3ULRB

Lysozyme contamination facilitates crystallization of a hetero-trimericcortactin:arg:lysozyme complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
PLGSSDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysozyme contamination facilitates crystallization of a heterotrimeric cortactin-Arg-lysozyme complex.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase, protein binding
molecule keywords Lysozyme C
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3ulrB00
2K9GA 4M4ZA 3IQLA 4R0KA 4AG1C 1GBQA 3EHRA 2DA9A 1S1NA 1JEGA 2KROA 5FW9A 4F16A 2LP5A 1H3HA 4AFSC 1ZUKA 1ZLMA 2KYBA 2FEIA 2DF6A 2MOXA 1K9AA 2JT4A 4OMQA 1HSQA 3EG2A 3VRZA 1X27A 2ROTA 4RTTA 2JXBA 1VYTA 2EGCA 2YUQA 1AWJA 2YT6A 2KXDA 1SPKA 1PKTA 1W1FA 1NG2A 3VS3A 3A98A 3H0IA 1UHFA 4RUGA 2DBMA 1K0XA 2LJ3A 4J9CA 1WXTA 3UF4A 1OPLA 1KIKA 1BBZA 2PNIA 2AKKA 2L0AA 1UTIA 4JZ3A 3H0FA 3THKA 1JXMA 4J9GA 2DE0X 1V1CA 2IIMA 4OMNA 1BK2A 2JM9A 1AWOA 1GFDA 1CKAA 2GGRA 1GBRA 2EW3A 2L3QA 2FG0A 4CC4B 4HVVA 2KT8A 1YWOA 3EGUA 1KFZA 3M0TA 2J05A 2X3WD 2DMOA 2SEMA 2MIOA 2YUOA 2AKLA 4HXJA 3VS2A 2GBQA 1YP5A 2CSQA 3RBBB 4AFQC 2JMCA 2M51A 4RTVA 1GFCA 1KJWA 1RUWA 2O31A 4J9BA 3ZL7C 1X2QA 1NEBA 2W10A 2DX1A 2KT1A 2KXCA 1SSHA 2D1XA 2JW4A 1J3TA 2O9VA 4JJDA 1B3QA 4RTYA 2X3XD 3I5RA 1AVZC 1AD5A 3VS7A 4F17A 1YWPA 2LMJA 5I22A 1MV3A 1I0CA 3FJ5A 2F2WA 1TG0A 2LZ6B 2CH4A 2LJ0A 1MUZA 3EG1A 1ZSGA 2O88A 5I11A 2DM1A 2F2VA 1PKSA 2KNBB 1NLOC 3M0UA 4JPBW 2RMOA 2SRCA 2KE9A 2LQNA 3PVQA 2RQUA 3SEMA 1X43A 2I0NA 2EQIA 2HDAA 2KRSA 5EC7A 1GCQC 4LNPA 1Z9ZA 1VA7A 4OMMA 2L3PA 1WA7A 2AZVA 2J6FA 1UJ0A 2DL7A 3H41A 3REBB 1ZUYA 3I9QA 1E7OA 3I35A 2DVJA 2KRMA 3TSWA 1K4US 1Y57A 1PRMC 3RNJA 3EG3A 1VYUA 3LH5A 2A08A 2EYZA 3NHNA 1QKWA 2GQIA 1M27C 1PRLC 3UA7A 1LCKA 3SHWA 2L3SA 1U3OA 4AFUC 2NWMA 4AG2C 1NYGA 2K79A 1QLYA 4IIMA 4IIOA 2PTKA 1M3AA 1HJDA 4J9DA 2EKHA 3NPFA 4Z88A 2HSPA 2V1RA 1A0NB 2JM8A 1NEGA 1YCSB 2J6OA 3PE0A 1UDLA 1ARKA 1WI7A 2FPFA 4D8KA 2BZYA 3VS6A 2KBTA 1I1JA 2DL5A 2ED1A 2DJQA 2RQTA 2RQVA 2C0OA 3H0HA 4OMOA 4D8DA 1T0HA 2KRNA 1PWTA 4LE9A 1E6GA 2FRWA 1ABQA 2KGTA 1WIEA 2DBKA 2FO0A 1AZGB 4WCIA 4JJCA 2DL4A 2YDLA 1RI9A 2A28A 4HVUA 