3ULRB

Lysozyme contamination facilitates crystallization of a hetero-trimericcortactin:arg:lysozyme complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
PLGSSDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysozyme contamination facilitates crystallization of a heterotrimeric cortactin-Arg-lysozyme complex.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase, protein binding
molecule keywords Lysozyme C
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ulrB00
4J9BA 4X1VA 1FYNA 2F2WA 4RTYA 3H0IA 1X6GA 2J6OA 2KYMA 4RTUA 2FO0A 3JV3A 1IO6A 1AWOA 1B3QA 1UHCA 3NPFA 3FJ5A 1AVZC 2DL8A 3M0UA 2FRWA 1Y57A 2DL7A 4OMLA 3RNJA 2KRMA 2EYZA 4D8DA 2J6KA 4IIOA 2J06A 1RUWA 1E6HA 1YNZA 2LX7A 3REBB 1OPKA 2E5KA 4RTVA 3ZL7C 4AG2C 2VVKA 1LCKA 1H92A 3REAB 4LE9A 4RTZA 2EYYA 2M0YA 3NHNA 2OAWA 3THKA 1X2QA 4F16A 1PKSA 3I9QA 2JXBA 3VS2A 2BTTA 2CSQA 2W0ZA 1WA7A 2EGEA 2HSPA 1GL5A 2D8HA 1M8MA 1X6BA 2O9VA 1JO8A 3UATA 3O5ZA 2YDLA 4OMPA 1QKWA 5FWBA 3RBBB 1NM7A 1MV0B 2XMFA 2KRNA 2KYBA 3M0PA 1BBZA 2L0AA 2KGTA 1A0NB 1SRLA 2AK5A 2RQTA 4J9DA 1E7OA 1GFCA 3EG1A 2J7IA 3VS4A 1OOTA 2ROTA 5FWCA 4AFUC 1ABQA 2DRKA 3NMZC 5I22A 1T0HA 2OJ2A 5IHKA 4Z89A 1GFDA 1AD5A 2YSQA 2PTKA 5IXFA 1WFWA 2ESWA 1UDLA 2LJ0A 5L23A 2YUOA 3VS7A 3VS3A 1AZEA 2EQIA 2O2OA 2EW3A 2EPDA 3TSZA 1UG1A 5ECAA 2CH4A 1QCFA 2HCKA 1SHFA 2CT3A 1M30A 4CC7A 1GRIA 1GCQC 4J9HA 4JJBA 2LMJA 2CT4A 1K9AA 2CUBA 3H0FA 3ULRB 1UJ0A 2DF6A 2A28A 2EKHA 2LQWA 1B07A 1SHGA 4QT7A 1UTIA 1ZUKA 2JW4A 5IHIA 4ZNXA 4AFZC 1SPKA 2EYWA 3VRZA 3H41A 1G2BA 1E6GA 1G83A 2L3SA 1UE9A 2DJQA 4HVUA 2ECZA 2O31A 3GBQA 1W70A 1TG0A 2JM8A 1H3HA 2KE9A 2EGCA 1T0JA 1M3AA 2LP5A 1RI9A 2GQIA 2RF0A 2X3WD 3EHQA 4J9CA 1GCPA 4J9GA 4HVWA 1UHFA 1JXOA 3QWXX 3U23A 1WDXA 1WYXA 1S1NA 4EIKA 4OMMA 1PKTA 1GCQA 2B86A 4J9FA 2KXDA 1ZBJA 2PZ1A 4Z88A 2RN8A 1JEGA 2BZYA 2AZVA 1UGVA 4K11A 1WXBA 1AWWA 2EVRA 2RMOA 2NUZA 1UFFA 5HCKA 1T3SA 1SEMA 1AWXA 1QWEA 2MOXA 1JQQA 2H8HA 4J9EA 3SEMA 2K9GA 2G6FX 4A63B 2CUDA 2HBWA 3PVLA 1HJDA 1CKAA 2KEAA 2LNHB 3UF4A 1I07A 2CDTA 2DX1A 2CH4W 4OMQA 1T3LA 5GJWB 1MV3A 2CSIA 1OEBA 1JXMA 2IIMA 2JM9A 1M3CA 1YWOA 2ROLA 1V1CA 2JMCA 2X3XD 1EFNA 2L2PA 4LUDA 1QWFA 2FPFA 2RQWA 1M27C 1NEGA 2FEIA 3A98A 3I5RA 1WXUA 1TUDA 3QWYA 1AWJA 2LQNA 4ORZA 3I5SA 2DVJA 2KT1A 2DL3A 1H8KA 4HVVA 1HSQA 3NGPA 1SRMA 2NWMA 1U06A 2DBMA 2C0OA 1ARKA 2FG0A 2C0TA 1QLYA 2EYXA 1HD3A 3VRYA 4CC3A 2C0IA 4WCIA 4D8KA 3SHWA 4IIMA 2BZXA 2LJ3A 2QDLA 1NG2A 1K1ZA 1BB9A 4F14A 3EG2A 4HXJA 2ED0A 4AG1C 2F2XA 5IH2A 3M0SA 2KRSA 1KIKA 1JU5C 2O9SA 1YN8A 3EGUA 4GBQA 2DLPA 1KJWA 2J05A 2V1RA 2GGRA 4CC4B 1XOVA 1WXTA 1AZGB 4OMNA 1NLPC 1NYFA 1OV3A 2MCNA 2JMAA 1PHTA 4JZ3A 1GBQA 4JJDA 1K0XA 4RTXA 2DL4A 3IQLA 1PNJA 3PE0A 2RQVA 4ESRA 1SSHA 2JS0A 5IHNA 1W1FA 2DBKA 1N5ZA 1PRLC 1TUCA 2PNIA 4Y92A 2GTJA 2BZ8A 1ZUYA 1WLPB 1GBRA 2A08A 2J6FA 2ED1A 2K6DA 2DMOA 2HEQA 2DNUA 2K3BA 3TSWA 2JT4A 4HCKA 2W10A 1VYVA 2YUQA 3PVQA 1Z9QA 2FPDA 3VS1A 1UUEA 1W6XA 2KT8A 5GJVB 1PRMC 1X27A 2ABLA 4LUEA 1KSWA 2FPEA 2F2VA 1VYTA 2YT6A 2AKLA 5EC7A 2D0NA 1CSKA 2RPNA 2DRMA 4FSSA 4KRTA 1RLQC 2K7AA 2YUNA 2RQRA 5IXBA 2L3PA 4LNPA 4RTTA 5FW9A 1YP5A 1ZLMA 3H0HA 4RUGA 4RTWA 1WIEA 4E6RA 2KR3A 1MUZA 1NEBA 2DE0X 2DL5A 2KXCA 1K0SA 1M3BA 2MIOA 2JS2A 3EG0A 4DEXA 3R6NA 2DM1A 1RLPC 1J3TA 2A37A 1FMKA 1KFZA 2DA9A 2D1XA 1YCSB 2KNBB 2D8JA 3LH5A 2K79A 4M4ZA 4Z8AA 2SEMA 5I11A 2AZSA 1K4US 1VYUA 4OMOA 1PWTA 2DILA 2VKNA 4AFSC 1X2KA 2K2MA 3KFVA 1ZUUA 3VS0A 4CC2A 3C0CA 1X43A 1Y0MA 1QKXA 4DEYA 2OI3A 2JTEA 1ZSGA 4JPBW 2CREA 3VS5A 4AFQC 4F17A 2FRYA 1WX6A 2I0NA 1NLOC 1BU1A 1BK2A 1Z9ZA 2HDAA 3EG3A 2EBPA 3UA6A 1ZX6A 1UECA 2L3QA 1UJYA 2ENMA 2GNCA 2AKKA 3VS6A 2YUPA 3EHRA 4J9IA 2LJ1A 3M0QA 2A36A 1WI7A 2RNAA 3M0TA 2P4RA 3M0RA 4GLMA 4R0KA 1I0CA 1CKBA 3I35A 3TVTA 2LZ6B 2GTOA 2V1QA 1AEYA 1NYGA 2KBTA 2EGAA 2DYBA 2KROA 1I1JA 2LCSA 1AOJA 4JZ4A 2O88A 1K76A 1OPLA 2GBQA 3UA7A 2SRCA 1X69A 2VWFA 1ABOA 1U5SA 2RQUA 3CQTA 1YWPA 4LN2A 1U3OA 1VA7A 2M51A 4JJCA
chains in the Genus database with same CATH superfamily
4X1VA 2QYZA 3RKXA 3PIPA 1BI0A 4RTYA 2XIDA 3CCJQ 1X6GA 3HKSA 2J6OA 4HCBA 3JCMh 2QEXA 1AVZC 1Y7XA 1U1TA 4A4EA 1VQKA 2KRMA 2XKOC 4IIOA 2QI2A 2XG8D 2VC8A 2KVQG 3REBB 2R57A 4XU3A 1G3SA 4KH0B 4RTVA 1ZA2B 4AG2C 1G3TA 1H92A 1QW1A 2RB6A 2HSEB 1YITT 3HRTA 4PJOF 2OTJA 1OX9A 3CPWS 1D0ZA 2E10A 3NHNA 5GAN8 2OAWA 3EFRA 3V7CA 1X2QA 4F16A 1OZ2A 2GQVA 3VS2A 3EFOA 2BTTA 2CSQA 1C0MA 2EGEA 1QVFA 2D8HA 2O9VA 3ER0A 3GNGA 1JO8A 3UATA 4OMPA 4M77E 2AT1B 3RBBB 5AYFA 2NUPA 4XK8E 2KYBA 1VQ4A 2VYTA 2JZ2A 2L0AA 1Q7YC 1SRLA 4J9DA 1E7OA 1K9MR 1GFCA 3EG1A 3QDRB 1OQKA 1HK9A 2OJ2A 3E1SA 1K73C 2MF2A 3JCMQ 5KYWA 1KD1C 4XQ3A 3QXEB 2L5QA 3V8JA 3L2UA 3VS3A 1AZEA 2EQIA 1FWZA 2O2OA 2RM4A 3M57A 3CCMT 2A3LA 5GAOn 2HL3A 1BI3A 2HMAA 3EGDB 2XHCA 2CT3A 3OYMA 4M78F 4ZN1A 2HAXA 2RJFA 5LJ5f 2XU8A 4JJBA 3G71Q 4MMLA 3ULRB 2RA2A 3X20B 2DF6A 3T9NA 2DZCA 2E6ZA 3M4YA 2QTVA 4QT7A 5LJ5d 2LRQA 1IXDA 1XTDA 1D3BB 1MMGA 5IHIA 3QO3A 5FU7B 4DOVA 2KY9A 2LTOA 3JCMc 1E6GA 4MZTA 2L3SA 1YI2A 3G71T 1QP2A 1PD0A 1UE9A 2YRDA 1SKUB 4C8QC 2YWWA 3GBQA 3CEYA 4N4HA 2WSEE 2BE7D 2A0FB 2EGCA 2RI5A 3MP8A 2EJ9A 2RF0A 4M7DB 4C8QB 1GCPA 2M16A 1MNEA 4J9GA 1NJIC 1UHFA 2LDMA 2FB7A 3CCUT 5KH6A 1I8FA 1S1NA 4EIKA 4OB0B 1YI2T 1PKTA 2RD1A 4BB7A 4J9FA 1Y96A 2PZ1A 5FRMA 5CKHA 1JEGA 2AZVA 3OB9A 2FZCB 2GCXA 2AIRB 2XICA 2NUZA 2COZA 5HCKA 1T3SA 2OTJQ 1AWXA 2LX9A 4KGVB 3C95A 2CZ1B 5GAOr 2G6FX 2CUDA 4M7AB 3PVLA 4M7AD 3UF4A 5DLOA 1OYXA 4UC4A 2CDTA 4HCZA 3BDUA 1BI1A 2DX1A 3QDFA 3EGDA 1T3LA 1MV3A 3OQ5A 3CC7T 2EYQA 2EFIA 2HZYA 2CSIA 2KSSA 2DTIA 2JM9A 1M3CA 4LDVA 2QXFA 1QWFA 2FPFA 5M9OA 3CBPA 1VQ7T 1WXUA 3QWYA 1AWJA 3M54A 4ORZA 1P92A 2DVJA 5CR2A 2KT1A 4HVVA 1QP3A 1SRMA 3CPWP 3CMAA 4MZMA 2NYSA 2FG0A 1ARKA 2EYXA 4BDZA 1D09B 4M75A 4F7UA 3CD6A 4CC3A 4DBQA 2P0PA 3HRUA 3EGXA 1Q81R 5KCHA 3SHWA 3CCEQ 4IIMA 2BZXA 1WGSA 2LJ3A 2QDLA 3J7AF 1UGPB 1BYMA 3E9FA 4FU6A 4HXJA 4M77F 4BDYA 2KK4A 3ZEHA 4C8QA 2OTLT 5KE3A 1NZ9A 4YTLA 2F2XA 5IH2A 1JU5C 2H3EB 5A0LA 3OYHA 1TH7A 4IUQA 4AT1B 1NYFA 2V8IA 3QYHB 5D6XA 4C0FA 1YHQT 3VYGA 4E7JA 2JMAA 4E7ZA 1Q86C 2RHZA 3L42A 2RJEA 2DTOA 4JJDA 3FDRA 