3D G;  4LFB L;  4QQB X;  1H95 A;  2Y0S E;  3AFP A;  2UUC Q;  4NXM Q;  3EN2 A;  3K81 C;  4PG3 A;  5IP7 H;  5M3M H;  1IBL L;  1WCM H;  1GO3 E;  4YWL A;  3H15 A;  4DR1 L;  3LGJ A;  3D31 A;  1N34 L;  2R92 H;  3S2H H;  1Y14 B;  2CWP A;  1R9T H;  5JEA J;  1QUQ B;  4DKA C;  4GLA C;  4PZ8 A;  4PMW A;  2Z6K A;  4HJA A;  2UXD L;  4GNX B;  1E1O A;  2AWN A;  3BZC A;  4JI7 L;  1KRT A;  1KIX A;  1KXL A;  5FLM H;  2N78 A;  4HJ8 A;  3NEN A;  5IYD G;  4YHH L;  5C44 G;  1LTL A;  3PUV A;  4L5R C;  2CQO A;  3GTK H;  2NVT H;  1JT8 A;  2UUB L;  3RR5 A;  5JJL A;  4DUZ L;  1TWF H;  4O2D A;  2AHO B;  3U4V A;  1HZ9 A;  2EIF A;  1BVS A;  3T1Y Q;  2ZTE A;  1Y1W H;  4UP8 A;  1VQM A;  1L1O A;  1CKN B;  1XNQ Q;  3RZO H;  4EQ5 A;  4BBS H;  4UP7 A;  4YWK A;  2YV5 A;  5IWA L;  2MO1 A;  4DR2 L;  3S1R H;  2B63 G;  3GTP H;  4X62 L;  1T9H A;  2I5L X;  4LF6 L;  2DGY A;  4JI5 L;  3AEV A;  1HJP A;  4LWC A;  4B3M Q;  4LFC L;  3A0J A;  4A3L H;  3S1Q H;  4Y52 H;  1G29 1;  2R6G A;  3RNU A;  1PH2 A;  3I4N H;  3L2P A;  2AMC B;  2MQH A;  3F8T A;  2HIX A;  1B8A A;  4KLK A;  2JA5 H;  1XNR L;  2K5H A;  2LXJ A;  1N36 L;  1YVC A;  3DLL A;  4JBW A;  5EAY A;  4AQY L;  1JJC B;  1PFS A;  4IJL A;  4A3K H;  2ZJP A;  2ES2 A;  3HOV H;  4DR5 L;  1X6O A;  2I5H A;  4YCU A;  1X9N A;  4NXM L;  5M3M G;  5IP7 G;  1X3E A;  4OO1 G;  3UDX A;  3H3V I;  2NZH A;  2BH2 A;  3D0F A;  1A62 A;  2F52 A;  1S72 A;  1VQB A;  4IPG A;  2HHH L;  1YBY A;  3J81 i;  1XPR A;  3PUZ A;  3PUW A;  1JB7 A;  3CCM A;  4JBK A;  4GN5 A;  2JE6 I;  2K4K A;  4TQU S;  4JI8 L;  3J81 c;  4DV7 Q;  4LF5 Q;  1D8L A;  2NVY H;  4RMF A;  2UUA Q;  2ASB A;  3GTJ H;  2R7Z G;  5GQO A;  1IYJ B;  1VQJ A;  1E7Z A;  2HIV A;  4OON A;  4WJ3 M;  1N9W A;  1IBM L;  3A5U A;  3J7Z C;  4O0A A;  2CKZ B;  1XJV A;  1K9M C;  4P72 A;  1Y1W G;  2VQE Q;  1VQL A;  1VQG A;  1VQA A;  4KI0 A;  1EUJ A;  4P73 A;  4GN4 B;  1I94 Q;  1J6Q A;  3L7Z C;  4R4I A;  1X56 A;  4IFD G;  1FGU A;  2GN5 A;  2CWA A;  2ZTD A;  2WB1 G;  3KF8 B;  4B3M L;  4LNQ A;  4DV6 Q;  1OTC A;  1I3Q H;  1IBK L;  1FL0 A;  1K83 H;  4XTC S;  3I4N G;  4K0K Q;  2KCM A;  3G48 A;  2JA5 G;  1FJG Q;  3RLO A;  3CXC A;  4LFB Q;  2I5M