1ZX6A 3UA6A 5IXBA 4LUEA 2LNHB 2CREA 5GJWB 2A37A 1FMKA 4J9IA 3TVTA 1ZBJA 1K76A 1OPKA 2HEQA 4J9EA 1I07A 1MV0B 1OV3A 2BZXA 1NYFA 2BTTA 2GNCA 1M8MA 4JJBA 4K11A 4OMPA 2DRKA 2AK5A 1Y0MA 5IHKA 2ESWA 2FPEA 2K7AA 4ORZA 4RTWA 1G83A 1VYVA 1UE9A 2VVKA 2NUZA 1NM7A 1BU1A 1EFNA 2OAWA 1HD3A 4LN2A 1JU5C 4CC2A 1WXUA 5IXFA 1UJYA 2FPDA 1UGVA 1ABOA 2DNUA 2K6DA 2DL8A 1T3SA 2LQWA 1GRIA 4ESRA 4E6RA 4GBQA 4RTUA 1OOTA 1G2BA 3VS5A 1PHTA 1RLQC 1NLPC 3EHQA 5FWBA 4DEYA 1K0SA 2H8HA 2RNAA 1QWEA 1YNZA 3NMZC 4OMLA 4Z89A 1WDXA 1CSKA 2KEAA 5ECAA 2YUNA 2YUPA 5IH2A 3QWYA 1WX6A 1OEBA 2C0IA 2GTOA 2OJ2A 2ENMA 2CUBA 2CDTA 2EBPA 3EG0A 5GJVB 1JXOA 2HBWA 1SHGA 2G6FX 1JO8A 1AOJA 1T3LA 4KRTA 1RLPC 2V1QA 2J06A 1U5SA 2AZSA 5L23A 2E5KA 2D8JA 1FYNA 2EGAA 1N5ZA 2D0NA 2M0YA 1XOVA 2RQWA 2CT3A 1Z9QA 1UUEA 1SRMA 2ROLA 4FSSA 4J9FA 1AWXA 1GL5A 2D8HA 1BB9A 4EIKA 1WLPB 1UECA 1YN8A 2DRMA 1QCFA 2EPDA 3JV3A 2JS0A 1T0JA 1TUCA 1WXBA 2EVRA 2DILA 2CSIA 2KYMA 1H92A 5FWCA 1M30A 2OI3A 2K2MA 3VS4A 1K1ZA 1JQQA 1E6HA 3U23A 2EYXA 3R6NA 1PNJA 3REAB 1AZEA 2L2PA 2QDLA 3VS1A 1WFWA 3VRYA 1W6XA 1X69A 2DL3A 3M0QA 2J7IA 1QWFA 2CH4W 1GCPA 4HCKA 2C0TA 4HVWA 3QWXX 2JS2A 4CC7A 2GTJA 4AFZC 3M0PA 2KR3A 2LX7A 3ULRB 3M0RA 1X2KA 2YSQA 2VWFA 1B07A 2DYBA 1KSWA 2JMAA 2XMFA 3NGPA 2VKNA 1UFFA 2P4RA 3M0SA 5IHIA 4A63B 2O9SA 4CC3A 4ZNXA 1SEMA 1SHFA 2RPNA 4GLMA 4DEXA 3VS0A 4LUDA 4Y92A 1UHCA 2W0ZA 4JZ4A 4Z8AA 2PZ1A 5IHNA 2CUDA 3PVLA 1ZUUA 2MCNA 2O2OA 1M3BA 1AWWA 2RN8A 2JTEA 3O5ZA 2F2XA 1WYXA 3TSZA 2BZ8A 2FRYA 3UATA 1TUDA 1SRLA 2EYWA 1H8KA 2RF0A 1AEYA 4RTZA 2DLPA 1UG1A 4F14A 2B86A 1IO6A 2LCSA 2J6KA 1GCQA 1X6BA 2A36A 2RQRA 3KFVA 4RTXA 2CT4A 5HCKA 2EGEA 1QKXA 3GBQA 4J9HA 4QT7A 1X6GA 2ABLA 2EYYA 2HCKA 1U06A 2ECZA 1W70A 3CQTA 3I5SA 2LJ1A 3C0CA 1CKBA 2K3BA 4X1VA 1M3CA 2ED0A
chains in the Genus database with same CATH superfamily
2QQ9A 3RIRA 1GBQA 2DA9A 3EH1A 1NJIR 5FW9A 1H3HA 2LP5A 4AFSC 2FYKA 3H8ZA 2KYBA 2DF6A 3CCET 4PJOC 3G71Q 1K9AA 1VQOQ 3JCMQ 4PJJA 2JT4A 1WJQA 3EG2A 3J81E 3VRZA 2EIFA 3CBPA 3CPWA 1N27A 4M7DC 1AWJA 2YT6A 1C1AA 3QZ9B 5GAOp 4M78E 3VS3A 2QTVA 4RUGA 2DBMA 3JB9D 2LRQA 1BBZA 1YI2Q 4XTZA 4QQDA 4JZ3A 4WTOB 4J9GA 3DB3A 1VOMA 