3R6OA 3PE0A 1Q82U 2DBKA 1VQ5Q 1TUCA 2PNIA 1S72T 1YIJQ 3GIBA 4FL6A 3G4ST 2K57A 1ZUYA 1KHIA 2A08A 2K6DA 2DMOA 1WJSA 1BI2A 5LJ3h 5GANg 2CS7A 4M77G 2K5LA 3OYDA 5GJVB 1X6OA 1PC0A 4E7IA 3J80E 2L8DA 4E7KA 3RKYA 3LLRA 4OB2B 2MWOA 5EC7A 1D0XA 3QZ5B 3LWIA 1CSKA 3CCQA 3ZBDA 3LYIA 3HTRA 2IVWA 2RHXA 3DLLA 1QMCA 2YUNA 1WHJA 4LNPA 4RTTA 5FW9A 4F7UB 4WTOB 2XDBA 1VQNT 4RTWA 3HRSA 5KYXA 3FRNA 3P8HA 3VKIA 4JRQA 2KXCA 1K0SA 1M3BA 2MIOA 2JS2A 3EG0A 4DEXA 3RESA 1RLPC 2Y4YA 1FMKA 2JTMA 3WVDB 3AT1B 1FX7A 2D8JA 5GAMg 2CGHA 4M4ZA 4Z8AA 1Q95G 5GAMh 1QVFP 1YFNA 1X2KA 2K2MA 4DOWA 5GAN3 4E7LA 4CC2A 2EJFA 4M78E 2X9HA 1B34B 3DKMA 3M4GA 2OI3A 4PJLA 2JTEA 1ZSGA 1YHQA 1PM3A 1XQHA 4OGCA 2FRYA 2VASA 1NLOC 1BK2A 3G6EA 3EG9B 3CCLA 1UECA 2DVEA 2KQWA 2L3QA 2QQ9A 3M56A 1KC8C 2MAMA 3OW2A 3EHRA 3M9QA 2R5AA 1YHQQ 1WI7A 1BCOA 1YIJA 5GMKh 4KUIA 3I35A 1CKBA 2V1QA 4A4FA 1AEYA 3OYAA 3FJPA 5I2SA 3NTIA 3OYBA 3LW5E 2YLBA 4A4HA 1F1BB 3CCMA 4AMCA 2MYSA 1AOJA 5GAMd 3JCMW 4JZ4A 3CCVQ 2ZAEA 2CP6A 1N9RA 1RAGB 5A0GA 3OS2A 1VQOQ 4C8QD 4JS5A 2QG9B 2VWFA 3HL8A 3JB9I 2RHIA 3CCJA 2RI3A 2QA4Q 1FMVA 3CMET 2RQUA 4LN2A 1U3OA 4XU1A 4HCCA 4M7AE 4J9BA 4KUDK 3TREA 1LJOA 3QBYA 1D1BA 1OULA 4Y91A 1KQSA 5IN1A 1M90U 1VQ4Q 4IUUA 2HD0A 3NPFA 4N4GA 3OMGA 1WQWA 5GMKm 2FRWA 1Y57A 2DL7A 3MP1A 1ZSZC 4PJOD 4PJMA 3RNJA 4E47A 3SWNA 4FYYB 4D8DA 2J6KA 3NFCA 1QVFS 5KYUB 1YNZA 1OPKA 2E5KA 2YRVA 4J7IA 3ZL7C 3ASKA 4M7DF 2EYYA 2M0YA 4X9CA 2E1HA 4C92E 1RAIB 2JNGA 1YITA 3LX7A 1PKSA 5A0DA 3OS0A 1YBYA 3V7SA 3QUIA 1RAFB 1GL5A 1M8MA 1WHGA 2R58A 3MEVA 3GPLA 2CYZB 2CP7A 5FWBA 4LD9K 5L8RE 2XMFA 2JOYA 3CD6Q 3FC3A 2QQRA 4KH1B 2KGTA 2Y4XA 2HBPA 3CCUQ 2QAZA 1N27A 2EQMA 1VQ4T 3CCUA 5KYYA 4QVDA 2RHUA 1OOTA 5FWCA 1ABQA 2DRKA 5FU6B 3NMZC 2R5MA 3C12A 4Z89A 1GFDA 3I55A 3WVEB 1BIAA 2M9UA 1WFWA 1UDLA 1UEBA 2LJ0A 1S72A 1FMWA 4OVAA 1IHWA 1ACMB 4PJOG 2M02A 2B8AA 2XDPA 5GAN5 1Q7YU 4DQ2A 1TUGB 1H3ZA 1Q86R 4CC7A 1X01A 4M75C 1I5LA 3PT9A 1YJNQ 4J9HA 2CT4A 3GOXA 3D7SB 2HKNA 4EMKB 5GANe 1EZZB 2A28A 1MMDA 2EKHA 4RG2A 1SHGA 3A8LB 1M90R 4LDXA 2JW4A 4AFZC 3QJ6A 1SPKA 3CCQQ 3VRZA 2LQ8A 2DJQA 5J39A 1W2BP 5FRNA 3UWNA 2ECZA 2FL7A 1VQ6T 3H8ZA 3JCMV 3JCMP 4C5GA 1U8RA 1NJIR 4RCCA 2LP5A 2GQIA 4FYWB 5J26A 2DEUA 2X3WD 3SB2A 4MDXA 1R0BG 4FSXA 1MMAA 3V7RA 2VV5A 3QWXX 3U23A 2VB6A 1JJ2A 4B9XA 2X4XA 4J83A 3VV0A 2BZYA 1UB4A 1WXBA 2PVGB 2EVRA 3M53A 2K5IA 1UFFA 3OBYA 3RR6A 1QWEA 1D1CA 4WF2A 1JQQA 3SEMA 4C92B 1SG5A 2ZCFB 3G6ET 3O8VA 3META 1VIFA 2P0KA 2CH4W 4OMQA 5GJWB 4PJOA 4OGEA 3QIIA 4ZN3A 2GF7A 3CCQT 3WXMB 3CC2A 2JMCA 2RJDA 2X3XD 4RMOA 3HSBA 2ZPHB 2L2PA 4LUDA 4F7UF 1M27C 2FEIA 3A98A 2EJGA 4ELYC 1TUDA 1D0YA 2LQNA 3QYGB 5FLXE 4C5EA 1HSQA 2MWPA 4NOYA 3RUXA 1SSFA 2ATCB 3MJXA 1WQ7A 1QVGP 4F7UG 1QLYA 2JN0A 3V8KA 3CC4A 1LNXA 3VRYA 2M1HA 4C92C 2ZPGB 5CO7A 4HKEA 4C0ZA 3MKDA 1WJQA 3X26B 2ZZDA 1K1ZA 1BB9A 4F14A 3MHXA 3EG2A 2DXCA 2C06A 1QVPA 3QPHA 3M59A 1M1KR 4N4IA 5GMKj 1YN8A 2LQKA 1PCXA 1WPYA 1YCYA 2KAFA 3HP9A 4J5YA 4GBQA 3VJPA 2J05A 2V1RA 4C5HA 4CC4B 1AHJB 2X51A 1WXTA 1AZGB 1WHLA 3S3OA 1NLPC 2WACA 5I2MA 1Y07A 4M78C 2DAQA 1ZSZA 2DL4A 3IQLA 1PNJA 3ZFJA 1VQMQ 1SSHA 2JS0A 1W1FA 2PVDB 5KYUA 1N5ZA 3CCST 2COWA 4M7DD 2GTJA 1B7TA 3CBOA 1GBRA 5DM7R 2ZPFB 2HEQA 2RHYA 2E3HA 2RJCA 4M75E 4M77C 5GMKi 3QZ9B 2W10A 3VS1A 1A0NB 1Z9QA 2FPDA 1RAHB 1VQMT 1O75A 1KK7A 2IPOB 1PRMC 4LUEA 4M77A 2MPXC 2FPEA 4FYVB 5C6SA 2YT6A 2AKLA 1N6AA 5I21A 1XNIA 3JB9F 2RPNA 2LVMA 3A8MB 2LT4A 4KRTA 1RLQC 2K7AA 1KQ2A 2RQRA 2E64A 3KBGA 1M2VB 3H0HA 3RERA 1WIEA 4E6RA 3L2RA 5CKFA 4M78A 1VQPA 1MUZA 3M55A 1WHMA 2ZPEB 2H3JA 2F5TX 2QA4T 2LCCA 4KT0E 2DM1A 1PSEA 2X35A 2X4JA 2EKOA 1KFZA 2CP0A 4RKUE 3X24B 2CKKA 1VQLA 1YJ9Q 5GANd 2VUBA 2K79A 4J6YA 5J3BA 3JB9H 2YRCA 4BI8B 2AZSA 4JS4A 1K4US 1VYUA 2VKNA 4BD3A 4AFSC 5CAIA 4PLIA 3GNFB 4XTWA 1OX8A 1X43A 2DXBA 4CRIA 1QKXA 2QGFB 1QCNA 2NUPB 2CREA 4VUBA 3VS5A 4HT8A 4EMKA 1RACB 3PGGA 1BU1A 5DLQE 3EG3A 4KGXB 4BI4A 1VQ9T 3UA6A 3G7ZA 2OTLA 1KHCA 1UJYA 2BE9B 2DETA 4C5IA 3RIRA 3CCRA 1KQSS 5FROA 2YUPA 2E5QA 4PL6A 5KYWB 3M0QA 3X25B 3PIOA 3M0TA 2P4RA 1RAAB 1XJWB 1VQMA 2QQSA 2DXUA 3TVTA 2LZ6B 3ME9A 4C0GA 3GP8A 5GANh 2F1LA 3CC4T 1N8RC 4E2FB 1I1JA 4OB3B 2LCSA 2O88A 1M2VA 5HK0A 4FCYA 4X9DA 1K76A 1OPLA 4IUPA 4PFZA 3UA7A 2SRCA 1X69A 2JJ9A 4M78B 1IREB 3CXCP 1KG1A 1YWPA 4NL3A 2E41A 1N8RU 4FIBA 1I5OB 4JJCA 1VQPT 4XTZA 1FYNA 4JJNK 2DO3A 2F2WA 1ZBXA 1VQNQ 3INZA 3L2VA 4C0DC 3L2WA 3H0IA 3OW2S 2FO0A 2DK3A 2QGGA 4BE1A 1UHCA 3FJ5A 2D0QB 2DL8A 3M0UA 2F69A 1KC8U 4Y28E 1M5Q1 3CPWA 2EYZA 1WJRA 3JB9J 3CCSQ 3EH2A 1VQ6A 4M7AG 4XTVA 2LX7A 1Y71A 4F7UE 4JRPA 3OYLA 3REAB 4RTZA 2KI7A 4M75F 2RI2A 1YIJT 2JXBA 4NL2A 2HSPA 1HYOA 3PMIA 3S3NA 2D9TA 3O5ZA 4QQGA 5GMKl 1M4ZA 2O01E 3PMTA 1MV0B 2KRNA 2HKQB 2LC4A 2RH2A 4C92F 4EMHA 4M7AF 2OTJT 1RABB 1YJNT 1Q7YR 1ZA1B 5LJ3g 5HK3A 3CCVT 2J7IA 3VS4A 2ROTA 1K73R 5I22A 3I55Q 1PSFA 1YI2Q 1PD1A 1AD5A 2FHDA 4KBMB 2MMPA 3I55T 2PTKA 5IXFA 2DERA 2QQBA 4A54A 4HA8A 2RK2A 2DTHA 2EPDA 3CXCS 2CH4A 1QCFA 2ZGWA 4M7DE 1ZSZB 2LNVA 2HQEA 4PJOC 2PVOB 1WHKA 2DKGA 4C0DB 3I56A 1N8RR 2DYIA 3G1JA 4M7DA 3EGXB 1TXQA 4XTUA 4PLLA 1K9AA 3H0FA 4XU0A 1UJ0A 1K8AC 2LQWA 4FT4A 5HKCA 1QCOA 4J6XA 4B9WA 4M77B 3BDLA 4ZNXA 3OYKA 2EYWA 2E6NA 1G2BA 1GXIE 3E19A 1AT1B 1IB8A 2I2LA 3MPUB 1V29B 4ELZC 4HVUA 4N0AA 5LJ3d 2EQUA 1TG0A 1RL2A 3OSVA 4M7DG 2KE9A 2HQHA 2ZPIB 1T0JA 1RI9A 3A5ZB 3CCEA 4J9CA 4PJNA 4HVWA 3G6EQ 1JXOA 4O5VA 1WYXA 4B6MA 2CZ6B 5KCOA 1G8XA 4OMMA 2EQKA 1I4K1 3EFOB 2G3RA 2AHJB 1VQ6Q 1ZBJA 2RN8A 1UGVA 2DXTA 1AWWA 5GAMe 2RMOA 4PJJA 3VU3C 4DBRA 1SEMA 3BW1A 4ZGJB 4J9EA 4QVZA 2HNIA 2QDYB 4A63B 2HBWA 1CKAA 3OA6A 1I07A 1HXDA 1U1SA 3OYFA 4BUGA 5LJ3f 1TS9A 2X4YA 1OEBA 2IIMA 1Q81U 1V1CA 4JUVA 3QKJA 1EFNA 4II1A 2L89A 2V26A 1NEGA 4A4GA 3I5RA 2F5KA 3RMQA 2CP3A 3OMCA 1MMNA 3URGA 1QQJA 2EQJA 3L2QA 3CCRQ 1BKBA 5DY9A 2DEQA 2C0OA 5CK9A 5IAYA 3DB4A 1OU9A 2L3RA 3OBWA 4QVCA 1M2OA 4C92G 3RKWA 1JBMA 2V8JA 5LJ3e 1Q82C 4BI3A 4WCIA 1R8OB 1K8AR 3KUFA 3GLXA 4EDUA 3QSUA 2XI9A 2OTLQ 3F70A 4AG1C 2P84A 2CZ0B 3H6ZA 1KIKA 1SF9A 2O9SA 2K2VA 3CCET 3EGUA 2DLPA 5LL6S 2WSCE 3A8GB 1XOVA 2VGMA 4OMNA 4QW2A 1YJWA 3P8BB 3HFNA 1UGQB 1PHTA 1M1KC 