3ULRB

Lysozyme contamination facilitates crystallization of a hetero-trimericcortactin:arg:lysozyme complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
PLGSSDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Lysozyme contamination facilitates crystallization of a heterotrimeric cortactin-Arg-lysozyme complex.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase, protein binding
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ulrB00
2K2MA 4OMMA 1SHGA 1U3OA 2DRKA 2K9GA 2KRMA 5GJWB 4Z8AA 4FSSA 1CKAA 1IO6A 4LUEA 1S1NA 1E6HA 1NLPC 4R0KA 3EG0A 2AK5A 2GNCA 2LJ1A 3VRZA 3EG1A 2YUPA 2J6FA 1UTIA 3VS4A 2CUBA 2LZ6B 1XOVA 2DL4A 2LQWA 2D1XA 1WXTA 2AZVA 1W70A 2DX1A 4ZNXA 1PRMC 5HCKA 2IIMA 3H0HA 3SHWA 2CT3A 1UFFA 1ABOA 1OPKA 1ZUKA 3NHNA 3REBB 3U23A 1M3CA 2KYBA 1UE9A 1PRLC 2FRWA 2K3BA 2K6DA 1WLPB 1W6XA 2KNBB 4JJDA 4J9CA 4WCIA 4DEYA 3VS6A 2YT6A 2FPEA 2HDAA 1H92A 2CSIA 2KBTA 4RTYA 1JXMA 1SRLA 1FMKA 2CT4A 4J9DA 1VYUA 5FW9A 3EGUA 2JS2A 3VRYA 4RTXA 4RTWA 1PWTA 2RN8A 1NEBA 5I11A 3KFVA 2FO0A 1AWJA 2RQWA 4RTTA 1JQQA 1U5SA 1AZGB 1YCSB 2QDLA 4J9BA 4AG2C 3RBBB 1X27A 2YSQA 2ROLA 2VVKA 3M0TA 1ZUUA 1Z9ZA 1UHFA 1MV0B 4CC7A 1OV3A 1LCKA 2CSQA 2F2VA 3VS0A 1Z9QA 3VS3A 3PVLA 1YWPA 2BZXA 5GJVB 1UJYA 2JM8A 2OJ2A 2GGRA 3CQTA 2JXBA 1HJDA 1K0SA 2ROTA 4IIOA 1TUDA 1UECA 3LH5A 3UF4A 3VS5A 1SPKA 1B3QA 2YUOA 4LN2A 1GRIA 4HVWA 1QKWA 2EYXA 1QLYA 1Y0MA 2MOXA 3GBQA 4AG1C 1K1ZA 1X69A 1UJ0A 1H8KA 2VKNA 1HD3A 1E6GA 2RQVA 2AKLA 1WI7A 4OMOA 2B86A 4JZ3A 3NMZC 4RTZA 2A37A 2SRCA 2MCNA 3A98A 2I0NA 1ZX6A 1I0CA 3M0QA 4GBQA 1ZSGA 4F16A 2X3XD 2KR3A 1V1CA 1NM7A 1GL5A 2ED0A 2D8HA 2F2WA 1KIKA 1NEGA 1WFWA 1M30A 2FPDA 3M0PA 2KE9A 2DVJA 4HXJA 2G6FX 2CREA 2JW4A 2X3WD 2DA9A 2O9SA 2RMOA 4LNPA 1X2KA 3EHQA 2BZYA 1VYTA 2D8JA 2D0NA 2DNUA 1RUWA 1B07A 4KRTA 1GFDA 2YUNA 2KRSA 1KFZA 1BU1A 1WXUA 2HSPA 2KT8A 2O31A 2J7IA 2KROA 1OOTA 1GBRA 2ABLA 1UUEA 1GCQC 3TSZA 1OPLA 2J6OA 2EYWA 1YNZA 4HVVA 1SHFA 4J9EA 5EC7A 1CKBA 4JJBA 2A28A 1K4US 1TUCA 2E5KA 1ARKA 2KXCA 3H41A 4JZ4A 2A08A 4HVUA 1ZBJA 2J06A 1GBQA 2LP5A 1X6BA 2L3QA 1PKTA 4RTUA 2LQNA 1UDLA 1BK2A 2LMJA 2RQRA 2RNAA 3M0SA 3C0CA 2L0AA 5ECAA 1YN8A 4AFSC 1SSHA 1QWEA 1GFCA 2JTEA 1MV3A 3EHRA 1T3LA 4OMLA 2BTTA 1JO8A 2FG0A 2DILA 2J6KA 5L23A 1PNJA 5IXFA 3UA6A 1K0XA 1JXOA 2YUQA 1RI9A 1X43A 2FEIA 3JV3A 3UA7A 2GTOA 2CH4A 3M0RA 5FWCA 4D8DA 2C0OA 1T0JA 1H3HA 2FRYA 3O5ZA 1AWXA 2J05A 1AOJA 2JS0A 3IQLA 2P4RA 4DEXA 4ESRA 2YDLA 2DL5A 2EW3A 2OAWA 2C0IA 2XMFA 2H8HA 4K11A 1WDXA 3RNJA 1PHTA 4AFQC 4CC3A 2W10A 4J9FA 2KT1A 3EG2A 2EYYA 2JT4A 3VS2A 2KGTA 2CUDA 3TVTA 4F14A 1GCPA 2EVRA 2A36A 1BB9A 1M8MA 1EFNA 2DLPA 2ECZA 2HCKA 1QKXA 3NPFA 3I9QA 2EKHA 4J9HA 2V1QA 1Y57A 2C0TA 4J9IA 4A63B 1AD5A 1YP5A 1I07A 1K76A 3I5SA 4J9GA 1AEYA 1FYNA 1T3SA 1GCQA 1AZEA 5IHNA 4JPBW 2PTKA 3PVQA 1SRMA 4OMPA 2K7AA 5I22A 1AWWA 2DE0X 2EPDA 2RPNA 1M3BA 1TG0A 1J3TA 3PE0A 2DF6A 4JJCA 3NGPA 1KSWA 2LCSA 1HSQA 1U06A 2DMOA 2LJ3A 1AVZC 3VS7A 2K79A 2KRNA 1E7OA 1UG1A 1WIEA 1OEBA 1VA7A 3ZL7C 5IHKA 4Z89A 2KXDA 1X6GA 1JU5C 1WA7A 1ABQA 2V1RA 2DRMA 3TSWA 2PNIA 1KJWA 1QCFA 2DL8A 2DL3A 2L3PA 4Y92A 2HBWA 1JEGA 4AFZC 2OI3A 1M27C 2L3SA 1I1JA 2O9VA 4LUDA 2M51A 2KYMA 1NYFA 3H0IA 2LNHB 2RQUA 3QWYA 2O2OA 2EQIA 4OMQA 2M0YA 1RLQC 3ULRB 4HCKA 1X2QA 3I5RA 2DBKA 2DJQA 2GBQA 2JM9A 1UHCA 1RLPC 2ENMA 2RQTA 2DM1A 1WYXA 3FJ5A 1ZUYA 4QT7A 1M3AA 4E6RA 4D8KA 4GLMA 2EGAA 5IH2A 1ZLMA 3EG3A 4RTVA 3VS1A 2DL7A 1A0NB 2KEAA 4F17A 4ORZA 1QWFA 4CC4B 2CH4W 2O88A 1WX6A 1NYGA 4CC2A 2EGEA 1K9AA 2HEQA 4OMNA 2DBMA 2DYBA 3H0FA 2JMAA 4EIKA 3THKA 2RF0A 1G83A 1NG2A 2EYZA 5IXBA 3SEMA 2LJ0A 1YWOA 2AZSA 4AFUC 3QWXX 1AWOA 3R6NA 4Z88A 2SEMA 2NUZA 4M4ZA 1UGVA 5FWBA 4LE9A 2F2XA 2LX7A 2GQIA 2JMCA 2EBPA 2MIOA 4X1VA 3I35A 2EGCA 1SEMA 2GTJA 2CDTA 1G2BA 3REAB 4RUGA 1N5ZA 1CSKA 1WXBA 2W0ZA 4IIMA 1T0HA 1VYVA 2BZ8A 2ED1A 2FPFA 2NWMA 1NLOC 1W1FA 2AKKA 3M0UA 1MUZA 2PZ1A 1BBZA 2L2PA 2VWFA 1PKSA 3UATA 5IHIA 2ESWA
chains in the Genus database with same CATH superfamily
2DXCA 5GAN4 2R57A 4FSSA 4EMKC 1IO6A 1E6HA 1NLPC 1R8OB 1C0MA 3EG0A 2K5LA 2RK1A 2LJ1A 4A4KA 3EG1A 3BE3A 1VQ5A 2RA2A 2YUPA 3CCUQ 5DLOA 4MDWA 1UTIA 3PNWC 3VS4A 5FLXE 2CUBA 2LZ6B 1M1KC 2AZVA 4OGEA 2LTOA 3CCQA 1PRMC 4XTUA 3SHWA 5CKBA 5D6YA 2CT3A 3WXMB 3M55A 4MZTA 3EFRA 1UE9A 2FRWA 2XHCA 1WLPB 2KNBB 4WCIA 4DEYA 4B9XA 1YIJA 5GAOn 2HDAA 1H92A 3RDVA 2KBTA 8ATCB 5M9OA 5GAN3 2RI2A 1Q86C 2QXFA 3CBPA 2QQBA 3JB9F 4M77E 1OX8A 3ZEHA 5KYUB 1NEBA 1WPYA 4M78E 4BE2A 3C12A 4PJMA 3V7RA 1U5SA 1RI0A 1ZBXA 1AZGB 2RHXA 2LQ8A 1O75A 2DERA 4II1A 5D7UA 5LJ5g 3HP9A 3QDFA 1R0CB 1ZUUA 2PU9B 2PVDB 4D6WA 1G5VA 1D09B 3VS3A 2QA4Q 4M7AF 1UJYA 2JM8A 3S3MA 1VQPA 3CQTA 3JB9D 3CCSQ 1X75C 2VB6A 5KYYA 1WZOA 2FZCB 2QEXA 3DB4A 4FT4A 4IIOA 2XDPA 4LD6A 1IRXA 1QLYA 2RI3A 2VASA 4PJNA 1WHLA 2RO0A 3GBQA 4AG1C 1VQ9Q 1MGQA 1VQ7Q 1H8KA 1VOMA 2GCXA 3RUXA 3PIOA 2AKLA 4JZ3A 1RABB 3NMZC 2A37A 4J5YA 5GAOm 2MCNA 1G3TA 4J6YA 3CXCS 1ZX6A 1I0CA 2CP3A 1YJ9Q 1ZSGA 1I8FA 2KR3A 1V1CA 1NM7A 2ED0A 3MP1A 3EFSA 2XI9A 1WFWA 3M0PA 4M77D 2EWNA 4O5VA 5GANj 4C92F 1YHQT 4E7LA 3NTIA 1UGPB 5GMKm 2CREA 4M78D 2XU8A 2DA9A 2QAZA 1VIFA 3KUFA 1N8RC 4M75F 4HCBA 1TUGB 1X2KA 2D0NA 4BI8B 1YJWT 3I56T 4LDWA 2MWPA 2WSCE 1GFDA 2YUNA 1X6OA 2HSPA 1RACB 2KROA 4NL2A 1IHVA 2DIGA 1WHMA 3OYNA 4EMHA 3AT1B 1OPLA 2EYWA 2ATCB 1SHFA 1VQ4A 3AHUA 3CCQQ 3CCVA 4J6XA 1EIFA 4IURA 2V8KA 4BE0A 2X9HA 1K4US 4V2SA 2AIRB 4PFZA 3HKSA 3MKDA 1NZ9A 1ZBJA 1OZ3A 3JCMW 5GAOq 1GBQA 1LOJA 4RMOA 1YIJQ 4RTUA 4LDXA 1AT1B 1OU8A 3O8VA 2RK2A 2RQRA 3C0CA 2NUTB 3A8HB 4YTLA 1QVFA 2B8AA 3VV0A 2RJCA 1VQNA 2CP0A 1QWEA 1GFCA 4E7KA 2HSEB 1T3LA 2BTTA 1FMWA 1PNJA 4X9CA 5IXFA 3CMAT 4RCCA 1N9RA 2FEIA 3UA7A 3SD4A 1M4ZA 2GTOA 2QDYB 2DAQA 4E7SA 4D8DA 1T0JA 2E4HA 4IKFA 3FC3A 1BIBA 4N0AA 2JS0A 3IQLA 4KT0E 2P4RA 3RERA 2HL5C 5CQYA 4PJLA 1VQPQ 2DL5A 5IAYA 4K11A 2VGNA 2EJGA 3J7AF 5GAMd 2NYSA 1D0YA 1N9SA 2QEXQ 4M7DA 4CC3A 2CZ6B 2W10A 3EG2A 2FZKB 1VQLA 2KGTA 2CUDA 3QPHA 5GAMf 2EJ9A 4F14A 1V76A 3CCRT 2EVRA 3V7CA 1BI2A 3HL8A 2QQ9A 1LPLA 3MJXA 1EFNA 1KC8U 3I9QA 2E10A 2XDDA 1AD5A 2V26A 2A0FB 1T3SA 4M7DC 1SRMA 2E64A 1AWWA 2LDMA 3V7SA 1M3BA 