3KBGA 2DE0X 5LJ5e 3P8BB 1OX8A 3X26B 2OTLQ 3M5AA 1QVGS 3R6OA 3CBOA 2GGRA 4LDVA 1M2VA 4OGCA 8ATCB 3BE3A 4M75D 4HVVA 2QXFA 1YWOA 2J05A 2C06A 4ANJA 2DMOA 1K8AR 1TSFA 3CPWP 2P4TA 3RMSA 1B34B 2GBQA 1OYXA 1PCXA 5KYWB 1QW1A 3PNWC 3G71A 4N0AC 1RUWA 2MPXC 2O31A 1YJ9Q 1YJNQ 1NEBA 2DX1A 2O9VA 4JJDA 4XQ3A 2X3XD 1Q7YR 2GQVA 3VS7A 3OBWA 2DETA 4A4EA 3OA6A 2CS7A 3FJ5A 2COYA 1MHNA 4Z02A 1MUZA 2E70A 1ZSGA 4KGZB 2O88A 5I11A 2F2VA 1PKSA 1HYOA 2K5LA 1IREB 2Y90A 1MGQA 3CPFA 2LQNA 1Q81R 4NS5A 3LX7A 3PTAA 2NUTB 3CXCP 1WA7A 2QQRA 2DJZA 3H41A 4M75F 1E7OA 4ZGDB 1BKBA 1MMNA 1PRMC 2EWNA 3L2ZA 4F7UA 4M77F 4C8QF 2ZPBB 4JS4A 3SD4A 4QVDA 1OULA 2HBPA 1R0BG 2RM4A 1YBYA 2OTLA 3FIFA 1D1BA 4AG2C 1QVPA 4C0DC 4JRPA 1QLYA 1KQ1A 4IUVA 2PTKA 4RCCA 5CO7A 1Q86U 1RAAB 2JOYA 2E1HA 1M3AA 2PU9B 1YITA 2NUPB 1FX7A 2QGGA 2DKGA 3M59A 4RKUE 4FL6A 2MWPA 1A0NB 4XAXB 1UDLA 5KYUA 1M1KU 5GMKm 4C0GA 4DOVA 1I8FA 1VQPT 2V26A 2HSEB 4M7DD 3TEEA 4M78A 3PMIA 4DBRA 2C0OA 3H0HA 2DIGA 2D0QB 4LE9A 1ABQA 2KGTA 4J6WA 1SSFA 1AZGB 2E10A 4BDZA 4KH1B 4HVUA 3SWNB 1WHLA 1M1GA 4NOYA 2XDPA 3CC4T 2RA2A 2CREA 1RAEB 3C12A 4OB1B 3VKIA 2IVWA 2QI2A 1JRIA 5KCHA 2K3XA 4E2FB 3CCRA 1NYFA 1M8MA 1PD1A 2OAUA 3WVEB 2DD5A 4OMPA 5IHKA 2VB6A 1WNLA 2FPEA 3EFSA 2E6NA 3LGLA 3RR6A 2YLBA 4OVAA 4RTWA 2CP3A 3V8JA 1M5Q1 1EFNA 2OAWA 2XK0A 1JU5C 4CC2A 4JJNK 1WXUA 3OYDA 1UJYA 1UGVA 1XJWB 4X9CA 4CRIA 4BUGA 1UEBA 1Y96A 2DL8A 2LVMA 4KGXB 2LQWA 1O9SA 5KYXB 3I55Q 1GRIA 1BCMA 1G2BA 1Y96B 3VS5A 1G3SA 3LYIA 2R58A 1NPRA 1OQKA 5FWBA 5FU6B 3EH2A 4M78F 1S72A 3RERA 3NMZC 1G5VA 2RJDA 4EMKA 4JLGA 1VQ4A 1WDXA 2DZCA 3L42A 1UGSB 3LLRA 3QWYA 4HCZA 2C0IA 2GTOA 1WPYA 2ENMA 3EG0A 2CDTA 3A8LB 3V7CA 3JCMJ 1G3WA 1SHGA 2YRVA 2V8KA 2MF2A 1RLPC 2XDBA 1PG5B 5GANf 5J3BA 2E6ZA 1LPLA 1FYNA 4C92F 1N5ZA 2D0NA 2M0YA 3L2UA 1C6VX 4C92G 5LJ3j 3CCEQ 3PT9A 4C8QA 3JCMc 3JB9J 2E4HA 1VQKQ 5FROA 5A2QE 3CC4Q 1M1KR 1VQNA 4J6YA 2D9TA 5DLOA 1IXDA 1SKUB 3CC7A 1YJ9A 2COWA 1LOJA 2M9UA 4XTVA 5GANg 3I55A 1K73R 2D8HA 4EIKA 1BYMA 1QCFA 2QDYB 1YIJA 3JV3A 3QIIA 5A0LA 1G3YA 2P0QA 2DILA 3LGFA 1WQWA 4MMKA 4L59A 2HQHA 2XICA 4C92E 2ZPEB 1S72Q 2K5FA 3HRSA 4B9XA 1E6HA 3GF5A 3HL8A 3OS0A 1JBMA 1VQKT 