1IGUA 4JZ3A 1GBQA 5LJ3j 3JB9D 2CZ7B 4RTXA 2PU9B 2VGNA 4EMGA 2QQAA 5IHNA 4CI0C 4Y92A 1KC8R 4J8OA 3CMAQ 1JJ2P 4O6JA 1Y96B 1WLPB 3LGFA 3P8DA 1YITQ 3I56T 2CP5A 2DNUA 3TSWA 1KQSP 2JT4A 3PFSA 4HCKA 4PFPA 2YUQA 3PVQA 1UUEA 2KT8A 1M9SA 2F2VA 3JSCA 4XTYA 1IHVA 3G4SA 2Z0WA 2D0NA 1O9SA 5GAN4 2DRMA 3UDCA 4FSSA 3OYNA 2GFUA 1X75C 5C0MA 5KE2A 5GANf 1NBEB 4M78G 5IXBA 1ZLMA 3A1PA 4RUGA 1KD1U 8ATCB 2KR3A 1B34A 1VQKQ 2E3IA 1NEBA 4JDSA 2QEXQ 2DL5A 5GAMj 3EAEA 1NPPA 5IT9E 2QA4A 1J3TA 1MNDA 2A37A 3EG9A 1JRIA 4FW2A 3KXTA 4IUTA 2DA9A 1YCSB 3LH5A 1QVGA 3C4SA 4BY6B 3RMSA 2SEMA 5I11A 4M75B 2DPPB 4OMOA 2DILA 4E7HA 2M0OA 4QQDA 2XDDA 3PNWC 3VS0A 1OI1A 1K9MU 1C1AA 2YLCA 4ZTJA 5LJ5e 5LJ5j 4L6V5 3OYCA 5GAOp 4JPBW 2A7YA 1YJNA 4F17A 3FIFA 2I0NA 1VOMA 2HDAA 5LJ5h 3OYIA 4A4KA 3QHSA 4D6WA 8AT1B 4IKFA 2PQWA 1G3YA 5LJ5g 1EIFA 1V76A 2GNCA 2DIGA 2JVVA 3OS5A 4JRKA 1M1GA 4J9IA 3TU4K 3MP6A 2LJ1A 1Q81C 1VQ7A 3LGLA 2EAYA 3S6WA 1M90C 3I56Q 2E70A 1ZHIA 4GLMA 1VQ8A 3CMEA 2GTOA 1NYGA 2KBTA 4MMKA 4L5GA 2DYBA 2HQXA 2MI6A 1JB0E 2FZKB 2X4WA 3SWNB 2KMTA 3CC7Q 3OSSC 1VA7A 1ABOA 1U5SA 3M5AA 5GMKe 1MHNA 4PK4A 2V8KA 1M8VA 2OX7A 2KYMA 4RTUA 3MEWA 3JV3A 3HFOA 1IO6A 1AWOA 1B3QA 4DA4A 3OYJA 2DIQA 4LD6A 2XD0A 2K3XA 4IUVA 4OMLA 5KYXB 4MDWA 3E2UA 2J06A 1RUWA 1E6HA 1VQ5T 1YJ9A 4R56A 3N5BB 3MEUA 1G3WA 2VVKA 1LCKA 4IURA 4LE9A 3SFMA 3JCMJ 1JJ2S 4J7FA 3THKA 3I9QA 3L2ZA 4ZTFA 2W0ZA 3JCMf 1WA7A 4M77D 4C92D 3JCMX 2O4XB 1M1FA 1X6BA 2E4HA 2E65A 3CCMQ 1OU8A 2YDLA 4M75D 1QKWA 1TU0B 3FLGA 2RO0A 1NM7A 3JAME 4KULA 3SD4A 3OYGA 1VQ9A 1I81A 3M58A 3M0PA 1BBZA 3PTAA 5CKDA 1BIBA 2AK5A 2RQTA 4EMKC 2XK0A 5CCAA 3LH0A 4AFUC 5GAOm 1T0HA 5IHKA 2YSQA 1TOVA 2EIFA 2ESWA 4M75G 5L23A 2YUOA 2QEXT 3H9NA 3VS7A 1TWBA 3TQ7P 5GAOl 3DB3A 2EW3A 4OF1A 3TSZA 1UG1A 2JUFA 5ECAA 3CC2T 2VXEA 2HCKA 1SHFA 2MK5A 2DFUA 3CD6T 1VQ7Q 1M30A 3DLMA 4Z02A 4C8QG 1GRIA 1GCQC 1VIEA 2LMJA 1VQNA 2CUBA 2RK1A 1PG5B 3UPUA 5D7UA 1B07A 4OMFB 4PFOA 7AT1B 1UTIA 1ZUKA 4LDYA 4F04B 3SDZA 1WNLA 2JTFA 3H41A 4M7AC 1G83A 1G5VA 1N9SA 1TTHB 1D1AA 2GFAA 3G71A 3L1AA 2P0QA 1QVGS 2O31A 2Y90A 1W70A 1W4SA 2JM8A 3CC2Q 1H3HA 2NUTA 2K4YA 2COYA 3MO8A 2VXFA 1M3AA 5GAN7 1WHHA 4ZGDB 3EHQA 4M78D 3OS1A 4P5NA 4FYXB 4PJOB 1UGSB 1IZ6A 2YHTA 5GANj 1WDXA 1VQLT 3SWNC 1GCQA 2B86A 1C6VX 2KXDA 4Z88A 4NS5A 4K11A 4FT2A 3A8HB 3CCRT 3TCJA 5D6YA 2MOXA 1R77A 4DBHA 2H8HA 4V2SA 2K9GA 1VQOA 4Q5WA 4OB1B 1HJDA 5CQXA 2K3YA 3EFSA 2KEAA 3CCLT 2LNHB 4JLIA 5CIUA 4X34A 1ZQ1A 3EH1A 2K5FA 1BCMA 2DZ9A 9ATCB 5GAN6 5KYYB 3JB9G 4RG8A 2LCLA 1JXMA 1YWOA 2ROLA 1Q86U 5CQYA 1VUBA 2RQWA 4FW1A 3BFMA 3V8LA 1R0CB 4PKCC 3HHTB 3I5SA 1VQ5A 2LT1A 1H8KA 2DL3A 3UT1A 3NGPA 4JLGA 2FZGB 3QJYA 1M1KU 3BY7A 2NWMA 4KGZB 1U06A 2BUDA 3JCMg 2DBMA 5AT1B 4C92A 2C0TA 4QQ6A 5HY6A 3CMAT 1HD3A 5GAN2 4BACA 3AHUA 3VUBA 1NPRA 4C8QE 1RADB 4TVRA 1K9MC 4FM4B 2C0IA 5KYNA 4D8KA 1NG2A 1KD1R 3Q1JA 2ED0A 1NE8A 2NLUA 3JRZA 3M0SA 2KRSA 4ME7A 3CMEQ 4BE2A 1KJWA 1RI0A 2GGRA 4PNOA 1RAEB 4XAXB 4XTXA 4N0AC 3X28B 1OV3A 2MCNA 2BKDN 4C8QF 3JCMb 1K0XA 4MZPA 5CKBA 1IGQA 2RQVA 4LXCA 4ESRA 3CC4Q 1PRLC 3HPWA 2CP2A 4QKUA 2BZ8A 3JCMd 2YXYA 4JRIA 1LOJA 2J6FA 2ED1A 3MCAB 5FU7C 1IRXA 2K3BA 4RCBA 1VYVA 1W6XA 1EX4A 2HL5C 1X27A 2ABLA 2O4XA 1D3BA 1KSWA 3G4SQ 4XU2A 1VYTA 1UGRB 3C94A 3FB9A 1TSFA 1S72Q 1VQ9Q 4E7SA 4A53A 2IG0A 2OAUA 6AT1B 1NJIU 2EWNA 3CCVA 4L59A 2L3PA 1YP5A 1LPLA 5A2QE 1K73U 2DJZA 1K8AU 2QASA 1MGQA 2DE0X 4R55A 4PJOE 3CCJT 1YJWQ 3R6NA 4LDWA 3OY9A 1DJ7B 5FU6C 2BIVA 1KQ1A 3CPFA 4J6WA 3A8OB 1YJ9T 2D1XA 2KNBB 2KDSA 1VQKT 3S3MA 2D6FA 3E9GA 5GAMf 4ZGEB 2QTXA 1H641 1PWTA 3OW2P 5D6WA 3KFVA 4M7AA 1ZUUA 3NTHA 5CVIA 3RDVA 3C0CA 2DD4A 1Y0MA 4DEYA 4ATOA 3TEEA 3MEAA 4DBFA 4AFQC 3QG1A 1VQ8Q 1WX6A 5GAOq 2E12A 2PUOB 1Z9ZA 5CKEA 3FEOA 4HT9A 2EBPA 3JCMe 1ZX6A 3BE3A 2PUKB 3CCSA 2ENMA 4EPCA 3OYEA 2AKKA 3CXCA 3VS6A 4OP0A 4GY5A 2A36A 2RNAA 1VQ8T 4GLKA 3M0RA 4M7DC 3GF5A 2NUTB 4BY6C 4R0KA 3OYYA 1I0CA 1YJWT 2WSFE 2DD5A 2EGAA 2KROA 1FXXA 1W2BA 2ZPBB 3CC7A 3NTKA 4ANJA 1Q82R 2QK0A 1VQLQ 1VQOT 1LVKA 3CBMA 2GBQA 3VYHB 1WZOA 2FVUA 5EG2A 2P4TA 4LDUA 3VUZA 4BE0A 1VQPQ 3CCLQ 3CQTA 3J81E 1OZ3A 2FYKA 3LWHA 2M51A 1W2BS
chains in the Genus database with same CATH topology
4J9BA 4X1VA 1FYNA 2F2WA 4RTYA 3H0IA 1X6GA 2J6OA 2KYMA 4RTUA 2FO0A 3JV3A 1IO6A 1AWOA 1B3QA 1UHCA 3NPFA 3FJ5A 1AVZC 2DL8A 3M0UA 2FRWA 1Y57A 2DL7A 4OMLA 3RNJA 2KRMA 2EYZA 4D8DA 2J6KA 4IIOA 2J06A 1RUWA 1E6HA 1YNZA 2LX7A 3REBB 1OPKA 2E5KA 4RTVA 3ZL7C 4AG2C 2VVKA 1LCKA 1H92A 3REAB 4LE9A 4RTZA 2EYYA 2M0YA 3NHNA 2OAWA 3THKA 1X2QA 4F16A 1PKSA 3I9QA 2JXBA 3VS2A 2BTTA 2CSQA 2W0ZA 1WA7A 2EGEA 2HSPA 1GL5A 2D8HA 1M8MA 1X6BA 2O9VA 1JO8A 3UATA 3O5ZA 2YDLA 4OMPA 1QKWA 5FWBA 3RBBB 1NM7A 1MV0B 2XMFA 2KRNA 2KYBA 3M0PA 1BBZA 2L0AA 2KGTA 1A0NB 1SRLA 2AK5A 2RQTA 4J9DA 1E7OA 1GFCA 3EG1A 2J7IA 3VS4A 1OOTA 2ROTA 5FWCA 4AFUC 1ABQA 2DRKA 3NMZC 5I22A 1T0HA 2OJ2A 5IHKA 4Z89A 1GFDA 1AD5A 2YSQA 2PTKA 5IXFA 1WFWA 2ESWA 1UDLA 2LJ0A 5L23A 2YUOA 3VS7A 3VS3A 1AZEA 2EQIA 2O2OA 2EW3A 2EPDA 3TSZA 1UG1A 5ECAA 2CH4A 1QCFA 2HCKA 1SHFA 2CT3A 1M30A 4CC7A 1GRIA 1GCQC 4J9HA 4JJBA 2LMJA 2CT4A 1K9AA 2CUBA 3H0FA 3ULRB 1UJ0A 2DF6A 2A28A 2EKHA 2LQWA 1B07A 1SHGA 4QT7A 1UTIA 1ZUKA 2JW4A 5IHIA 4ZNXA 4AFZC 1SPKA 2EYWA 3VRZA 3H41A 1G2BA 1E6GA 1G83A 2L3SA 1UE9A 2DJQA 4HVUA 2ECZA 2O31A 3GBQA 1W70A 1TG0A 2JM8A 1H3HA 2KE9A 2EGCA 1T0JA 1M3AA 2LP5A 1RI9A 2GQIA 2RF0A 2X3WD 3EHQA 4J9CA 1GCPA 4J9GA 4HVWA 1UHFA 1JXOA 3QWXX 3U23A 1WDXA 1WYXA 1S1NA 4EIKA 4OMMA 1PKTA 1GCQA 2B86A 4J9FA 2KXDA 1ZBJA 2PZ1A 4Z88A 2RN8A 1JEGA 2BZYA 2AZVA 1UGVA 4K11A 1WXBA 1AWWA 2EVRA 2RMOA 2NUZA 1UFFA 5HCKA 1T3SA 1SEMA 1AWXA 1QWEA 2MOXA 1JQQA 2H8HA 4J9EA 3SEMA 2K9GA 2G6FX 4A63B 2CUDA 2HBWA 3PVLA 1HJDA 1CKAA 2KEAA 2LNHB 3UF4A 1I07A 2CDTA 2DX1A 2CH4W 4OMQA 1T3LA 5GJWB 1MV3A 2CSIA 1OEBA 1JXMA 2IIMA 2JM9A 1M3CA 1YWOA 2ROLA 1V1CA 2JMCA 2X3XD 1EFNA 2L2PA 4LUDA 1QWFA 2FPFA 2RQWA 1M27C 1NEGA 2FEIA 3A98A 3I5RA 1WXUA 1TUDA 3QWYA 1AWJA 2LQNA 4ORZA 3I5SA 2DVJA 2KT1A 2DL3A 1H8KA 4HVVA 1HSQA 3NGPA 1SRMA 2NWMA 1U06A 2DBMA 2C0OA 1ARKA 2FG0A 2C0TA 1QLYA 2EYXA 1HD3A 3VRYA 4CC3A 2C0IA 4WCIA 4D8KA 3SHWA 4IIMA 2BZXA 2LJ3A 2QDLA 