1J3TA 3PE0A 3NGPA 4IUVA 4OF1A 2EFIA 3CC4T 3ZFJA 5GAOr 3V8LA 2KRNA 3M9QA 4FSXA 5IHKA 4Z89A 4J6WA 2KXDA 3G71T 1RADB 2V1RA 4XU1A 1KJWA 2DL8A 2BE9B 4AFZC 2OI3A 3BFMA 2L5QA 3JB9J 2KYMA 1NYFA 4KBMB 1KQSP 2RQUA 2QTVA 4B6MA 2KI7A 4PJOG 5GAMh 1H641 1IB8A 3VKIA 3G7ZA 4OB3B 1VQ4Q 3CCVQ 2RQTA 2DPPB 3G4SA 5GAMe 5KYWB 4DOVA 3FJ5A 1M3AA 3UT1A 4C5HA 5IH2A 3EG3A 1YI2A 1D3BA 2EIFA 4F17A 4ME7A 2OTLT 1I4K1 2CH4W 2DXTA 1WX6A 5GAOp 1BI0A 2OTJA 3R6OA 1Y07A 1BI3A 1ZSZA 2JMAA 3SB2A 4C8QG 3M54A 3THKA 1Q95G 1NG2A 2RF0A 3OSVA 5IXBA 2PVOB 1VQNQ 4KUIA 4E7ZA 3FRNA 2SEMA 3EGXB 3CCUT 2JZ2A 2OTLA 2KVQG 2QG9B 3OYHA 2LX7A 3OQ5A 3OYAA 5FRMA 3VUZA 4FCYA 1RAFB 3LGLA 4FW2A 2CKKA 2GTJA 1ZSZC 3A5ZB 1RAGB 4M7AA 2W0ZA 3PIPA 1T0HA 2BZ8A 3OS1A 4AT1B 4BUGA 2NWMA 1RAIB 1W1FA 2AKKA 1K8AR 5HY6A 2PZ1A 5GMKj 2P0PA 3JB9I 3INZA 2X4XA 2ZPBB 5CR2A 4NS5A 4M77A 2K2MA 3OMCA 1U3OA 3QYHB 4M7AC 3S3OA 1TS9A 1S1NA 4LUEA 4AMCA 4ZN3A 4R0KA 3HPWA 4E7HA 3FEOA 2GNCA 1KQSA 1QVGP 2YWWA 3EGDB 2J6FA 4MZPA 1W4SA 3VYGA 1XOVA 5KH6A 4RKUE 2D1XA 1WXTA 3VJPA 2LX9A 2Y4YA 1W2BA 1WJRA 5HCKA 2XKOC 2IIMA 5EG2A 4NL3A 1ABOA 1ZUKA 4C0DC 3REBB 4CRIA 4C92A 4PL6A 2QA4T 1QP2A 3FIFA 4M7DE 1PRLC 2K6DA 3F70A 2GF7A 4E47A 4JRIA 4M75A 1M1KU 1W6XA 3CCST 1SKUB 4J9CA 4DBQA 3VS6A 2YT6A 1YITA 4XTXA 5A0LA 2CSIA 4RTYA 1JXMA 3PMTA 1RAHB 3DLLA 1VYUA 5FW9A 3VRYA 4C92C 2C06A 2RN8A 2NUPA 1VQ9T 3FDRA 2RQWA 4M75C 1VQ7T 3E9GA 2K3XA 2X4WA 2VV5A 4RTTA 1JQQA 1VQMT 3CEYA 4DBHA 2O4XA 4F7UG 1Q86U 2DXBA 4FU6A 2HMAA 1X27A 1UB4A 2YSQA 2EAYA 2ROLA 4MDXA 3M0TA 5LJ3j 1UHFA 1MV0B 1YJ9T 3CCMA 1OV3A 3Q1JA 1YI2Q 1LCKA 3P8HA 2F2VA 1Z9QA 4J7IA 3CPWS 2MI6A 1D1CA 1YWPA 2BZXA 2PUOB 1XTDA 5KYXB 2OJ2A 2Y90A 2JXBA 1HJDA 1K0SA 2OTJQ 2XK0A 4VUBA 2RHUA 1TUDA 5D6WA 3OS0A 3QIIA 3TQ7P 1K73R 2RJFA 2YUOA 2DD4A 4EMKA 1GRIA 2RD1A 1QVGA 1Y0MA 1VQ5T 1X69A 2OTLQ 1UJ0A 4M7DD 2DTOA 1HD3A 2RHIA 1PD0A 1E6GA 2RQVA 4KUDK 1BCOA 1VQOA 2JUFA 2DFUA 2B86A 2DZ9A 3CCQT 1XNIA 1BKBA 2L3RA 2RHZA 1EZZB 2LCCA 2X3XD 4ANJA 3UDCA 1GL5A 3ER0A 2D8HA 3A8OB 4HKEA 5LJ5d 1M30A 2HBPA 2DVJA 2LT4A 3CCEA 2Z0WA 3MP6A 5LJ5f 2JW4A 1V29B 1YIJT 2GQVA 1LVKA 2CYZB 2BZYA 2K2VA 1VYTA 3JCMf 3LWHA 1IHWA 2M1HA 1RUWA 4F7UB 1RAAB 3M4YA 3OB9A 1QVPA 1KFZA 1WXUA 1GXIE 1G3YA 2KT8A 3P8DA 1QMCA 2D6FA 1YCYA 5IT9E 2ABLA 1UUEA 4M7AE 5GMKi 1N8RU 4FW1A 4GLKA 2J6OA 1YNZA 1KHIA 4MMKA 3M59A 4J9EA 3CBOA 1NE8A 3FB9A 1MHNA 2WSEE 1CKBA 3G6EA 3MEUA 2RHYA 4JJBA 1Y71A 5HK3A 4E7JA 4JZ4A 1RL2A 1VQPT 4HVUA 3OYGA 1BI1A 2HD0A 2LP5A 1KD1R 2L3QA 1PKTA 1K8AC 1D0ZA 4J83A 4DA4A 3OS5A 3QZ9B 3DB3A 3T9NA 2QEXT 1UDLA 2LMJA 3L2WA 2RJDA 2DO3A 3A1PA 3OY9A 4KGZB 1TU0B 1M1FA 3S3NA 1MMAA 2EQJA 5LJ5h 2EKOA 4J7FA 3JCMg 2DILA 1QP3A 3LW5E 2J6KA 5LJ5e 5KYUA 1RI9A 2ZPGB 4OB0B 4ZN1A 4C92E 2C0OA 3JCMe 1FMVA 4M75E 1M2OA 3OA6A 1QVFP 2I2LA 3CCMQ 3M53A 2DIQA 2VUBA 2PUKB 4DEXA 2DVEA 4A53A 1D1AA 4C0ZA 2IPOB 4XU0A 2EW3A 2OAWA 5GANg 1WDXA 1OULA 3JCMV 3PGGA 4M7AD 4OP0A 1VQMQ 1PHTA 7AT1B 4PJJA 4EMGA 1WHKA 2KT1A 2EYYA 2RH2A 3VS2A 3QO3A 1M8VA 5HKCA 2MYSA 5GANe 2DLPA 2ECZA 3D7SB 3RESA 2FB7A 4J9IA 4A63B 1YP5A 3N5BB 1FYNA 4PJOF 3OYKA 1SF9A 1AZEA 4C0GA 2FL7A 3PVQA 2ZGWA 1VQOQ 1VQ4T 3RMQA 3CCVT 5GAN2 3PFSA 2RPNA 5GAOl 4MZMA 2E5QA 4JJCA 3L2RA 5AT1B 4QQDA 1KSWA 2LCSA 3SDZA 2DMOA 2LJ3A 1VQ5Q 3VS7A 2K5IA 3CCEQ 1WIEA 2YRDA 2KSSA 3ZL7C 3OYMA 3GPLA 1X6GA 5GMKl 1JU5C 2EYQA 1JRIA 4C8QF 4C92D 2A3LA 2PNIA 4EDUA 3J80E 3EG9B 3E1SA 1VQNT 3A8MB 2HBWA 4M75D 1K9MR 1K73C 3OYBA 3E19A 2M51A 3OYEA 3H0IA 3J81E 2JVVA 2JNGA 2PVGB 2M0YA 1RLQC 4OB1B 1X2QA 3I5RA 2DJQA 1UHCA 3GIBA 1RLPC 1Q7YR 2QI2A 4B9WA 2IVWA 2DM1A 2HZYA 1PM3A 1WYXA 3G6EQ 3TU4K 4XQ3A 3VS1A 1YJNA 1A0NB 3MHXA 2RI5A 4BI3A 1QWFA 2YRCA 2O88A 2BE7D 4CC2A 3EH1A 4OMNA 2DBMA 2DYBA 1XJWB 3H0FA 1M1GA 4A4EA 1VQLT 4PNOA 2VC8A 3SEMA 2LJ0A 1YWOA 4O6JA 3X26B 2AZSA 4AFUC 1AWOA 4JLGA 3R6NA 4Z88A 2NUTA 1VIEA 3MP8A 4FYWB 2RB6A 4IUUA 5FWBA 3FLGA 1B7TA 2MIOA 4X1VA 5A2QE 2EGCA 2CDTA 1VQKA 3REAB 1M90R 2L89A 3ASKA 1N5ZA 1UGRB 2E41A 2ED1A 2FPFA 3JB9G 4NOYA 4XAXB 4TVRA 1YFNA 4QKUA 5I2SA 3M57A 1QVFS 4JS5A 2HQEA 4RG8A 1JB0E 2EQMA 1TSFA 1KK7A 3CC7A 1PKSA 2E70A 4L59A 5IHIA 4WTOB 4XTWA 4R55A 2DETA 3META 3MEWA 2DRKA 2F5TX 1KD1C 1PC0A 4Z8AA 2R5MA 4JUVA 4QW2A 2AK5A 5HK0A 3MEAA 1JJ2P 1ZHIA 1UGQB 4L5GA 3OYIA 2QQAA 1PD1A 3PTAA 1XQHA 1NJIR 4F7UF 3SWNB 3G4ST 4M77G 1UFFA 4KH1B 2COWA 2QGGA 3NHNA 3RIRA 2YLBA 1YI2T 4M78G 1M3CA 3JCMJ 1RAEB 2E6NA 5KE3A 2IG0A 1MMDA 1FWZA 2OTJT 2FPEA 4KGVB 3LX7A 4PK4A 1KHCA 3EFOB 3QBYA 5KE2A 3EGUA 1W2BP 3H8ZA 1FX7A 4RG2A 4RTWA 1OZ2A 3SWNA 5I11A 2R58A 4JLIA 4XU3A 2F69A 2P0QA 4XTZA 2F5KA 2CZ1B 2COZA 3L2QA 3HHTB 4BI4A 3OMGA 1OQKA 2YXYA 1YCSB 1ZA2B 4J9BA 2KMTA 2LNVA 2QTXA 1Z9ZA 2P84A 5GAMj 1M2VB 3SWNC 3VS0A 2QQRA 5C0MA 5KYWA 1ZA1B 3CCLA 2GGRA 4Y28E 2JN0A 3OW2P 1B34B 3CPFA 4FM4B 2ROTA 1P92A 5GAN7 4FYYB 3UF4A 1KQ1A 3PMIA 1JJ2A 2EYXA 4Z02A 4F04B 1VUBA 1Q81U 1K9MC 1D1BA 3CC2A 2VKNA 4M78B 1WHJA 2QK0A 4PFOA 3EGXA 5LJ3f 3EH2A 2ZAEA 1VQKQ 2YRVA 2CP7A 3CMEA 3LYIA 1VQLQ 3VUBA 4PJOB 3A98A 2I0NA 3M0QA 4GBQA 4BB7A 2G3RA 4F16A 3OBWA 1Q7YC 1KIKA 1Q82R 5LL6S 2X51A 3JRZA 4HXJA 3I55A 2G6FX 3CC7Q 2X3WD 1O9SA 1YITT 3ME9A 2E1HA 3G1JA 2RMOA 2X4JA 4LNPA 3RKWA 4OVAA 2D8JA 1I5OB 1NPPA 2H3JA 3E9FA 2VXFA 3MEVA 4KRTA 2KRSA 3VYHB 4C8QB 1BU1A 3BY7A 4WF2A 2O31A 1OOTA 1KG1A 5KCHA 2ZCFB 1GCQC 4BACA 3TSZA 1IZ6A 2CZ0B 4HVVA 3EGDA 1HXDA 4JRKA 2F1LA 1DJ7B 5CAIA 5EC7A 3A8GB 4LDUA 5A0DA 5LJ3g 4LD9K 1OI1A 3CCMT 2E5KA 2QYZA 1M90C 4PJOC 1AHJB 3OW2A 3P8BB 2XG8D 1D0XA 2J06A 4C8QA 4C5IA 1X6BA 1VQ6A 3QG1A 1VQ8A 2LQNA 3ZBDA 5LJ3e 1BK2A 1KQSS 2HNIA 3CD6A 3M0SA 2L0AA 1MMNA 3G4SQ 2EJFA 1QW1A 1YN8A 4AFSC 1SSHA 4JDSA 5CKDA 3RMSA 1HYOA 4UC4A 1JO8A 1N27A 1W2BS 5L23A 3UA6A 1K0XA 1K8AU 4C8QC 1WJQA 2YUQA 1QCOA 1VQOT 2CH4A 1LJOA 2E3HA 5GAN5 2HQHA 3MPUB 3JCMQ 3RR6A 2FRYA 3O5ZA 1AWXA 1NJIC 2FVUA 2KQWA 2DEUA 1AOJA 3TEEA 2BKDN 4ESRA 3GLXA 2ZZDA 2MPXC 3CCLQ 1UEBA 5L8RE 3MCAB 3QZ5B 3CCET 3L42A 3QSUA 1UGSB 2D0QB 3RNJA 2COYA 1IGQA 2A7YA 5KYXA 1R77A 2K4YA 1S72A 3DKMA 3TVTA 1GCPA 2DK3A 1BB9A 4HCCA 1QKXA 4J9HA 2V1QA 2C0TA 2OX7A 3L2VA 3CCJA 3CC2Q 1K76A 5IHNA 4JPBW 3TREA 1QQJA 2PTKA 4A4GA 3JCMd 2K7AA 