X;  2D0P A;  1Q8K A;  2F3I A;  1YJW A;  1EQR A;  1CKN A;  1J5E Q;  5C0X I;  4A3B G;  1YIT A;  3FP9 A;  1SE8 A;  3PGZ A;  4A3K G;  1IXR A;  1IBL Q;  4IOC A;  4B3R Q;  3HOV G;  3NEL A;  3RN5 A;  1JMC A;  1PH9 A;  3S15 H;  4POF A;  3HOX H;  1PH4 A;  4DUY Q;  4JI0 L;  2D0O A;  1C7Y A;  1TXY A;  1YJN A;  1PHJ A;  4BA2 I;  4JI7 Q;  2R7D A;  1UEB A;  4R1J A;  4Y7N H;  1EYG A;  4C3H H;  2D62 A;  4YHH Q;  1WI5 A;  2VS1 A;  1Y1V H;  4BBR H;  1QZH A;  1UE5 A;  4A3I G;  2YTX A;  2K50 A;  4DV7 L;  3F2B A;  4GLX A;  1HR0 W;  1KRS A;  3A74 A;  4LF5 L;  2UXB Q;  4GOP C;  4JI4 Q;  1G6P A;  2PI2 A;  2B3G A;  3BZK A;  5IWA Q;  4LUV A;  4X62 Q;  3S14 H;  4LF6 Q;  2K5N A;  1A8V A;  3KDF A;  3KOJ A;  4UP9 A;  5H1S E;  4GN3 B;  3FKI H;  1NJI C;  1VQ9 A;  4JI5 Q;  2UXC Q;  4DAY B;  1YHA A;  3HKZ G;  1YEZ A;  3IRB A;  4DV4 L;  4R4Q A;  3F2C A;  2PI2 E;  5M5W H;  4HJ7 A;  3U58 A;  1N33 Q;  1GM5 A;  2VNU D;  1NBW A;  1YJ9 A;  1IL2 A;  5FJ8 G;  4DV6 L;  1E24 A;  1NMG A;  3MEF A;  2K14 A;  2NZO A;  4AQY Q;  4EX5 A;  3NEM A;  1QVC A;  1K0R A;  1VQI A;  3CC2 A;  3KFU A;  2JA8 H;  4JI3 L;  4UPA A;  1J5E L;  4DR5 Q;  3TRE A;  1HR0 Q;  4BY7 G;  4DR6 Q;  1Z47 A;  5C4J H;  3S17 H;  4A4I A;  4B3R L;  4OX9 Q;  4ME3 A;  4IFD J;  5LMN W;  5IYB G;  4LFA Q;  4AH6 A;  2HHH Q;  2HT1 A;  3HOZ H;  2KEN A;  4DUY L;  2ZTC A;  3I2Z A;  4NPS A;  3S24 A;  3KF6 B;  4DV5 Q;  3PO3 H;  1MJE A;  2Y0S G;  4A3G G;  1DGS A;  1TWA H;  4JI8 Q;  3PIO A;  1YHB A;  4DV1 L;  3ULP A;  3SGI A;  1HZA A;  2QEX A;  2XGT A;  2VW9 A;  2E8G A;  4BA1 I;  1EWI A;  1Y1V G;  4BBR G;  4B3T Q;  4GKK L;  4LF8 Q;  4HIO A;  4DR3 L;  5C4X H;  2GVB A;  4LUZ A;  1IBM Q;  1AE2 A;  2UXB L;  1U5K A;  4JI4 L;  4LFC Q;  2R7F A;  4B3S L;  2R93 G;  4IPH A;  4DV2 Q;  3CW2 C;  5LMU Q;  2AWO A;  2MFI A;  1Q1E A;  2PQA B;  3S1N H;  1A0I A;  1V1Q A;  2UXC L;  1SMX A;  3FKI G;  1C0A A;  4A75 A;  2Z6K C;  3I56 A;  1PH7 A;  1IBK Q;  4A3M H;  4JG2 A;  5LMN Q;  3M7N A;  3S2D H;  3EBE A;  1N33 L;  3HOW H;  2OQ0 A;  3UE0 A;  3OTO Q;  2KBN A;  4OXP A;  4TVA B;  1PYB A;  2VL6 A;  3NBH B;  3TQY A;  5C3E H;  3G71 A;  1B70 B;  3GTM H;  1A63 A;  2ZM6 Q;  1JJG