1NG2A 1K1ZA 1BB9A 4F14A 3EG2A 4HXJA 2ED0A 4AG1C 2F2XA 5IH2A 3M0SA 2KRSA 1KIKA 1JU5C 2O9SA 1YN8A 3EGUA 4GBQA 2DLPA 1KJWA 2J05A 2V1RA 2GGRA 4CC4B 1XOVA 1WXTA 1AZGB 4OMNA 1NLPC 1NYFA 1OV3A 2MCNA 2JMAA 1PHTA 4JZ3A 1GBQA 4JJDA 1K0XA 4RTXA 2DL4A 3IQLA 1PNJA 3PE0A 2RQVA 4ESRA 1SSHA 2JS0A 5IHNA 1W1FA 2DBKA 1N5ZA 1PRLC 1TUCA 2PNIA 4Y92A 2GTJA 2BZ8A 1ZUYA 1WLPB 1GBRA 2A08A 2J6FA 2ED1A 2K6DA 2DMOA 2HEQA 2DNUA 2K3BA 3TSWA 2JT4A 4HCKA 2W10A 1VYVA 2YUQA 3PVQA 1Z9QA 2FPDA 3VS1A 1UUEA 1W6XA 2KT8A 5GJVB 1PRMC 1X27A 2ABLA 4LUEA 1KSWA 2FPEA 2F2VA 1VYTA 2YT6A 2AKLA 5EC7A 2D0NA 1CSKA 2RPNA 2DRMA 4FSSA 4KRTA 1RLQC 2K7AA 2YUNA 2RQRA 5IXBA 2L3PA 4LNPA 4RTTA 5FW9A 1YP5A 1ZLMA 3H0HA 4RUGA 4RTWA 1WIEA 4E6RA 2KR3A 1MUZA 1NEBA 2DE0X 2DL5A 2KXCA 1K0SA 1M3BA 2MIOA 2JS2A 3EG0A 4DEXA 3R6NA 2DM1A 1RLPC 1J3TA 2A37A 1FMKA 1KFZA 2DA9A 2D1XA 1YCSB 2KNBB 2D8JA 3LH5A 2K79A 4M4ZA 4Z8AA 2SEMA 5I11A 2AZSA 1K4US 1VYUA 4OMOA 1PWTA 2DILA 2VKNA 4AFSC 1X2KA 2K2MA 3KFVA 1ZUUA 3VS0A 4CC2A 3C0CA 1X43A 1Y0MA 1QKXA 4DEYA 2OI3A 2JTEA 1ZSGA 4JPBW 2CREA 3VS5A 4AFQC 4F17A 2FRYA 1WX6A 2I0NA 1NLOC 1BU1A 1BK2A 1Z9ZA 2HDAA 3EG3A 2EBPA 3UA6A 1ZX6A 1UECA 2L3QA 1UJYA 2ENMA 2GNCA 2AKKA 3VS6A 2YUPA 3EHRA 4J9IA 2LJ1A 3M0QA 2A36A 1WI7A 2RNAA 3M0TA 2P4RA 3M0RA 4GLMA 4R0KA 1I0CA 1CKBA 3I35A 3TVTA 2LZ6B 2GTOA 2V1QA 1AEYA 1NYGA 2KBTA 2EGAA 2DYBA 2KROA 1I1JA 2LCSA 1AOJA 4JZ4A 2O88A 1K76A 1OPLA 2GBQA 3UA7A 2SRCA 1X69A 2VWFA 1ABOA 1U5SA 2RQUA 3CQTA 1YWPA 4LN2A 1U3OA 1VA7A 2M51A 4JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9B A;  4X1V A;  1FYN A;  2F2W A;  4RTY A;  3H0I A;  1X6G A;  2J6O A;  2KYM A;  4RTU A;  2FO0 A;  3JV3 A;  1IO6 A;  1AWO A;  1B3Q A;  1UHC A;  3NPF A;  3FJ5 A;  1AVZ C;  2DL8 A;  3M0U A;  2FRW A;  1Y57 A;  2DL7 A;  4OML A;  3RNJ A;  2KRM A;  2EYZ A;  4D8D A;  2J6K A;  4IIO A;  2J06 A;  1RUW A;  1E6H A;  1YNZ A;  2LX7 A;  3REB B;  1OPK A;  2E5K A;  4RTV A;  3ZL7 C;  4AG2 C;  2VVK A;  1LCK A;  1H92 A;  3REA B;  4LE9 A;  4RTZ A;  2EYY A;  2M0Y A;  3NHN A;  2OAW A;  3THK A;  1X2Q A;  4F16 A;  1PKS A;  3I9Q A;  2JXB A;  3VS2 A;  2BTT A;  2CSQ A;  2W0Z A;  1WA7 A;  2EGE A;  2HSP A;  1GL5 A;  2D8H A;  1M8M A;  1X6B A;  2O9V A;  1JO8 A;  3UAT A;  3O5Z A;  2YDL A;  4OMP A;  1QKW A;  5FWB A;  3RBB B;  1NM7 A;  1MV0 B;  2XMF A;  2KRN A;  2KYB A;  3M0P A;  1BBZ A;  2L0A A;  2KGT A;  1A0N B;  1SRL A;  2AK5 A;  2RQT A;  4J9D A;  1E7O A;  1GFC A;  3EG1 A;  2J7I A;  3VS4 A;  1OOT A;  2ROT A;  5FWC A;  4AFU C;  1ABQ A;  2DRK A;  3NMZ C;  5I22 A;  1T0H A;  2OJ2 A;  5IHK A;  4Z89 A;  1GFD A;  1AD5 A;  2YSQ A;  2PTK A;  5IXF A;  1WFW A;  2ESW A;  1UDL A;  2LJ0 A;  5L23 A;  2YUO A;  3VS7 A;  3VS3 A;  1AZE A;  2EQI A;  2O2O A;  2EW3 A;  2EPD A;  3TSZ A;  1UG1 A;  5ECA A;  2CH4 A;  1QCF A;  2HCK A;  1SHF A;  2CT3 A;  1M30 A;  4CC7 A;  1GRI A;  1GCQ C;  4J9H A;  4JJB A;  2LMJ A;  2CT4 A;  1K9A A;  2CUB A;  3H0F A;  3ULR B;  1UJ0 A;  2DF6 A;  2A28 A;  2EKH A;  2LQW A;  1B07 A;  1SHG A;  4QT7 A;  1UTI A;  1ZUK A;  2JW4 A;  5IHI A;  4ZNX A;  4AFZ C;  1SPK A;  2EYW A;  3VRZ A;  3H41 A;  1G2B A;  1E6G A;  1G83 A;  2L3S A;  1UE9 A;  2DJQ A;  4HVU A;  2ECZ A;  2O31 A;  3GBQ A;  1W70 A;  1TG0 A;  2JM8 A;  1H3H A;  2KE9 A;  2EGC A;  1T0J A;  1M3A A;  2LP5 A;  1RI9 A;  2GQI A;  2RF0 A;  2X3W D;  3EHQ A;  4J9C A;  1GCP A;  4J9G A;  4HVW A;  1UHF A;  1JXO A;  3QWX X;  3U23 A;  1WDX A;  1WYX A;  1S1N A;  4EIK A;  4OMM A;  1PKT A;  1GCQ A;  2B86 A;  4J9F A;  2KXD A;  1ZBJ A;  2PZ1 A;  4Z88 A;  2RN8 A;  1JEG A;  2BZY A;  2AZV A;  1UGV A;  4K11 A;  1WXB A;  1AWW A;  2EVR A;  2RMO A;  2NUZ A;  1UFF A;  5HCK A;  1T3S A;  1SEM A;  1AWX A;  1QWE A;  2MOX A;  1JQQ A;  2H8H A;  4J9E A;  3SEM A;  2K9G A;  2G6F X;  4A63 B;  2CUD A;  2HBW A;  3PVL A;  1HJD A;  1CKA A;  2KEA A;  2LNH B;  3UF4 A;  1I07 A;  2CDT A;  2DX1 A;  2CH4 W;  4OMQ A;  1T3L A;  5GJW B;  1MV3 A;  2CSI A;  1OEB A;  1JXM A;  2IIM A;  2JM9 A;  1M3C A;  1YWO A;  2ROL A;  1V1C A;  2JMC A;  2X3X D;  1EFN A;  2L2P A;  4LUD A;  1QWF A;  2FPF A;  2RQW A;  1M27 C;  1NEG A;  2FEI A;  3A98 A;  3I5R A;  1WXU A;  1TUD A;  3QWY A;  1AWJ A;  2LQN A;  4ORZ A;  3I5S A;  2DVJ A;  2KT1 A;  2DL3 A;  1H8K A;  4HVV A;  1HSQ A;  3NGP A;  1SRM A;  2NWM A;  1U06 A;  2DBM A;  2C0O A;  1ARK A;  2FG0 A;  2C0T A;  1QLY A;  2EYX A;  1HD3 A;  3VRY A;  4CC3 A;  2C0I A;  4WCI A;  4D8K A;  3SHW A;  4IIM A;  2BZX A;  2LJ3 A;  2QDL A;  1NG2 A;  1K1Z A;  1BB9 A;  4F14 A;  3EG2 A;  4HXJ A;  2ED0 A;  4AG1 C;  2F2X A;  5IH2 A;  3M0S A;  2KRS A;  1KIK A;  1JU5 C;  2O9S A;  1YN8 A;  3EGU A;  4GBQ A;  2DLP A;  1KJW A;  2J05 A;  2V1R A;  2GGR A;  4CC4 B;  1XOV A;  1WXT A;  1AZG B;  4OMN A;  1NLP C;  1NYF A;  1OV3 A;  2MCN A;  2JMA A;  1PHT A;  4JZ3 A;  1GBQ A;  4JJD A;  1K0X A;  4RTX A;  2DL4 A;  3IQL A;  1PNJ A;  3PE0 A;  2RQV A;  4ESR A;  1SSH A;  2JS0 A;  5IHN A;  1W1F A;  2DBK A;  1N5Z A;  1PRL C;  1TUC A;  2PNI A;  4Y92 A;  2GTJ A;  2BZ8 A;  1ZUY A;  1WLP B;  1GBR A;  2A08 A;  2J6F A;  2ED1 A;  2K6D A;  2DMO A;  2HEQ A;  2DNU A;  2K3B A;  3TSW A;  2JT4 A;  4HCK A;  2W10 A;  1VYV A;  2YUQ A;  3PVQ A;  1Z9Q A;  2FPD A;  3VS1 A;  1UUE A;  1W6X A;  2KT8 A;  5GJV B;  1PRM C;  1X27 A;  2ABL A;  4LUE A;  1KSW A;  2FPE A;  2F2V A;  1VYT A;  2YT6 A;  2AKL A;  5EC7 A;  2D0N A;  1CSK A;  2RPN A;  2DRM A;  4FSS A;  4KRT A;  1RLQ C;  2K7A A;  2YUN A;  2RQR A;  5IXB A;  2L3P A;  4LNP A;  4RTT A;  5FW9 A;  1YP5 A;  1ZLM A;  3H0H A;  4RUG A;  4RTW A;  1WIE A;  4E6R A;  2KR3 A;  1MUZ A;  1NEB A;  2DE0 X;  2DL5 A;  2KXC A;  1K0S A;  1M3B A;  2MIO A;  2JS2 A;  3EG0 A;  4DEX A;  3R6N A;  2DM1 A;  1RLP C;  1J3T A;  2A37 A;  1FMK A;  1KFZ A;  2DA9 A;  2D1X A;  1YCS B;  2KNB B;  2D8J A;  3LH5 A;  2K79 A;  4M4Z A;  4Z8A A;  2SEM A;  5I11 A;  2AZS A;  1K4U S;  1VYU A;  4OMO A;  1PWT A;  2DIL A;  2VKN A;  4AFS C;  1X2K A;  2K2M A;  3KFV A;  1ZUU A;  3VS0 A;  4CC2 A;  3C0C A;  1X43 A;  1Y0M A;  1QKX A;  4DEY A;  2OI3 A;  2JTE A;  1ZSG A;  4JPB W;  2CRE A;  3VS5 A;  4AFQ C;  4F17 A;  2FRY A;  1WX6 A;  2I0N A;  1NLO C;  1BU1 A;  1BK2 A;  1Z9Z A;  2HDA A;  3EG3 A;  2EBP A;  3UA6 A;  1ZX6 A;  1UEC A;  2L3Q A;  1UJY A;  2ENM A;  2GNC A;  2AKK A;  3VS6 A;  2YUP A;  3EHR A;  4J9I A;  2LJ1 A;  3M0Q A;  2A36 A;  1WI7 A;  2RNA A;  3M0T A;  2P4R A;  3M0R A;  4GLM A;  4R0K A;  1I0C A;  1CKB A;  3I35 A;  3TVT A;  2LZ6 B;  2GTO A;  2V1Q A;  1AEY A;  1NYG A;  2KBT A;  2EGA A;  2DYB A;  2KRO A;  1I1J A;  2LCS A;  1AOJ A;  4JZ4 A;  2O88 A;  1K76 A;  1OPL A;  2GBQ A;  3UA7 A;  2SRC A;  1X69 A;  2VWF A;  1ABO A;  1U5S A;  2RQU A;  3CQT A;  1YWP A;  4LN2 A;  1U3O A;  1VA7 A;  2M51 A;  4JJC A; 