1WHGA 5I22A 5AYFA 4R56A 2DE0X 3CMEQ 2QGFB 3FJPA 3G6ET 1TG0A 2KK4A 1YBYA 2DF6A 2MWOA 1G8XA 2E65A 3UWNA 1HSQA 2DD5A 1U06A 5I2MA 1R0BG 2XICA 1SSFA 1E7OA 3I55Q 1UG1A 4HCZA 1OEBA 1H3ZA 1PG5B 3HFNA 4JRQA 4C0FA 2LT1A 1QVGS 2LCLA 1ABQA 3TSWA 5GANd 5CO7A 2DKGA 2L3PA 4Y92A 1JEGA 2LVMA 5GANf 1M27C 2L3SA 3OYDA 2LRQA 2ZPIB 4BDYA 2LNHB 2WSFE 3QWYA 2O2OA 4OMQA 4F7UA 1X01A 3ULRB 4JS4A 1YITQ 3LWIA 3SFMA 2ENMA 3BDUA 3WVEB 1G3WA 2CP2A 1BCMA 1ZUYA 4QT7A 1K73U 1IREB 1ACMB 8AT1B 4GLMA 1WHHA 3NTHA 4RTVA 5KYYB 2Y4XA 4ORZA 3OYJA 1MNDA 2HL3A 3CXCA 3OBYA 1Q82C 2HEQA 1VQ6Q 3X20B 4ZGEB 1VQ8Q 3JCMh 3HSBA 3QDRB 3CD6Q 2CS7A 4EIKA 5D6XA 4PJOE 1G83A 4BE1A 4ZTJA 3V8JA 4FT2A 1WJSA 4PKCC 3OSSC 3M58A 3QKJA 5FU7B 1WNLA 2NUZA 4P5NA 4M4ZA 3C4SA 1UGVA 4KULA 5FRNA 4ZGJB 4LE9A 2DTIA 2GQIA 4LDYA 3I35A 5LJ5j 2DYIA 5A0GA 5I21A 5GANh 4M77F 4ATOA 1CSKA 2VGMA 2MAMA 4C8QE 5CK9A 4M78F 3M0UA 3GF5A 2LQKA 2L2PA 3UATA 4OMMA 1SHGA 3QJ6A 2DJZA 1TWBA 1S72Q 2K9GA 2X35A 2KRMA 3M56A 5GJWB 1CKAA 3MO8A 3HRTA 4M7DG 3NTKA 5J3BA 4C5GA 3VRZA 2GFAA 4J8OA 1U1SA 2BUDA 4FIBA 3CCJQ 3BW1A 1MNEA 5FU7C 1N6AA 2DL4A 2LQWA 1KD1U 2M16A 3M5AA 2X4YA 1W70A 1M9SA 2DX1A 4ZNXA 3M4GA 1FXXA 3H0HA 5CVIA 3OYFA 1KC8R 4PJOD 4QVZA 1OPKA 1WQ7A 2PQWA 3U23A 1TH7A 1YJNT 2KYBA 4A4FA 2FYKA 2K3BA 1I81A 1YHQA 2L8DA 4JJDA 5GAN6 3L2ZA 2WACA 1SRLA 1FMKA 2CT4A 1YJWA 1Y96B 4J9DA 2JS2A 2KAFA 3I56A 2XD0A 3HRSA 4RTXA 1PWTA 4C8QD 3H6ZA 3KFVA 2FO0A 1AWJA 4ELYC 3EG9A 2AT1B 1TXQA 2MK5A 2E6ZA 3RKXA 5GAN8 2QDLA 4AG2C 1VQKT 4HA8A 1TOVA 3RBBB 3PT9A 2VVKA 2V8IA 2E3IA 4CC7A 4DQ2A 2CSQA 3PVLA 4M7DB 5GJVB 1Y96A 1PCXA 2EQKA 1EX4A 3CC7T 3V8KA 1LNXA 2CP5A 6AT1B 3H9NA 1WGSA 1UECA 3LH5A 3VS5A 1PSEA 1C1AA 1SPKA 1B3QA 4LN2A 1MMGA 5FU6B 5CKEA 4HVWA 4F7UE 1QKWA 2MF2A 3JCMP 2KDSA 1U1TA 2MOXA 4DBRA 1K1ZA 4XTYA 4QQ6A 3CMAA 2JJ9A 3L2UA 4DOWA 2BIVA 4BDZA 1WI7A 4OMOA 2ZPEB 1TTHB 5J39A 4RTZA 2SRCA 3KBGA 2NLUA 4N0AC 4FYXB 2VYTA 4IUTA 1OX9A 4ZTFA 5KCOA 2F2WA 1NEGA 4M7AG 1K9MU 2FPDA 4LXCA 1IXDA 2KE9A 3OS2A 1Y7XA 1OYXA 3JCMX 4JJNK 4X34A 2O9SA 1ZQ1A 5J26A 3EHQA 4OMFB 4EPCA 3X25B 3CCRA 1C6VX 2DNUA 4A4HA 1Q7YU 1B07A 4KH0B 1Q81R 2HAXA 1NBEB 3GP8A 2J7IA 5FU6C 1GBRA 4FYVB 2V8JA 3KXTA 2M0OA 4N4GA 2ZPFB 3GOXA 1WQWA 4A54A 1D3BB 4OGCA 3GNFB 3OYYA 4X9DA 5DM7R 2LC4A 2M02A 2A28A 1TUCA 1ARKA 4GY5A 4PLIA 5GAMg 2KXCA 3CC4A 1G3SA 3H41A 3QUIA 2A08A 3CCLT 4L6V5 1ZSZB 3HFOA 4C92G 1YHQQ 3QHSA 4BY6B 3G71A 5FROA 4M75G 2RNAA 4BD3A 3JCMc 3QJYA 3CPWP 5ECAA 2D9TA 3C95A 1YJWQ 1M90U 4KGXB 3I56Q 1F1BB 4MMLA 1HK9A 2JTEA 1MV3A 3EHRA 4OMLA 1YJNQ 1IGUA 1QCNA 2FG0A 2EQUA 3EFOA 1M1KR 3CC2T 4M7AB 4JRPA 1JXOA 1X43A 3JV3A 3QYGB 3M0RA 4IUQA 2CGHA 1PSFA 2KY9A 5GMKh 2FZGB 2R5AA 5FWCA 3CMET 3OYCA 1H3HA 5DY9A 4HT8A 4HT9A 4OB2B 4QQGA 2J05A 5GMKe 3A8LB 1SG5A 4M77B 1KC8C 2AHJB 2QQSA 4IUPA 2YDLA 5LJ3d 2C0IA 2XMFA 2H8HA 3I55T 1M2VA 1Q86R 4C0DB 4AFQC 4J9FA 4XU2A 2DZCA 2JT4A 1NJIU 3JCMb 2XDBA 4BY6C 2HKNA 4PFPA 2ZPHB 5IN1A 1B34A 2A36A 4XK8E 1KQ2A 1M8MA 2HCKA 2DEQA 3NPFA 4Q5WA 2EKHA 3RKYA 5KYNA 9ATCB 3CCUA 1Y57A 5CIUA 2M9UA 3CMAQ 3WVDB 1I07A 3I5SA 1BIAA 4J9GA 5CKFA 1AEYA 2P4TA 1GCQA 3LH0A 4OMPA 4C92B 3E2UA 5C6SA 4E2FB 4M78A 4QVDA 3DLMA 2EPDA 2H3EB 2JTMA 4M75B 2RJEA 3VU3C 2YLCA 3S6WA 2K3YA 1M5Q1 2VXEA 2HKQB 4PJOA 1JBMA 1AVZC 4LDVA 2K79A 4RCBA 1JJ2S 4M77C 1VA7A 1VQ6T 1VQ8T 3CPWA 1WA7A 3CD6T 2K57A 2DRMA 4M78C 1QCFA 2NUPB 2RM4A 3CCRQ 1I5LA 2DL3A 4ZGDB 3HRUA 4PLLA 4Y91A 3OYLA 1I1JA 2O9VA 4LUDA 4FL6A 2DTHA 2FHDA 3LLRA 2OAUA 2O4XB 3URGA 5LJ3h 2EQIA 2HQXA 3QXEB 3TCJA 4HCKA 2DBKA 2GBQA 2JM9A 5CQXA 2O01E 3X24B 2P0KA 5DLQE 3JSCA 2DXUA 2JTFA 4E6RA 4D8KA 2EGAA 1ZLMA 2CP6A 4QVCA 5CCAA 2DL7A 2QA4A 3CC4Q 2KEAA 3HTRA 4CC4B 3GNGA 4N4IA 1N8RR 1NYGA 2EGEA 3CCSA 1K9AA 3JAME 4N4HA 4EMKB 3G71Q 3EAEA 4ELZC 4XTVA 1S72T 2EYZA 2K5FA 4M7DF 3CBMA 3LGFA 3QWXX 2E12A 1NPRA 2MMPA 3UPUA 1VQ9A 1Q81C 3X28B 1Q82U 3CCJT 1VQ7A 2F2XA 2JMCA 3L1AA 2EBPA 1VQMA 1BYMA 3CXCP 4C5EA 1SEMA 2JOYA 5CKHA 1G2BA 4RUGA 3OW2S 1WXBA 1OU9A 4IIMA 1VYVA 1YJ9A 4E7IA 1NLOC 3JB9H 1U8RA 3NFCA 4CI0C 2CZ7B 2YHTA 1MUZA 3C94A 2XIDA 4DBFA 1BBZA 2VWFA 3BDLA 2QASA 2GFUA 2ESWA
chains in the Genus database with same CATH topology
2K2MA 4OMMA 1SHGA 1U3OA 2DRKA 2K9GA 2KRMA 5GJWB 4Z8AA 4FSSA 1CKAA 1IO6A 4LUEA 1S1NA 1E6HA 1NLPC 4R0KA 3EG0A 2AK5A 2GNCA 2LJ1A 3VRZA 3EG1A 2YUPA 2J6FA 1UTIA 3VS4A 2CUBA 2LZ6B 1XOVA 2DL4A 2LQWA 2D1XA 1WXTA 2AZVA 1W70A 2DX1A 4ZNXA 1PRMC 5HCKA 2IIMA 3H0HA 3SHWA 2CT3A 1UFFA 1ABOA 1OPKA 1ZUKA 3NHNA 3REBB 3U23A 1M3CA 2KYBA 1UE9A 1PRLC 2FRWA 2K3BA 2K6DA 1WLPB 1W6XA 2KNBB 4JJDA 4J9CA 4WCIA 4DEYA 3VS6A 2YT6A 2FPEA 2HDAA 1H92A 2CSIA 2KBTA 4RTYA 1JXMA 1SRLA 1FMKA 2CT4A 4J9DA 1VYUA 5FW9A 3EGUA 2JS2A 3VRYA 4RTXA 4RTWA 1PWTA 2RN8A 1NEBA 5I11A 3KFVA 2FO0A 1AWJA 2RQWA 4RTTA 1JQQA 1U5SA 1AZGB 1YCSB 2QDLA 4J9BA 4AG2C 3RBBB 1X27A 2YSQA 2ROLA 2VVKA 3M0TA 1ZUUA 1Z9ZA 1UHFA 1MV0B 4CC7A 1OV3A 1LCKA 2CSQA 2F2VA 3VS0A 1Z9QA 3VS3A 3PVLA 1YWPA 2BZXA 5GJVB 1UJYA 2JM8A 2OJ2A 2GGRA 3CQTA 2JXBA 1HJDA 1K0SA 2ROTA 4IIOA 1TUDA 1UECA 3LH5A 3UF4A 3VS5A 1SPKA 1B3QA 2YUOA 4LN2A 1GRIA 4HVWA 1QKWA 2EYXA 1QLYA 1Y0MA 2MOXA 3GBQA 4AG1C 1K1ZA 1X69A 1UJ0A 1H8KA 2VKNA 1HD3A 1E6GA 2RQVA 2AKLA 1WI7A 4OMOA 2B86A 4JZ3A 3NMZC 4RTZA 2A37A 2SRCA 2MCNA 3A98A 2I0NA 1ZX6A 1I0CA 3M0QA 4GBQA 1ZSGA 4F16A 2X3XD 2KR3A 1V1CA 1NM7A 1GL5A 2ED0A 2D8HA 2F2WA 1KIKA 1NEGA 1WFWA 1M30A 2FPDA 3M0PA 2KE9A 2DVJA 4HXJA 2G6FX 2CREA 2JW4A 2X3WD 2DA9A 2O9SA 2RMOA 4LNPA 1X2KA 3EHQA 2BZYA 1VYTA 2D8JA 2D0NA 2DNUA 1RUWA 1B07A 4KRTA 1GFDA 2YUNA 2KRSA 1KFZA 1BU1A 1WXUA 2HSPA 2KT8A 2O31A 2J7IA 2KROA 1OOTA 1GBRA 2ABLA 1UUEA 1GCQC 3TSZA 1OPLA 2J6OA 2EYWA 1YNZA 4HVVA 1SHFA 4J9EA 5EC7A 1CKBA 4JJBA 2A28A 1K4US 1TUCA 2E5KA 1ARKA 2KXCA 3H41A 4JZ4A 2A08A 4HVUA 1ZBJA 2J06A 1GBQA 2LP5A 1X6BA 2L3QA 1PKTA 4RTUA 2LQNA 1UDLA 1BK2A 2LMJA 2RQRA 2RNAA 3M0SA 3C0CA 2L0AA 5ECAA 1YN8A 4AFSC 1SSHA 1QWEA 1GFCA 2JTEA 1MV3A 3EHRA 1T3LA 4OMLA 2BTTA 1JO8A 2FG0A 2DILA 2J6KA 5L23A 1PNJA 5IXFA 3UA6A 1K0XA 1JXOA 2YUQA 1RI9A 1X43A 2FEIA 3JV3A 3UA7A 2GTOA 2CH4A 3M0RA 5FWCA 4D8DA 2C0OA 1T0JA 1H3HA 2FRYA 3O5ZA 1AWXA 2J05A 1AOJA 2JS0A 3IQLA 2P4RA 4DEXA 