A;  1W3S A;  4KHP L;  3J7A 5;  3G4S A;  2JA8 G;  3STB C;  3BU2 A;  1L1O C;  3UDG A;  2OQK A;  4P71 A;  3J80 i;  4GOP B;  4DR6 L;  1HR0 L;  1BBU A;  3S16 H;  4DK3 C;  1PVO A;  4HIK A;  3U4Z A;  3CC7 A;  4JI0 Q;  1WCM G;  3J80 c;  2ZJR A;  1BKB A;  1X3G A;  2N8N A;  2H5X A;  2PMZ E;  4L5S A;  4OX9 L;  2R92 G;  2VUM H;  5C0X G;  4YCV A;  2KCT A;  4LFA L;  4BXX H;  2GVA A;  4X6A H;  2N49 A;  5BR8 Q;  4C3J H;  3HOZ G;  1YNX A;  3ULL A;  1KC8 C;  1X55 A;  1GD7 A;  3PO3 G;  2OCE A;  4DV5 L;  1SRO A;  2JQO A;  3CAM A;  1Q46 A;  5IP9 H;  3K8A A;  5FLM G;  5M3F H;  2C35 B;  3RLN A;  1KHI A;  4FDB A;  2E2J H;  4B3T L;  4BY1 H;  4LF8 L;  2L15 A;  3I55 A;  5C4X G;  3W1B A;  4LF7 L;  4R4C A;  1TWG H;  1VQO A;  2JA7 H;  3GDE A;  3G6E A;  1WOC A;  2V1C C;  3DM3 A;  4BBS G;  4YCW A;  4DV2 L;  1QUQ A;  1YHQ A;  2OTL A;  5LMU L;  3KF6 A;  2HQL A;  1X3F A;  4DV4 Q;  1UWV A;  4DNI A;  4GNX A;  1PV4 A;  1K8A C;  4LF9 L;  2CFM A;  1SRU A;  2E2I H;  2BH8 A;  2YYZ A;  2ALY B;  3EIV A;  2MO0 A;  3CCV A;  1VS0 A;  2WAQ G;  5DLQ E;  4A3L G;  2ZJQ A;  4A3M G;  5GRO A;  1OXT A;  5LMN L;  2MNA A;  2F4V L;  1WJJ A;  2N3S A;  3HOW G;  5JJK A;  2OWO A;  2NVQ H;  3GTG H;  1VQ7 A;  1GKH A;  2ID0 A;  3OTO L;  1KAW A;  2IHF A;  4JI3 Q;  1PH8 A;  1MKH A;  2IX0 A;  2JK8 A;  4OWX B;  2ZM6 L;  5FLX c;  4JI2 Q;  4DV3 L;  3W5O A;  4LF4 Q;  3CCU A;  3CCJ A;  1QVF A;  2VQF L;  1Q81 C;  4YY3 L;  3S1M H;  3M3Y H;  2LSS A;  4A3F H;  1N8R C;  2JA9 A;  1KQS A;  2VUM G;  1SN8 A;  4NB3 A;  3H0G H;  5GAE C;  4BXX G;  4DV1 Q;  1CKM A;  4XIG S;  1VQ6 A;  5BR8 L;  1LUZ A;  3M85 A;  1OXS C;  2KHI A;  4JOI A;  4DPG A;  3H3V H;  1YZ6 A;  4GKK Q;  1VQN A;  4DR3 Q;  4QGU A;  5IP9 G;  1G51 A;  4B3S Q;  3TEH B;  4BY1 G;  3PSI A;  1RL2 A;  3K7U C;  4MNO A;  1Q12 A;  3UDI A;  5GAD C;  3M4Q A;  4KHZ A;  2JA7 G;  4NXN Q;  4A93 H;  1FVI A;  3CQZ H;  5C0X J;  1L1O B;  4DV0 L;  5K36 G;  4AYB G;  2NVX H;  3GO5 A;  1O7I A;  4AIM A;  3KJO A;  2OTJ A;  1OXX K;  4LUO A;  1PA6 A;  1D7Q A;  1OXU A;  4JBJ A;  1YI2 A;  4L5T A;  1XTD A;  2Z0S A;  3K7A H;  4JOI C;  1XMO L;  4JI1 Q;  1KD1 C;  1NMF A;  2YTY A;  2RHS B;  4J15 A;  4DR7 