#chains in the Genus database with same CATH topology
 4X1V A;  2QYZ A;  3RKX A;  3PIP A;  1BI0 A;  4RTY A;  2XID A;  3CCJ Q;  1X6G A;  3HKS A;  2J6O A;  4HCB A;  3JCM h;  2QEX A;  1AVZ C;  1Y7X A;  1U1T A;  4A4E A;  1VQK A;  2KRM A;  2XKO C;  4IIO A;  2QI2 A;  2XG8 D;  2VC8 A;  2KVQ G;  3REB B;  2R57 A;  4XU3 A;  1G3S A;  4KH0 B;  4RTV A;  1ZA2 B;  4AG2 C;  1G3T A;  1H92 A;  1QW1 A;  2RB6 A;  2HSE B;  1YIT T;  3HRT A;  4PJO F;  2OTJ A;  1OX9 A;  3CPW S;  1D0Z A;  2E10 A;  3NHN A;  5GAN 8;  2OAW A;  3EFR A;  3V7C A;  1X2Q A;  4F16 A;  1OZ2 A;  2GQV A;  3VS2 A;  3EFO A;  2BTT A;  2CSQ A;  1C0M A;  2EGE A;  1QVF A;  2D8H A;  2O9V A;  3ER0 A;  3GNG A;  1JO8 A;  3UAT A;  4OMP A;  4M77 E;  2AT1 B;  3RBB B;  5AYF A;  2NUP A;  4XK8 E;  2KYB A;  1VQ4 A;  2VYT A;  2JZ2 A;  2L0A A;  1Q7Y C;  1SRL A;  4J9D A;  1E7O A;  1K9M R;  1GFC A;  3EG1 A;  3QDR B;  1OQK A;  1HK9 A;  2OJ2 A;  3E1S A;  1K73 C;  2MF2 A;  3JCM Q;  5KYW A;  1KD1 C;  4XQ3 A;  3QXE B;  2L5Q A;  3V8J A;  3L2U A;  3VS3 A;  1AZE A;  2EQI A;  1FWZ A;  2O2O A;  2RM4 A;  3M57 A;  3CCM T;  2A3L A;  5GAO n;  2HL3 A;  1BI3 A;  2HMA A;  3EGD B;  2XHC A;  2CT3 A;  3OYM A;  4M78 F;  4ZN1 A;  2HAX A;  2RJF A;  5LJ5 f;  2XU8 A;  4JJB A;  3G71 Q;  4MML A;  3ULR B;  2RA2 A;  3X20 B;  2DF6 A;  3T9N A;  2DZC A;  2E6Z A;  3M4Y A;  2QTV A;  4QT7 A;  5LJ5 d;  2LRQ A;  1IXD A;  1XTD A;  1D3B B;  1MMG A;  5IHI A;  3QO3 A;  5FU7 B;  4DOV A;  2KY9 A;  2LTO A;  3JCM c;  1E6G A;  4MZT A;  2L3S A;  1YI2 A;  3G71 T;  1QP2 A;  1PD0 A;  1UE9 A;  2YRD A;  1SKU B;  4C8Q C;  2YWW A;  3GBQ A;  3CEY A;  4N4H A;  2WSE E;  2BE7 D;  2A0F B;  2EGC A;  2RI5 A;  3MP8 A;  2EJ9 A;  2RF0 A;  4M7D B;  4C8Q B;  1GCP A;  2M16 A;  1MNE A;  4J9G A;  1NJI C;  1UHF A;  2LDM A;  2FB7 A;  3CCU T;  5KH6 A;  1I8F A;  1S1N A;  4EIK A;  4OB0 B;  1YI2 T;  1PKT A;  2RD1 A;  4BB7 A;  4J9F A;  1Y96 A;  2PZ1 A;  5FRM A;  5CKH A;  1JEG A;  2AZV A;  3OB9 A;  2FZC B;  2GCX A;  2AIR B;  2XIC A;  2NUZ A;  2COZ A;  5HCK A;  1T3S A;  2OTJ Q;  1AWX A;  2LX9 A;  4KGV B;  3C95 A;  2CZ1 B;  5GAO r;  2G6F X;  2CUD A;  4M7A B;  3PVL A;  4M7A D;  3UF4 A;  5DLO A;  1OYX A;  4UC4 A;  2CDT A;  4HCZ A;  3BDU A;  1BI1 A;  2DX1 A;  3QDF A;  3EGD A;  1T3L A;  1MV3 A;  3OQ5 A;  3CC7 T;  2EYQ A;  2EFI A;  2HZY A;  2CSI A;  2KSS A;  2DTI A;  2JM9 A;  1M3C A;  4LDV A;  2QXF A;  1QWF A;  2FPF A;  5M9O A;  3CBP A;  1VQ7 T;  1WXU A;  3QWY A;  1AWJ A;  3M54 A;  4ORZ A;  1P92 A;  2DVJ A;  5CR2 A;  2KT1 A;  4HVV A;  1QP3 A;  1SRM A;  3CPW P;  3CMA A;  4MZM A;  2NYS A;  2FG0 A;  1ARK A;  2EYX A;  4BDZ A;  1D09 B;  4M75 A;  4F7U A;  3CD6 A;  4CC3 A;  4DBQ A;  2P0P A;  3HRU A;  3EGX A;  1Q81 R;  5KCH A;  3SHW A;  3CCE Q;  4IIM A;  2BZX A;  1WGS A;  2LJ3 A;  2QDL A;  3J7A F;  1UGP B;  1BYM A;  3E9F A;  4FU6 A;  4HXJ A;  4M77 F;  4BDY A;  2KK4 A;  3ZEH A;  4C8Q A;  2OTL T;  5KE3 A;  1NZ9 A;  4YTL A;  2F2X A;  5IH2 A;  1JU5 C;  2H3E B;  5A0L A;  3OYH A;  1TH7 A;  4IUQ A;  4AT1 B;  1NYF A;  2V8I A;  3QYH B;  5D6X A;  4C0F A;  1YHQ T;  3VYG A;  4E7J A;  2JMA A;  4E7Z A;  1Q86 C;  2RHZ A;  3L42 A;  2RJE A;  2DTO A;  4JJD A;  3FDR A;  3R6O A;  3PE0 A;  1Q82 U;  2DBK A;  1VQ5 Q;  1TUC A;  2PNI A;  1S72 T;  1YIJ Q;  3GIB A;  4FL6 A;  3G4S T;  2K57 A;  1ZUY A;  1KHI A;  2A08 A;  2K6D A;  2DMO A;  1WJS A;  1BI2 A;  5LJ3 h;  5GAN g;  2CS7 A;  4M77 G;  2K5L A;  3OYD A;  5GJV B;  1X6O A;  1PC0 A;  4E7I A;  3J80 E;  2L8D A;  4E7K A;  3RKY A;  3LLR A;  4OB2 B;  2MWO A;  5EC7 A;  1D0X A;  3QZ5 B;  3LWI A;  1CSK A;  3CCQ A;  3ZBD A;  3LYI A;  3HTR A;  2IVW A;  2RHX A;  3DLL A;  1QMC A;  2YUN A;  1WHJ A;  4LNP A;  4RTT A;  5FW9 A;  4F7U B;  4WTO B;  2XDB A;  1VQN T;  4RTW A;  3HRS A;  5KYX A;  3FRN A;  3P8H A;  3VKI A;  4JRQ A;  2KXC A;  1K0S A;  1M3B A;  2MIO A;  2JS2 A;  3EG0 A;  4DEX A;  3RES A;  1RLP C;  2Y4Y A;  1FMK A;  2JTM A;  3WVD B;  3AT1 B;  1FX7 A;  2D8J A;  5GAM g;  2CGH A;  4M4Z A;  4Z8A A;  1Q95 G;  5GAM h;  1QVF P;  1YFN A;  1X2K A;  2K2M A;  4DOW A;  5GAN 3;  4E7L A;  4CC2 A;  2EJF A;  4M78 E;  2X9H A;  1B34 B;  3DKM A;  3M4G A;  2OI3 A;  4PJL A;  2JTE A;  1ZSG A;  1YHQ A;  1PM3 A;  1XQH A;  4OGC A;  2FRY A;  2VAS A;  1NLO C;  1BK2 A;  3G6E A;  3EG9 B;  3CCL A;  1UEC A;  2DVE A;  2KQW A;  2L3Q A;  2QQ9 A;  3M56 A;  1KC8 C;  2MAM A;  3OW2 A;  3EHR A;  3M9Q A;  2R5A A;  1YHQ Q;  1WI7 A;  1BCO A;  1YIJ A;  5GMK h;  4KUI A;  3I35 A;  1CKB A;  2V1Q A;  4A4F A;  1AEY A;  3OYA A;  3FJP A;  5I2S A;  3NTI A;  3OYB A;  3LW5 E;  2YLB A;  4A4H A;  1F1B B;  3CCM A;  4AMC A;  2MYS A;  1AOJ A;  5GAM d;  3JCM W;  4JZ4 A;  3CCV Q;  2ZAE A;  2CP6 A;  1N9R A;  1RAG B;  5A0G A;  3OS2 A;  1VQO Q;  4C8Q D;  4JS5 A;  2QG9 B;  2VWF A;  3HL8 A;  3JB9 I;  2RHI A;  3CCJ A;  2RI3 A;  2QA4 Q;  1FMV A;  3CME T;  2RQU A;  4LN2 A;  1U3O A;  4XU1 A;  4HCC A;  4M7A E;  4J9B A;  4KUD K;  3TRE A;  1LJO A;  3QBY A;  1D1B A;  1OUL A;  4Y91 A;  1KQS A;  5IN1 A;  1M90 U;  1VQ4 Q;  4IUU A;  2HD0 A;  3NPF A;  4N4G A;  3OMG A;  1WQW A;  5GMK m;  2FRW A;  1Y57 A;  2DL7 A;  3MP1 A;  1ZSZ C;  4PJO D;  4PJM A;  3RNJ A;  4E47 A;  3SWN A;  4FYY B;  4D8D A;  2J6K A;  3NFC A;  1QVF S;  5KYU B;  1YNZ A;  1OPK A;  2E5K A;  2YRV A;  4J7I A;  3ZL7 C;  3ASK A;  4M7D F;  2EYY A;  2M0Y A;  4X9C A;  2E1H A;  4C92 E;  1RAI B;  2JNG A;  1YIT A;  3LX7 A;  1PKS A;  5A0D A;  3OS0 A;  1YBY A;  3V7S A;  3QUI A;  1RAF B;  1GL5 