3ULRB

Lysozyme contamination facilitates crystallization of a hetero-trimericcortactin:arg:lysozyme complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'PLGSSDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Lysozyme contamination facilitates crystallization of a heterotrimeric cortactin-Arg-lysozyme complex.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase, protein binding
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ulrB00
2FPEA 2K6DA 2C0OA 2ED1A 1QWFA 1YP5A 3QWYA 1UJ0A 1N5ZA 2KT8A 3EG3A 1GFCA 3ULRB 2RNAA 5GJWB 2DMOA 2GGRA 2KE9A 2DBKA 2LZ6B 4J9BA 1K0SA 2AKKA 1QCFA 1WLPB 2E5KA 2EGCA 2PZ1A 4KRTA 4F17A 1ZUKA 3REBB 2L0AA 3NGPA 2YT6A 4OMNA 2NUZA 2EVRA 1VYUA 2LJ3A 1MV0B 1T3LA 3VS5A 2JS2A 2KNBB 2KGTA 1KSWA 4EIKA 2OAWA 1UE9A 2L3QA 2L2PA 4J9FA 2KT1A 3REAB 1X6GA 1HSQA 2DBMA 1KFZA 2KBTA 1X2KA 1AWWA 1GRIA 2DM1A 1BB9A 3A98A 1U3OA 4AFUC 1RLPC 2LNHB 2I0NA 1JU5C 3VS2A 2JXBA 1OV3A 1PRLC 2DX1A 1OPLA 3QWXX 2A36A 1I07A 2CT3A 2MIOA 4E6RA 3UA6A 2H8HA 1SRMA 5IH2A 2CH4A 3C0CA 1WIEA 2F2VA 1UGVA 2K7AA 1ABOA 1JO8A 2HCKA 4J9CA 1WI7A 3VRZA 3VS6A 2DL4A 1EFNA 1QWEA 2GBQA 2PNIA 1UTIA 1K76A 2A37A 2DE0X 3VRYA 1TUCA 2D8JA 3EG2A 4IIOA 5IHNA 4AFQC 2J6KA 2MOXA 2GTJA 1SHFA 4CC3A 1T0HA 1T3SA 1RUWA 2SEMA 1WFWA 3EG0A 1B3QA 2KYMA 2JMAA 3UA7A 2HDAA 3LH5A 1BBZA 2EGAA 1Z9QA 2ABLA 1OOTA 2EYZA 5I22A 4LUEA 4AFSC 1J3TA 1VYVA 1HD3A 4HCKA 1AZGB 1U06A 1Z9ZA 2GQIA 2CREA 2HSPA 2ESWA 4RTTA 2DILA 2FRYA 2RMOA 1Y0MA 4LE9A 1SRLA 2LQWA 3I5SA 2ED0A 4F14A 2O31A 4D8DA 1AWXA 1KIKA 3O5ZA 2AZSA 2BTTA 2EQIA 2HEQA 1K0XA 2JMCA 1QLYA 1YWPA 2GNCA 2CDTA 1AD5A 4GBQA 4M4ZA 1VA7A 2KR3A 2W10A 1GFDA 1BU1A 1JQQA 4OMQA 4IIMA 2DNUA 2X3XD 1PRMC 1X27A 4RUGA 5FW9A 1ZUYA 4K11A 1AVZC 1CKBA 1UUEA 1RI9A 3TSWA 1XOVA 2DF6A 3U23A 4RTWA 2DYBA 2BZYA 2HBWA 3I5RA 1NYFA 4RTZA 1ZBJA 1IO6A 3SEMA 2V1RA 2VKNA 1UHCA 1AWJA 4Y92A 1ZUUA 2DL7A 2FO0A 2FRWA 2RN8A 4Z88A 2A28A 4J9IA 2JTEA 2JM9A 1LCKA 2KRSA 2EW3A 2JT4A 1MV3A 2EYYA 4CC4B 1ZX6A 2J6OA 2G6FX 1H92A 4LN2A 4RTVA 3KFVA 2DJQA 1AOJA 3VS7A 4CC7A 2FPFA 1JEGA 1WXTA 1NM7A 1QKWA 1E6HA 4ESRA 3VS3A 3VS4A 2K2MA 2K3BA 1S1NA 2AZVA 2D1XA 1I1JA 1GBRA 4Z89A 5IXBA 2F2WA 1KJWA 1M3CA 3I9QA 1UG1A 3PVLA 2ECZA 2LP5A 2YSQA 3M0TA 4JPBW 4QT7A 5FWCA 1Y57A 1OEBA 1ARKA 2DRKA 3H41A 4LUDA 1B07A 5I11A 2QDLA 2YUOA 3UATA 1UHFA 4LNPA 4JJBA 2O9VA 1X2QA 1YNZA 2EYXA 2LJ0A 4RTUA 2BZXA 1ZSGA 1NLOC 1BK2A 5IHKA 1A0NB 4OMOA 1AWOA 2O88A 1NEBA 2OJ2A 2C0IA 1CSKA 4DEXA 1CKAA 2J05A 3NMZC 4J9HA 1E6GA 3GBQA 1ZLMA 3RBBB 1SHGA 2ROLA 4JJDA 4HXJA 3PVQA 1HJDA 2O9SA 1W70A 1YWOA 2CSQA 2FEIA 2CSIA 4X1VA 4ORZA 1SPKA 1PHTA 3NHNA 3EHRA 2LX7A 1X6BA 1MUZA 1NG2A 5IXFA 1GBQA 2D0NA 1PWTA 3UF4A 4HVWA 1X69A 3FJ5A 1NLPC 3H0FA 2KXDA 3TVTA 1JXMA 1T0JA 2CUDA 2PTKA 5GJVB 1G83A 3ZL7C 2BZ8A 2K9GA 2RQWA 2KYBA 4Z8AA 2KRMA 5IHIA 4OMPA 2VVKA 4J9DA 1YCSB 2CUBA 2M51A 1W1FA 2KEAA 2KRNA 1OPKA 2CH4W 2YDLA 2IIMA 5HCKA 2JW4A 2AKLA 2RQUA 3M0SA 4GLMA 4WCIA 2ROTA 2DL3A 2DL8A 1SEMA 2CT4A 4D8KA 2C0TA 2YUQA 1ABQA 1UFFA 3H0IA 2RQRA 1WYXA 4JZ4A 2FG0A 4JZ3A 3M0UA 1K4US 2P4RA 1NEGA 1M3AA 1I0CA 4J9GA 3SHWA 4AG1C 1GCQC 3M0PA 1WXBA 2EYWA 4ZNXA 2NWMA 1PKTA 2J7IA 2DVJA 2LMJA 4FSSA 4HVVA 2DL5A 3R6NA 4CC2A 2LJ1A 2DRMA 4A63B 4OMLA 4AFZC 5FWBA 2FPDA 4JJCA 2K79A 2D8HA 1PKSA 2EKHA 2RQTA 4RTYA 5L23A 2AK5A 3VS0A 1NYGA 2O2OA 2LCSA 1M30A 1GCQA 3NPFA 2RF0A 2J06A 1FYNA 3EHQA 3RNJA 2YUPA 1G2BA 2MCNA 3TSZA 2ENMA 3JV3A 1H8KA 2RPNA 1FMKA 2B86A 2L3PA 2X3WD 4HVUA 1TUDA 5EC7A 2EPDA 1M8MA 2YUNA 1GCPA 1H3HA 1AZEA 1YN8A 1W6XA 2J6FA 1WDXA 1VYTA 1UECA 3THKA 1K1ZA 2EGEA 1E7OA 1AEYA 2W0ZA 1UJYA 1WX6A 1K9AA 1PNJA 1V1CA 2VWFA 2RQVA 4OMMA 3PE0A 3EG1A 3IQLA 1TG0A 3I35A 3CQTA 1UDLA 3EGUA 2M0YA 4R0KA 1SSHA 1M27C 2KXCA 4J9EA 2DA9A 3M0QA 2KROA 2EBPA 2JS0A 2L3SA 1WXUA 3M0RA 2XMFA 1GL5A 2A08A 3H0HA 4F16A 2GTOA 1WA7A 1X43A 2JM8A 4RTXA 1JXOA 2LQNA 2F2XA 4AG2C 1M3BA 4DEYA 5ECAA 1RLQC 1U5SA 2DLPA 2V1QA 2SRCA 1QKXA 3VS1A 2OI3A
chains in the Genus database with same CATH superfamily
2K6DA 2C0OA 4FT2A 1KD1R 1QWFA 1D09B 3QWYA 3EG3A 2KT8A 3CCUA 1D0XA 4Q5WA 2RNAA 4ELZC 3QJYA 4XTUA 5C0MA 4M7DG 1MNDA 3DB3A 4KRTA 1WLPB 2PZ1A 1WHKA 3SWNA 1TH7A 1NJIR 1N8RC 2OTJT 3QDFA 4M7DA 4FT4A 1M4ZA 2JS2A 1YI2T 3VUBA 3GLXA 2RHXA 4J9FA 3CBMA 4M7DF 4C92C 1OQKA 3CD6Q 4PFOA 1HSQA 2A0FB 1VQMQ 2O01E 4BI8B 2QQSA 4PNOA 3JB9J 2DEUA 1U3OA 3FC3A 1ZSZC 1TXQA 2BIVA 2LNHB 2K4YA 3L2UA 2JXBA 4DQ2A 2LRQA 3OW2S 1WJQA 2A36A 1I07A 2MIOA 3PIPA 2H8HA 1WIEA 2F2VA 3MJXA 1UGVA 1ABOA 1JO8A 4ZTFA 4BDYA 2GBQA 1QWEA 3CC2T 1UTIA 5CQYA 4M75G 2XD0A 4R56A 2ZGWA 4DOWA 1VIFA 5IHNA 2DXUA 2MK5A 1RUWA 2SEMA 4M75A 1B3QA 1O9SA 2HDAA 3LH5A 2KK4A 3R6OA 3CXCP 3MEVA 1WZOA 1J3TA 1VYVA 4M75F 1O75A 3I56T 1UGRB 2MAMA 2GQIA 4J6XA 4RTTA 2DILA 1EZZB 3HPWA 5LL6S 2E3IA 1YJNT 3OYEA 3DKMA 1N8RU 2QK0A 3CCSA 4DBFA 3VU3C 3OSVA 2CP6A 2LC4A 1QVGS 4KGXB 1IGQA 3MP6A 3PTAA 1KD1C 2YHTA 3FRNA 3ME9A 4M4ZA 2E6ZA 4EMKA 4OMQA 3H8ZA 2VGNA 3J81E 2IG0A 1X27A 4FW1A 1ZUYA 2VYTA 2JZ2A 4PJLA 3CPWA 1XOVA 4E7KA 1KQSA 4RTWA 1NJIC 1IB8A 1NYFA 2DPPB 2P84A 1LJOA 2V1RA 4MDXA 4EPCA 1VQ4Q 4J7IA 2DL7A 2FRWA 2AT1B 3EGDB 3CCLA 3J80E 2JTEA 3CCRQ 2Y90A 2PVGB 4C8QC 2EW3A 2MF2A 2JT4A 2B8AA 2EYYA 1BKBA 3AT1B 1RACB 2G6FX 4C5EA 3CMAQ 4LN2A 4LD6A 4M78D 5KH6A 2HZYA 4CC7A 3G7ZA 2FPFA 1YITQ 1JEGA 1JJ2S 4NL2A 4DOVA 3MEAA 3EFOB 1E6HA 3MPUB 3VS3A 3NFCA 2K2MA 2CZ1B 1PC0A 2D1XA 5GAMg 1U8RA 1VQ5T 1M1KR 2F2WA 2HL5C 3I9QA 5CO7A 4RMOA 2ECZA 3RR6A 2QGFB 4N4GA 2RHZA 4JPBW 3CC4T 4LD9K 2DRKA 2X51A 1OX9A 3H41A 4LUDA 3OYCA 5KYYB 1W2BP 1VQ9A 4JRPA 1KD1U 1TU0B 4XU2A 3UATA 4P5NA 4RG2A 4JDSA 4A4FA 2EJ9A 5GAOn 5J3BA 2LJ0A 3M54A 2EQKA 3ER0A 5IHKA 1BCOA 1A0NB 1AWOA 2O88A 1N9RA 2XU8A 1NJIU 3E19A 1YHQQ 2C0IA 4DEXA 4KGVB 4PJOG 2J05A 4J9HA 1KQ1A 3A8HB 5A2QE 2K57A 3FB9A 3CCVQ 4MDWA 4PJOA 1V76A 5GANg 2CSIA 1PSEA 5GAN5 1PHTA 2KQWA 1FMVA 1NG2A 1QCOA 4PJOF 5IXFA 2K2VA 4IUUA 4JUVA 2ZPFB 3FJ5A 1ZA1B 2KXDA 2KI7A 3O8VA 3TVTA 2M9UA 2DTHA 1JXMA 1FMWA 1RAEB 2BZ8A 1BIBA 2RQWA 3CC7A 3VJPA 5IHIA 3CMEQ 2RHUA 4M78G 1YCSB 5IAYA 2CUBA 8AT1B 3D7SB 3OBWA 4X9CA 3OYDA 3PMTA 4CRIA 4GLMA 3M0SA 1UEBA 3CCJQ 2YRCA 1SEMA 3OYHA 2KSSA 