4ESRA 2YDLA 2DL5A 2EW3A 2OAWA 2C0IA 2XMFA 2H8HA 4K11A 1WDXA 3RNJA 1PHTA 4AFQC 4CC3A 2W10A 4J9FA 2KT1A 3EG2A 2EYYA 2JT4A 3VS2A 2KGTA 2CUDA 3TVTA 4F14A 1GCPA 2EVRA 2A36A 1BB9A 1M8MA 1EFNA 2DLPA 2ECZA 2HCKA 1QKXA 3NPFA 3I9QA 2EKHA 4J9HA 2V1QA 1Y57A 2C0TA 4J9IA 4A63B 1AD5A 1YP5A 1I07A 1K76A 3I5SA 4J9GA 1AEYA 1FYNA 1T3SA 1GCQA 1AZEA 5IHNA 4JPBW 2PTKA 3PVQA 1SRMA 4OMPA 2K7AA 5I22A 1AWWA 2DE0X 2EPDA 2RPNA 1M3BA 1TG0A 1J3TA 3PE0A 2DF6A 4JJCA 3NGPA 1KSWA 2LCSA 1HSQA 1U06A 2DMOA 2LJ3A 1AVZC 3VS7A 2K79A 2KRNA 1E7OA 1UG1A 1WIEA 1OEBA 1VA7A 3ZL7C 5IHKA 4Z89A 2KXDA 1X6GA 1JU5C 1WA7A 1ABQA 2V1RA 2DRMA 3TSWA 2PNIA 1KJWA 1QCFA 2DL8A 2DL3A 2L3PA 4Y92A 2HBWA 1JEGA 4AFZC 2OI3A 1M27C 2L3SA 1I1JA 2O9VA 4LUDA 2M51A 2KYMA 1NYFA 3H0IA 2LNHB 2RQUA 3QWYA 2O2OA 2EQIA 4OMQA 2M0YA 1RLQC 3ULRB 4HCKA 1X2QA 3I5RA 2DBKA 2DJQA 2GBQA 2JM9A 1UHCA 1RLPC 2ENMA 2RQTA 2DM1A 1WYXA 3FJ5A 1ZUYA 4QT7A 1M3AA 4E6RA 4D8KA 4GLMA 2EGAA 5IH2A 1ZLMA 3EG3A 4RTVA 3VS1A 2DL7A 1A0NB 2KEAA 4F17A 4ORZA 1QWFA 4CC4B 2CH4W 2O88A 1WX6A 1NYGA 4CC2A 2EGEA 1K9AA 2HEQA 4OMNA 2DBMA 2DYBA 3H0FA 2JMAA 4EIKA 3THKA 2RF0A 1G83A 1NG2A 2EYZA 5IXBA 3SEMA 2LJ0A 1YWOA 2AZSA 4AFUC 3QWXX 1AWOA 3R6NA 4Z88A 2SEMA 2NUZA 4M4ZA 1UGVA 5FWBA 4LE9A 2F2XA 2LX7A 2GQIA 2JMCA 2EBPA 2MIOA 4X1VA 3I35A 2EGCA 1SEMA 2GTJA 2CDTA 1G2BA 3REAB 4RUGA 1N5ZA 1CSKA 1WXBA 2W0ZA 4IIMA 1T0HA 1VYVA 2BZ8A 2ED1A 2FPFA 2NWMA 1NLOC 1W1FA 2AKKA 3M0UA 1MUZA 2PZ1A 1BBZA 2L2PA 2VWFA 1PKSA 3UATA 5IHIA 2ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2M A;  4OMM A;  1SHG A;  1U3O A;  2DRK A;  2K9G A;  2KRM A;  5GJW B;  4Z8A A;  4FSS A;  1CKA A;  1IO6 A;  4LUE A;  1S1N A;  1E6H A;  1NLP C;  4R0K A;  3EG0 A;  2AK5 A;  2GNC A;  2LJ1 A;  3VRZ A;  3EG1 A;  2YUP A;  2J6F A;  1UTI A;  3VS4 A;  2CUB A;  2LZ6 B;  1XOV A;  2DL4 A;  2LQW A;  2D1X A;  1WXT A;  2AZV A;  1W70 A;  2DX1 A;  4ZNX A;  1PRM C;  5HCK A;  2IIM A;  3H0H A;  3SHW A;  2CT3 A;  1UFF A;  1ABO A;  1OPK A;  1ZUK A;  3NHN A;  3REB B;  3U23 A;  1M3C A;  2KYB A;  1UE9 A;  1PRL C;  2FRW A;  2K3B A;  2K6D A;  1WLP B;  1W6X A;  2KNB B;  4JJD A;  4J9C A;  4WCI A;  4DEY A;  3VS6 A;  2YT6 A;  2FPE A;  2HDA A;  1H92 A;  2CSI A;  2KBT A;  4RTY A;  1JXM A;  1SRL A;  1FMK A;  2CT4 A;  4J9D A;  1VYU A;  5FW9 A;  3EGU A;  2JS2 A;  3VRY A;  4RTX A;  4RTW A;  1PWT A;  2RN8 A;  1NEB A;  5I11 A;  3KFV A;  2FO0 A;  1AWJ A;  2RQW A;  4RTT A;  1JQQ A;  1U5S A;  1AZG B;  1YCS B;  2QDL A;  4J9B A;  4AG2 C;  3RBB B;  1X27 A;  2YSQ A;  2ROL A;  2VVK A;  3M0T A;  1ZUU A;  1Z9Z A;  1UHF A;  1MV0 B;  4CC7 A;  1OV3 A;  1LCK A;  2CSQ A;  2F2V A;  3VS0 A;  1Z9Q A;  3VS3 A;  3PVL A;  1YWP A;  2BZX A;  5GJV B;  1UJY A;  2JM8 A;  2OJ2 A;  2GGR A;  3CQT A;  2JXB A;  1HJD A;  1K0S A;  2ROT A;  4IIO A;  1TUD A;  1UEC A;  3LH5 A;  3UF4 A;  3VS5 A;  1SPK A;  1B3Q A;  2YUO A;  4LN2 A;  1GRI A;  4HVW A;  1QKW A;  2EYX A;  1QLY A;  1Y0M A;  2MOX A;  3GBQ A;  4AG1 C;  1K1Z A;  1X69 A;  1UJ0 A;  1H8K A;  2VKN A;  1HD3 A;  1E6G A;  2RQV A;  2AKL A;  1WI7 A;  4OMO A;  2B86 A;  4JZ3 A;  3NMZ C;  4RTZ A;  2A37 A;  2SRC A;  2MCN A;  3A98 A;  2I0N A;  1ZX6 A;  1I0C A;  3M0Q A;  4GBQ A;  1ZSG A;  4F16 A;  2X3X D;  2KR3 A;  1V1C A;  1NM7 A;  1GL5 A;  2ED0 A;  2D8H A;  2F2W A;  1KIK A;  1NEG A;  1WFW A;  1M30 A;  2FPD A;  3M0P A;  2KE9 A;  2DVJ A;  4HXJ A;  2G6F X;  2CRE A;  2JW4 A;  2X3W D;  2DA9 A;  2O9S A;  2RMO A;  4LNP A;  1X2K A;  3EHQ A;  2BZY A;  1VYT A;  2D8J A;  2D0N A;  2DNU A;  1RUW A;  1B07 A;  4KRT A;  1GFD A;  2YUN A;  2KRS A;  1KFZ A;  1BU1 A;  1WXU A;  2HSP A;  2KT8 A;  2O31 A;  2J7I A;  2KRO A;  1OOT A;  1GBR A;  2ABL A;  1UUE A;  1GCQ C;  3TSZ A;  1OPL A;  2J6O A;  2EYW A;  1YNZ A;  4HVV A;  1SHF A;  4J9E A;  5EC7 A;  1CKB A;  4JJB A;  2A28 A;  1K4U S;  1TUC A;  2E5K A;  1ARK A;  2KXC A;  3H41 A;  4JZ4 A;  2A08 A;  4HVU A;  1ZBJ A;  2J06 A;  1GBQ A;  2LP5 A;  1X6B A;  2L3Q A;  1PKT A;  4RTU A;  2LQN A;  1UDL A;  1BK2 A;  2LMJ A;  2RQR A;  2RNA A;  3M0S A;  3C0C A;  2L0A A;  5ECA A;  1YN8 A;  4AFS C;  1SSH A;  1QWE A;  1GFC A;  2JTE A;  1MV3 A;  3EHR A;  1T3L A;  4OML A;  2BTT A;  1JO8 A;  2FG0 A;  2DIL A;  2J6K A;  5L23 A;  1PNJ A;  5IXF A;  3UA6 A;  1K0X A;  1JXO A;  2YUQ A;  1RI9 A;  1X43 A;  2FEI A;  3JV3 A;  3UA7 A;  2GTO A;  2CH4 A;  3M0R A;  5FWC A;  4D8D A;  2C0O A;  1T0J A;  1H3H A;  2FRY A;  3O5Z A;  1AWX A;  2J05 A;  1AOJ A;  2JS0 A;  3IQL A;  2P4R A;  4DEX A;  4ESR A;  2YDL A;  2DL5 A;  2EW3 A;  2OAW A;  2C0I A;  2XMF A;  2H8H A;  4K11 A;  1WDX A;  3RNJ A;  1PHT A;  4AFQ C;  4CC3 A;  2W10 A;  4J9F A;  2KT1 A;  3EG2 A;  2EYY A;  2JT4 A;  3VS2 A;  2KGT A;  2CUD A;  3TVT A;  4F14 A;  1GCP A;  2EVR A;  2A36 A;  1BB9 A;  1M8M A;  1EFN A;  2DLP A;  2ECZ A;  2HCK A;  1QKX A;  3NPF A;  3I9Q A;  2EKH A;  4J9H A;  2V1Q A;  1Y57 A;  2C0T A;  4J9I A;  4A63 B;  1AD5 A;  1YP5 A;  1I07 A;  1K76 A;  3I5S A;  4J9G A;  1AEY A;  1FYN A;  1T3S A;  1GCQ A;  1AZE A;  5IHN A;  4JPB W;  2PTK A;  3PVQ A;  1SRM A;  4OMP A;  2K7A A;  5I22 A;  1AWW A;  2DE0 X;  2EPD A;  2RPN A;  1M3B A;  1TG0 A;  1J3T A;  3PE0 A;  2DF6 A;  4JJC A;  3NGP A;  1KSW A;  2LCS A;  1HSQ A;  1U06 A;  2DMO A;  2LJ3 A;  1AVZ C;  3VS7 A;  2K79 A;  2KRN A;  1E7O A;  1UG1 A;  1WIE A;  1OEB A;  1VA7 A;  3ZL7 C;  5IHK A;  4Z89 A;  2KXD A;  1X6G A;  1JU5 C;  1WA7 A;  1ABQ A;  2V1R A;  2DRM A;  3TSW A;  2PNI A;  1KJW A;  1QCF A;  2DL8 A;  2DL3 A;  2L3P A;  4Y92 A;  2HBW A;  1JEG A;  4AFZ C;  2OI3 A;  1M27 C;  2L3S A;  1I1J A;  2O9V A;  4LUD A;  2M51 A;  2KYM A;  1NYF A;  3H0I A;  2LNH B;  2RQU A;  3QWY A;  2O2O A;  2EQI A;  4OMQ A;  2M0Y A;  1RLQ C;  3ULR B;  4HCK A;  1X2Q A;  3I5R A;  2DBK A;  2DJQ A;  2GBQ A;  2JM9 A;  1UHC A;  1RLP C;  2ENM A;  2RQT A;  2DM1 A;  1WYX A;  3FJ5 A;  1ZUY A;  4QT7 A;  1M3A A;  4E6R A;  4D8K A;  4GLM A;  2EGA A;  5IH2 A;  1ZLM A;  3EG3 A;  4RTV A;  3VS1 A;  2DL7 A;  1A0N B;  2KEA A;  4F17 A;  4ORZ A;  1QWF A;  4CC4 B;  2CH4 W;  2O88 A;  1WX6 A;  1NYG A;  4CC2 A;  2EGE A;  1K9A A;  2HEQ A;  4OMN A;  2DBM A;  2DYB A;  3H0F A;  2JMA A;  4EIK A;  3THK A;  2RF0 A;  1G83 A;  1NG2 A;  2EYZ A;  5IXB A;  3SEM A;  2LJ0 A;  1YWO A;  2AZS A;  4AFU C;  3QWX X;  1AWO A;  3R6N A;  4Z88 A;  2SEM A;  2NUZ A;  4M4Z A;  1UGV A;  5FWB A;  4LE9 A;  2F2X A;  2LX7 A;  2GQI A;  2JMC A;  2EBP A;  2MIO A;  4X1V A;  3I35 A;  2EGC A;  1SEM A;  2GTJ A;  2CDT A;  1G2B A;  3REA B;  4RUG A;  1N5Z A;  1CSK A;  1WXB A;  2W0Z A;  4IIM A;  1T0H A;  1VYV A;  2BZ8 A;  2ED1 A;  2FPF A;  2NWM A;  1NLO C;  1W1F A;  2AKK A;  3M0U A;  1MUZ A;  2PZ1 A;  1BBZ A;  2L2P A;  2VWF A;  1PKS A;  3UAT A;  5IHI A;  2ESW A; 