2PQWA 3MEAA 1WFWA 4KULA 4BE0A 1W6XA 3M9QA 1X69A 4M7AC 3PIPA 2JJ9A 3BFMA 1GCPA 1FMWA 3UT1A 2GTJA 1RL2A 3M0PA 2IG0A 2LX7A 5LJ5f 3MEWA 1X2KA 4M75E 3MPUB 2YSQA 2VWFA 4FT4A 3EGDA 2RHIA 2XMFA 3NGPA 2VKNA 4M77B 1KC8R 5GAN3 1M90R 2P4RA 1VIFA 3SWNC 1NZ9A 5IHIA 4A63B 3G71T 4ATOA 2O9SA 1YI2T 4CC3A 4XU0A 1QP3A 3NFCA 4A4KA 2RJCA 4LUDA 3OQ5A 1UHCA 2YWWA 2W0ZA 4JZ4A 2O01E 4Z8AA 2XDDA 2PZ1A 2CUDA 3PVLA 6AT1B 4E7KA 2MCNA 1YJWA 2O2OA 1M3BA 1YIJQ 4QW2A 4ZN1A 1YITQ 1HXDA 4M75G 2JTEA 3O5ZA 3QHSA 2CZ7B 1WJRA 2F2XA 2Y4YA 1WYXA 3UATA 1WHMA 4D6WA 2RF0A 2R57A 1AEYA 2VASA 4EMKC 2DLPA 4E7SA 3UPUA 5CKDA 3JSCA 5GAN2 3GOXA 1WHHA 2LCSA 1D0YA 1H3ZA 4FW2A 3KFVA 1V29B 4QT7A 1X6GA 1GXIE 2EQUA 3MEVA 2RB6A 1W70A 3CQTA 4BY6C 2LJ1A 3JB9H 3CCVT 9ATCB 2CP7A 1KQSA 1M90C 3OYLA 2E5QA 3GIBA 3IQLA 2MI6A 3EHRA 1S1NA 5GMKh 3NTKA 1KQ2A 3HTRA 2YHTA 3NTHA 4F16A 3ZBDA 2FEIA 5HK0A 3LH0A 4BI3A 5GANh 5KE2A 4PFZA 1M4ZA 1HSQA 3CCRQ 4UC4A 2X51A 3G4SA 2QASA 3VU3C 2YUQA 2EGCA 4V2SA 3QG1A 2DPPB 5FU7C 4BB7A 3CMAQ 5GAOl 1PKTA 1NG2A 4N4HA 1RAGB 1FXXA 4FYXB 3QBYA 3S3MA 1K0XA 3UF4A 2RHXA 3E19A 1OPLA 1KIKA 1Q82R 1X75C 2VYTA 2QQSA 2ZGWA 4LDYA 4M7AF 4OMNA 1AWOA 1SF9A 2JTFA 2FG0A 1O75A 1KFZA 2A0FB 3HP9A 3OYAA 1Q95G 3RKWA 3OW2S 2MIOA 4C92D 5GAMg 3CCQT 1D0ZA 5GAMe 1YP5A 1BI2A 1QVFA 2CSQA 3RBBB 3OYBA 3MJXA 4AFQC 2JMCA 5KH6A 1MMDA 4RTVA 3V8LA 1ZSZB 2EKOA 2M0OA 1VQOA 3ZL7C 1X2QA 2QQAA 3OYFA 2LDMA 1ACMB 4RTYA 3I5RA 1AVZC 1AD5A 1EZZB 2CP0A 2LMJA 4IKFA 1M8VA 4M77C 5I22A 1MV3A 1I0CA 2Z0WA 2DIQA 1TG0A 3S3NA 4M7AA 2CH4A 1QCOA 3EG1A 3CCQQ 3CCUA 2JNGA 4C92C 2KNBB 3A1PA 5KE3A 2CYZB 3M0UA 4JPBW 4E7HA 3PVQA 2RQUA 5C0MA 2P0PA 3EGXA 4B9WA 2O4XB 2HDAA 2KRSA 3ASKA 4QQGA 5EC7A 1PC0A 1VA7A 4OMMA 3CCMA 4E47A 1NE8A 2J6FA 1UJ0A 5FU6C 1ZUYA 3I35A 3X20B 3UWNA 3TSWA 2R5AA 2KAFA 3LH5A 1QKWA 4M78C 3CCLT 2PVDB 1KK7A 2GQIA 3JCMg 2ATCB 2CP6A 3SHWA 1IGQA 3A8OB 2BUDA 3E2UA 5FLXE 3OW2P 3FDRA 5KYNA 4DA4A 2EQJA 3JCMV 1QVGP 2L89A 1VQPQ 1NEGA 1YCSB 3CC7T 4BE1A 2A7YA 1ARKA 1WI7A 3JCMb 1Y71A 2LC4A 2B8AA 1I1JA 2ED1A 4BI4A 2DJQA 1E6GA 2FRWA 1WIEA 4ZGJB 4JJCA 5GANe 4GLKA 4E7LA 1B7TA 2A28A 1BIAA 1ZX6A 3UA6A 5IXBA 1MNDA 4IUPA 2MYSA 2XD0A 2LNHB 2GFUA 