5LJ3e 4BUGA 4MZMA 2QEXQ 1UFFA 1X01A 5GMKj 4JZ4A 2DVEA 4XTZA 2FG0A 4JZ3A 1M1KC 1MHNA 4FW2A 1M3AA 1I0CA 3SHWA 3CCST 4X34A 1G3SA 4ME7A 3CXCS 1WXBA 3WVDB 1PKTA 2J7IA 2DVJA 4XTYA 1WHGA 4HVVA 3RKYA 5IN1A 4RCCA 4OMLA 4YTLA 1VQNA 4XAXB 2K79A 4M7AD 2WSEE 2VC8A 5KYNA 3DLMA 5LJ3f 3CCMQ 4EMKB 3JB9G 3SD4A 3VS0A 2EWNA 3QDRB 1OULA 4C92G 2KVQG 1XJWB 2RJFA 3EHQA 4FIBA 2X4JA 2YUPA 2HD0A 2V26A 1G2BA 4HA8A 2D6FA 1BCMA 2CYZB 1VQ7Q 3JV3A 4C92A 1H8KA 2RPNA 4BE2A 2B86A 4C8QD 4QVCA 5KYUB 1TUDA 2YUNA 3JB9F 5FROA 4OGEA 4C92F 1AZEA 1WDXA 3CCQA 1RI0A 1ACMB 1D3BB 2RB6A 2EGEA 3OA6A 4LDXA 2WSCE 3GPLA 1AEYA 1YI2A 1WX6A 4OMMA 1HK9A 3IQLA 1UDLA 3OW2P 1M1KU 2M0YA 1M27C 4J9EA 3GNGA 3QHSA 3UWNA 2KROA 3LYIA 1K73R 1JB0E 2L3SA 2XMFA 1F1BB 3A5ZB 2QQBA 2A08A 3H9NA 4M7DE 1X43A 1VQ9T 1Y71A 2OTLQ 2VB6A 3RMSA 4AG2C 2KDSA 2F69A 4BE0A 5GAN3 1R0BG 1QVFP 1IXDA 4JS4A 2VASA 3JCMc 3CC2A 2FPEA 4X9DA 2K5IA 2BUDA 5GJWB 5GAN6 3EFRA 2JJ9A 5KE3A 3LWIA 2KE9A 2LX9A 1FXXA 4O5VA 1K0SA 1QCFA 2E5KA 4C5HA 4F7UB 1ZUKA 1MMAA 2L0AA 3H6ZA 3NGPA 2L3RA 2DXTA 1VYUA 5CR2A 2KY9A 4M77D 2KNBB 2KGTA 3CCEA 1KSWA 4EIKA 1OU8A 2L2PA 2KT1A 1G3TA 5FLXE 4ELYC 3REAB 1VQKT 2A3LA 2V8IA 5HY6A 5CCAA 3OYNA 2DBMA 4M75E 3ZBDA 1AWWA 2RH2A 4C8QG 2DM1A 4RKUE 1BB9A 3L1AA 4QVZA 1SKUB 1RLPC 2DERA 5LJ3j 4ZTJA 2Y4XA 1QP3A 1YJNQ 1BI3A 1JU5C 1LOJA 1D0ZA 3CC7T 1VQ6T 1HXDA 4PJMA 1OV3A 1PRLC 3QWXX 4E6RA 3JCMd 5M9OA 5LJ5d 5GMKm 2JUFA 2Y4YA 1LNXA 1WQWA 2HCKA 3OMCA 1WI7A 3VRZA 1YJWQ 2DL4A 1EFNA 2PNIA 3OSSC 4ANJA 1EX4A 3LGFA 4NL3A 2DE0X 3EG2A 3EGDA 4IIOA 2RK1A 3A8GB 4M78B 2GTJA 1SHFA 1T0HA 2HNIA 3QBYA 3L2ZA 5EG2A 2KYMA 1BBZA 2ABLA 1OOTA 1C6VX 2EIFA 4N4HA 4LUEA 4AFSC 2DYIA 1D0YA 1RAFB 4HCKA 4HCZA 1K73C 1U06A 1Z9ZA 1PSFA 3EFOA 2FZGB 1Y0MA 2LT4A 1SRLA 1Q95G 4E7SA 2D9TA 1RAHB 1AWXA 1FX7A 4JS5A 2JMCA 1QLYA 2GFAA 2GNCA 4C0GA 1AD5A 4GBQA 5KYYA 1VQPT 4Y28E 1VA7A 2ZCFB 2KR3A 2DD5A 2YWWA 1GFDA 3MP8A 1JQQA 3META 2DNUA 2X3XD 2QASA 3M4YA 1GXIE 4OF1A 4RUGA 1AVZC 1UUEA 1C1AA 2X4WA 3S6WA 2PU9B 2CGHA 3I5RA 3CC4Q 2LCLA 2HQEA 4J83A 4C92B 2VKNA 3RIRA 3RMQA 1RAAB 1ZUUA 3MP1A 2E1HA 1K8AR 3CCQT 2RN8A 4J9IA 2DIQA 3CCUQ 4BI4A 1ZSZB 3MEUA 3JSCA 4CC4B 2QYZA 1AOJA 5HK3A 4F04B 1G3YA 1YBYA 3CD6A 4J6YA 2L5QA 3M58A 1VQMA 3M59A 3JRZA 1K73U 1RAGB 4LDYA 4XU0A 3EG9B 4EMGA 1S1NA 2AZVA 3URGA 1I1JA 4Z89A 1KJWA 1M3CA 2YLCA 1M2VB 3JCMX 2QA4Q 4E7ZA 1SSFA 2YSQA 5GAN4 4QT7A 8ATCB 1KC8R 1Y57A 1ARKA 3C94A 3CXCA 1B07A 2QDLA 3PT9A 4PJOE 2YUOA 5D7UA 5DM7R 3HSBA 2O9VA 3V7CA 1XTDA 2DTIA 3RERA 1YNZA 3TQ7P 5LJ3h 4RTUA 1QVFS 5J26A 2PVDB 1ZSGA 3G4ST 2JOYA 3G71T 4OB0B 1VUBA 4ZGDB 2QDYB 2NUPB 4PFPA 1NPPA 1M90R 1CSKA 1C0MA 5FRNA 3CCET 4E2FB 3NMZC 2LT1A 2JTFA 3VUZA 2ROLA 1UGQB 2ZPIB 3A8OB 2EJFA 4M7AB 1W70A 2CSQA 2FZKB 3MKDA 4X1VA 4ORZA 1XQHA 1MNEA 1X6BA 1X75C 1MUZA 4HVWA 1X69A 4N0AC 3CCSQ 2XIDA 2WACA 3T9NA 2DETA 4M7AC 5J39A 2CUDA 3JCMV 5CVIA 5DY9A 3S3MA 2XHCA 4C8QB 4BB7A 1DJ7B 1K8AC 4A4GA 4OMPA 4C0ZA 5CK9A 4J9DA 1NE8A 2KEAA 4N4IA 2ZZDA 1OPKA 5KYUA 2CH4W 5HCKA 2RI2A 2JW4A 2AKLA 2RQUA 4WCIA 2ROTA 4JJNK 2DL8A 2WSFE 2CT4A 2EQUA 3CCRA 3NTKA 1D3BA 4QW2A 2HKNA 5FU6B 3H0IA 1OU9A 1JBMA 2RQRA 5GMKl 1WYXA 3MCAB 4J8OA 3CMAA 3CCLQ 3GNFB 1OZ3A 4FYXB 1Q7YR 4J9GA 1W2BA 4KT0E 1GCQC 4A4KA 3E1SA 1YITA 2EYWA 2RHIA 2NWMA 4C92E 2EYQA 3HFNA 1KC8C 4Y91A 3CPWP 2LMJA 2VV5A 4FSSA 3I55Q 2RK2A 5FU6C 3R6NA 2RO0A 4GLKA 4CC2A 2ZPHB 4FL6A 1VQLQ 2E70A 4FM4B 4DBQA 2X9HA 4C0DC 1S72A 2D8HA 1U1SA 4B9WA 1OZ2A 4FYYB 2P0KA 1PKSA 4ZGEB 2FVUA 2RQTA 3OYMA 1NYGA 2MYSA 2LCSA 5AT1B 4L5GA 1ZQ1A 3GOXA 2J06A 1I81A 4F7UG 3RNJA 3VKIA 2JNGA 1D1BA 3PNWC 7AT1B 1K8AU 2RJCA 3M55A 4M77B 4F7UA 2HKQB 3JCMg 5LJ5g 1H3HA 2J6FA 1W6XA 1IGUA 2DZCA 2E64A 4F7UF 1H641 3TU4K 1M5Q1 1QVPA 1R77A 3S3OA 5CKDA 4LDWA 1E7OA 2W0ZA 3CD6T 4QKUA 1VQMT 3KXTA 1V1CA 2VWFA 4M77C 3JCMQ 3EG1A 3HRTA 5GAMe 1KHIA 3L42A 4VUBA 2A7YA 2BE9B 2RM4A 2DKGA 2PUOB 1VQKA 4R0KA 5GAOp 2P0PA 1M8VA 1ZA2B 1M1GA 2DA9A 3FIFA 2JS0A 3PFSA 1PM3A 4MMLA 2HQXA 1KC8U 3BFMA 1GL5A 1VQ6A 3H0HA 1RL2A 1QQJA 4BD3A 4J5YA 3SWNC 3CBOA 3OYYA 3CMEA 3C95A 4JRIA 5ECAA 3JCMP 1U5SA 4C5IA 2DLPA 3BDLA 1Y7XA 4FYWB 2SRCA 4QQ6A 2OI3A 4M78A 3AHUA 2ED1A 3QG1A 1N5ZA 2E4HA 5GAMf 1GFCA 1Q7YC 3ULRB 2GGRA 3N5BB 3JCMe 2LZ6B 4M78F 5LJ5e 3RKXA 5CKEA 4J9BA 1RADB 2CS7A 3EGXA 3REBB 1PD1A 4QQGA 1N27A 3P8DA 1YIJA 3QJ6A 5DLQE 2P4TA 5GANe 2E12A 1T3LA 3VS5A 2VGMA 3MHXA 1RABB 1Y96B 2OAWA 4JLIA 4PK4A 2M16A 4OB2B 4D6WA 1VQOA 3BW1A 1VIEA 3FDRA 4BE1A 3VYHB 3X25B 4HT8A 1X2KA 3UPUA 2GF7A 4A4EA 1GRIA 3QO3A 3HHTB 3A98A 3ZFJA 2I0NA 2AHJB 3VS2A 1B7TA 4M75C 4DBHA 2KAFA 1VQPA 1OPLA 2FB7A 1VQNQ 3UA6A 1YFNA 1HYOA 5IH2A 3OYLA 2EQJA 1QMCA 3C0CA 5GANf 1VQ4T 3VS6A 2COYA 2A37A 3OW2A 1FWZA 2D8JA 3L2RA 3CCRT 4AFQC 2MOXA 4CC3A 1ZSZA 1T3SA 1WFWA 2EKOA 3JB9I 3CMAT 2CP3A 2JMAA 3UA7A 2C06A 2EGAA 1Z9QA 2IVWA 1I5LA 1Q7YU 2E10A 1YITT 3EFSA 3UT1A 3CCQQ 2CREA 3GF5A 2ESWA 3LH0A 2RMOA 4LE9A 2OTJQ 3EG9A 4F14A 2O31A 2YLBA 3RDVA 2LQKA 1YI2Q 3C4SA 1M2VA 3V7SA 1KIKA 1S72T 3O5ZA 4FYVB 3M4GA 2BTTA 2EQIA 2HEQA 3CPWS 1K0XA 1YWPA 3HP9A 1KQSS 2R58A 3HRUA 2V8JA 2CDTA 3M56A 3QZ5B 4FU6A 2W10A 2OTLA 2PVOB 5FW9A 4K11A 1CKBA 1QVGA 4WTOB 2DF6A 5KYWB 5GMKi 2HBWA 2OAUA 3CPFA 2NUPA 1YHQT 1ZBJA 3S3NA 3G4SA 4M7AG 2ZPEB 3G71A 3CC2Q 2FO0A 2DJZA 4Z88A 2A28A 2JM9A 3P8BB 3QPHA 2GCXA 6AT1B 1WJSA 2RA2A 4M7AA 1ZX6A 4PKCC 2J6OA 4RTVA 3KFVA 3VS7A 4KBMB 1IHWA 4M7AF 2M0OA 4QVDA 3EH1A 3I56Q 5I2SA 1WXTA 2RJDA 1YJ9A 3FEOA 4KH0B 4A4HA 4ESRA 5GAOr 3LLRA 2HL3A 2V8KA 5IXBA 1MGQA 2DXBA 1UG1A 4C8QA 2MPXC 1WJRA 2MWOA 2LP5A 3CMET 4DA4A 4M7DD 2Z0WA 4L59A 3E9GA 3M0TA 1JJ2A 2L89A 4KUIA 4IKFA 4C8QF 1WHMA 2NYSA 1UHFA 1QW1A 4JJBA 1YJWA 1X2QA 5LJ3d 3JCMJ 1X6OA 2YXYA 3CCJT 4L6V5 1M9SA 1G8XA 1UB4A 3X26B 4E47A 1Q82R 1SF9A 2L8DA 1AT1B 2F5KA 3OQ5A 2VXFA 2LVMA 1YIJT 2OJ2A 3EGXB 2IPOB 1G5VA 1N9SA 1N6AA 1Y07A 3G6EA 3BDUA 2I2LA 3GBQA 1ZLMA 1SHGA 1VQOT 3G1JA 4HXJA 3PVQA 3LWHA 3LX7A 4ZN1A 2YRDA 1BI1A 4II1A 5CAIA 3OS5A 2LCCA 1SPKA 4OB1B 4QQDA 2LX7A 4Z02A 4M75D 1OI1A 3QYGB 5CKHA 3HRSA 2JVVA 1BYMA 1GBQA 2EQMA 1PWTA 3CCMT 3UDCA 3H0FA 1VQ8A 5GAN7 1VQ5Q 2E3HA 2K9GA 4M77G 3TEEA 4KH1B 2KYBA 4HCBA 5L8RE 2KRMA 4CI0C 4JRKA 