#chains in the Genus database with same CATH topology
 2DXC A;  5GAN 4;  2R57 A;  4FSS A;  4EMK C;  1IO6 A;  1E6H A;  1NLP C;  1R8O B;  1C0M A;  3EG0 A;  2K5L A;  2RK1 A;  2LJ1 A;  4A4K A;  3EG1 A;  3BE3 A;  1VQ5 A;  2RA2 A;  2YUP A;  3CCU Q;  5DLO A;  4MDW A;  1UTI A;  3PNW C;  3VS4 A;  5FLX E;  2CUB A;  2LZ6 B;  1M1K C;  2AZV A;  4OGE A;  2LTO A;  3CCQ A;  1PRM C;  4XTU A;  3SHW A;  5CKB A;  5D6Y A;  2CT3 A;  3WXM B;  3M55 A;  4MZT A;  3EFR A;  1UE9 A;  2FRW A;  2XHC A;  1WLP B;  2KNB B;  4WCI A;  4DEY A;  4B9X A;  1YIJ A;  5GAO n;  2HDA A;  1H92 A;  3RDV A;  2KBT A;  8ATC B;  5M9O A;  5GAN 3;  2RI2 A;  1Q86 C;  2QXF A;  3CBP A;  2QQB A;  3JB9 F;  4M77 E;  1OX8 A;  3ZEH A;  5KYU B;  1NEB A;  1WPY A;  4M78 E;  4BE2 A;  3C12 A;  4PJM A;  3V7R A;  1U5S A;  1RI0 A;  1ZBX A;  1AZG B;  2RHX A;  2LQ8 A;  1O75 A;  2DER A;  4II1 A;  5D7U A;  5LJ5 g;  3HP9 A;  3QDF A;  1R0C B;  1ZUU A;  2PU9 B;  2PVD B;  4D6W A;  1G5V A;  1D09 B;  3VS3 A;  2QA4 Q;  4M7A F;  1UJY A;  2JM8 A;  3S3M A;  1VQP A;  3CQT A;  3JB9 D;  3CCS Q;  1X75 C;  2VB6 A;  5KYY A;  1WZO A;  2FZC B;  2QEX A;  3DB4 A;  4FT4 A;  4IIO A;  2XDP A;  4LD6 A;  1IRX A;  1QLY A;  2RI3 A;  2VAS A;  4PJN A;  1WHL A;  2RO0 A;  3GBQ A;  4AG1 C;  1VQ9 Q;  1MGQ A;  1VQ7 Q;  1H8K A;  1VOM A;  2GCX A;  3RUX A;  3PIO A;  2AKL A;  4JZ3 A;  1RAB B;  3NMZ C;  2A37 A;  4J5Y A;  5GAO m;  2MCN A;  1G3T A;  4J6Y A;  3CXC S;  1ZX6 A;  1I0C A;  2CP3 A;  1YJ9 Q;  1ZSG A;  1I8F A;  2KR3 A;  1V1C A;  1NM7 A;  2ED0 A;  3MP1 A;  3EFS A;  2XI9 A;  1WFW A;  3M0P A;  4M77 D;  2EWN A;  4O5V A;  5GAN j;  4C92 F;  1YHQ T;  4E7L A;  3NTI A;  1UGP B;  5GMK m;  2CRE A;  4M78 D;  2XU8 A;  2DA9 A;  2QAZ A;  1VIF A;  3KUF A;  1N8R C;  4M75 F;  4HCB A;  1TUG B;  1X2K A;  2D0N A;  4BI8 B;  1YJW T;  3I56 T;  4LDW A;  2MWP A;  2WSC E;  1GFD A;  2YUN A;  1X6O A;  2HSP A;  1RAC B;  2KRO A;  4NL2 A;  1IHV A;  2DIG A;  1WHM A;  3OYN A;  4EMH A;  3AT1 B;  1OPL A;  2EYW A;  2ATC B;  1SHF A;  1VQ4 A;  3AHU A;  3CCQ Q;  3CCV A;  4J6X A;  1EIF A;  4IUR A;  2V8K A;  4BE0 A;  2X9H A;  1K4U S;  4V2S A;  2AIR B;  4PFZ A;  3HKS A;  3MKD A;  1NZ9 A;  1ZBJ A;  1OZ3 A;  3JCM W;  5GAO q;  1GBQ A;  1LOJ A;  4RMO A;  1YIJ Q;  4RTU A;  4LDX A;  1AT1 B;  1OU8 A;  3O8V A;  2RK2 A;  2RQR A;  3C0C A;  2NUT B;  3A8H B;  4YTL A;  1QVF A;  2B8A A;  3VV0 A;  2RJC A;  1VQN A;  2CP0 A;  1QWE A;  1GFC A;  4E7K A;  2HSE B;  1T3L A;  2BTT A;  1FMW A;  1PNJ A;  4X9C A;  5IXF A;  3CMA T;  4RCC A;  1N9R A;  2FEI A;  3UA7 A;  3SD4 A;  1M4Z A;  2GTO A;  2QDY B;  2DAQ A;  4E7S A;  4D8D A;  1T0J A;  2E4H A;  4IKF A;  3FC3 A;  1BIB A;  4N0A A;  2JS0 A;  3IQL A;  4KT0 E;  2P4R A;  3RER A;  2HL5 C;  5CQY A;  4PJL A;  1VQP Q;  2DL5 A;  5IAY A;  4K11 A;  2VGN A;  2EJG A;  3J7A F;  5GAM d;  2NYS A;  1D0Y A;  1N9S A;  2QEX Q;  4M7D A;  4CC3 A;  2CZ6 B;  2W10 A;  3EG2 A;  2FZK B;  1VQL A;  2KGT A;  2CUD A;  3QPH A;  5GAM f;  2EJ9 A;  4F14 A;  1V76 A;  3CCR T;  2EVR A;  3V7C A;  1BI2 A;  3HL8 A;  2QQ9 A;  1LPL A;  3MJX A;  1EFN A;  1KC8 U;  3I9Q A;  2E10 A;  2XDD A;  1AD5 A;  2V26 A;  2A0F B;  1T3S A;  4M7D C;  1SRM A;  2E64 A;  1AWW A;  2LDM A;  3V7S A;  1M3B A;  1J3T A;  3PE0 A;  3NGP A;  4IUV A;  4OF1 A;  2EFI A;  3CC4 T;  3ZFJ A;  5GAO r;  3V8L A;  2KRN A;  3M9Q A;  4FSX A;  5IHK A;  4Z89 A;  4J6W A;  2KXD A;  3G71 T;  1RAD B;  2V1R A;  4XU1 A;  1KJW A;  2DL8 A;  2BE9 B;  4AFZ C;  2OI3 A;  3BFM A;  2L5Q A;  3JB9 J;  2KYM A;  1NYF A;  4KBM B;  1KQS P;  2RQU A;  2QTV A;  4B6M A;  2KI7 A;  4PJO G;  5GAM h;  1H64 1;  1IB8 A;  3VKI A;  3G7Z A;  4OB3 B;  1VQ4 Q;  3CCV Q;  2RQT A;  2DPP B;  3G4S A;  5GAM e;  5KYW B;  4DOV A;  3FJ5 A;  1M3A A;  3UT1 A;  4C5H A;  5IH2 A;  3EG3 A;  1YI2 A;  1D3B A;  2EIF A;  4F17 A;  4ME7 A;  2OTL T;  1I4K 1;  2CH4 W;  2DXT A;  1WX6 A;  5GAO p;  1BI0 A;  2OTJ A;  3R6O A;  1Y07 A;  1BI3 A;  1ZSZ A;  2JMA A;  3SB2 A;  4C8Q G;  3M54 A;  3THK A;  1Q95 G;  1NG2 A;  2RF0 A;  3OSV A;  5IXB A;  2PVO B;  1VQN Q;  4KUI A;  4E7Z A;  3FRN A;  2SEM A;  3EGX B;  3CCU T;  2JZ2 A;  2OTL A;  2KVQ G;  2QG9 B;  3OYH A;  2LX7 A;  3OQ5 A;  3OYA A;  5FRM A;  3VUZ A;  4FCY A;  1RAF B;  3LGL A;  4FW2 A;  2CKK A;  2GTJ A;  1ZSZ C;  3A5Z B;  1RAG B;  4M7A A;  2W0Z A;  3PIP A;  1T0H A;  2BZ8 A;  3OS1 A;  4AT1 B;  4BUG A;  2NWM A;  1RAI B;  1W1F A;  2AKK A;  1K8A R;  5HY6 A;  2PZ1 A;  5GMK j;  2P0P A;  3JB9 I;  3INZ A;  2X4X A;  2ZPB B;  5CR2 A;  4NS5 A;  4M77 A;  2K2M A;  3OMC A;  1U3O A;  3QYH B;  4M7A C;  3S3O A;  1TS9 A;  1S1N A;  4LUE A;  4AMC A;  4ZN3 A;  4R0K A;  3HPW A;  4E7H A;  3FEO A;  2GNC A;  1KQS A;  1QVG P;  2YWW A;  3EGD B;  2J6F A;  4MZP A;  1W4S A;  3VYG A;  1XOV A;  5KH6 A;  4RKU E;  2D1X A;  1WXT A;  3VJP A;  2LX9 A;  2Y4Y A;  1W2B A;  1WJR A;  5HCK A;  2XKO C;  2IIM A;  5EG2 A;  4NL3 A;  1ABO A;  1ZUK A;  4C0D C;  3REB B;  4CRI A;  4C92 A;  4PL6 A;  2QA4 T;  1QP2 A;  3FIF A;  4M7D E;  1PRL C;  2K6D A;  3F70 A;  2GF7 A;  4E47 A;  4JRI A;  4M75 A;  1M1K U;  1W6X A;  3CCS T;  1SKU B;  4J9C A;  4DBQ A;  3VS6 A;  2YT6 A;  1YIT A;  4XTX A;  5A0L A;  2CSI A;  4RTY A;  1JXM A;  3PMT A;  1RAH B;  3DLL A;  1VYU A;  5FW9 A;  3VRY A;  4C92 C;  2C06 A;  2RN8 A;  2NUP A;  1VQ9 T;  3FDR A;  2RQW A;  4M75 C;  1VQ7 T;  3E9G A;  2K3X A;  2X4W A;  2VV5 A;  4RTT A;  1JQQ A;  1VQM T;  3CEY A;  4DBH A;  2O4X A;  4F7U G;  1Q86 U;  2DXB A;  4FU6 A;  2HMA A;  1X27 A;  1UB4 