3GNFB 2X4JA 5GJWB 1NPPA 5CQYA 3I56A 2A37A 1FMKA 3TVTA 3CXCS 2QEXA 2FZCB 1WGSA 2HEQA 4J9EA 1OV3A 2BTTA 4FU6A 1JJ2S 3A8HB 4P5NA 1TUGB 4M78B 4PKCC 3G6EQ 3CD6T 3MO8A 1VYVA 2YXYA 2E3IA 1U1TA 1HD3A 4LN2A 2LT1A 1ZBXA 1NBEB 1VQ9Q 3OSSC 4N0AA 3CCLQ 1RAHB 5GAMh 2P84A 2HKNA 3EGXB 3QXEB 2K6DA 2COZA 2K3YA 2HQXA 2MMPA 1TS9A 5GAN5 3L2RA 4E6RA 3BY7A 1X6OA 3M53A 1PHTA 1RLQC 1NLPC 1M1KC 2H8HA 2V8JA 2D6FA 4OMLA 2LX9A 1W2BP 5LJ5h 2KSSA 1CSKA 1BI0A 1KC8U 2DAQA 3ER0A 2YUNA 2YUPA 5IH2A 4AT1B 3M57A 3QYHB 4IUQA 5GJVB 2CUBA 2HBWA 3QPHA 1QP2A 3QSUA 4FT2A 4PLLA 3RUXA 3PMTA 4DBQA 1VQ6A 4MZMA 5DY9A 3TU4K 2KI7A 3HFNA 2EGAA 3MP6A 1EIFA 4BDYA 1BCOA 2DXTA 2RQWA 3OYKA 3QJYA 1V76A 4FYVB 3CBMA 4HKEA 4OB3B 4PJMA 1W2BA 4J83A 2K4YA 1N8RC 3OY9A 4FSSA 2M1HA 1F1BB 1GL5A 4ZN3A 3OYNA 1WXBA 2EVRA 5EG2A 2CSIA 1UGPB 3G1JA 1H92A 2BIVA 2QA4Q 5FU7B 1YJNT 1X01A 2K2MA 4MZTA 3VS4A 4PFPA 4C0FA 3U23A 3M56A 3CCUQ 2AT1B 1PNJA 3JRZA 4C5GA 1IGUA 3CCUT 2LTOA 3EG9B 3M55A 4M75A 1QWFA 4HVWA 4IURA 5CK9A 1MMGA 4PJOB 4EMKB 3HKSA 1YITT 3O8VA 1KD1C 4PK4A 4LDUA 1KSWA 4Q5WA 4JS5A 1D1AA 3M0SA 2RH2A 3CCEA 1K9MC 1VQOT 1VQLQ 4FM4B 3VV0A 4ME7A 1LNXA 5C6SA 3C95A 2V8IA 4LDWA 1D3BB 4Y92A 1VQ4T 2DERA 3ME9A 1YIJT 3GLXA 5IHNA 1Q86R 1ZUUA 2DEUA 3CCVQ 2DTIA 4HT9A 2K57A 2HZYA 1KQSS 3TSZA 2XI9A 3OMCA 1TUDA 4M78D 4J8OA 5CKBA 2AHJB 3KUFA 3CCSQ 2LT4A 1UG1A 5GAN7 3SDZA 1IO6A 2R5MA 2RK2A 2VXEA 1X6BA 4PJOG 4R55A 2RQRA 3E9FA 4M7AE 2CT4A 4A53A 4E7ZA 2EYYA 3PGGA 2RK1A 1HK9A 3VUBA 2XU8A 4C8QE 2ED0A 4A54A 2K9GA 4M4ZA 4RMOA 3L2QA 1WHJA 1JEGA 5AT1B 4M77A 2OTJQ 1ZLMA 4DBFA 1IHVA 2F5KA 3L2VA 2FVUA 1Y07A 1N6AA 4RG8A 3OMGA 2HL3A 4M77E 2X4WA 4A4GA 4BE2A 2ROTA 3BDUA 4RTTA 1VYTA 1NJIC 5DM7R 1I81A 1YJWQ 4PJLA 5LJ5d 2VV5A 1SPKA 3CCMQ 3A98A 3H0IA 1UHFA 1G8XA 1WXTA 2HQEA 3OYJA 2RI2A 3JCMX 2AKKA 4N4GA 1UTIA 4HA8A 3THKA 2A3LA 2M16A 5CQXA 2QK0A 2IIMA 3S3OA 2HKQB 2JM9A 2EAYA 4FYWB 1GFDA 3CC2A 2L3QA 2KY9A 1KC8C 4CC4B 2ZPIB 1Y7XA 2KT8A 3EGUA 4MDWA 2WSFE 3M0TA 2BE9B 2G3RA 3CMEA 2YUOA 3OB9A 3V8KA 2VUBA 1I4K1 1PM3A 3M4YA 1VQNT 4E7JA 3CCST 1WQ7A 4FW1A 3QDRB 1GFCA 1R77A 4C5EA 4J9BA 4GY5A 5IN1A 2W10A 1K8AC 2ZPFB 1QMCA 2KT1A 3OYIA 4XU3A 4KUIA 3P8DA 