2VVKA 4IURA 2E5QA 2E65A 2BKDN 2QQ9A 4J7FA 1W1FA 4M77A 2YDLA 3OYAA 2CZ0B 4IUPA 3QXEB 3QSUA 4PLLA 4M77F 2E6NA 4XU3A 4PL6A 2XDPA 4D8KA 2C0TA 2YUQA 1ABQA 3RKWA 4B6MA 5GAMh 2DZ9A 1NEGA 4C0FA 3OBYA 4ZNXA 2FL7A 5FU7B 2XI9A 2HQHA 3J7AF 3KUFA 4F7UE 3L2WA 1VOMA 2G3RA 1TTHB 2QAZA 2LJ1A 4A63B 5IT9E 2OTLT 3Q1JA 3C12A 5FWBA 2FPDA 3RESA 4JJCA 2QA4A 2LTOA 3JAME 5I21A 1Q82C 2EKHA 2K3XA 5FU7C 5L23A 2AK5A 5FRMA 2O2OA 5CIUA 2CP5A 1M30A 2P0QA 2RF0A 1FYNA 5I2MA 4FSXA 4OMFB 3JCMh 5LJ5h 3OS2A 1FMKA 1NBEB 1R8OB 4HVUA 5DLOA 2EPDA 1M8MA 2O4XB 5GANh 1YN8A 1NZ9A 1KK7A 1VYTA 1UECA 1Y96A 3THKA 1K1ZA 1QCNA 2NUTB 3INZA 1UJYA 4M78E 1YJ9T 1G3WA 3OYGA 3M5AA 3I35A 3EGUA 1SSHA 4E7IA 5CKFA 2KXCA 4IUVA 4XQ3A 4GY5A 3M0QA 2LDMA 2QTVA 3DB4A 4XU1A 3ASKA 3PMIA 1WA7A 2JM8A 4RTXA 2QQRA 2XICA 2YRVA 1PCXA 1YJWT 2F2XA 2ZPBB 1K9MR 4PJOD 5GMKe 4KULA 1P92A 3A1PA 2V1QA 4OP0A 1Q82U 1VQ4A 5HK0A 2XDBA 4DBRA 1YP5A 2PQWA 1V29B 1UJ0A 4JRQA 5KYXB 1MMNA 5GAN2 2DXCA 2DMOA 2HBPA 2ZPGB 3EH2A 1R0CB 4A53A 1QP2A 2DBKA 1KQ2A 2K5LA 3L2QA 3G6ET 2FZCB 1OX8A 2AKKA 2EGCA 4F17A 2XK0A 4C0DB 2CZ7B 3QIIA 2YT6A 2CP0A 4OMNA 1WNLA 2NUZA 2EVRA 2OX7A 2LJ3A 1MV0B 3LGLA 2DIGA 4HT9A 4A54A 1WHHA 4HCCA 1UE9A 1KQSP 5KCHA 1H3ZA 2L3QA 3JCMW 5D6YA 3I55A 5CKBA 2LNVA 1X6GA 4UC4A 1KFZA 2KBTA 3CBPA 1VQLA 3DLLA 1SG5A 1VQ8T 2DAQA 3QKJA 5HKCA 4AFUC 3SFMA 2PUKB 2H3EB 4XK8E 3WVEB 4NOYA 3X28B 2DX1A 3VV0A 3QYHB 2CT3A 1M90C 2CP2A 1S72Q 1IREB 1I8FA 1SRMA 4C5GA 3PIOA 2CH4A 2FHDA 5KYWA 4V2SA 1VQ9Q 2X35A 2K7AA 3BE3A 4BY6B 4J9CA 3SB2A 2H3JA 1K76A 3VRYA 1TUCA 5A0LA 3CCUT 1YHQA 2J6KA 5KCOA 1PD0A 1EIFA 3EG0A 5A0DA 2VUBA 3EAEA 3CCVA 1TUGB 3M9QA 4WF2A 3V8JA 1BIAA 4BY6C 2EYZA 5I22A 3TCJA 3MEWA 5LJ3g 1HD3A 1B34A 1WHJA 4J6WA 2X4YA 3SWNB 1UGSB 1AZGB 3P8HA 2VXEA 4BI3A 2HSPA 3JB9D 2FRYA 2RHYA 4OVAA 4C92D 1D1AA 4LXCA 4M7DB 2LQWA 1MMDA 4RG8A 3I5SA 2ED0A 5AYFA 4D8DA 2DK3A 2QA4T 1K9MC 2AZSA 2XKOC 4KGZB 1VQKQ 2QQAA 4E7HA 4JLGA 4M7AE 2HMAA 1WHLA 4M7DC 4E7LA 1BU1A 1M2OA 2EAYA 3FLGA 4IIMA 3OYFA 1TS9A 1Q86R 1PRMC 1VQ6Q 3CC7Q 4E7JA 4AMCA 2AIRB 2HSEB 2RI5A 1RI9A 2R5MA 1XNIA 3A8LB 3TSWA 3U23A 4B9XA 3BY7A 2DYBA 2BZYA 3CCJA 1M90U 4RTZA 2NLUA 2QEXA 1IO6A 3SEMA 1UHCA 1AWJA 4Y92A 4C8QE 3OMGA 2GQVA 1IZ6A 4MZTA 1LCKA 5A0GA 5GAOm 2KRSA 3E2UA 4ZN3A 4M75B 1MV3A 1JRIA 2R5AA 1H92A 2XG8D 2DJQA 3X20B 3OYIA 2ATCB 1YIJQ 3A8MB 2COZA 4LDUA 3KBGA 1NM7A 1QKWA 2CP7A 3VS4A 2K3BA 2EFIA 1VQOQ 1GBRA 1BI2A 3JCMf 5LJ5f 4HKEA 3PVLA 3CCMA 1AHJB 2K5FA 4BDZA 1K9MU 5FWCA 1OEBA 3WXMB 1ZBXA 4TVRA 5I11A 3OY9A 1IRXA 3F70A 1VQPQ 1VQ7A 4LNPA 2FYKA 1LPLA 1Q81R 5KE2A 4ATOA 2QG9B 5D6XA 2EYXA 2X4XA 5GAN8 2BZXA 5CQXA 1PG5B 1NLOC 1BK2A 1YCYA 1MMGA 4OMOA 2EJGA 3QUIA 1TWBA 3CCLT 1NEBA 4PJNA 1CKAA 2XDDA 4EMKC 1BI0A 3MO8A 1E6GA 1KHCA 2D0QB 1QVFA 3RBBB 4IUTA 4JJDA 4PJJA 2F5TX 4M77E 3I55T 1HJDA 1TSFA 1NPRA 2OTJA 2O9SA 3HKSA 4OGCA 1YWOA 2JN0A 3V8LA 4KUDK 2FEIA 1VQLT 4PLIA 3NHNA 4FCYA 3EHRA 1Q86C 3X24B 1U1TA 2MMPA 2K3YA 4MMKA 2D0NA 3UF4A 2QTXA 1NLPC 3FJPA 1WGSA 3CEYA 3JB9H 3LW5E 1T0JA 2PTKA 5GJVB 1G83A 2DO3A 3ZL7C 3V7RA 3SDZA 4Z8AA 5GAMj 1RAIB 1TOVA 2MWPA 2M51A 2KRNA 2IIMA 2O4XA 2BE7D 2R57A 1W2BS 3CCVT 4N0AA 1OYXA 2DL3A 2DEQA 4XTWA 4NS5A 2E41A 4LDVA 2NUTA 1I5OB 4ZGJB 3G4SQ 1KG1A 5GAMd 3G71Q 4EMHA 2CKKA 3VYGA 3HFOA 3M0UA 1K4US 2P4RA 3OS1A 4OB3B 2MI6A 1B34B 2ZAEA 4AG1C 3CCEQ 3M0PA 2M02A 3OYBA 3I56A 3TREA 2HAXA 5LJ5j 1QVGP 4IUQA 1YJNA 2DL5A 4PJOB 1N8RR 4PFZA 2DRMA 1YJ9Q 4AFZC 3OYJA 1Q81C 5GANj 5GMKh 1Q86U 2RD1A 4XTVA 3ZEHA 3HL8A 4RTYA 3OB9A 4O6JA 1M1FA 2CZ6B 4XTXA 1GCQA 2M1HA 3NPFA 3RUXA 1IHVA 3NTIA 4PJOC 5KYXA 2QEXT 2MCNA 3TSZA 1ZHIA 2ENMA 2COWA 2L3PA 2X3WD 5GANd 5EC7A 1GCPA 2DFUA 2LQ8A 2QI2A 3OS0A 3GP8A 2KMTA 3OYKA 1WQ7A 1JJ2P 1K9AA 1PNJA 3G6EQ 2RQVA 3L2VA 3E9FA 3PE0A 3V8KA 3M53A 1W4SA 2RI3A 5D6WA 3HTRA 1TG0A 2DTOA 2QGGA 1LVKA 3CQTA 4M78C 3QZ9B 1D1CA 3JCMb 2GFUA 1I4K1 3NTHA 2EBPA 9ATCB 3GIBA 2JTMA 1VQNT 5GAOl 3M57A 1WPYA 1WXUA 3M0RA 3PGGA 5GAOq 1VQ5A 2F1LA 4F16A 1UGPB 2GTOA 4EDUA 1JXOA 2LQNA 2QXFA 1VQ7T 4AT1B 4BACA 2RJEA 1M3BA 1Q81U 4DEYA 1VQ8Q 1RLQC 3CC4A 4RCBA 5C6SA 4MZPA 2DD4A 1QKXA 3VS1A 4R55A
chains in the Genus database with same CATH topology
2FPEA 2K6DA 2C0OA 2ED1A 1QWFA 1YP5A 3QWYA 1UJ0A 1N5ZA 2KT8A 3EG3A 1GFCA 3ULRB 2RNAA 5GJWB 2DMOA 2GGRA 2KE9A 2DBKA 2LZ6B 4J9BA 1K0SA 2AKKA 1QCFA 1WLPB 2E5KA 2EGCA 2PZ1A 4KRTA 4F17A 1ZUKA 3REBB 2L0AA 3NGPA 2YT6A 4OMNA 2NUZA 2EVRA 1VYUA 2LJ3A 1MV0B 1T3LA 3VS5A 2JS2A 2KNBB 2KGTA 1KSWA 4EIKA 2OAWA 1UE9A 2L3QA 2L2PA 4J9FA 2KT1A 3REAB 1X6GA 1HSQA 2DBMA 1KFZA 2KBTA 1X2KA 1AWWA 1GRIA 2DM1A 1BB9A 3A98A 1U3OA 4AFUC 1RLPC 2LNHB 2I0NA 1JU5C 3VS2A 2JXBA 1OV3A 1PRLC 2DX1A 1OPLA 3QWXX 2A36A 1I07A 2CT3A 2MIOA 4E6RA 3UA6A 2H8HA 1SRMA 5IH2A 2CH4A 3C0CA 1WIEA 2F2VA 1UGVA 2K7AA 1ABOA 1JO8A 2HCKA 4J9CA 1WI7A 3VRZA 3VS6A 2DL4A 1EFNA 1QWEA 2GBQA 2PNIA 1UTIA 1K76A 2A37A 2DE0X 3VRYA 1TUCA 2D8JA 3EG2A 4IIOA 5IHNA 4AFQC 2J6KA 2MOXA 2GTJA 1SHFA 4CC3A 1T0HA 1T3SA 1RUWA 2SEMA 1WFWA 3EG0A 1B3QA 2KYMA 2JMAA 3UA7A 2HDAA 3LH5A 1BBZA 2EGAA 1Z9QA 2ABLA 1OOTA 2EYZA 5I22A 4LUEA 4AFSC 1J3TA 1VYVA 1HD3A 4HCKA 1AZGB 1U06A 1Z9ZA 2GQIA 2CREA 2HSPA 2ESWA 4RTTA 2DILA 2FRYA 2RMOA 1Y0MA 4LE9A 1SRLA 2LQWA 3I5SA 2ED0A 4F14A 2O31A 4D8DA 1AWXA 1KIKA 3O5ZA 2AZSA 2BTTA 2EQIA 2HEQA 1K0XA 2JMCA 1QLYA 1YWPA 2GNCA 2CDTA 1AD5A 4GBQA 4M4ZA 1VA7A 2KR3A 2W10A 1GFDA 1BU1A 1JQQA 4OMQA 4IIMA 2DNUA 2X3XD 1PRMC 1X27A 4RUGA 5FW9A 1ZUYA 4K11A 1AVZC 1CKBA 1UUEA 1RI9A 3TSWA 1XOVA 2DF6A 3U23A 4RTWA 2DYBA 2BZYA 2HBWA 3I5RA 1NYFA 4RTZA 1ZBJA 1IO6A 3SEMA 2V1RA 2VKNA 1UHCA 1AWJA 4Y92A 1ZUUA 2DL7A 2FO0A 2FRWA 2RN8A 4Z88A 2A28A 4J9IA 2JTEA 2JM9A 1LCKA 2KRSA 2EW3A 2JT4A 1MV3A 2EYYA 4CC4B 1ZX6A 2J6OA 2G6FX 1H92A 4LN2A 4RTVA 3KFVA 2DJQA 1AOJA 3VS7A 4CC7A 2FPFA 1JEGA 1WXTA 1NM7A 1QKWA 1E6HA 4ESRA 3VS3A 3VS4A 2K2MA 2K3BA 1S1NA 2AZVA 2D1XA 1I1JA 1GBRA 4Z89A 5IXBA 2F2WA 1KJWA 1M3CA 3I9QA 1UG1A 3PVLA 2ECZA 2LP5A 2YSQA 3M0TA 4JPBW 4QT7A 5FWCA 1Y57A 1OEBA 1ARKA 2DRKA 3H41A 4LUDA 1B07A 5I11A 2QDLA 2YUOA 3UATA 1UHFA 4LNPA 4JJBA 2O9VA 1X2QA 1YNZA 2EYXA 2LJ0A 4RTUA 2BZXA 1ZSGA 1NLOC 1BK2A 5IHKA 1A0NB 4OMOA 1AWOA 2O88A 1NEBA 