Q;  1TWH H;  1HZB A;  4KHP Q;  4HIM A;  1S40 A;  1NY4 A;  4QY7 A;  4P75 A;  1Q82 C;  2A8V A;  4C2M H;  2E2H H;  1IZ6 A;  2QGQ A;  4MZ9 A;  4RG1 A;  4JI2 L;  5ELN A;  4QIW E;  1L0W A;  1MJC A;  4R4O A;  4LF4 L;  1VQH A;  2RF4 A;  1UE7 A;  2VZA A;  1E3P A;  3HOX G;  3PO2 H;  4A3F G;  4DR7 L;  3K80 C;  1PH1 A;  3H0G G;  4APV A;  4JC0 A;  3HKS A;  2RCN A;  4JI6 Q;  2K52 A;  2JJQ A;  3PCO B;  3W1G A;  4GLV B;  3KJP A;  3JAM i;  4HJ5 A;  1VQ8 A;  2DUD A;  1X65 A;  5E7N A;  1Q1B A;  5HGQ A;  1VQK A;  2E5L L;  1X54 A;  3E9H A;  3I7F A;  3JAM c;  3CD6 A;  3VDY A;  4LF7 Q;  1AH9 A;  1PYS B;  3U50 C;  1AE3 A;  3K0X A;  1HNW L;  4JYA L;  3GD7 A;  4PZ6 A;  4X64 Q;  4DAM A;  4A93 G;  4LF9 Q;  3PV0 A;  4NXN L;  4LW1 A;  1RIP A;  1VQ5 A;  1LYL A;  2A1A A;  1NE3 A;  4A3E H;  1EOV A;  3UE1 A;  2RHQ B;  1K8G A;  3KYH C;  3CPW A;  3CCR A;  4DR4 L;  1K73 C;  2VY3 A;  4R4T A;  3I4M H;  2IT1 A;  3HOU H;  2F4V Q;  1TWC H;  4HJ9 A;  1GVP A;  3STB D;  2R7Z H;  1EIY B;  1M1K C;  2NN6 I;  4IPD A;  1E1T A;  4IPC A;  4JI1 L;  1HNX L;  1VQC A;  4IOA A;  4JCV E;  5IYC H;  1XMQ Q;  4DV3 Q;  4UY8 C;  2YU9 H;  1Q7Y C;  2Q2U A;  1UE1 A;  3GTQ H;  2VQF Q;  4YY3 Q;  2EXD A;  5AJ3 L;  2JEB I;  4OWT B;  3WWV A;  1QZG A;  3PF5 A;  3PO2 G;  4GKJ Q;  3T1H L;  3CF5 A;  3CCE A;  4JV5 L;  2JA6 H;  3CC4 A;  1I5F A;  1W2B A;  4JI6 L;  1SLJ A;  4DK6 C;  4JBM A;  1JE5 A;  5JJI A;  1L2F A;  4A3B H;  3OW2 A;  1MIU A;  1Z9F A;  1P16 A;  5IE8 A;  4HID A;  3RZD H;  3TRZ A;  1N32 Q;  4A3J H;  3CMA A;  3E0E A;  2IY5 B;  1LM0 A;  3CP0 A;  4QJF A;  1HNZ Q;  1V9P A;  1SFO H;  3I4O A;  2UUC L;  3PUX A;  4DV0 Q;  1VQD A;  1HZC A;  1SR3 A;  3RN2 A;  4GS3 A;  1JJ2 A;  4X64 L;  1ASY A;  5ELO A;  2FXQ A;  3TS0 A;  1B7Y B;  4IJH A;  4A3E G;  3HOY H;  3HFZ B;  3KDF B;  5GAH C;  1XPO A;  4A3C H;  1XMO Q;  1PH5 A;  3AQQ A;  2Q2T A;  1VCI A;  3ER0 A;  3I4M G;  4A3I H;  3HOU G;  1S3O A;  3E9I A;  3CME A;  5J3B A;  3CCS A;  2B29 A;  3JC6 6;  5HY6 A;  2WB1 E;  3BJU A;  5C3E G;  3Q8D A;  1EQQ A;  2WAQ E;  5IY0 A;  5IYC G;  2XTI A;  1Q86 C;  1XMQ L;  1M90 C;  2PQA A;  1ASZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...