1KHIA 2E12A 2D1XA 2JW4A 2DYIA 4R56A 2X4XA 1B3QA 3CCJT 2KK4A 2NYSA 2DK3A 1YWPA 4F04B 3A8MB 1TU0B 2EJ9A 4EDUA 2FHDA 1ZQ1A 4J7FA 2F2WA 7AT1B 5D7UA 5GMKj 1VQKA 2EFIA 2LZ6B 2ZAEA 1VQNQ 2OTJT 1XNIA 2CZ1B 3CD6A 2JN0A 2RMOA 2SRCA 2KE9A 5GAOq 1OU9A 1D09B 5KYWA 1Q7YC 1OZ3A 2X4YA 2YLCA 1X43A 2PUOB 1QCNA 1VIEA 3MHXA 3BW1A 1AHJB 4LNPA 3CC2Q 1VQ8Q 4O5VA 2AZVA 5J39A 1IHWA 3E1SA 4OB0B 3I9QA 1K8AU 3I55T 2DVJA 1K4US 1Y57A 4ZTFA 1VQ9T 4PJOD 3CMEQ 2A08A 2EYZA 3DB4A 1M27C 2KVQG 3UA7A 1LCKA 3GPLA 2DZ9A 2L3SA 3HRUA 5CVIA 1U3OA 4AFUC 3N5BB 4ZTJA 5CIUA 5GAOn 1VQMT 4C92B 1YJ9T 3FEOA 3AHUA 1HJDA 4J9DA 2EKHA 4A4HA 3NPFA 4Z88A 2HSPA 2JM8A 3VUZA 3AT1B 3SWNA 1UGRB 2DXCA 3CXCA 4HCCA 3M58A 2MK5A 2KBTA 2DL5A 5FRNA 2RQTA 2RQVA 1T0HA 1PWTA 5GAN6 5LJ5j 3OS2A 2KDSA 2DL4A 4JDSA 4BACA 3E9GA 1NJIU 2QG9B 2YDLA 3EG9A 4M7DB 3X25B 3JCMf 4LUEA 3QKJA 1FWZA 3CCLA 1WHKA 3CPWS 1KD1U 2NUPA 3INZA 5LJ3g 4J9IA 5A0DA 5GAMd 2JUFA 4XTYA 2DFUA 1BI1A 1MMAA 1I07A 1MV0B 2RI3A 2VGMA 1PD0A 4PJNA 2GNCA 3EGDB 3OYYA 4K11A 4M7AD 2AK5A 3S6WA 2FB7A 5CKEA 2ESWA 4PLIA 4PL6A 3OYCA 1G83A 3D7SB 5HY6A 2K2VA 2VVKA 2NUZA 1NM7A 1BU1A 2FZGB 3LWHA 2QAZA 2ZPHB 5IXFA 1W2BS 2FPDA 1R8OB 3SFMA 1ABOA 2HL5C 1T3SA 3CCJA 4TVRA 4RTUA 2HMAA 1OOTA 4M7DG 2M02A 1VQMQ 3P8HA 2WSCE 1I5OB 1K0SA 2RNAA 1QWEA 3MP1A 1YNZA 5GMKl 4Z89A 3G4ST 2KEAA 2H3EB 5HK3A 2X9HA 3PIOA 1VQLT 5LJ3e 2XHCA 4Y91A 1QVFS 2OJ2A 3I56Q 2GF7A 2HD0A 2G6FX 1JO8A 1AOJA 1T3LA 2RHZA 4KRTA 4XK8E 3MCAB 2WSEE 1PSFA 2AZSA 5L23A 2E5KA 2D8JA 3RKXA 1OZ2A 1Q81U 1BIBA 2QA4A 2AIRB 4ELZC 3G6EA 2JTMA 3RMQA 4L5GA 2CT3A 8AT1B 4M7DE 2F5TX 3FC3A 1Z9QA 1UUEA 2ROLA 4B6MA 2F1LA 1M1FA 1M2VB 1TTHB 2JZ2A 3OS5A 1AWXA 1YJWT 3CCJQ 3MEUA 1BB9A 1WLPB 1YN8A 5L8RE 4YTLA 1ZA1B 2EPDA 2E65A 5LJ3f 2JS0A 3BDLA 2GFAA 2RD1A 2YRDA 2KYMA 3JB9F 5FWCA 1M90U 1M30A 5I21A 4ZGEB 5KYXA 2OI3A 1K1ZA 1JQQA 3OW2A 3TREA 2FL7A 5GAMf 3R6NA 3REAB 1AZEA 2QGFB 2QDLA 5CR2A 4C92A 3MKDA 3MP8A 3VRYA 3L2WA 5CKFA 3KXTA 3CMAT 2DL3A 2HNIA 2J7IA 1VQ6T 3CCVA 2CH4W 4HCKA 2C0TA 4FYYB 2LCLA 4AFZC 2KR3A 1VQ8A 1VQ6Q 2MWOA 3ULRB 3M0RA 2XKOC 2JMAA 2IPOB 5GAN4 2XIDA 2LNVA 3QUIA 3OYHA 5IT9E 3EFOA 3URGA 1SEMA 1SHFA 2CP2A 2RPNA 4GLMA 