2OJ2A 2C0IA 1CSKA 4DEXA 1CKAA 2J05A 3NMZC 4J9HA 1E6GA 3GBQA 1ZLMA 3RBBB 1SHGA 2ROLA 4JJDA 4HXJA 3PVQA 1HJDA 2O9SA 1W70A 1YWOA 2CSQA 2FEIA 2CSIA 4X1VA 4ORZA 1SPKA 1PHTA 3NHNA 3EHRA 2LX7A 1X6BA 1MUZA 1NG2A 5IXFA 1GBQA 2D0NA 1PWTA 3UF4A 4HVWA 1X69A 3FJ5A 1NLPC 3H0FA 2KXDA 3TVTA 1JXMA 1T0JA 2CUDA 2PTKA 5GJVB 1G83A 3ZL7C 2BZ8A 2K9GA 2RQWA 2KYBA 4Z8AA 2KRMA 5IHIA 4OMPA 2VVKA 4J9DA 1YCSB 2CUBA 2M51A 1W1FA 2KEAA 2KRNA 1OPKA 2CH4W 2YDLA 2IIMA 5HCKA 2JW4A 2AKLA 2RQUA 3M0SA 4GLMA 4WCIA 2ROTA 2DL3A 2DL8A 1SEMA 2CT4A 4D8KA 2C0TA 2YUQA 1ABQA 1UFFA 3H0IA 2RQRA 1WYXA 4JZ4A 2FG0A 4JZ3A 3M0UA 1K4US 2P4RA 1NEGA 1M3AA 1I0CA 4J9GA 3SHWA 4AG1C 1GCQC 3M0PA 1WXBA 2EYWA 4ZNXA 2NWMA 1PKTA 2J7IA 2DVJA 2LMJA 4FSSA 4HVVA 2DL5A 3R6NA 4CC2A 2LJ1A 2DRMA 4A63B 4OMLA 4AFZC 5FWBA 2FPDA 4JJCA 2K79A 2D8HA 1PKSA 2EKHA 2RQTA 4RTYA 5L23A 2AK5A 3VS0A 1NYGA 2O2OA 2LCSA 1M30A 1GCQA 3NPFA 2RF0A 2J06A 1FYNA 3EHQA 3RNJA 2YUPA 1G2BA 2MCNA 3TSZA 2ENMA 3JV3A 1H8KA 2RPNA 1FMKA 2B86A 2L3PA 2X3WD 4HVUA 1TUDA 5EC7A 2EPDA 1M8MA 2YUNA 1GCPA 1H3HA 1AZEA 1YN8A 1W6XA 2J6FA 1WDXA 1VYTA 1UECA 3THKA 1K1ZA 2EGEA 1E7OA 1AEYA 2W0ZA 1UJYA 1WX6A 1K9AA 1PNJA 1V1CA 2VWFA 2RQVA 4OMMA 3PE0A 3EG1A 3IQLA 1TG0A 3I35A 3CQTA 1UDLA 3EGUA 2M0YA 4R0KA 1SSHA 1M27C 2KXCA 4J9EA 2DA9A 3M0QA 2KROA 2EBPA 2JS0A 2L3SA 1WXUA 3M0RA 2XMFA 1GL5A 2A08A 3H0HA 4F16A 2GTOA 1WA7A 1X43A 2JM8A 4RTXA 1JXOA 2LQNA 2F2XA 4AG2C 1M3BA 4DEYA 5ECAA 1RLQC 1U5SA 2DLPA 2V1QA 2SRCA 1QKXA 3VS1A 2OI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPE A;  2K6D A;  2C0O A;  2ED1 A;  1QWF A;  1YP5 A;  3QWY A;  1UJ0 A;  1N5Z A;  2KT8 A;  3EG3 A;  1GFC A;  3ULR B;  2RNA A;  5GJW B;  2DMO A;  2GGR A;  2KE9 A;  2DBK A;  2LZ6 B;  4J9B A;  1K0S A;  2AKK A;  1QCF A;  1WLP B;  2E5K A;  2EGC A;  2PZ1 A;  4KRT A;  4F17 A;  1ZUK A;  3REB B;  2L0A A;  3NGP A;  2YT6 A;  4OMN A;  2NUZ A;  2EVR A;  1VYU A;  2LJ3 A;  1MV0 B;  1T3L A;  3VS5 A;  2JS2 A;  2KNB B;  2KGT A;  1KSW A;  4EIK A;  2OAW A;  1UE9 A;  2L3Q A;  2L2P A;  4J9F A;  2KT1 A;  3REA B;  1X6G A;  1HSQ A;  2DBM A;  1KFZ A;  2KBT A;  1X2K A;  1AWW A;  1GRI A;  2DM1 A;  1BB9 A;  3A98 A;  1U3O A;  4AFU C;  1RLP C;  2LNH B;  2I0N A;  1JU5 C;  3VS2 A;  2JXB A;  1OV3 A;  1PRL C;  2DX1 A;  1OPL A;  3QWX X;  2A36 A;  1I07 A;  2CT3 A;  2MIO A;  4E6R A;  3UA6 A;  2H8H A;  1SRM A;  5IH2 A;  2CH4 A;  3C0C A;  1WIE A;  2F2V A;  1UGV A;  2K7A A;  1ABO A;  1JO8 A;  2HCK A;  4J9C A;  1WI7 A;  3VRZ A;  3VS6 A;  2DL4 A;  1EFN A;  1QWE A;  2GBQ A;  2PNI A;  1UTI A;  1K76 A;  2A37 A;  2DE0 X;  3VRY A;  1TUC A;  2D8J A;  3EG2 A;  4IIO A;  5IHN A;  4AFQ C;  2J6K A;  2MOX A;  2GTJ A;  1SHF A;  4CC3 A;  1T0H A;  1T3S A;  1RUW A;  2SEM A;  1WFW A;  3EG0 A;  1B3Q A;  2KYM A;  2JMA A;  3UA7 A;  2HDA A;  3LH5 A;  1BBZ A;  2EGA A;  1Z9Q A;  2ABL A;  1OOT A;  2EYZ A;  5I22 A;  4LUE A;  4AFS C;  1J3T A;  1VYV A;  1HD3 A;  4HCK A;  1AZG B;  1U06 A;  1Z9Z A;  2GQI A;  2CRE A;  2HSP A;  2ESW A;  4RTT A;  2DIL A;  2FRY A;  2RMO A;  1Y0M A;  4LE9 A;  1SRL A;  2LQW A;  3I5S A;  2ED0 A;  4F14 A;  2O31 A;  4D8D A;  1AWX A;  1KIK A;  3O5Z A;  2AZS A;  2BTT A;  2EQI A;  2HEQ A;  1K0X A;  2JMC A;  1QLY A;  1YWP A;  2GNC A;  2CDT A;  1AD5 A;  4GBQ A;  4M4Z A;  1VA7 A;  2KR3 A;  2W10 A;  1GFD A;  1BU1 A;  1JQQ A;  4OMQ A;  4IIM A;  2DNU A;  2X3X D;  1PRM C;  1X27 A;  4RUG A;  5FW9 A;  1ZUY A;  4K11 A;  1AVZ C;  1CKB A;  1UUE A;  1RI9 A;  3TSW A;  1XOV A;  2DF6 A;  3U23 A;  4RTW A;  2DYB A;  2BZY A;  2HBW A;  3I5R A;  1NYF A;  4RTZ A;  1ZBJ A;  1IO6 A;  3SEM A;  2V1R A;  2VKN A;  1UHC A;  1AWJ A;  4Y92 A;  1ZUU A;  2DL7 A;  2FO0 A;  2FRW A;  2RN8 A;  4Z88 A;  2A28 A;  4J9I A;  2JTE A;  2JM9 A;  1LCK A;  2KRS A;  2EW3 A;  2JT4 A;  1MV3 A;  2EYY A;  4CC4 B;  1ZX6 A;  2J6O A;  2G6F X;  1H92 A;  4LN2 A;  4RTV A;  3KFV A;  2DJQ A;  1AOJ A;  3VS7 A;  4CC7 A;  2FPF A;  1JEG A;  1WXT A;  1NM7 A;  1QKW A;  1E6H A;  4ESR A;  3VS3 A;  3VS4 A;  2K2M A;  2K3B A;  1S1N A;  2AZV A;  2D1X A;  1I1J A;  1GBR A;  4Z89 A;  5IXB A;  2F2W A;  1KJW A;  1M3C A;  3I9Q A;  1UG1 A;  3PVL A;  2ECZ A;  2LP5 A;  2YSQ A;  3M0T A;  4JPB W;  4QT7 A;  5FWC A;  1Y57 A;  1OEB A;  1ARK A;  2DRK A;  3H41 A;  4LUD A;  1B07 A;  5I11 A;  2QDL A;  2YUO A;  3UAT A;  1UHF A;  4LNP A;  4JJB A;  2O9V A;  1X2Q A;  1YNZ A;  2EYX A;  2LJ0 A;  4RTU A;  2BZX A;  1ZSG A;  1NLO C;  1BK2 A;  5IHK A;  1A0N B;  4OMO A;  1AWO A;  2O88 A;  1NEB A;  2OJ2 A;  2C0I A;  1CSK A;  4DEX A;  1CKA A;  2J05 A;  3NMZ C;  4J9H A;  1E6G A;  3GBQ A;  1ZLM A;  3RBB B;  1SHG A;  2ROL A;  4JJD A;  4HXJ A;  3PVQ A;  1HJD A;  2O9S A;  1W70 A;  1YWO A;  2CSQ A;  2FEI A;  2CSI A;  4X1V A;  4ORZ A;  1SPK A;  1PHT A;  3NHN A;  3EHR A;  2LX7 A;  1X6B A;  1MUZ A;  1NG2 A;  5IXF A;  1GBQ A;  2D0N A;  1PWT A;  3UF4 A;  4HVW A;  1X69 A;  3FJ5 A;  1NLP C;  3H0F A;  2KXD A;  3TVT A;  1JXM A;  1T0J A;  2CUD A;  2PTK A;  5GJV B;  1G83 A;  3ZL7 C;  2BZ8 A;  2K9G A;  2RQW A;  2KYB A;  4Z8A A;  2KRM A;  5IHI A;  4OMP A;  2VVK A;  4J9D A;  1YCS B;  2CUB A;  2M51 A;  1W1F A;  2KEA A;  2KRN A;  1OPK A;  2CH4 W;  2YDL A;  2IIM A;  5HCK A;  2JW4 A;  2AKL A;  2RQU A;  3M0S A;  4GLM A;  4WCI A;  2ROT A;  2DL3 A;  2DL8 A;  1SEM A;  2CT4 A;  4D8K A;  2C0T A;  2YUQ A;  1ABQ A;  1UFF A;  3H0I A;  2RQR A;  1WYX A;  4JZ4 A;  2FG0 A;  4JZ3 A;  3M0U A;  1K4U S;  2P4R A;  1NEG A;  1M3A A;  1I0C A;  4J9G A;  3SHW A;  4AG1 C;  1GCQ C;  3M0P A;  1WXB A;  2EYW A;  4ZNX A;  2NWM A;  1PKT A;  2J7I A;  2DVJ A;  2LMJ A;  4FSS A;  4HVV A;  2DL5 A;  3R6N A;  4CC2 A;  2LJ1 A;  2DRM A;  4A63 B;  4OML A;  4AFZ C;  5FWB A;  2FPD A;  4JJC A;  2K79 A;  2D8H A;  1PKS A;  2EKH A;  2RQT A;  4RTY A;  5L23 A;  2AK5 A;  3VS0 A;  1NYG A;  2O2O A;  2LCS A;  1M30 A;  1GCQ A;  3NPF A;  2RF0 A;  2J06 A;  1FYN A;  3EHQ A;  3RNJ A;  2YUP A;  1G2B A;  2MCN A;  3TSZ A;  2ENM A;  3JV3 A;  1H8K A;  2RPN A;  1FMK A;  2B86 A;  2L3P A;  2X3W D;  4HVU A;  1TUD A;  5EC7 A;  2EPD A;  1M8M A;  2YUN A;  1GCP A;  1H3H A;  1AZE A;  1YN8 A;  1W6X A;  2J6F A;  1WDX A;  1VYT A;  1UEC A;  3THK A;  1K1Z A;  2EGE A;  1E7O A;  1AEY A;  2W0Z A;  1UJY A;  1WX6 A;  1K9A A;  1PNJ A;  1V1C A;  2VWF A;  2RQV A;  4OMM A;  3PE0 A;  3EG1 A;  3IQL A;  1TG0 A;  3I35 A;  3CQT A;  1UDL A;  3EGU A;  2M0Y A;  4R0K A;  1SSH A;  1M27 C;  2KXC A;  4J9E A;  2DA9 A;  3M0Q A;  2KRO A;  2EBP A;  2JS0 A;  2L3S A;  1WXU A;  3M0R A;  2XMF A;  1GL5 A;  2A08 A;  3H0H A;  4F16 A;  2GTO A;  1WA7 A;  1X43 A;  2JM8 A;  4RTX A;  1JXO A;  2LQN A;  2F2X A;  4AG2 C;  1M3B A;  4DEY A;  5ECA A;  1RLQ C;  1U5S A;  2DLP A;  2V1Q A;  2SRC A;  1QKX A;  3VS1 A;  2OI3 A; 