A;  2YSQ A;  2EAY A;  2ROL A;  4MDX A;  3M0T A;  5LJ3 j;  1UHF A;  1MV0 B;  1YJ9 T;  3CCM A;  1OV3 A;  3Q1J A;  1YI2 Q;  1LCK A;  3P8H A;  2F2V A;  1Z9Q A;  4J7I A;  3CPW S;  2MI6 A;  1D1C A;  1YWP A;  2BZX A;  2PUO B;  1XTD A;  5KYX B;  2OJ2 A;  2Y90 A;  2JXB A;  1HJD A;  1K0S A;  2OTJ Q;  2XK0 A;  4VUB A;  2RHU A;  1TUD A;  5D6W A;  3OS0 A;  3QII A;  3TQ7 P;  1K73 R;  2RJF A;  2YUO A;  2DD4 A;  4EMK A;  1GRI A;  2RD1 A;  1QVG A;  1Y0M A;  1VQ5 T;  1X69 A;  2OTL Q;  1UJ0 A;  4M7D D;  2DTO A;  1HD3 A;  2RHI A;  1PD0 A;  1E6G A;  2RQV A;  4KUD K;  1BCO A;  1VQO A;  2JUF A;  2DFU A;  2B86 A;  2DZ9 A;  3CCQ T;  1XNI A;  1BKB A;  2L3R A;  2RHZ A;  1EZZ B;  2LCC A;  2X3X D;  4ANJ A;  3UDC A;  1GL5 A;  3ER0 A;  2D8H A;  3A8O B;  4HKE A;  5LJ5 d;  1M30 A;  2HBP A;  2DVJ A;  2LT4 A;  3CCE A;  2Z0W A;  3MP6 A;  5LJ5 f;  2JW4 A;  1V29 B;  1YIJ T;  2GQV A;  1LVK A;  2CYZ B;  2BZY A;  2K2V A;  1VYT A;  3JCM f;  3LWH A;  1IHW A;  2M1H A;  1RUW A;  4F7U B;  1RAA B;  3M4Y A;  3OB9 A;  1QVP A;  1KFZ A;  1WXU A;  1GXI E;  1G3Y A;  2KT8 A;  3P8D A;  1QMC A;  2D6F A;  1YCY A;  5IT9 E;  2ABL A;  1UUE A;  4M7A E;  5GMK i;  1N8R U;  4FW1 A;  4GLK A;  2J6O A;  1YNZ A;  1KHI A;  4MMK A;  3M59 A;  4J9E A;  3CBO A;  1NE8 A;  3FB9 A;  1MHN A;  2WSE E;  1CKB A;  3G6E A;  3MEU A;  2RHY A;  4JJB A;  1Y71 A;  5HK3 A;  4E7J A;  4JZ4 A;  1RL2 A;  1VQP T;  4HVU A;  3OYG A;  1BI1 A;  2HD0 A;  2LP5 A;  1KD1 R;  2L3Q A;  1PKT A;  1K8A C;  1D0Z A;  4J83 A;  4DA4 A;  3OS5 A;  3QZ9 B;  3DB3 A;  3T9N A;  2QEX T;  1UDL A;  2LMJ A;  3L2W A;  2RJD A;  2DO3 A;  3A1P A;  3OY9 A;  4KGZ B;  1TU0 B;  1M1F A;  3S3N A;  1MMA A;  2EQJ A;  5LJ5 h;  2EKO A;  4J7F A;  3JCM g;  2DIL A;  1QP3 A;  3LW5 E;  2J6K A;  5LJ5 e;  5KYU A;  1RI9 A;  2ZPG B;  4OB0 B;  4ZN1 A;  4C92 E;  2C0O A;  3JCM e;  1FMV A;  4M75 E;  1M2O A;  3OA6 A;  1QVF P;  2I2L A;  3CCM Q;  3M53 A;  2DIQ A;  2VUB A;  2PUK B;  4DEX A;  2DVE A;  4A53 A;  1D1A A;  4C0Z A;  2IPO B;  4XU0 A;  2EW3 A;  2OAW A;  5GAN g;  1WDX A;  1OUL A;  3JCM V;  3PGG A;  4M7A D;  4OP0 A;  1VQM Q;  1PHT A;  7AT1 B;  4PJJ A;  4EMG A;  1WHK A;  2KT1 A;  2EYY A;  2RH2 A;  3VS2 A;  3QO3 A;  1M8V A;  5HKC A;  2MYS A;  5GAN e;  2DLP A;  2ECZ A;  3D7S B;  3RES A;  2FB7 A;  4J9I A;  4A63 B;  1YP5 A;  3N5B B;  1FYN A;  4PJO F;  3OYK A;  1SF9 A;  1AZE A;  4C0G A;  2FL7 A;  3PVQ A;  2ZGW A;  1VQO Q;  1VQ4 T;  3RMQ A;  3CCV T;  5GAN 2;  3PFS A;  2RPN A;  5GAO l;  4MZM A;  2E5Q A;  4JJC A;  3L2R A;  5AT1 B;  4QQD A;  1KSW A;  2LCS A;  3SDZ A;  2DMO A;  2LJ3 A;  1VQ5 Q;  3VS7 A;  2K5I A;  3CCE Q;  1WIE A;  2YRD A;  2KSS A;  3ZL7 C;  3OYM A;  3GPL A;  1X6G A;  5GMK l;  1JU5 C;  2EYQ A;  1JRI A;  4C8Q F;  4C92 D;  2A3L A;  2PNI A;  4EDU A;  3J80 E;  3EG9 B;  3E1S A;  1VQN T;  3A8M B;  2HBW A;  4M75 D;  1K9M R;  1K73 C;  3OYB A;  3E19 A;  2M51 A;  3OYE A;  3H0I A;  3J81 E;  2JVV A;  2JNG A;  2PVG B;  2M0Y A;  1RLQ C;  4OB1 B;  1X2Q A;  3I5R A;  2DJQ A;  1UHC A;  3GIB A;  1RLP C;  1Q7Y R;  2QI2 A;  4B9W A;  2IVW A;  2DM1 A;  2HZY A;  1PM3 A;  1WYX A;  3G6E Q;  3TU4 K;  4XQ3 A;  3VS1 A;  1YJN A;  1A0N B;  3MHX A;  2RI5 A;  4BI3 A;  1QWF A;  2YRC A;  2O88 A;  2BE7 D;  4CC2 A;  3EH1 A;  4OMN A;  2DBM A;  2DYB A;  1XJW B;  3H0F A;  1M1G A;  4A4E A;  1VQL T;  4PNO A;  2VC8 A;  3SEM A;  2LJ0 A;  1YWO A;  4O6J A;  3X26 B;  2AZS A;  4AFU C;  1AWO A;  4JLG A;  3R6N A;  4Z88 A;  2NUT A;  1VIE A;  3MP8 A;  4FYW B;  2RB6 A;  4IUU A;  5FWB A;  3FLG A;  1B7T A;  2MIO A;  4X1V A;  5A2Q E;  2EGC A;  2CDT A;  1VQK A;  3REA B;  1M90 R;  2L89 A;  3ASK A;  1N5Z A;  1UGR B;  2E41 A;  2ED1 A;  2FPF A;  3JB9 G;  4NOY A;  4XAX B;  4TVR A;  1YFN A;  4QKU A;  5I2S A;  3M57 A;  1QVF S;  4JS5 A;  2HQE A;  4RG8 A;  1JB0 E;  2EQM A;  1TSF A;  1KK7 A;  3CC7 A;  1PKS A;  2E70 A;  4L59 A;  5IHI A;  4WTO B;  4XTW A;  4R55 A;  2DET A;  3MET A;  3MEW A;  2DRK A;  2F5T X;  1KD1 C;  1PC0 A;  4Z8A A;  2R5M A;  4JUV A;  4QW2 A;  2AK5 A;  5HK0 A;  3MEA A;  1JJ2 P;  1ZHI A;  1UGQ B;  4L5G A;  3OYI A;  2QQA A;  1PD1 A;  3PTA A;  1XQH A;  1NJI R;  4F7U F;  3SWN B;  3G4S T;  4M77 G;  1UFF A;  4KH1 B;  2COW A;  2QGG A;  3NHN A;  3RIR A;  2YLB A;  1YI2 T;  4M78 G;  1M3C A;  3JCM J;  1RAE B;  2E6N A;  5KE3 A;  2IG0 A;  1MMD A;  1FWZ A;  2OTJ T;  2FPE A;  4KGV B;  3LX7 A;  4PK4 A;  1KHC A;  3EFO B;  3QBY A;  5KE2 A;  3EGU A;  1W2B P;  3H8Z A;  1FX7 A;  4RG2 A;  4RTW A;  1OZ2 A;  3SWN A;  5I11 A;  2R58 A;  4JLI A;  4XU3 A;  2F69 A;  2P0Q A;  4XTZ A;  2F5K A;  2CZ1 B;  2COZ A;  3L2Q A;  3HHT B;  4BI4 A;  3OMG A;  1OQK A;  2YXY A;  1YCS B;  1ZA2 B;  4J9B A;  2KMT A;  2LNV A;  2QTX A;  1Z9Z A;  2P84 A;  5GAM j;  1M2V B;  3SWN C;  3VS0 A;  2QQR A;  5C0M A;  5KYW A;  1ZA1 B;  3CCL A;  2GGR A;  4Y28 E;  2JN0 A;  3OW2 P;  1B34 B;  3CPF A;  4FM4 B;  2ROT A;  1P92 A;  5GAN 7;  4FYY B;  3UF4 A;  1KQ1 A;  3PMI A;  1JJ2 A;  2EYX A;  4Z02 A;  4F04 B;  1VUB A;  1Q81 U;  1K9M C;  1D1B A;  3CC2 A;  2VKN A;  4M78 B;  1WHJ A;  2QK0 A;  4PFO A;  3EGX A;  5LJ3 f;  3EH2 A;  2ZAE A;  1VQK Q;  2YRV A;  2CP7 A;  3CME A;  3LYI A;  1VQL Q;  3VUB A;  4PJO B;  3A98 A;  2I0N A;  3M0Q A;  4GBQ A;  4BB7 A;  2G3R A;  4F16 A;  3OBW A;  1Q7Y C;  1KIK A;  1Q82 R;  5LL6 S;  2X51 A;  3JRZ A;  4HXJ A;  3I55 A;  2G6F X;  3CC7 Q;  2X3W D;  1O9S A;  1YIT T;  3ME9 A;  2E1H A;  3G1J A;  2RMO A;  2X4J A;  4LNP A;  3RKW A;  4OVA A;  2D8J A;  1I5O B;  1NPP A;  2H3J A;  3E9F A;  2VXF A;  3MEV A;  4KRT A;  2KRS A;  3VYH B;  4C8Q B;  1BU1 A;  3BY7 A;  4WF2 A;  2O31 A;  1OOT A;  1KG1 A;  5KCH A;  2ZCF B;  1GCQ C;  4BAC A;  3TSZ A;  1IZ6 A;  2CZ0 B;  4HVV A;  3EGD A;  1HXD A;  4JRK A;  2F1L A;  1DJ7 B;  5CAI A;  5EC7 A;  3A8G B;  4LDU A;  5A0D A;  5LJ3 g;  4LD9 K;  1OI1 A;  3CCM T;  2E5K A;  2QYZ A;  1M90 C;  4PJO C;  1AHJ B;  3OW2 A;  3P8B B;  2XG8 D;  1D0X A;  2J06 A;  4C8Q A;  4C5I A;  1X6B A;  1VQ6 A;  3QG1 A;  1VQ8 A;  2LQN A;  3ZBD A;  5LJ3 e;  1BK2 A;  1KQS S;  2HNI A;  3CD6 A;  3M0S A;  2L0A A;  1MMN A;  3G4S Q;  2EJF A;  