4C0ZA 4DEXA 1RI0A 3VS0A 3GP8A 1VQ7T 1VUBA 4PJOE 4II1A 3OSVA 4M7AG 3WVDB 3PFSA 1OX9A 4RG2A 2RN8A 1TXQA 3QZ5B 4KBMB 4O6JA 2QYZA 2BZ8A 4EPCA 1SRLA 2EYWA 4IUTA 2CGHA 4ELYC 2QEXT 1VQ5Q 1YHQT 5KYUB 4AMCA 5LL6S 3OBYA 3JAME 1IZ6A 4EMHA 5GAOr 5GANd 2EGEA 3FJPA 4J9HA 1VQ8T 2O4XA 3JCMP 2ECZA 3I5SA 1CKBA 2K3BA 2DXBA 3HSBA 1M3CA 1FMVA 2F69A 4AG1C 4R0KA 3DLMA 5KYYA 4FSXA 1N9RA 1MNEA 2LQ8A 4OMFB 3OYMA 2KROA 4M7AB 2PVGB 4XTXA 1TWBA 1Q82U 1DJ7B 2EJFA 1ZUKA 5CKHA 2QEXQ 1VQ5T 4JRQA 2MOXA 4F7UB 1S72T 2ZCFB 4OMQA 4C8QC 3WXMB 3CD6Q 1Q82C 1X27A 4JUVA 2CKKA 2JXBA 2CZ6B 2KXDA 2EYQA 1W1FA 1RACB 3ZFJA 4A4FA 4LD9K 3HHTB 1H641 3G7ZA 2QTXA 3CMET 2LJ3A 4J9CA 1VQ9A 3EFOB 2PNIA 1BI3A 3CCSA 2DVEA 2EJGA 2L0AA 1UB4A 3EFRA 3H0FA 1JXMA 1UGQB 1V1CA 1BK2A 3OYEA 1WHGA 1CKAA 3H6ZA 1GBRA 2EW3A 3OS1A 1WJSA 2X3WD 1K9MR 4OF1A 3VYHB 2SEMA 1VQ5A 3J80E 4F7UG 4M77G 1D3BA 3DKMA 2AKLA 4HXJA 3FB9A 3VS2A 2RHUA 4J7IA 4PNOA 4MZPA 2OTJA 1SG5A 4EMGA 4XU1A 2M51A 4LD6A 2VC8A 4PFOA 1KJWA 3CEYA 5HKCA 1Q86C 2PUKB 2PVOB 1N9SA 2KXCA 1SSHA 5DLQE 1J3TA 3C4SA 4PJOA 3VYGA 1U8RA 4F17A 2VXFA 4M75B 3JCMh 5GAMj 4C0DB 2LJ0A 2I2LA 1D1CA 4QKUA 2DM1A 4RCBA 3EAEA 1NLOC 1AT1B 3Q1JA 1Q7YU 4F7UE 3CC2T 3JB9I 3SEMA 5GAN8 2E64A 1C0MA 2I0NA 3ZEHA 2EQIA 1GCQC 1Z9ZA 3HPWA 2L3PA 2OTLT 3X28B 3VJPA 2DL7A 3REBB 4L6V5 3TQ7P 2KRMA 2RJEA 3JB9G 2BKDN 3I56T 3RNJA 3EG3A 1XTDA 1VYUA 3NHNA 3HRTA 5CCAA 1KHCA 4FIBA 4WF2A 1PRLC 1TOVA 5KCOA 1LJOA 3CCMT 2DTOA 4NL3A 2QA4T 2EQKA 2GCXA 2NWMA 1NYGA 5LJ3h 3G6ET 2K79A 2KQWA 4IIMA 2DTHA 4IIOA 4FCYA 3DLLA 1RABB 5IAYA 4J5YA 4CI0C 2V1RA 1Q81C 3L1AA 2J6OA 1VQLA 3PE0A 4C5HA 2FPFA 2WACA 4D8KA 2BZYA 3VS6A 1YJNA 1KG1A 3V7RA 2LCCA 3C94A 3NTIA 2K5IA 4X9DA 4OMOA 4D8DA 2KRNA 3GNGA 4C8QB 4M75C 4J6XA 2DBKA 1K73C 1JB0E 2FO0A 4WCIA 2ZPGB 2RHYA 1RI9A 3UDCA 2CP5A 1VQ4Q 3QYGB 2H3JA 4BI8B 4VUBA 5GMKi 3LWIA 3F70A 1VQPA 1ZBJA 4N4IA 1K76A 3FLGA 1OPKA 2NLUA 4JRIA 1IB8A 3LW5E 1JJ2P 3OYGA 1VQMA 3META 2BZXA 1ZHIA 4JJBA 1PSEA 5GAOm 2DRKA 1Y0MA 2DD4A 2K7AA 1LVKA 3RESA 4DOWA 3A8GB 4C5IA 4ORZA 3CMAA 3X24B 1RAFB 1UE9A 3A5ZB 3FRNA 1U1SA 3JCMd 1W4SA 4KT0E 3RDVA 1EX4A 4C8QG 3CC7Q 2DNUA 1RADB 5M9OA 3H9NA 1ZSZC 4ESRA 4GBQA 4M77D 