#chains in the Genus database with same CATH topology
 2K6D A;  2C0O A;  4FT2 A;  1KD1 R;  1QWF A;  1D09 B;  3QWY A;  3EG3 A;  2KT8 A;  3CCU A;  1D0X A;  4Q5W A;  2RNA A;  4ELZ C;  3QJY A;  4XTU A;  5C0M A;  4M7D G;  1MND A;  3DB3 A;  4KRT A;  1WLP B;  2PZ1 A;  1WHK A;  3SWN A;  1TH7 A;  1NJI R;  1N8R C;  2OTJ T;  3QDF A;  4M7D A;  4FT4 A;  1M4Z A;  2JS2 A;  1YI2 T;  3VUB A;  3GLX A;  2RHX A;  4J9F A;  3CBM A;  4M7D F;  4C92 C;  1OQK A;  3CD6 Q;  4PFO A;  1HSQ A;  2A0F B;  1VQM Q;  2O01 E;  4BI8 B;  2QQS A;  4PNO A;  3JB9 J;  2DEU A;  1U3O A;  3FC3 A;  1ZSZ C;  1TXQ A;  2BIV A;  2LNH B;  2K4Y A;  3L2U A;  2JXB A;  4DQ2 A;  2LRQ A;  3OW2 S;  1WJQ A;  2A36 A;  1I07 A;  2MIO A;  3PIP A;  2H8H A;  1WIE A;  2F2V A;  3MJX A;  1UGV A;  1ABO A;  1JO8 A;  4ZTF A;  4BDY A;  2GBQ A;  1QWE A;  3CC2 T;  1UTI A;  5CQY A;  4M75 G;  2XD0 A;  4R56 A;  2ZGW A;  4DOW A;  1VIF A;  5IHN A;  2DXU A;  2MK5 A;  1RUW A;  2SEM A;  4M75 A;  1B3Q A;  1O9S A;  2HDA A;  3LH5 A;  2KK4 A;  3R6O A;  3CXC P;  3MEV A;  1WZO A;  1J3T A;  1VYV A;  4M75 F;  1O75 A;  3I56 T;  1UGR B;  2MAM A;  2GQI A;  4J6X A;  4RTT A;  2DIL A;  1EZZ B;  3HPW A;  5LL6 S;  2E3I A;  1YJN T;  3OYE A;  3DKM A;  1N8R U;  2QK0 A;  3CCS A;  4DBF A;  3VU3 C;  3OSV A;  2CP6 A;  2LC4 A;  1QVG S;  4KGX B;  1IGQ A;  3MP6 A;  3PTA A;  1KD1 C;  2YHT A;  3FRN A;  3ME9 A;  4M4Z A;  2E6Z A;  4EMK A;  4OMQ A;  3H8Z A;  2VGN A;  3J81 E;  2IG0 A;  1X27 A;  4FW1 A;  1ZUY A;  2VYT A;  2JZ2 A;  4PJL A;  3CPW A;  1XOV A;  4E7K A;  1KQS A;  4RTW A;  1NJI C;  1IB8 A;  1NYF A;  2DPP B;  2P84 A;  1LJO A;  2V1R A;  4MDX A;  4EPC A;  1VQ4 Q;  4J7I A;  2DL7 A;  2FRW A;  2AT1 B;  3EGD B;  3CCL A;  3J80 E;  2JTE A;  3CCR Q;  2Y90 A;  2PVG B;  4C8Q C;  2EW3 A;  2MF2 A;  2JT4 A;  2B8A A;  2EYY A;  1BKB A;  3AT1 B;  1RAC B;  2G6F X;  4C5E A;  3CMA Q;  4LN2 A;  4LD6 A;  4M78 D;  5KH6 A;  2HZY A;  4CC7 A;  3G7Z A;  2FPF A;  1YIT Q;  1JEG A;  1JJ2 S;  4NL2 A;  4DOV A;  3MEA A;  3EFO B;  1E6H A;  3MPU B;  3VS3 A;  3NFC A;  2K2M A;  2CZ1 B;  1PC0 A;  2D1X A;  5GAM g;  1U8R A;  1VQ5 T;  1M1K R;  2F2W A;  2HL5 C;  3I9Q A;  5CO7 A;  4RMO A;  2ECZ A;  3RR6 A;  2QGF B;  4N4G A;  2RHZ A;  4JPB W;  3CC4 T;  4LD9 K;  2DRK A;  2X51 A;  1OX9 A;  3H41 A;  4LUD A;  3OYC A;  5KYY B;  1W2B P;  1VQ9 A;  4JRP A;  1KD1 U;  1TU0 B;  4XU2 A;  3UAT A;  4P5N A;  4RG2 A;  4JDS A;  4A4F A;  2EJ9 A;  5GAO n;  5J3B A;  2LJ0 A;  3M54 A;  2EQK A;  3ER0 A;  5IHK A;  1BCO A;  1A0N B;  1AWO A;  2O88 A;  1N9R A;  2XU8 A;  1NJI U;  3E19 A;  1YHQ Q;  2C0I A;  4DEX A;  4KGV B;  4PJO G;  2J05 A;  4J9H A;  1KQ1 A;  3A8H B;  5A2Q E;  2K57 A;  3FB9 A;  3CCV Q;  4MDW A;  4PJO A;  1V76 A;  5GAN g;  2CSI A;  1PSE A;  5GAN 5;  1PHT A;  2KQW A;  1FMV A;  1NG2 A;  1QCO A;  4PJO F;  5IXF A;  2K2V A;  4IUU A;  4JUV A;  2ZPF B;  3FJ5 A;  1ZA1 B;  2KXD A;  2KI7 A;  3O8V A;  3TVT A;  2M9U A;  2DTH A;  1JXM A;  1FMW A;  1RAE B;  2BZ8 A;  1BIB A;  2RQW A;  3CC7 A;  3VJP A;  5IHI A;  3CME Q;  2RHU A;  4M78 G;  1YCS B;  5IAY A;  2CUB A;  8AT1 B;  3D7S B;  3OBW A;  4X9C A;  3OYD A;  3PMT A;  4CRI A;  4GLM A;  3M0S A;  1UEB A;  3CCJ Q;  2YRC A;  1SEM A;  3OYH A;  2KSS A;  5LJ3 e;  4BUG A;  4MZM A;  2QEX Q;  1UFF A;  1X01 A;  5GMK j;  4JZ4 A;  2DVE A;  4XTZ A;  2FG0 A;  4JZ3 A;  1M1K C;  1MHN A;  4FW2 A;  1M3A A;  1I0C A;  3SHW A;  3CCS T;  4X34 A;  1G3S A;  4ME7 A;  3CXC S;  1WXB A;  3WVD B;  1PKT A;  2J7I A;  2DVJ A;  4XTY A;  1WHG A;  4HVV A;  3RKY A;  5IN1 A;  4RCC A;  4OML A;  4YTL A;  1VQN A;  4XAX B;  2K79 A;  4M7A D;  2WSE E;  2VC8 A;  5KYN A;  3DLM A;  5LJ3 f;  3CCM Q;  4EMK B;  3JB9 G;  3SD4 A;  3VS0 A;  2EWN A;  3QDR B;  1OUL A;  4C92 G;  2KVQ G;  1XJW B;  2RJF A;  3EHQ A;  4FIB A;  2X4J A;  2YUP A;  2HD0 A;  2V26 A;  1G2B A;  4HA8 A;  2D6F A;  1BCM A;  2CYZ B;  1VQ7 Q;  3JV3 A;  4C92 A;  1H8K A;  2RPN A;  4BE2 A;  2B86 A;  4C8Q D;  4QVC A;  5KYU B;  1TUD A;  2YUN A;  3JB9 F;  5FRO A;  4OGE A;  4C92 F;  1AZE A;  1WDX A;  3CCQ A;  1RI0 A;  1ACM B;  1D3B B;  2RB6 A;  2EGE A;  3OA6 A;  4LDX A;  2WSC E;  3GPL A;  1AEY A;  1YI2 A;  1WX6 A;  4OMM A;  1HK9 A;  3IQL A;  1UDL A;  3OW2 P;  1M1K U;  2M0Y A;  1M27 C;  4J9E A;  3GNG A;  3QHS A;  3UWN A;  2KRO A;  3LYI A;  1K73 R;  1JB0 E;  2L3S A;  2XMF A;  1F1B B;  3A5Z B;  2QQB A;  2A08 A;  3H9N A;  4M7D E;  1X43 A;  1VQ9 T;  1Y71 A;  2OTL Q;  2VB6 A;  3RMS A;  4AG2 C;  2KDS A;  2F69 A;  4BE0 A;  5GAN 3;  1R0B G;  1QVF P;  1IXD A;  4JS4 A;  2VAS A;  3JCM c;  3CC2 A;  2FPE A;  4X9D A;  2K5I A;  2BUD A;  5GJW B;  5GAN 6;  3EFR A;  2JJ9 A;  5KE3 A;  3LWI A;  2KE9 A;  2LX9 A;  1FXX A;  4O5V A;  1K0S A;  1QCF A;  2E5K A;  4C5H A;  4F7U B;  1ZUK A;  1MMA A;  2L0A A;  3H6Z A;  3NGP A;  2L3R A;  2DXT A;  1VYU A;  5CR2 A;  2KY9 A;  4M77 D;  2KNB B;  2KGT A;  3CCE A;  1KSW A;  4EIK A;  1OU8 A;  2L2P A;  2KT1 A;  1G3T A;  5FLX E;  4ELY C;  3REA B;  1VQK T;  2A3L A;  2V8I A;  5HY6 A;  5CCA A;  3OYN A;  2DBM A;  4M75 E;  3ZBD A;  1AWW A;  2RH2 A;  4C8Q G;  2DM1 A;  4RKU E;  1BB9 A;  3L1A A;  4QVZ A;  1SKU B;  1RLP C;  2DER A;  5LJ3 j;  4ZTJ A;  2Y4X A;  1QP3 A;  1YJN Q;  1BI3 A;  1JU5 C;  1LOJ A;  1D0Z A;  3CC7 T;  1VQ6 T;  1HXD A;  4PJM A;  1OV3 A;  1PRL C;  3QWX X;  4E6R A;  3JCM d;  5M9O A;  5LJ5 d;  5GMK m;  2JUF A;  2Y4Y A;  1LNX A;  1WQW A;  2HCK A;  3OMC A;  1WI7 A;  3VRZ A;  1YJW Q;  2DL4 A;  1EFN A;  2PNI A;  3OSS C;  4ANJ A;  1EX4 