A;  1M8M A;  1WHG A;  2R58 A;  3MEV A;  3GPL A;  2CYZ B;  2CP7 A;  5FWB A;  4LD9 K;  5L8R E;  2XMF A;  2JOY A;  3CD6 Q;  3FC3 A;  2QQR A;  4KH1 B;  2KGT A;  2Y4X A;  2HBP A;  3CCU Q;  2QAZ A;  1N27 A;  2EQM A;  1VQ4 T;  3CCU A;  5KYY A;  4QVD A;  2RHU A;  1OOT A;  5FWC A;  1ABQ A;  2DRK A;  5FU6 B;  3NMZ C;  2R5M A;  3C12 A;  4Z89 A;  1GFD A;  3I55 A;  3WVE B;  1BIA A;  2M9U A;  1WFW A;  1UDL A;  1UEB A;  2LJ0 A;  1S72 A;  1FMW A;  4OVA A;  1IHW A;  1ACM B;  4PJO G;  2M02 A;  2B8A A;  2XDP A;  5GAN 5;  1Q7Y U;  4DQ2 A;  1TUG B;  1H3Z A;  1Q86 R;  4CC7 A;  1X01 A;  4M75 C;  1I5L A;  3PT9 A;  1YJN Q;  4J9H A;  2CT4 A;  3GOX A;  3D7S B;  2HKN A;  4EMK B;  5GAN e;  1EZZ B;  2A28 A;  1MMD A;  2EKH A;  4RG2 A;  1SHG A;  3A8L B;  1M90 R;  4LDX A;  2JW4 A;  4AFZ C;  3QJ6 A;  1SPK A;  3CCQ Q;  3VRZ A;  2LQ8 A;  2DJQ A;  5J39 A;  1W2B P;  5FRN A;  3UWN A;  2ECZ A;  2FL7 A;  1VQ6 T;  3H8Z A;  3JCM V;  3JCM P;  4C5G A;  1U8R A;  1NJI R;  4RCC A;  2LP5 A;  2GQI A;  4FYW B;  5J26 A;  2DEU A;  2X3W D;  3SB2 A;  4MDX A;  1R0B G;  4FSX A;  1MMA A;  3V7R A;  2VV5 A;  3QWX X;  3U23 A;  2VB6 A;  1JJ2 A;  4B9X A;  2X4X A;  4J83 A;  3VV0 A;  2BZY A;  1UB4 A;  1WXB A;  2PVG B;  2EVR A;  3M53 A;  2K5I A;  1UFF A;  3OBY A;  3RR6 A;  1QWE A;  1D1C A;  4WF2 A;  1JQQ A;  3SEM A;  4C92 B;  1SG5 A;  2ZCF B;  3G6E T;  3O8V A;  3MET A;  1VIF A;  2P0K A;  2CH4 W;  4OMQ A;  5GJW B;  4PJO A;  4OGE A;  3QII A;  4ZN3 A;  2GF7 A;  3CCQ T;  3WXM B;  3CC2 A;  2JMC A;  2RJD A;  2X3X D;  4RMO A;  3HSB A;  2ZPH B;  2L2P A;  4LUD A;  4F7U F;  1M27 C;  2FEI A;  3A98 A;  2EJG A;  4ELY C;  1TUD A;  1D0Y A;  2LQN A;  3QYG B;  5FLX E;  4C5E A;  1HSQ A;  2MWP A;  4NOY A;  3RUX A;  1SSF A;  2ATC B;  3MJX A;  1WQ7 A;  1QVG P;  4F7U G;  1QLY A;  2JN0 A;  3V8K A;  3CC4 A;  1LNX A;  3VRY A;  2M1H A;  4C92 C;  2ZPG B;  5CO7 A;  4HKE A;  4C0Z A;  3MKD A;  1WJQ A;  3X26 B;  2ZZD A;  1K1Z A;  1BB9 A;  4F14 A;  3MHX A;  3EG2 A;  2DXC A;  2C06 A;  1QVP A;  3QPH A;  3M59 A;  1M1K R;  4N4I A;  5GMK j;  1YN8 A;  2LQK A;  1PCX A;  1WPY A;  1YCY A;  2KAF A;  3HP9 A;  4J5Y A;  4GBQ A;  3VJP A;  2J05 A;  2V1R A;  4C5H A;  4CC4 B;  1AHJ B;  2X51 A;  1WXT A;  1AZG B;  1WHL A;  3S3O A;  1NLP C;  2WAC A;  5I2M A;  1Y07 A;  4M78 C;  2DAQ A;  1ZSZ A;  2DL4 A;  3IQL A;  1PNJ A;  3ZFJ A;  1VQM Q;  1SSH A;  2JS0 A;  1W1F A;  2PVD B;  5KYU A;  1N5Z A;  3CCS T;  2COW A;  4M7D D;  2GTJ A;  1B7T A;  3CBO A;  1GBR A;  5DM7 R;  2ZPF B;  2HEQ A;  2RHY A;  2E3H A;  2RJC A;  4M75 E;  4M77 C;  5GMK i;  3QZ9 B;  2W10 A;  3VS1 A;  1A0N B;  1Z9Q A;  2FPD A;  1RAH B;  1VQM T;  1O75 A;  1KK7 A;  2IPO B;  1PRM C;  4LUE A;  4M77 A;  2MPX C;  2FPE A;  4FYV B;  5C6S A;  2YT6 A;  2AKL A;  1N6A A;  5I21 A;  1XNI A;  3JB9 F;  2RPN A;  2LVM A;  3A8M B;  2LT4 A;  4KRT A;  1RLQ C;  2K7A A;  1KQ2 A;  2RQR A;  2E64 A;  3KBG A;  1M2V B;  3H0H A;  3RER A;  1WIE A;  4E6R A;  3L2R A;  5CKF A;  4M78 A;  1VQP A;  1MUZ A;  3M55 A;  1WHM A;  2ZPE B;  2H3J A;  2F5T X;  2QA4 T;  2LCC A;  4KT0 E;  2DM1 A;  1PSE A;  2X35 A;  2X4J A;  2EKO A;  1KFZ A;  2CP0 A;  4RKU E;  3X24 B;  2CKK A;  1VQL A;  1YJ9 Q;  5GAN d;  2VUB A;  2K79 A;  4J6Y A;  5J3B A;  3JB9 H;  2YRC A;  4BI8 B;  2AZS A;  4JS4 A;  1K4U S;  1VYU A;  2VKN A;  4BD3 A;  4AFS C;  5CAI A;  4PLI A;  3GNF B;  4XTW A;  1OX8 A;  1X43 A;  2DXB A;  4CRI A;  1QKX A;  2QGF B;  1QCN A;  2NUP B;  2CRE A;  4VUB A;  3VS5 A;  4HT8 A;  4EMK A;  1RAC B;  3PGG A;  1BU1 A;  5DLQ E;  3EG3 A;  4KGX B;  4BI4 A;  1VQ9 T;  3UA6 A;  3G7Z A;  2OTL A;  1KHC A;  1UJY A;  2BE9 B;  2DET A;  4C5I A;  3RIR A;  3CCR A;  1KQS S;  5FRO A;  2YUP A;  2E5Q A;  4PL6 A;  5KYW B;  3M0Q A;  3X25 B;  3PIO A;  3M0T A;  2P4R A;  1RAA B;  1XJW B;  1VQM A;  2QQS A;  2DXU A;  3TVT A;  2LZ6 B;  3ME9 A;  4C0G A;  3GP8 A;  5GAN h;  2F1L A;  3CC4 T;  1N8R C;  4E2F B;  1I1J A;  4OB3 B;  2LCS A;  2O88 A;  1M2V A;  5HK0 A;  4FCY A;  4X9D A;  1K76 A;  1OPL A;  4IUP A;  4PFZ A;  3UA7 A;  2SRC A;  1X69 A;  2JJ9 A;  4M78 B;  1IRE B;  3CXC P;  1KG1 A;  1YWP A;  4NL3 A;  2E41 A;  1N8R U;  4FIB A;  1I5O B;  4JJC A;  1VQP T;  4XTZ A;  1FYN A;  4JJN K;  2DO3 A;  2F2W A;  1ZBX A;  1VQN Q;  3INZ A;  3L2V A;  4C0D C;  3L2W A;  3H0I A;  3OW2 S;  2FO0 A;  2DK3 A;  2QGG A;  4BE1 A;  1UHC A;  3FJ5 A;  2D0Q B;  2DL8 A;  3M0U A;  2F69 A;  1KC8 U;  4Y28 E;  1M5Q 1;  3CPW A;  2EYZ A;  1WJR A;  3JB9 J;  3CCS Q;  3EH2 A;  1VQ6 A;  4M7A G;  4XTV A;  2LX7 A;  1Y71 A;  4F7U E;  4JRP A;  3OYL A;  3REA B;  4RTZ A;  2KI7 A;  4M75 F;  2RI2 A;  1YIJ T;  2JXB A;  4NL2 A;  2HSP A;  1HYO A;  3PMI A;  3S3N A;  2D9T A;  3O5Z A;  4QQG A;  5GMK l;  1M4Z A;  2O01 E;  3PMT A;  1MV0 B;  2KRN A;  2HKQ B;  2LC4 A;  2RH2 A;  4C92 F;  4EMH A;  4M7A F;  2OTJ T;  1RAB B;  1YJN T;  1Q7Y R;  1ZA1 B;  5LJ3 g;  5HK3 A;  3CCV T;  2J7I A;  3VS4 A;  2ROT A;  1K73 R;  5I22 A;  3I55 Q;  1PSF A;  1YI2 Q;  1PD1 A;  1AD5 A;  2FHD A;  4KBM B;  2MMP A;  3I55 T;  2PTK A;  5IXF A;  2DER A;  2QQB A;  4A54 A;  4HA8 A;  2RK2 A;  2DTH A;  2EPD A;  3CXC S;  2CH4 A;  1QCF A;  2ZGW A;  4M7D E;  1ZSZ B;  2LNV A;  2HQE A;  4PJO C;  2PVO B;  1WHK A;  2DKG A;  4C0D B;  3I56 A;  1N8R R;  2DYI A;  3G1J A;  4M7D A;  3EGX B;  1TXQ A;  4XTU A;  4PLL A;  1K9A A;  3H0F A;  4XU0 A;  1UJ0 A;  1K8A C;  2LQW A;  4FT4 A;  5HKC A;  1QCO A;  4J6X A;  4B9W A;  4M77 B;  3BDL A;  4ZNX A;  3OYK A;  2EYW A;  2E6N A;  1G2B A;  1GXI E;  3E19 A;  1AT1 B;  1IB8 A;  2I2L A;  3MPU B;  1V29 B;  4ELZ C;  4HVU A;  4N0A A;  5LJ3 d;  2EQU A;  1TG0 A;  1RL2 A;  3OSV A;  4M7D G;  2KE9 A;  2HQH A;  2ZPI B;  1T0J A;  1RI9 A;  3A5Z B;  3CCE A;  4J9C A;  4PJN A;  4HVW A;  3G6E Q;  1JXO A;  4O5V A;  1WYX A;  4B6M A;  2CZ6 B;  5KCO A;  1G8X A;  4OMM A;  2EQK A;  1I4K 1;  3EFO B;  2G3R A;  2AHJ B;  1VQ6 Q;  1ZBJ A;  2RN8 A;  1UGV A;  2DXT A;  1AWW A;  5GAM e;  2RMO A;  4PJJ A;  3VU3 C;  4DBR A;  1SEM A;  3BW1 A;  4ZGJ B;  4J9E A;  4QVZ A;  2HNI A;  2QDY B;  4A63 B;  2HBW A;  1CKA A;  3OA6 A;  1I07 A;  1HXD A;  1U1S A;  