1QW1 A;  1YN8 A;  4AFS C;  1SSH A;  4JDS A;  5CKD A;  3RMS A;  1HYO A;  4UC4 A;  1JO8 A;  1N27 A;  1W2B S;  5L23 A;  3UA6 A;  1K0X A;  1K8A U;  4C8Q C;  1WJQ A;  2YUQ A;  1QCO A;  1VQO T;  2CH4 A;  1LJO A;  2E3H A;  5GAN 5;  2HQH A;  3MPU B;  3JCM Q;  3RR6 A;  2FRY A;  3O5Z A;  1AWX A;  1NJI C;  2FVU A;  2KQW A;  2DEU A;  1AOJ A;  3TEE A;  2BKD N;  4ESR A;  3GLX A;  2ZZD A;  2MPX C;  3CCL Q;  1UEB A;  5L8R E;  3MCA B;  3QZ5 B;  3CCE T;  3L42 A;  3QSU A;  1UGS B;  2D0Q B;  3RNJ A;  2COY A;  1IGQ A;  2A7Y A;  5KYX A;  1R77 A;  2K4Y A;  1S72 A;  3DKM A;  3TVT A;  1GCP A;  2DK3 A;  1BB9 A;  4HCC A;  1QKX A;  4J9H A;  2V1Q A;  2C0T A;  2OX7 A;  3L2V A;  3CCJ A;  3CC2 Q;  1K76 A;  5IHN A;  4JPB W;  3TRE A;  1QQJ A;  2PTK A;  4A4G A;  3JCM d;  2K7A A;  1WHG A;  5I22 A;  5AYF A;  4R56 A;  2DE0 X;  3CME Q;  2QGF B;  3FJP A;  3G6E T;  1TG0 A;  2KK4 A;  1YBY A;  2DF6 A;  2MWO A;  1G8X A;  2E65 A;  3UWN A;  1HSQ A;  2DD5 A;  1U06 A;  5I2M A;  1R0B G;  2XIC A;  1SSF A;  1E7O A;  3I55 Q;  1UG1 A;  4HCZ A;  1OEB A;  1H3Z A;  1PG5 B;  3HFN A;  4JRQ A;  4C0F A;  2LT1 A;  1QVG S;  2LCL A;  1ABQ A;  3TSW A;  5GAN d;  5CO7 A;  2DKG A;  2L3P A;  4Y92 A;  1JEG A;  2LVM A;  5GAN f;  1M27 C;  2L3S A;  3OYD A;  2LRQ A;  2ZPI B;  4BDY A;  2LNH B;  2WSF E;  3QWY A;  2O2O A;  4OMQ A;  4F7U A;  1X01 A;  3ULR B;  4JS4 A;  1YIT Q;  3LWI A;  3SFM A;  2ENM A;  3BDU A;  3WVE B;  1G3W A;  2CP2 A;  1BCM A;  1ZUY A;  4QT7 A;  1K73 U;  1IRE B;  1ACM B;  8AT1 B;  4GLM A;  1WHH A;  3NTH A;  4RTV A;  5KYY B;  2Y4X A;  4ORZ A;  3OYJ A;  1MND A;  2HL3 A;  3CXC A;  3OBY A;  1Q82 C;  2HEQ A;  1VQ6 Q;  3X20 B;  4ZGE B;  1VQ8 Q;  3JCM h;  3HSB A;  3QDR B;  3CD6 Q;  2CS7 A;  4EIK A;  5D6X A;  4PJO E;  1G83 A;  4BE1 A;  4ZTJ A;  3V8J A;  4FT2 A;  1WJS A;  4PKC C;  3OSS C;  3M58 A;  3QKJ A;  5FU7 B;  1WNL A;  2NUZ A;  4P5N A;  4M4Z A;  3C4S A;  1UGV A;  4KUL A;  5FRN A;  4ZGJ B;  4LE9 A;  2DTI A;  2GQI A;  4LDY A;  3I35 A;  5LJ5 j;  2DYI A;  5A0G A;  5I21 A;  5GAN h;  4M77 F;  4ATO A;  1CSK A;  2VGM A;  2MAM A;  4C8Q E;  5CK9 A;  4M78 F;  3M0U A;  3GF5 A;  2LQK A;  2L2P A;  3UAT A;  4OMM A;  1SHG A;  3QJ6 A;  2DJZ A;  1TWB A;  1S72 Q;  2K9G A;  2X35 A;  2KRM A;  3M56 A;  5GJW B;  1CKA A;  3MO8 A;  3HRT A;  4M7D G;  3NTK A;  5J3B A;  4C5G A;  3VRZ A;  2GFA A;  4J8O A;  1U1S A;  2BUD A;  4FIB A;  3CCJ Q;  3BW1 A;  1MNE A;  5FU7 C;  1N6A A;  2DL4 A;  2LQW A;  1KD1 U;  2M16 A;  3M5A A;  2X4Y A;  1W70 A;  1M9S A;  2DX1 A;  4ZNX A;  3M4G A;  1FXX A;  3H0H A;  5CVI A;  3OYF A;  1KC8 R;  4PJO D;  4QVZ A;  1OPK A;  1WQ7 A;  2PQW A;  3U23 A;  1TH7 A;  1YJN T;  2KYB A;  4A4F A;  2FYK A;  2K3B A;  1I81 A;  1YHQ A;  2L8D A;  4JJD A;  5GAN 6;  3L2Z A;  2WAC A;  1SRL A;  1FMK A;  2CT4 A;  1YJW A;  1Y96 B;  4J9D A;  2JS2 A;  2KAF A;  3I56 A;  2XD0 A;  3HRS A;  4RTX A;  1PWT A;  4C8Q D;  3H6Z A;  3KFV A;  2FO0 A;  1AWJ A;  4ELY C;  3EG9 A;  2AT1 B;  1TXQ A;  2MK5 A;  2E6Z A;  3RKX A;  5GAN 8;  2QDL A;  4AG2 C;  1VQK T;  4HA8 A;  1TOV A;  3RBB B;  3PT9 A;  2VVK A;  2V8I A;  2E3I A;  4CC7 A;  4DQ2 A;  2CSQ A;  3PVL A;  4M7D B;  5GJV B;  1Y96 A;  1PCX A;  2EQK A;  1EX4 A;  3CC7 T;  3V8K A;  1LNX A;  2CP5 A;  6AT1 B;  3H9N A;  1WGS A;  1UEC A;  3LH5 A;  3VS5 A;  1PSE A;  1C1A A;  1SPK A;  1B3Q A;  4LN2 A;  1MMG A;  5FU6 B;  5CKE A;  4HVW A;  4F7U E;  1QKW A;  2MF2 A;  3JCM P;  2KDS A;  1U1T A;  2MOX A;  4DBR A;  1K1Z A;  4XTY A;  4QQ6 A;  3CMA A;  2JJ9 A;  3L2U A;  4DOW A;  2BIV A;  4BDZ A;  1WI7 A;  4OMO A;  2ZPE B;  1TTH B;  5J39 A;  4RTZ A;  2SRC A;  3KBG A;  2NLU A;  4N0A C;  4FYX B;  2VYT A;  4IUT A;  1OX9 A;  4ZTF A;  5KCO A;  2F2W A;  1NEG A;  4M7A G;  1K9M U;  2FPD A;  4LXC A;  1IXD A;  2KE9 A;  3OS2 A;  1Y7X A;  1OYX A;  3JCM X;  4JJN K;  4X34 A;  2O9S A;  1ZQ1 A;  5J26 A;  3EHQ A;  4OMF B;  4EPC A;  3X25 B;  3CCR A;  1C6V X;  2DNU A;  4A4H A;  1Q7Y U;  1B07 A;  4KH0 B;  1Q81 R;  2HAX A;  1NBE B;  3GP8 A;  2J7I A;  5FU6 C;  1GBR A;  4FYV B;  2V8J A;  3KXT A;  2M0O A;  4N4G A;  2ZPF B;  3GOX A;  1WQW A;  4A54 A;  1D3B B;  4OGC A;  3GNF B;  3OYY A;  4X9D A;  5DM7 R;  2LC4 A;  2M02 A;  2A28 A;  1TUC A;  1ARK A;  4GY5 A;  4PLI A;  5GAM g;  2KXC A;  3CC4 A;  1G3S A;  3H41 A;  3QUI A;  2A08 A;  3CCL T;  4L6V 5;  1ZSZ B;  3HFO A;  4C92 G;  1YHQ Q;  3QHS A;  4BY6 B;  3G71 A;  5FRO A;  4M75 G;  2RNA A;  4BD3 A;  3JCM c;  3QJY A;  3CPW P;  5ECA A;  2D9T A;  3C95 A;  1YJW Q;  1M90 U;  4KGX B;  3I56 Q;  1F1B B;  4MML A;  1HK9 A;  2JTE A;  1MV3 A;  3EHR A;  4OML A;  1YJN Q;  1IGU A;  1QCN A;  2FG0 A;  2EQU A;  3EFO A;  1M1K R;  3CC2 T;  4M7A B;  4JRP A;  1JXO A;  1X43 A;  3JV3 A;  3QYG B;  3M0R A;  4IUQ A;  2CGH A;  1PSF A;  2KY9 A;  5GMK h;  2FZG B;  2R5A A;  5FWC A;  3CME T;  3OYC A;  1H3H A;  5DY9 A;  4HT8 A;  4HT9 A;  4OB2 B;  4QQG A;  2J05 A;  5GMK e;  3A8L B;  1SG5 A;  4M77 B;  1KC8 C;  2AHJ B;  2QQS A;  4IUP A;  2YDL A;  5LJ3 d;  2C0I A;  2XMF A;  2H8H A;  3I55 T;  1M2V A;  1Q86 R;  4C0D B;  4AFQ C;  4J9F A;  4XU2 A;  2DZC A;  2JT4 A;  1NJI U;  3JCM b;  2XDB A;  4BY6 C;  2HKN A;  4PFP A;  2ZPH B;  5IN1 A;  1B34 A;  2A36 A;  4XK8 E;  1KQ2 A;  1M8M A;  2HCK A;  2DEQ A;  3NPF A;  4Q5W A;  2EKH A;  3RKY A;  5KYN A;  9ATC B;  3CCU A;  1Y57 A;  5CIU A;  2M9U A;  3CMA Q;  3WVD B;  1I07 A;  3I5S A;  1BIA A;  4J9G A;  5CKF A;  1AEY A;  2P4T A;  1GCQ A;  3LH0 A;  4OMP A;  4C92 B;  3E2U A;  5C6S A;  4E2F B;  4M78 A;  4QVD A;  3DLM A;  2EPD A;  2H3E B;  2JTM A;  4M75 B;  2RJE A;  3VU3 C;  2YLC A;  3S6W A;  2K3Y A;  1M5Q 1;  2VXE A;  2HKQ B;  4PJO A;  1JBM A;  1AVZ C;  4LDV A;  2K79 A;  4RCB A;  1JJ2 S;  4M77 C;  1VA7 A;  1VQ6 T;  1VQ8 T;  3CPW A;  1WA7 A;  3CD6 T;  2K57 A;  2DRM A;  4M78 C;  1QCF A;  2NUP B;  2RM4 A;  3CCR Q;  1I5L A;  2DL3 A;  4ZGD B;  3HRU A;  4PLL A;  4Y91 A;  3OYL A;  1I1J A;  2O9V A;  4LUD A;  4FL6 A;  2DTH A;  2FHD A;  3LLR A;  2OAU A;  2O4X B;  3URG A;  5LJ3 h;  2EQI A;  2HQX A;  3QXE B;  3TCJ A;  4HCK A;  2DBK A;  2GBQ A;  2JM9 A;  5CQX A;  2O01 E;  3X24 B;  2P0K A;  5DLQ E;  3JSC A;  2DXU A;  2JTF A;  4E6R A;  4D8K A;  2EGA A;  1ZLM A;  2CP6 A;  4QVC A;  5CCA A;  2DL7 A;  2QA4 A;  3CC4 Q;  2KEA A;  3HTR A;  4CC4 B;  3GNG A;  4N4I A;  1N8R R;  1NYG A;  2EGE A;  3CCS A;  1K9A A;  3JAM E;  4N4H A;  4EMK B;  3G71 Q;  3EAE A;  4ELZ C;  4XTV A;  1S72 T;  2EYZ A;  2K5F A;  4M7D F;  3CBM A;  3LGF A;  3QWX X;  2E12 A;  1NPR A;  2MMP A;  3UPU A;  1VQ9 A;  1Q81 C;  3X28 B;  1Q82 U;  3CCJ T;  1VQ7 A;  2F2X A;  2JMC A;  3L1A A;  2EBP A;  1VQM A;  1BYM A;  3CXC P;  4C5E A;  1SEM A;  2JOY A;  5CKH A;  1G2B A;  4RUG A;  3OW2 S;  1WXB A;  1OU9 A;  4IIM A;  1VYV A;  1YJ9 A;  4E7I A;  1NLO C;  3JB9 H;  1U8R A;  3NFC A;  4CI0 C;  2CZ7 B;  2YHT A;  1MUZ A;  3C94 A;  2XID A;  4DBF A;  1BBZ A;  2VWF A;  3BDL A;  2QAS A;  2GFU A;  2ESW A; 