A;  3LGF A;  4NL3 A;  2DE0 X;  3EG2 A;  3EGD A;  4IIO A;  2RK1 A;  3A8G B;  4M78 B;  2GTJ A;  1SHF A;  1T0H A;  2HNI A;  3QBY A;  3L2Z A;  5EG2 A;  2KYM A;  1BBZ A;  2ABL A;  1OOT A;  1C6V X;  2EIF A;  4N4H A;  4LUE A;  4AFS C;  2DYI A;  1D0Y A;  1RAF B;  4HCK A;  4HCZ A;  1K73 C;  1U06 A;  1Z9Z A;  1PSF A;  3EFO A;  2FZG B;  1Y0M A;  2LT4 A;  1SRL A;  1Q95 G;  4E7S A;  2D9T A;  1RAH B;  1AWX A;  1FX7 A;  4JS5 A;  2JMC A;  1QLY A;  2GFA A;  2GNC A;  4C0G A;  1AD5 A;  4GBQ A;  5KYY A;  1VQP T;  4Y28 E;  1VA7 A;  2ZCF B;  2KR3 A;  2DD5 A;  2YWW A;  1GFD A;  3MP8 A;  1JQQ A;  3MET A;  2DNU A;  2X3X D;  2QAS A;  3M4Y A;  1GXI E;  4OF1 A;  4RUG A;  1AVZ C;  1UUE A;  1C1A A;  2X4W A;  3S6W A;  2PU9 B;  2CGH A;  3I5R A;  3CC4 Q;  2LCL A;  2HQE A;  4J83 A;  4C92 B;  2VKN A;  3RIR A;  3RMQ A;  1RAA B;  1ZUU A;  3MP1 A;  2E1H A;  1K8A R;  3CCQ T;  2RN8 A;  4J9I A;  2DIQ A;  3CCU Q;  4BI4 A;  1ZSZ B;  3MEU A;  3JSC A;  4CC4 B;  2QYZ A;  1AOJ A;  5HK3 A;  4F04 B;  1G3Y A;  1YBY A;  3CD6 A;  4J6Y A;  2L5Q A;  3M58 A;  1VQM A;  3M59 A;  3JRZ A;  1K73 U;  1RAG B;  4LDY A;  4XU0 A;  3EG9 B;  4EMG A;  1S1N A;  2AZV A;  3URG A;  1I1J A;  4Z89 A;  1KJW A;  1M3C A;  2YLC A;  1M2V B;  3JCM X;  2QA4 Q;  4E7Z A;  1SSF A;  2YSQ A;  5GAN 4;  4QT7 A;  8ATC B;  1KC8 R;  1Y57 A;  1ARK A;  3C94 A;  3CXC A;  1B07 A;  2QDL A;  3PT9 A;  4PJO E;  2YUO A;  5D7U A;  5DM7 R;  3HSB A;  2O9V A;  3V7C A;  1XTD A;  2DTI A;  3RER A;  1YNZ A;  3TQ7 P;  5LJ3 h;  4RTU A;  1QVF S;  5J26 A;  2PVD B;  1ZSG A;  3G4S T;  2JOY A;  3G71 T;  4OB0 B;  1VUB A;  4ZGD B;  2QDY B;  2NUP B;  4PFP A;  1NPP A;  1M90 R;  1CSK A;  1C0M A;  5FRN A;  3CCE T;  4E2F B;  3NMZ C;  2LT1 A;  2JTF A;  3VUZ A;  2ROL A;  1UGQ B;  2ZPI B;  3A8O B;  2EJF A;  4M7A B;  1W70 A;  2CSQ A;  2FZK B;  3MKD A;  4X1V A;  4ORZ A;  1XQH A;  1MNE A;  1X6B A;  1X75 C;  1MUZ A;  4HVW A;  1X69 A;  4N0A C;  3CCS Q;  2XID A;  2WAC A;  3T9N A;  2DET A;  4M7A C;  5J39 A;  2CUD A;  3JCM V;  5CVI A;  5DY9 A;  3S3M A;  2XHC A;  4C8Q B;  4BB7 A;  1DJ7 B;  1K8A C;  4A4G A;  4OMP A;  4C0Z A;  5CK9 A;  4J9D A;  1NE8 A;  2KEA A;  4N4I A;  2ZZD A;  1OPK A;  5KYU A;  2CH4 W;  5HCK A;  2RI2 A;  2JW4 A;  2AKL A;  2RQU A;  4WCI A;  2ROT A;  4JJN K;  2DL8 A;  2WSF E;  2CT4 A;  2EQU A;  3CCR A;  3NTK A;  1D3B A;  4QW2 A;  2HKN A;  5FU6 B;  3H0I A;  1OU9 A;  1JBM A;  2RQR A;  5GMK l;  1WYX A;  3MCA B;  4J8O A;  3CMA A;  3CCL Q;  3GNF B;  1OZ3 A;  4FYX B;  1Q7Y R;  4J9G A;  1W2B A;  4KT0 E;  1GCQ C;  4A4K A;  3E1S A;  1YIT A;  2EYW A;  2RHI A;  2NWM A;  4C92 E;  2EYQ A;  3HFN A;  1KC8 C;  4Y91 A;  3CPW P;  2LMJ A;  2VV5 A;  4FSS A;  3I55 Q;  2RK2 A;  5FU6 C;  3R6N A;  2RO0 A;  4GLK A;  4CC2 A;  2ZPH B;  4FL6 A;  1VQL Q;  2E70 A;  4FM4 B;  4DBQ A;  2X9H A;  4C0D C;  1S72 A;  2D8H A;  1U1S A;  4B9W A;  1OZ2 A;  4FYY B;  2P0K A;  1PKS A;  4ZGE B;  2FVU A;  2RQT A;  3OYM A;  1NYG A;  2MYS A;  2LCS A;  5AT1 B;  4L5G A;  1ZQ1 A;  3GOX A;  2J06 A;  1I81 A;  4F7U G;  3RNJ A;  3VKI A;  2JNG A;  1D1B A;  3PNW C;  7AT1 B;  1K8A U;  2RJC A;  3M55 A;  4M77 B;  4F7U A;  2HKQ B;  3JCM g;  5LJ5 g;  1H3H A;  2J6F A;  1W6X A;  1IGU A;  2DZC A;  2E64 A;  4F7U F;  1H64 1;  3TU4 K;  1M5Q 1;  1QVP A;  1R77 A;  3S3O A;  5CKD A;  4LDW A;  1E7O A;  2W0Z A;  3CD6 T;  4QKU A;  1VQM T;  3KXT A;  1V1C A;  2VWF A;  4M77 C;  3JCM Q;  3EG1 A;  3HRT A;  5GAM e;  1KHI A;  3L42 A;  4VUB A;  2A7Y A;  2BE9 B;  2RM4 A;  2DKG A;  2PUO B;  1VQK A;  4R0K A;  5GAO p;  2P0P A;  1M8V A;  1ZA2 B;  1M1G A;  2DA9 A;  3FIF A;  2JS0 A;  3PFS A;  1PM3 A;  4MML A;  2HQX A;  1KC8 U;  3BFM A;  1GL5 A;  1VQ6 A;  3H0H A;  1RL2 A;  1QQJ A;  4BD3 A;  4J5Y A;  3SWN C;  3CBO A;  3OYY A;  3CME A;  3C95 A;  4JRI A;  5ECA A;  3JCM P;  1U5S A;  4C5I A;  2DLP A;  3BDL A;  1Y7X A;  4FYW B;  2SRC A;  4QQ6 A;  2OI3 A;  4M78 A;  3AHU A;  2ED1 A;  3QG1 A;  1N5Z A;  2E4H A;  5GAM f;  1GFC A;  1Q7Y C;  3ULR B;  2GGR A;  3N5B B;  3JCM e;  2LZ6 B;  4M78 F;  5LJ5 e;  3RKX A;  5CKE A;  4J9B A;  1RAD B;  2CS7 A;  3EGX A;  3REB B;  1PD1 A;  4QQG A;  1N27 A;  3P8D A;  1YIJ A;  3QJ6 A;  5DLQ E;  2P4T A;  5GAN e;  2E12 A;  1T3L A;  3VS5 A;  2VGM A;  3MHX A;  1RAB B;  1Y96 B;  2OAW A;  4JLI A;  4PK4 A;  2M16 A;  4OB2 B;  4D6W A;  1VQO A;  3BW1 A;  1VIE A;  3FDR A;  4BE1 A;  3VYH B;  3X25 B;  4HT8 A;  1X2K A;  3UPU A;  2GF7 A;  4A4E A;  1GRI A;  3QO3 A;  3HHT B;  3A98 A;  3ZFJ A;  2I0N A;  2AHJ B;  3VS2 A;  1B7T A;  4M75 C;  4DBH A;  2KAF A;  1VQP A;  1OPL A;  2FB7 A;  1VQN Q;  3UA6 A;  1YFN A;  1HYO A;  5IH2 A;  3OYL A;  2EQJ A;  1QMC A;  3C0C A;  5GAN f;  1VQ4 T;  3VS6 A;  2COY A;  2A37 A;  3OW2 A;  1FWZ A;  2D8J A;  3L2R A;  3CCR T;  4AFQ C;  2MOX A;  4CC3 A;  1ZSZ A;  1T3S A;  1WFW A;  2EKO A;  3JB9 I;  3CMA T;  2CP3 A;  2JMA A;  3UA7 A;  2C06 A;  2EGA A;  1Z9Q A;  2IVW A;  1I5L A;  1Q7Y U;  2E10 A;  1YIT T;  3EFS A;  3UT1 A;  3CCQ Q;  2CRE A;  3GF5 A;  2ESW A;  3LH0 A;  2RMO A;  4LE9 A;  2OTJ Q;  3EG9 A;  4F14 A;  2O31 A;  2YLB A;  3RDV A;  2LQK A;  1YI2 Q;  3C4S A;  1M2V A;  3V7S A;  1KIK A;  1S72 T;  3O5Z A;  4FYV B;  3M4G A;  2BTT A;  2EQI A;  2HEQ A;  3CPW S;  1K0X A;  1YWP A;  3HP9 A;  1KQS S;  2R58 A;  3HRU A;  2V8J A;  2CDT A;  3M56 A;  3QZ5 B;  4FU6 A;  2W10 A;  2OTL A;  2PVO B;  5FW9 A;  4K11 A;  1CKB A;  1QVG A;  4WTO B;  2DF6 A;  5KYW B;  5GMK i;  2HBW A;  2OAU A;  3CPF A;  2NUP A;  1YHQ T;  1ZBJ A;  3S3N A;  3G4S A;  4M7A G;  2ZPE B;  3G71 A;  3CC2 Q;  2FO0 A;  2DJZ A;  4Z88 A;  2A28 A;  2JM9 A;  3P8B B;  3QPH A;  2GCX A;  6AT1 B;  1WJS A;  2RA2 A;  4M7A A;  1ZX6 A;  4PKC C;  2J6O A;  4RTV A;  3KFV A;  3VS7 A;  4KBM B;  1IHW A;  4M7A F;  2M0O A;  4QVD A;  3EH1 A;  3I56 Q;  5I2S A;  1WXT A;  2RJD A;  1YJ9 A;  3FEO A;  4KH0 B;  4A4H A;  4ESR A;  5GAO r;  3LLR A;  2HL3 A;  2V8K A;  5IXB A;  1MGQ A;  2DXB A;  1UG1 A;  4C8Q A;  2MPX C;  1WJR A;  2MWO A;  2LP5 A;  3CME T;  4DA4 A;  4M7D D;  2Z0W A;  4L59 A;  3E9G A;  3M0T A;  1JJ2 A;  2L89 A;  4KUI A;  4IKF A;  4C8Q F;  1WHM A;  