3OYF A;  4BUG A;  5LJ3 f;  1TS9 A;  2X4Y A;  1OEB A;  2IIM A;  1Q81 U;  1V1C A;  4JUV A;  3QKJ A;  1EFN A;  4II1 A;  2L89 A;  2V26 A;  1NEG A;  4A4G A;  3I5R A;  2F5K A;  3RMQ A;  2CP3 A;  3OMC A;  1MMN A;  3URG A;  1QQJ A;  2EQJ A;  3L2Q A;  3CCR Q;  1BKB A;  5DY9 A;  2DEQ A;  2C0O A;  5CK9 A;  5IAY A;  3DB4 A;  1OU9 A;  2L3R A;  3OBW A;  4QVC A;  1M2O A;  4C92 G;  3RKW A;  1JBM A;  2V8J A;  5LJ3 e;  1Q82 C;  4BI3 A;  4WCI A;  1R8O B;  1K8A R;  3KUF A;  3GLX A;  4EDU A;  3QSU A;  2XI9 A;  2OTL Q;  3F70 A;  4AG1 C;  2P84 A;  2CZ0 B;  3H6Z A;  1KIK A;  1SF9 A;  2O9S A;  2K2V A;  3CCE T;  3EGU A;  2DLP A;  5LL6 S;  2WSC E;  3A8G B;  1XOV A;  2VGM A;  4OMN A;  4QW2 A;  1YJW A;  3P8B B;  3HFN A;  1UGQ B;  1PHT A;  1M1K C;  1IGU A;  4JZ3 A;  1GBQ A;  5LJ3 j;  3JB9 D;  2CZ7 B;  4RTX A;  2PU9 B;  2VGN A;  4EMG A;  2QQA A;  5IHN A;  4CI0 C;  4Y92 A;  1KC8 R;  4J8O A;  3CMA Q;  1JJ2 P;  4O6J A;  1Y96 B;  1WLP B;  3LGF A;  3P8D A;  1YIT Q;  3I56 T;  2CP5 A;  2DNU A;  3TSW A;  1KQS P;  2JT4 A;  3PFS A;  4HCK A;  4PFP A;  2YUQ A;  3PVQ A;  1UUE A;  2KT8 A;  1M9S A;  2F2V A;  3JSC A;  4XTY A;  1IHV A;  3G4S A;  2Z0W A;  2D0N A;  1O9S A;  5GAN 4;  2DRM A;  3UDC A;  4FSS A;  3OYN A;  2GFU A;  1X75 C;  5C0M A;  5KE2 A;  5GAN f;  1NBE B;  4M78 G;  5IXB A;  1ZLM A;  3A1P A;  4RUG A;  1KD1 U;  8ATC B;  2KR3 A;  1B34 A;  1VQK Q;  2E3I A;  1NEB A;  4JDS A;  2QEX Q;  2DL5 A;  5GAM j;  3EAE A;  1NPP A;  5IT9 E;  2QA4 A;  1J3T A;  1MND A;  2A37 A;  3EG9 A;  1JRI A;  4FW2 A;  3KXT A;  4IUT A;  2DA9 A;  1YCS B;  3LH5 A;  1QVG A;  3C4S A;  4BY6 B;  3RMS A;  2SEM A;  5I11 A;  4M75 B;  2DPP B;  4OMO A;  2DIL A;  4E7H A;  2M0O A;  4QQD A;  2XDD A;  3PNW C;  3VS0 A;  1OI1 A;  1K9M U;  1C1A A;  2YLC A;  4ZTJ A;  5LJ5 e;  5LJ5 j;  4L6V 5;  3OYC A;  5GAO p;  4JPB W;  2A7Y A;  1YJN A;  4F17 A;  3FIF A;  2I0N A;  1VOM A;  2HDA A;  5LJ5 h;  3OYI A;  4A4K A;  3QHS A;  4D6W A;  8AT1 B;  4IKF A;  2PQW A;  1G3Y A;  5LJ5 g;  1EIF A;  1V76 A;  2GNC A;  2DIG A;  2JVV A;  3OS5 A;  4JRK A;  1M1G A;  4J9I A;  3TU4 K;  3MP6 A;  2LJ1 A;  1Q81 C;  1VQ7 A;  3LGL A;  2EAY A;  3S6W A;  1M90 C;  3I56 Q;  2E70 A;  1ZHI A;  4GLM A;  1VQ8 A;  3CME A;  2GTO A;  1NYG A;  2KBT A;  4MMK A;  4L5G A;  2DYB A;  2HQX A;  2MI6 A;  1JB0 E;  2FZK B;  2X4W A;  3SWN B;  2KMT A;  3CC7 Q;  3OSS C;  1VA7 A;  1ABO A;  1U5S A;  3M5A A;  5GMK e;  1MHN A;  4PK4 A;  2V8K A;  1M8V A;  2OX7 A;  2KYM A;  4RTU A;  3MEW A;  3JV3 A;  3HFO A;  1IO6 A;  1AWO A;  1B3Q A;  4DA4 A;  3OYJ A;  2DIQ A;  4LD6 A;  2XD0 A;  2K3X A;  4IUV A;  4OML A;  5KYX B;  4MDW A;  3E2U A;  2J06 A;  1RUW A;  1E6H A;  1VQ5 T;  1YJ9 A;  4R56 A;  3N5B B;  3MEU A;  1G3W A;  2VVK A;  1LCK A;  4IUR A;  4LE9 A;  3SFM A;  3JCM J;  1JJ2 S;  4J7F A;  3THK A;  3I9Q A;  3L2Z A;  4ZTF A;  2W0Z A;  3JCM f;  1WA7 A;  4M77 D;  4C92 D;  3JCM X;  2O4X B;  1M1F A;  1X6B A;  2E4H A;  2E65 A;  3CCM Q;  1OU8 A;  2YDL A;  4M75 D;  1QKW A;  1TU0 B;  3FLG A;  2RO0 A;  1NM7 A;  3JAM E;  4KUL A;  3SD4 A;  3OYG A;  1VQ9 A;  1I81 A;  3M58 A;  3M0P A;  1BBZ A;  3PTA A;  5CKD A;  1BIB A;  2AK5 A;  2RQT A;  4EMK C;  2XK0 A;  5CCA A;  3LH0 A;  4AFU C;  5GAO m;  1T0H A;  5IHK A;  2YSQ A;  1TOV A;  2EIF A;  2ESW A;  4M75 G;  5L23 A;  2YUO A;  2QEX T;  3H9N A;  3VS7 A;  1TWB A;  3TQ7 P;  5GAO l;  3DB3 A;  2EW3 A;  4OF1 A;  3TSZ A;  1UG1 A;  2JUF A;  5ECA A;  3CC2 T;  2VXE A;  2HCK A;  1SHF A;  2MK5 A;  2DFU A;  3CD6 T;  1VQ7 Q;  1M30 A;  3DLM A;  4Z02 A;  4C8Q G;  1GRI A;  1GCQ C;  1VIE A;  2LMJ A;  1VQN A;  2CUB A;  2RK1 A;  1PG5 B;  3UPU A;  5D7U A;  1B07 A;  4OMF B;  4PFO A;  7AT1 B;  1UTI A;  1ZUK A;  4LDY A;  4F04 B;  3SDZ A;  1WNL A;  2JTF A;  3H41 A;  4M7A C;  1G83 A;  1G5V A;  1N9S A;  1TTH B;  1D1A A;  2GFA A;  3G71 A;  3L1A A;  2P0Q A;  1QVG S;  2O31 A;  2Y90 A;  1W70 A;  1W4S A;  2JM8 A;  3CC2 Q;  1H3H A;  2NUT A;  2K4Y A;  2COY A;  3MO8 A;  2VXF A;  1M3A A;  5GAN 7;  1WHH A;  4ZGD B;  3EHQ A;  4M78 D;  3OS1 A;  4P5N A;  4FYX B;  4PJO B;  1UGS B;  1IZ6 A;  2YHT A;  5GAN j;  1WDX A;  1VQL T;  3SWN C;  1GCQ A;  2B86 A;  1C6V X;  2KXD A;  4Z88 A;  4NS5 A;  4K11 A;  4FT2 A;  3A8H B;  3CCR T;  3TCJ A;  5D6Y A;  2MOX A;  1R77 A;  4DBH A;  2H8H A;  4V2S A;  2K9G A;  1VQO A;  4Q5W A;  4OB1 B;  1HJD A;  5CQX A;  2K3Y A;  3EFS A;  2KEA A;  3CCL T;  2LNH B;  4JLI A;  5CIU A;  4X34 A;  1ZQ1 A;  3EH1 A;  2K5F A;  1BCM A;  2DZ9 A;  9ATC B;  5GAN 6;  5KYY B;  3JB9 G;  4RG8 A;  2LCL A;  1JXM A;  1YWO A;  2ROL A;  1Q86 U;  5CQY A;  1VUB A;  2RQW A;  4FW1 A;  3BFM A;  3V8L A;  1R0C B;  4PKC C;  3HHT B;  3I5S A;  1VQ5 A;  2LT1 A;  1H8K A;  2DL3 A;  3UT1 A;  3NGP A;  4JLG A;  2FZG B;  3QJY A;  1M1K U;  3BY7 A;  2NWM A;  4KGZ B;  1U06 A;  2BUD A;  3JCM g;  2DBM A;  5AT1 B;  4C92 A;  2C0T A;  4QQ6 A;  5HY6 A;  3CMA T;  1HD3 A;  5GAN 2;  4BAC A;  3AHU A;  3VUB A;  1NPR A;  4C8Q E;  1RAD B;  4TVR A;  1K9M C;  4FM4 B;  2C0I A;  5KYN A;  4D8K A;  1NG2 A;  1KD1 R;  3Q1J A;  2ED0 A;  1NE8 A;  2NLU A;  3JRZ A;  3M0S A;  2KRS A;  4ME7 A;  3CME Q;  4BE2 A;  1KJW A;  1RI0 A;  2GGR A;  4PNO A;  1RAE B;  4XAX B;  4XTX A;  4N0A C;  3X28 B;  1OV3 A;  2MCN A;  2BKD N;  4C8Q F;  3JCM b;  1K0X A;  4MZP A;  5CKB A;  1IGQ A;  2RQV A;  4LXC A;  4ESR A;  3CC4 Q;  1PRL C;  3HPW A;  2CP2 A;  4QKU A;  2BZ8 A;  3JCM d;  2YXY A;  4JRI A;  1LOJ A;  2J6F A;  2ED1 A;  3MCA B;  5FU7 C;  1IRX A;  2K3B A;  4RCB A;  1VYV A;  1W6X A;  1EX4 A;  2HL5 C;  1X27 A;  2ABL A;  2O4X A;  1D3B A;  1KSW A;  3G4S Q;  4XU2 A;  1VYT A;  1UGR B;  3C94 A;  3FB9 A;  1TSF A;  1S72 Q;  1VQ9 Q;  4E7S A;  4A53 A;  2IG0 A;  2OAU A;  6AT1 B;  1NJI U;  2EWN A;  3CCV A;  4L59 A;  2L3P A;  1YP5 A;  1LPL A;  5A2Q E;  1K73 U;  2DJZ A;  1K8A U;  2QAS A;  1MGQ A;  2DE0 X;  4R55 A;  4PJO E;  3CCJ T;  1YJW Q;  3R6N A;  4LDW A;  3OY9 A;  1DJ7 B;  5FU6 C;  2BIV A;  1KQ1 A;  3CPF A;  4J6W A;  3A8O B;  1YJ9 T;  2D1X A;  2KNB B;  2KDS A;  1VQK T;  3S3M A;  2D6F A;  3E9G A;  5GAM f;  4ZGE B;  2QTX A;  1H64 1;  1PWT A;  3OW2 P;  5D6W A;  3KFV A;  4M7A A;  1ZUU A;  3NTH A;  5CVI A;  3RDV A;  3C0C A;  2DD4 A;  1Y0M A;  4DEY A;  4ATO A;  3TEE A;  3MEA A;  4DBF A;  4AFQ C;  3QG1 A;  1VQ8 Q;  1WX6 A;  5GAO q;  2E12 A;  2PUO B;  1Z9Z A;  5CKE A;  3FEO A;  4HT9 A;  2EBP A;  3JCM e;  1ZX6 A;  3BE3 A;  2PUK B;  3CCS A;  2ENM A;  4EPC A;  3OYE A;  2AKK A;  3CXC A;  3VS6 A;  4OP0 A;  4GY5 A;  2A36 A;  2RNA A;  1VQ8 T;  4GLK A;  3M0R A;  4M7D C;  3GF5 A;  2NUT B;  4BY6 C;  4R0K A;  3OYY A;  1I0C A;  1YJW T;  2WSF E;  2DD5 A;  2EGA A;  2KRO A;  1FXX A;  1W2B A;  2ZPB B;  3CC7 A;  3NTK A;  4ANJ A;  1Q82 R;  2QK0 A;  1VQL Q;  1VQO T;  1LVK A;  3CBM A;  2GBQ A;  3VYH B;  1WZO A;  2FVU A;  5EG2 A;  2P4T A;  4LDU A;  3VUZ A;  4BE0 A;  1VQP Q;  3CCL Q;  3CQT A;  3J81 E;  1OZ3 A;  2FYK A;  3LWH A;  2M51 A;  1W2B S; 