#chains in the Genus database with same CATH homology
 2K2M A;  4OMM A;  1SHG A;  1U3O A;  2DRK A;  2K9G A;  2KRM A;  5GJW B;  4Z8A A;  4FSS A;  1CKA A;  1IO6 A;  4LUE A;  1S1N A;  1E6H A;  1NLP C;  4R0K A;  3EG0 A;  2AK5 A;  2GNC A;  2LJ1 A;  3VRZ A;  3EG1 A;  2YUP A;  2J6F A;  1UTI A;  3VS4 A;  2CUB A;  2LZ6 B;  1XOV A;  2DL4 A;  2LQW A;  2D1X A;  1WXT A;  2AZV A;  1W70 A;  2DX1 A;  4ZNX A;  1PRM C;  5HCK A;  2IIM A;  3H0H A;  3SHW A;  2CT3 A;  1UFF A;  1ABO A;  1OPK A;  1ZUK A;  3NHN A;  3REB B;  3U23 A;  1M3C A;  2KYB A;  1UE9 A;  1PRL C;  2FRW A;  2K3B A;  2K6D A;  1WLP B;  1W6X A;  2KNB B;  4JJD A;  4J9C A;  4WCI A;  4DEY A;  3VS6 A;  2YT6 A;  2FPE A;  2HDA A;  1H92 A;  2CSI A;  2KBT A;  4RTY A;  1JXM A;  1SRL A;  1FMK A;  2CT4 A;  4J9D A;  1VYU A;  5FW9 A;  3EGU A;  2JS2 A;  3VRY A;  4RTX A;  4RTW A;  1PWT A;  2RN8 A;  1NEB A;  5I11 A;  3KFV A;  2FO0 A;  1AWJ A;  2RQW A;  4RTT A;  1JQQ A;  1U5S A;  1AZG B;  1YCS B;  2QDL A;  4J9B A;  4AG2 C;  3RBB B;  1X27 A;  2YSQ A;  2ROL A;  2VVK A;  3M0T A;  1ZUU A;  1Z9Z A;  1UHF A;  1MV0 B;  4CC7 A;  1OV3 A;  1LCK A;  2CSQ A;  2F2V A;  3VS0 A;  1Z9Q A;  3VS3 A;  3PVL A;  1YWP A;  2BZX A;  5GJV B;  1UJY A;  2JM8 A;  2OJ2 A;  2GGR A;  3CQT A;  2JXB A;  1HJD A;  1K0S A;  2ROT A;  4IIO A;  1TUD A;  1UEC A;  3LH5 A;  3UF4 A;  3VS5 A;  1SPK A;  1B3Q A;  2YUO A;  4LN2 A;  1GRI A;  4HVW A;  1QKW A;  2EYX A;  1QLY A;  1Y0M A;  2MOX A;  3GBQ A;  4AG1 C;  1K1Z A;  1X69 A;  1UJ0 A;  1H8K A;  2VKN A;  1HD3 A;  1E6G A;  2RQV A;  2AKL A;  1WI7 A;  4OMO A;  2B86 A;  4JZ3 A;  3NMZ C;  4RTZ A;  2A37 A;  2SRC A;  2MCN A;  3A98 A;  2I0N A;  1ZX6 A;  1I0C A;  3M0Q A;  4GBQ A;  1ZSG A;  4F16 A;  2X3X D;  2KR3 A;  1V1C A;  1NM7 A;  1GL5 A;  2ED0 A;  2D8H A;  2F2W A;  1KIK A;  1NEG A;  1WFW A;  1M30 A;  2FPD A;  3M0P A;  2KE9 A;  2DVJ A;  4HXJ A;  2G6F X;  2CRE A;  2JW4 A;  2X3W D;  2DA9 A;  2O9S A;  2RMO A;  4LNP A;  1X2K A;  3EHQ A;  2BZY A;  1VYT A;  2D8J A;  2D0N A;  2DNU A;  1RUW A;  1B07 A;  4KRT A;  1GFD A;  2YUN A;  2KRS A;  1KFZ A;  1BU1 A;  1WXU A;  2HSP A;  2KT8 A;  2O31 A;  2J7I A;  2KRO A;  1OOT A;  1GBR A;  2ABL A;  1UUE A;  1GCQ C;  3TSZ A;  1OPL A;  2J6O A;  2EYW A;  1YNZ A;  4HVV A;  1SHF A;  4J9E A;  5EC7 A;  1CKB A;  4JJB A;  2A28 A;  1K4U S;  1TUC A;  2E5K A;  1ARK A;  2KXC A;  3H41 A;  4JZ4 A;  2A08 A;  4HVU A;  1ZBJ A;  2J06 A;  1GBQ A;  2LP5 A;  1X6B A;  2L3Q A;  1PKT A;  4RTU A;  2LQN A;  1UDL A;  1BK2 A;  2LMJ A;  2RQR A;  2RNA A;  3M0S A;  3C0C A;  2L0A A;  5ECA A;  1YN8 A;  4AFS C;  1SSH A;  1QWE A;  1GFC A;  2JTE A;  1MV3 A;  3EHR A;  1T3L A;  4OML A;  2BTT A;  1JO8 A;  2FG0 A;  2DIL A;  2J6K A;  5L23 A;  1PNJ A;  5IXF A;  3UA6 A;  1K0X A;  1JXO A;  2YUQ A;  1RI9 A;  1X43 A;  2FEI A;  3JV3 A;  3UA7 A;  2GTO A;  2CH4 A;  3M0R A;  5FWC A;  4D8D A;  2C0O A;  1T0J A;  1H3H A;  2FRY A;  3O5Z A;  1AWX A;  2J05 A;  1AOJ A;  2JS0 A;  3IQL A;  2P4R A;  4DEX A;  4ESR A;  2YDL A;  2DL5 A;  2EW3 A;  2OAW A;  2C0I A;  2XMF A;  2H8H A;  4K11 A;  1WDX A;  3RNJ A;  1PHT A;  4AFQ C;  4CC3 A;  2W10 A;  4J9F A;  2KT1 A;  3EG2 A;  2EYY A;  2JT4 A;  3VS2 A;  2KGT A;  2CUD A;  3TVT A;  4F14 A;  1GCP A;  2EVR A;  2A36 A;  1BB9 A;  1M8M A;  1EFN A;  2DLP A;  2ECZ A;  2HCK A;  1QKX A;  3NPF A;  3I9Q A;  2EKH A;  4J9H A;  2V1Q A;  1Y57 A;  2C0T A;  4J9I A;  4A63 B;  1AD5 A;  1YP5 A;  1I07 A;  1K76 A;  3I5S A;  4J9G A;  1AEY A;  1FYN A;  1T3S A;  1GCQ A;  1AZE A;  5IHN A;  4JPB W;  2PTK A;  3PVQ A;  1SRM A;  4OMP A;  2K7A A;  5I22 A;  1AWW A;  2DE0 X;  2EPD A;  2RPN A;  1M3B A;  1TG0 A;  1J3T A;  3PE0 A;  2DF6 A;  4JJC A;  3NGP A;  1KSW A;  2LCS A;  1HSQ A;  1U06 A;  2DMO A;  2LJ3 A;  1AVZ C;  3VS7 A;  2K79 A;  2KRN A;  1E7O A;  1UG1 A;  1WIE A;  1OEB A;  1VA7 A;  3ZL7 C;  5IHK A;  4Z89 A;  2KXD A;  1X6G A;  1JU5 C;  1WA7 A;  1ABQ A;  2V1R A;  2DRM A;  3TSW A;  2PNI A;  1KJW A;  1QCF A;  2DL8 A;  2DL3 A;  2L3P A;  4Y92 A;  2HBW A;  1JEG A;  4AFZ C;  2OI3 A;  1M27 C;  2L3S A;  1I1J A;  2O9V A;  4LUD A;  2M51 A;  2KYM A;  1NYF A;  3H0I A;  2LNH B;  2RQU A;  3QWY A;  2O2O A;  2EQI A;  4OMQ A;  2M0Y A;  1RLQ C;  3ULR B;  4HCK A;  1X2Q A;  3I5R A;  2DBK A;  2DJQ A;  2GBQ A;  2JM9 A;  1UHC A;  1RLP C;  2ENM A;  2RQT A;  2DM1 A;  1WYX A;  3FJ5 A;  1ZUY A;  4QT7 A;  1M3A A;  4E6R A;  4D8K A;  4GLM A;  2EGA A;  5IH2 A;  1ZLM A;  3EG3 A;  4RTV A;  3VS1 A;  2DL7 A;  1A0N B;  2KEA A;  4F17 A;  4ORZ A;  1QWF A;  4CC4 B;  2CH4 W;  2O88 A;  1WX6 A;  1NYG A;  4CC2 A;  2EGE A;  1K9A A;  2HEQ A;  4OMN A;  2DBM A;  2DYB A;  3H0F A;  2JMA A;  4EIK A;  3THK A;  2RF0 A;  1G83 A;  1NG2 A;  2EYZ A;  5IXB A;  3SEM A;  2LJ0 A;  1YWO A;  2AZS A;  4AFU C;  3QWX X;  1AWO A;  3R6N A;  4Z88 A;  2SEM A;  2NUZ A;  4M4Z A;  1UGV A;  5FWB A;  4LE9 A;  2F2X A;  2LX7 A;  2GQI A;  2JMC A;  2EBP A;  2MIO A;  4X1V A;  3I35 A;  2EGC A;  1SEM A;  2GTJ A;  2CDT A;  1G2B A;  3REA B;  4RUG A;  1N5Z A;  1CSK A;  1WXB A;  2W0Z A;  4IIM A;  1T0H A;  1VYV A;  2BZ8 A;  2ED1 A;  2FPF A;  2NWM A;  1NLO C;  1W1F A;  2AKK A;  3M0U A;  1MUZ A;  2PZ1 A;  1BBZ A;  2L2P A;  2VWF A;  1PKS A;  3UAT A;  5IHI A;  2ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...