2NYS A;  1UHF A;  1QW1 A;  4JJB A;  1YJW A;  1X2Q A;  5LJ3 d;  3JCM J;  1X6O A;  2YXY A;  3CCJ T;  4L6V 5;  1M9S A;  1G8X A;  1UB4 A;  3X26 B;  4E47 A;  1Q82 R;  1SF9 A;  2L8D A;  1AT1 B;  2F5K A;  3OQ5 A;  2VXF A;  2LVM A;  1YIJ T;  2OJ2 A;  3EGX B;  2IPO B;  1G5V A;  1N9S A;  1N6A A;  1Y07 A;  3G6E A;  3BDU A;  2I2L A;  3GBQ A;  1ZLM A;  1SHG A;  1VQO T;  3G1J A;  4HXJ A;  3PVQ A;  3LWH A;  3LX7 A;  4ZN1 A;  2YRD A;  1BI1 A;  4II1 A;  5CAI A;  3OS5 A;  2LCC A;  1SPK A;  4OB1 B;  4QQD A;  2LX7 A;  4Z02 A;  4M75 D;  1OI1 A;  3QYG B;  5CKH A;  3HRS A;  2JVV A;  1BYM A;  1GBQ A;  2EQM A;  1PWT A;  3CCM T;  3UDC A;  3H0F A;  1VQ8 A;  5GAN 7;  1VQ5 Q;  2E3H A;  2K9G A;  4M77 G;  3TEE A;  4KH1 B;  2KYB A;  4HCB A;  5L8R E;  2KRM A;  4CI0 C;  4JRK A;  2VVK A;  4IUR A;  2E5Q A;  2E65 A;  2BKD N;  2QQ9 A;  4J7F A;  1W1F A;  4M77 A;  2YDL A;  3OYA A;  2CZ0 B;  4IUP A;  3QXE B;  3QSU A;  4PLL A;  4M77 F;  2E6N A;  4XU3 A;  4PL6 A;  2XDP A;  4D8K A;  2C0T A;  2YUQ A;  1ABQ A;  3RKW A;  4B6M A;  5GAM h;  2DZ9 A;  1NEG A;  4C0F A;  3OBY A;  4ZNX A;  2FL7 A;  5FU7 B;  2XI9 A;  2HQH A;  3J7A F;  3KUF A;  4F7U E;  3L2W A;  1VOM A;  2G3R A;  1TTH B;  2QAZ A;  2LJ1 A;  4A63 B;  5IT9 E;  2OTL T;  3Q1J A;  3C12 A;  5FWB A;  2FPD A;  3RES A;  4JJC A;  2QA4 A;  2LTO A;  3JAM E;  5I21 A;  1Q82 C;  2EKH A;  2K3X A;  5FU7 C;  5L23 A;  2AK5 A;  5FRM A;  2O2O A;  5CIU A;  2CP5 A;  1M30 A;  2P0Q A;  2RF0 A;  1FYN A;  5I2M A;  4FSX A;  4OMF B;  3JCM h;  5LJ5 h;  3OS2 A;  1FMK A;  1NBE B;  1R8O B;  4HVU A;  5DLO A;  2EPD A;  1M8M A;  2O4X B;  5GAN h;  1YN8 A;  1NZ9 A;  1KK7 A;  1VYT A;  1UEC A;  1Y96 A;  3THK A;  1K1Z A;  1QCN A;  2NUT B;  3INZ A;  1UJY A;  4M78 E;  1YJ9 T;  1G3W A;  3OYG A;  3M5A A;  3I35 A;  3EGU A;  1SSH A;  4E7I A;  5CKF A;  2KXC A;  4IUV A;  4XQ3 A;  4GY5 A;  3M0Q A;  2LDM A;  2QTV A;  3DB4 A;  4XU1 A;  3ASK A;  3PMI A;  1WA7 A;  2JM8 A;  4RTX A;  2QQR A;  2XIC A;  2YRV A;  1PCX A;  1YJW T;  2F2X A;  2ZPB B;  1K9M R;  4PJO D;  5GMK e;  4KUL A;  1P92 A;  3A1P A;  2V1Q A;  4OP0 A;  1Q82 U;  1VQ4 A;  5HK0 A;  2XDB A;  4DBR A;  1YP5 A;  2PQW A;  1V29 B;  1UJ0 A;  4JRQ A;  5KYX B;  1MMN A;  5GAN 2;  2DXC A;  2DMO A;  2HBP A;  2ZPG B;  3EH2 A;  1R0C B;  4A53 A;  1QP2 A;  2DBK A;  1KQ2 A;  2K5L A;  3L2Q A;  3G6E T;  2FZC B;  1OX8 A;  2AKK A;  2EGC A;  4F17 A;  2XK0 A;  4C0D B;  2CZ7 B;  3QII A;  2YT6 A;  2CP0 A;  4OMN A;  1WNL A;  2NUZ A;  2EVR A;  2OX7 A;  2LJ3 A;  1MV0 B;  3LGL A;  2DIG A;  4HT9 A;  4A54 A;  1WHH A;  4HCC A;  1UE9 A;  1KQS P;  5KCH A;  1H3Z A;  2L3Q A;  3JCM W;  5D6Y A;  3I55 A;  5CKB A;  2LNV A;  1X6G A;  4UC4 A;  1KFZ A;  2KBT A;  3CBP A;  1VQL A;  3DLL A;  1SG5 A;  1VQ8 T;  2DAQ A;  3QKJ A;  5HKC A;  4AFU C;  3SFM A;  2PUK B;  2H3E B;  4XK8 E;  3WVE B;  4NOY A;  3X28 B;  2DX1 A;  3VV0 A;  3QYH B;  2CT3 A;  1M90 C;  2CP2 A;  1S72 Q;  1IRE B;  1I8F A;  1SRM A;  4C5G A;  3PIO A;  2CH4 A;  2FHD A;  5KYW A;  4V2S A;  1VQ9 Q;  2X35 A;  2K7A A;  3BE3 A;  4BY6 B;  4J9C A;  3SB2 A;  2H3J A;  1K76 A;  3VRY A;  1TUC A;  5A0L A;  3CCU T;  1YHQ A;  2J6K A;  5KCO A;  1PD0 A;  1EIF A;  3EG0 A;  5A0D A;  2VUB A;  3EAE A;  3CCV A;  1TUG B;  3M9Q A;  4WF2 A;  3V8J A;  1BIA A;  4BY6 C;  2EYZ A;  5I22 A;  3TCJ A;  3MEW A;  5LJ3 g;  1HD3 A;  1B34 A;  1WHJ A;  4J6W A;  2X4Y A;  3SWN B;  1UGS B;  1AZG B;  3P8H A;  2VXE A;  4BI3 A;  2HSP A;  3JB9 D;  2FRY A;  2RHY A;  4OVA A;  4C92 D;  1D1A A;  4LXC A;  4M7D B;  2LQW A;  1MMD A;  4RG8 A;  3I5S A;  2ED0 A;  5AYF A;  4D8D A;  2DK3 A;  2QA4 T;  1K9M C;  2AZS A;  2XKO C;  4KGZ B;  1VQK Q;  2QQA A;  4E7H A;  4JLG A;  4M7A E;  2HMA A;  1WHL A;  4M7D C;  4E7L A;  1BU1 A;  1M2O A;  2EAY A;  3FLG A;  4IIM A;  3OYF A;  1TS9 A;  1Q86 R;  1PRM C;  1VQ6 Q;  3CC7 Q;  4E7J A;  4AMC A;  2AIR B;  2HSE B;  2RI5 A;  1RI9 A;  2R5M A;  1XNI A;  3A8L B;  3TSW A;  3U23 A;  4B9X A;  3BY7 A;  2DYB A;  2BZY A;  3CCJ A;  1M90 U;  4RTZ A;  2NLU A;  2QEX A;  1IO6 A;  3SEM A;  1UHC A;  1AWJ A;  4Y92 A;  4C8Q E;  3OMG A;  2GQV A;  1IZ6 A;  4MZT A;  1LCK A;  5A0G A;  5GAO m;  2KRS A;  3E2U A;  4ZN3 A;  4M75 B;  1MV3 A;  1JRI A;  2R5A A;  1H92 A;  2XG8 D;  2DJQ A;  3X20 B;  3OYI A;  2ATC B;  1YIJ Q;  3A8M B;  2COZ A;  4LDU A;  3KBG A;  1NM7 A;  1QKW A;  2CP7 A;  3VS4 A;  2K3B A;  2EFI A;  1VQO Q;  1GBR A;  1BI2 A;  3JCM f;  5LJ5 f;  4HKE A;  3PVL A;  3CCM A;  1AHJ B;  2K5F A;  4BDZ A;  1K9M U;  5FWC A;  1OEB A;  3WXM B;  1ZBX A;  4TVR A;  5I11 A;  3OY9 A;  1IRX A;  3F70 A;  1VQP Q;  1VQ7 A;  4LNP A;  2FYK A;  1LPL A;  1Q81 R;  5KE2 A;  4ATO A;  2QG9 B;  5D6X A;  2EYX A;  2X4X A;  5GAN 8;  2BZX A;  5CQX A;  1PG5 B;  1NLO C;  1BK2 A;  1YCY A;  1MMG A;  4OMO A;  2EJG A;  3QUI A;  1TWB A;  3CCL T;  1NEB A;  4PJN A;  1CKA A;  2XDD A;  4EMK C;  1BI0 A;  3MO8 A;  1E6G A;  1KHC A;  2D0Q B;  1QVF A;  3RBB B;  4IUT A;  4JJD A;  4PJJ A;  2F5T X;  4M77 E;  3I55 T;  1HJD A;  1TSF A;  1NPR A;  2OTJ A;  2O9S A;  3HKS A;  4OGC A;  1YWO A;  2JN0 A;  3V8L A;  4KUD K;  2FEI A;  1VQL T;  4PLI A;  3NHN A;  4FCY A;  3EHR A;  1Q86 C;  3X24 B;  1U1T A;  2MMP A;  2K3Y A;  4MMK A;  2D0N A;  3UF4 A;  2QTX A;  1NLP C;  3FJP A;  1WGS A;  3CEY A;  3JB9 H;  3LW5 E;  1T0J A;  2PTK A;  5GJV B;  1G83 A;  2DO3 A;  3ZL7 C;  3V7R A;  3SDZ A;  4Z8A A;  5GAM j;  1RAI B;  1TOV A;  2MWP A;  2M51 A;  2KRN A;  2IIM A;  2O4X A;  2BE7 D;  2R57 A;  1W2B S;  3CCV T;  4N0A A;  1OYX A;  2DL3 A;  2DEQ A;  4XTW A;  4NS5 A;  2E41 A;  4LDV A;  2NUT A;  1I5O B;  4ZGJ B;  3G4S Q;  1KG1 A;  5GAM d;  3G71 Q;  4EMH A;  2CKK A;  3VYG A;  3HFO A;  3M0U A;  1K4U S;  2P4R A;  3OS1 A;  4OB3 B;  2MI6 A;  1B34 B;  2ZAE A;  4AG1 C;  3CCE Q;  3M0P A;  2M02 A;  3OYB A;  3I56 A;  3TRE A;  2HAX A;  5LJ5 j;  1QVG P;  4IUQ A;  1YJN A;  2DL5 A;  4PJO B;  1N8R R;  4PFZ A;  2DRM A;  1YJ9 Q;  4AFZ C;  3OYJ A;  1Q81 C;  5GAN j;  5GMK h;  1Q86 U;  2RD1 A;  4XTV A;  3ZEH A;  3HL8 A;  4RTY A;  3OB9 A;  4O6J A;  1M1F A;  2CZ6 B;  4XTX A;  1GCQ A;  2M1H A;  3NPF A;  3RUX A;  1IHV A;  3NTI A;  4PJO C;  5KYX A;  2QEX T;  2MCN A;  3TSZ A;  1ZHI A;  2ENM A;  2COW A;  2L3P A;  2X3W D;  5GAN d;  5EC7 A;  1GCP A;  2DFU A;  2LQ8 A;  2QI2 A;  3OS0 A;  3GP8 A;  2KMT A;  3OYK A;  1WQ7 A;  1JJ2 P;  1K9A A;  1PNJ A;  3G6E Q;  2RQV A;  3L2V A;  3E9F A;  3PE0 A;  3V8K A;  3M53 A;  1W4S A;  2RI3 A;  5D6W A;  3HTR A;  1TG0 A;  2DTO A;  2QGG A;  1LVK A;  3CQT A;  4M78 C;  3QZ9 B;  1D1C A;  3JCM b;  2GFU A;  1I4K 1;  3NTH A;  2EBP A;  9ATC B;  3GIB A;  2JTM A;  1VQN T;  5GAO l;  3M57 A;  1WPY A;  1WXU A;  3M0R A;  3PGG A;  5GAO q;  1VQ5 A;  2F1L A;  4F16 A;  1UGP B;  2GTO A;  4EDU A;  1JXO A;  2LQN A;  2QXF A;  1VQ7 T;  4AT1 B;  4BAC A;  2RJE A;  1M3B A;  1Q81 U;  4DEY A;  1VQ8 Q;  1RLQ C;  3CC4 A;  4RCB A;  5C6S A;  4MZP A;  2DD4 A;  1QKX A;  3VS1 A;  4R55 A; 