#chains in the Genus database with same CATH homology
 4J9B A;  4X1V A;  1FYN A;  2F2W A;  4RTY A;  3H0I A;  1X6G A;  2J6O A;  2KYM A;  4RTU A;  2FO0 A;  3JV3 A;  1IO6 A;  1AWO A;  1B3Q A;  1UHC A;  3NPF A;  3FJ5 A;  1AVZ C;  2DL8 A;  3M0U A;  2FRW A;  1Y57 A;  2DL7 A;  4OML A;  3RNJ A;  2KRM A;  2EYZ A;  4D8D A;  2J6K A;  4IIO A;  2J06 A;  1RUW A;  1E6H A;  1YNZ A;  2LX7 A;  3REB B;  1OPK A;  2E5K A;  4RTV A;  3ZL7 C;  4AG2 C;  2VVK A;  1LCK A;  1H92 A;  3REA B;  4LE9 A;  4RTZ A;  2EYY A;  2M0Y A;  3NHN A;  2OAW A;  3THK A;  1X2Q A;  4F16 A;  1PKS A;  3I9Q A;  2JXB A;  3VS2 A;  2BTT A;  2CSQ A;  2W0Z A;  1WA7 A;  2EGE A;  2HSP A;  1GL5 A;  2D8H A;  1M8M A;  1X6B A;  2O9V A;  1JO8 A;  3UAT A;  3O5Z A;  2YDL A;  4OMP A;  1QKW A;  5FWB A;  3RBB B;  1NM7 A;  1MV0 B;  2XMF A;  2KRN A;  2KYB A;  3M0P A;  1BBZ A;  2L0A A;  2KGT A;  1A0N B;  1SRL A;  2AK5 A;  2RQT A;  4J9D A;  1E7O A;  1GFC A;  3EG1 A;  2J7I A;  3VS4 A;  1OOT A;  2ROT A;  5FWC A;  4AFU C;  1ABQ A;  2DRK A;  3NMZ C;  5I22 A;  1T0H A;  2OJ2 A;  5IHK A;  4Z89 A;  1GFD A;  1AD5 A;  2YSQ A;  2PTK A;  5IXF A;  1WFW A;  2ESW A;  1UDL A;  2LJ0 A;  5L23 A;  2YUO A;  3VS7 A;  3VS3 A;  1AZE A;  2EQI A;  2O2O A;  2EW3 A;  2EPD A;  3TSZ A;  1UG1 A;  5ECA A;  2CH4 A;  1QCF A;  2HCK A;  1SHF A;  2CT3 A;  1M30 A;  4CC7 A;  1GRI A;  1GCQ C;  4J9H A;  4JJB A;  2LMJ A;  2CT4 A;  1K9A A;  2CUB A;  3H0F A;  3ULR B;  1UJ0 A;  2DF6 A;  2A28 A;  2EKH A;  2LQW A;  1B07 A;  1SHG A;  4QT7 A;  1UTI A;  1ZUK A;  2JW4 A;  5IHI A;  4ZNX A;  4AFZ C;  1SPK A;  2EYW A;  3VRZ A;  3H41 A;  1G2B A;  1E6G A;  1G83 A;  2L3S A;  1UE9 A;  2DJQ A;  4HVU A;  2ECZ A;  2O31 A;  3GBQ A;  1W70 A;  1TG0 A;  2JM8 A;  1H3H A;  2KE9 A;  2EGC A;  1T0J A;  1M3A A;  2LP5 A;  1RI9 A;  2GQI A;  2RF0 A;  2X3W D;  3EHQ A;  4J9C A;  1GCP A;  4J9G A;  4HVW A;  1UHF A;  1JXO A;  3QWX X;  3U23 A;  1WDX A;  1WYX A;  1S1N A;  4EIK A;  4OMM A;  1PKT A;  1GCQ A;  2B86 A;  4J9F A;  2KXD A;  1ZBJ A;  2PZ1 A;  4Z88 A;  2RN8 A;  1JEG A;  2BZY A;  2AZV A;  1UGV A;  4K11 A;  1WXB A;  1AWW A;  2EVR A;  2RMO A;  2NUZ A;  1UFF A;  5HCK A;  1T3S A;  1SEM A;  1AWX A;  1QWE A;  2MOX A;  1JQQ A;  2H8H A;  4J9E A;  3SEM A;  2K9G A;  2G6F X;  4A63 B;  2CUD A;  2HBW A;  3PVL A;  1HJD A;  1CKA A;  2KEA A;  2LNH B;  3UF4 A;  1I07 A;  2CDT A;  2DX1 A;  2CH4 W;  4OMQ A;  1T3L A;  5GJW B;  1MV3 A;  2CSI A;  1OEB A;  1JXM A;  2IIM A;  2JM9 A;  1M3C A;  1YWO A;  2ROL A;  1V1C A;  2JMC A;  2X3X D;  1EFN A;  2L2P A;  4LUD A;  1QWF A;  2FPF A;  2RQW A;  1M27 C;  1NEG A;  2FEI A;  3A98 A;  3I5R A;  1WXU A;  1TUD A;  3QWY A;  1AWJ A;  2LQN A;  4ORZ A;  3I5S A;  2DVJ A;  2KT1 A;  2DL3 A;  1H8K A;  4HVV A;  1HSQ A;  3NGP A;  1SRM A;  2NWM A;  1U06 A;  2DBM A;  2C0O A;  1ARK A;  2FG0 A;  2C0T A;  1QLY A;  2EYX A;  1HD3 A;  3VRY A;  4CC3 A;  2C0I A;  4WCI A;  4D8K A;  3SHW A;  4IIM A;  2BZX A;  2LJ3 A;  2QDL A;  1NG2 A;  1K1Z A;  1BB9 A;  4F14 A;  3EG2 A;  4HXJ A;  2ED0 A;  4AG1 C;  2F2X A;  5IH2 A;  3M0S A;  2KRS A;  1KIK A;  1JU5 C;  2O9S A;  1YN8 A;  3EGU A;  4GBQ A;  2DLP A;  1KJW A;  2J05 A;  2V1R A;  2GGR A;  4CC4 B;  1XOV A;  1WXT A;  1AZG B;  4OMN A;  1NLP C;  1NYF A;  1OV3 A;  2MCN A;  2JMA A;  1PHT A;  4JZ3 A;  1GBQ A;  4JJD A;  1K0X A;  4RTX A;  2DL4 A;  3IQL A;  1PNJ A;  3PE0 A;  2RQV A;  4ESR A;  1SSH A;  2JS0 A;  5IHN A;  1W1F A;  2DBK A;  1N5Z A;  1PRL C;  1TUC A;  2PNI A;  4Y92 A;  2GTJ A;  2BZ8 A;  1ZUY A;  1WLP B;  1GBR A;  2A08 A;  2J6F A;  2ED1 A;  2K6D A;  2DMO A;  2HEQ A;  2DNU A;  2K3B A;  3TSW A;  2JT4 A;  4HCK A;  2W10 A;  1VYV A;  2YUQ A;  3PVQ A;  1Z9Q A;  2FPD A;  3VS1 A;  1UUE A;  1W6X A;  2KT8 A;  5GJV B;  1PRM C;  1X27 A;  2ABL A;  4LUE A;  1KSW A;  2FPE A;  2F2V A;  1VYT A;  2YT6 A;  2AKL A;  5EC7 A;  2D0N A;  1CSK A;  2RPN A;  2DRM A;  4FSS A;  4KRT A;  1RLQ C;  2K7A A;  2YUN A;  2RQR A;  5IXB A;  2L3P A;  4LNP A;  4RTT A;  5FW9 A;  1YP5 A;  1ZLM A;  3H0H A;  4RUG A;  4RTW A;  1WIE A;  4E6R A;  2KR3 A;  1MUZ A;  1NEB A;  2DE0 X;  2DL5 A;  2KXC A;  1K0S A;  1M3B A;  2MIO A;  2JS2 A;  3EG0 A;  4DEX A;  3R6N A;  2DM1 A;  1RLP C;  1J3T A;  2A37 A;  1FMK A;  1KFZ A;  2DA9 A;  2D1X A;  1YCS B;  2KNB B;  2D8J A;  3LH5 A;  2K79 A;  4M4Z A;  4Z8A A;  2SEM A;  5I11 A;  2AZS A;  1K4U S;  1VYU A;  4OMO A;  1PWT A;  2DIL A;  2VKN A;  4AFS C;  1X2K A;  2K2M A;  3KFV A;  1ZUU A;  3VS0 A;  4CC2 A;  3C0C A;  1X43 A;  1Y0M A;  1QKX A;  4DEY A;  2OI3 A;  2JTE A;  1ZSG A;  4JPB W;  2CRE A;  3VS5 A;  4AFQ C;  4F17 A;  2FRY A;  1WX6 A;  2I0N A;  1NLO C;  1BU1 A;  1BK2 A;  1Z9Z A;  2HDA A;  3EG3 A;  2EBP A;  3UA6 A;  1ZX6 A;  1UEC A;  2L3Q A;  1UJY A;  2ENM A;  2GNC A;  2AKK A;  3VS6 A;  2YUP A;  3EHR A;  4J9I A;  2LJ1 A;  3M0Q A;  2A36 A;  1WI7 A;  2RNA A;  3M0T A;  2P4R A;  3M0R A;  4GLM A;  4R0K A;  1I0C A;  1CKB A;  3I35 A;  3TVT A;  2LZ6 B;  2GTO A;  2V1Q A;  1AEY A;  1NYG A;  2KBT A;  2EGA A;  2DYB A;  2KRO A;  1I1J A;  2LCS A;  1AOJ A;  4JZ4 A;  2O88 A;  1K76 A;  1OPL A;  2GBQ A;  3UA7 A;  2SRC A;  1X69 A;  2VWF A;  1ABO A;  1U5S A;  2RQU A;  3CQT A;  1YWP A;  4LN2 A;  1U3O A;  1VA7 A;  2M51 A;  4JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...