#chains in the Genus database with same CATH homology
 2FPE A;  2K6D A;  2C0O A;  2ED1 A;  1QWF A;  1YP5 A;  3QWY A;  1UJ0 A;  1N5Z A;  2KT8 A;  3EG3 A;  1GFC A;  3ULR B;  2RNA A;  5GJW B;  2DMO A;  2GGR A;  2KE9 A;  2DBK A;  2LZ6 B;  4J9B A;  1K0S A;  2AKK A;  1QCF A;  1WLP B;  2E5K A;  2EGC A;  2PZ1 A;  4KRT A;  4F17 A;  1ZUK A;  3REB B;  2L0A A;  3NGP A;  2YT6 A;  4OMN A;  2NUZ A;  2EVR A;  1VYU A;  2LJ3 A;  1MV0 B;  1T3L A;  3VS5 A;  2JS2 A;  2KNB B;  2KGT A;  1KSW A;  4EIK A;  2OAW A;  1UE9 A;  2L3Q A;  2L2P A;  4J9F A;  2KT1 A;  3REA B;  1X6G A;  1HSQ A;  2DBM A;  1KFZ A;  2KBT A;  1X2K A;  1AWW A;  1GRI A;  2DM1 A;  1BB9 A;  3A98 A;  1U3O A;  4AFU C;  1RLP C;  2LNH B;  2I0N A;  1JU5 C;  3VS2 A;  2JXB A;  1OV3 A;  1PRL C;  2DX1 A;  1OPL A;  3QWX X;  2A36 A;  1I07 A;  2CT3 A;  2MIO A;  4E6R A;  3UA6 A;  2H8H A;  1SRM A;  5IH2 A;  2CH4 A;  3C0C A;  1WIE A;  2F2V A;  1UGV A;  2K7A A;  1ABO A;  1JO8 A;  2HCK A;  4J9C A;  1WI7 A;  3VRZ A;  3VS6 A;  2DL4 A;  1EFN A;  1QWE A;  2GBQ A;  2PNI A;  1UTI A;  1K76 A;  2A37 A;  2DE0 X;  3VRY A;  1TUC A;  2D8J A;  3EG2 A;  4IIO A;  5IHN A;  4AFQ C;  2J6K A;  2MOX A;  2GTJ A;  1SHF A;  4CC3 A;  1T0H A;  1T3S A;  1RUW A;  2SEM A;  1WFW A;  3EG0 A;  1B3Q A;  2KYM A;  2JMA A;  3UA7 A;  2HDA A;  3LH5 A;  1BBZ A;  2EGA A;  1Z9Q A;  2ABL A;  1OOT A;  2EYZ A;  5I22 A;  4LUE A;  4AFS C;  1J3T A;  1VYV A;  1HD3 A;  4HCK A;  1AZG B;  1U06 A;  1Z9Z A;  2GQI A;  2CRE A;  2HSP A;  2ESW A;  4RTT A;  2DIL A;  2FRY A;  2RMO A;  1Y0M A;  4LE9 A;  1SRL A;  2LQW A;  3I5S A;  2ED0 A;  4F14 A;  2O31 A;  4D8D A;  1AWX A;  1KIK A;  3O5Z A;  2AZS A;  2BTT A;  2EQI A;  2HEQ A;  1K0X A;  2JMC A;  1QLY A;  1YWP A;  2GNC A;  2CDT A;  1AD5 A;  4GBQ A;  4M4Z A;  1VA7 A;  2KR3 A;  2W10 A;  1GFD A;  1BU1 A;  1JQQ A;  4OMQ A;  4IIM A;  2DNU A;  2X3X D;  1PRM C;  1X27 A;  4RUG A;  5FW9 A;  1ZUY A;  4K11 A;  1AVZ C;  1CKB A;  1UUE A;  1RI9 A;  3TSW A;  1XOV A;  2DF6 A;  3U23 A;  4RTW A;  2DYB A;  2BZY A;  2HBW A;  3I5R A;  1NYF A;  4RTZ A;  1ZBJ A;  1IO6 A;  3SEM A;  2V1R A;  2VKN A;  1UHC A;  1AWJ A;  4Y92 A;  1ZUU A;  2DL7 A;  2FO0 A;  2FRW A;  2RN8 A;  4Z88 A;  2A28 A;  4J9I A;  2JTE A;  2JM9 A;  1LCK A;  2KRS A;  2EW3 A;  2JT4 A;  1MV3 A;  2EYY A;  4CC4 B;  1ZX6 A;  2J6O A;  2G6F X;  1H92 A;  4LN2 A;  4RTV A;  3KFV A;  2DJQ A;  1AOJ A;  3VS7 A;  4CC7 A;  2FPF A;  1JEG A;  1WXT A;  1NM7 A;  1QKW A;  1E6H A;  4ESR A;  3VS3 A;  3VS4 A;  2K2M A;  2K3B A;  1S1N A;  2AZV A;  2D1X A;  1I1J A;  1GBR A;  4Z89 A;  5IXB A;  2F2W A;  1KJW A;  1M3C A;  3I9Q A;  1UG1 A;  3PVL A;  2ECZ A;  2LP5 A;  2YSQ A;  3M0T A;  4JPB W;  4QT7 A;  5FWC A;  1Y57 A;  1OEB A;  1ARK A;  2DRK A;  3H41 A;  4LUD A;  1B07 A;  5I11 A;  2QDL A;  2YUO A;  3UAT A;  1UHF A;  4LNP A;  4JJB A;  2O9V A;  1X2Q A;  1YNZ A;  2EYX A;  2LJ0 A;  4RTU A;  2BZX A;  1ZSG A;  1NLO C;  1BK2 A;  5IHK A;  1A0N B;  4OMO A;  1AWO A;  2O88 A;  1NEB A;  2OJ2 A;  2C0I A;  1CSK A;  4DEX A;  1CKA A;  2J05 A;  3NMZ C;  4J9H A;  1E6G A;  3GBQ A;  1ZLM A;  3RBB B;  1SHG A;  2ROL A;  4JJD A;  4HXJ A;  3PVQ A;  1HJD A;  2O9S A;  1W70 A;  1YWO A;  2CSQ A;  2FEI A;  2CSI A;  4X1V A;  4ORZ A;  1SPK A;  1PHT A;  3NHN A;  3EHR A;  2LX7 A;  1X6B A;  1MUZ A;  1NG2 A;  5IXF A;  1GBQ A;  2D0N A;  1PWT A;  3UF4 A;  4HVW A;  1X69 A;  3FJ5 A;  1NLP C;  3H0F A;  2KXD A;  3TVT A;  1JXM A;  1T0J A;  2CUD A;  2PTK A;  5GJV B;  1G83 A;  3ZL7 C;  2BZ8 A;  2K9G A;  2RQW A;  2KYB A;  4Z8A A;  2KRM A;  5IHI A;  4OMP A;  2VVK A;  4J9D A;  1YCS B;  2CUB A;  2M51 A;  1W1F A;  2KEA A;  2KRN A;  1OPK A;  2CH4 W;  2YDL A;  2IIM A;  5HCK A;  2JW4 A;  2AKL A;  2RQU A;  3M0S A;  4GLM A;  4WCI A;  2ROT A;  2DL3 A;  2DL8 A;  1SEM A;  2CT4 A;  4D8K A;  2C0T A;  2YUQ A;  1ABQ A;  1UFF A;  3H0I A;  2RQR A;  1WYX A;  4JZ4 A;  2FG0 A;  4JZ3 A;  3M0U A;  1K4U S;  2P4R A;  1NEG A;  1M3A A;  1I0C A;  4J9G A;  3SHW A;  4AG1 C;  1GCQ C;  3M0P A;  1WXB A;  2EYW A;  4ZNX A;  2NWM A;  1PKT A;  2J7I A;  2DVJ A;  2LMJ A;  4FSS A;  4HVV A;  2DL5 A;  3R6N A;  4CC2 A;  2LJ1 A;  2DRM A;  4A63 B;  4OML A;  4AFZ C;  5FWB A;  2FPD A;  4JJC A;  2K79 A;  2D8H A;  1PKS A;  2EKH A;  2RQT A;  4RTY A;  5L23 A;  2AK5 A;  3VS0 A;  1NYG A;  2O2O A;  2LCS A;  1M30 A;  1GCQ A;  3NPF A;  2RF0 A;  2J06 A;  1FYN A;  3EHQ A;  3RNJ A;  2YUP A;  1G2B A;  2MCN A;  3TSZ A;  2ENM A;  3JV3 A;  1H8K A;  2RPN A;  1FMK A;  2B86 A;  2L3P A;  2X3W D;  4HVU A;  1TUD A;  5EC7 A;  2EPD A;  1M8M A;  2YUN A;  1GCP A;  1H3H A;  1AZE A;  1YN8 A;  1W6X A;  2J6F A;  1WDX A;  1VYT A;  1UEC A;  3THK A;  1K1Z A;  2EGE A;  1E7O A;  1AEY A;  2W0Z A;  1UJY A;  1WX6 A;  1K9A A;  1PNJ A;  1V1C A;  2VWF A;  2RQV A;  4OMM A;  3PE0 A;  3EG1 A;  3IQL A;  1TG0 A;  3I35 A;  3CQT A;  1UDL A;  3EGU A;  2M0Y A;  4R0K A;  1SSH A;  1M27 C;  2KXC A;  4J9E A;  2DA9 A;  3M0Q A;  2KRO A;  2EBP A;  2JS0 A;  2L3S A;  1WXU A;  3M0R A;  2XMF A;  1GL5 A;  2A08 A;  3H0H A;  4F16 A;  2GTO A;  1WA7 A;  1X43 A;  2JM8 A;  4RTX A;  1JXO A;  2LQN A;  2F2X A;  4AG2 C;  1M3B A;  4DEY A;  5ECA A;  1RLQ C;  1U5S A;  2DLP A;  2V1Q A;  2SRC A;  1QKX A;  3VS1 A;  2OI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...