5D6WA 4OP0A 2L3RA 3EHQA 4DEYA 5D6YA 1QQJA 2XG8D 3TCJA 1G3TA 5ECAA 3JCMe 1WX6A 4F7UF 1OEBA 2EBPA 4JLIA 1JXOA 2FZKB 2CZ0B 5AYFA 2V1QA 2HAXA 1P92A 2J06A 4LXCA 1U5SA 2RI5A 2RO0A 1N8RR 1I5LA 2L5QA 2Y4XA 4M7DF 4E7IA 3JCMW 3QO3A 1K9MU 3SB2A 1XOVA 2YRCA 4QVZA 1M9SA 1VQ7Q 4DBHA 1YFNA 1KQSP 4HT8A 1TH7A 1SRMA 3CCQA 4PJOF 1YHQA 3HFOA 3RKYA 2LQKA 4KGVB 4OGEA 4JRKA 4J9FA 1UECA 1OU8A 2DRMA 1T0JA 4QVCA 1TUCA 3M54A 5GANj 1R0CB 2MAMA 2L8DA 4MMLA 5J26A 4XTUA 3CCRT 1M2OA 1OI1A 4XU2A 2E3HA 2EYXA 5I2SA 5CAIA 1KD1R 2EQMA 3M4GA 2L2PA 1K73U 3VS1A 4NL2A 4KH0B 5LJ3d 1QVGA 3M0QA 2ZZDA 2OX7A 1XQHA 2E41A 4X34A 4QQ6A 3QWXX 2JS2A 1RAIB 4CC7A 1IRXA 1N8RU 2QQBA 4C8QD 1B07A 5FRMA 2DYBA 2JVVA 1D0XA 5LJ5g 2NUTA 2RJFA 1UFFA 4M78G 1JJ2A 5KYYB 4LDXA 4MDXA 4KUDK 3QJ6A 4ZNXA 4BY6B 2DEQA 3T9NA 2DO3A 4IUUA 4BD3A 3G4SQ 5I2MA 4HCBA 2P0KA 1AWWA 4Y28E 5A0GA 1VQ7A 3QDFA 4DQ2A 2FRYA 5D6XA 3CC4A 1H8KA 5GMKe 1YHQQ 1YI2A 4RTZA 2KMTA 4XTWA 4F14A 2B86A 2VGNA 1WZOA 4OB2B 3V7SA 2J6KA 1GCQA 2X35A 2A36A 4RTXA 5HCKA 1QKXA 3GBQA 1ZA2B 2ABLA 3J7AF 2HCKA 1B34A 1U06A 1ZSZA 2DXUA 3C0CA 2BE7D 4X1VA 4M7DA 1YCYA 1QVFP
chains in the Genus database with same CATH topology
2K9GA 4M4ZA 3IQLA 4R0KA 4AG1C 1GBQA 3EHRA 2DA9A 1S1NA 1JEGA 2KROA 5FW9A 4F16A 2LP5A 1H3HA 4AFSC 1ZUKA 1ZLMA 2KYBA 2FEIA 2DF6A 2MOXA 1K9AA 2JT4A 4OMQA 1HSQA 3EG2A 3VRZA 1X27A 2ROTA 4RTTA 2JXBA 1VYTA 2EGCA 2YUQA 1AWJA 2YT6A 2KXDA 1SPKA 1PKTA 1W1FA 1NG2A 3VS3A 3A98A 3H0IA 1UHFA 4RUGA 2DBMA 1K0XA 2LJ3A 4J9CA 1WXTA 3UF4A 1OPLA 1KIKA 1BBZA 2PNIA 2AKKA 2L0AA 1UTIA 4JZ3A 3H0FA 3THKA 1JXMA 4J9GA 2DE0X 1V1CA 2IIMA 4OMNA 1BK2A 2JM9A 1AWOA 1GFDA 1CKAA 2GGRA 1GBRA 2EW3A 2L3QA 2FG0A 4CC4B 4HVVA 2KT8A 1YWOA 3EGUA 1KFZA 3M0TA 2J05A 2X3WD 2DMOA 2SEMA 2MIOA 2YUOA 2AKLA 4HXJA 3VS2A 2GBQA 1YP5A 2CSQA 3RBBB 4AFQC 2JMCA 2M51A 4RTVA 1GFCA 1KJWA 1RUWA 2O31A 4J9BA 3ZL7C 1X2QA 1NEBA 2W10A 2DX1A 2KT1A 2KXCA 1SSHA 2D1XA 2JW4A 1J3TA 2O9VA 4JJDA 1B3QA 4RTYA 2X3XD 3I5RA 1AVZC 1AD5A 3VS7A 4F17A 1YWPA 2LMJA 5I22A 1MV3A 1I0CA 3FJ5A 2F2WA 1TG0A 2LZ6B 2CH4A 2LJ0A 1MUZA 3EG1A 1ZSGA 2O88A 5I11A 2DM1A 2F2VA 1PKSA 2KNBB 1NLOC 3M0UA 4JPBW 2RMOA 2SRCA 2KE9A 2LQNA 3PVQA 2RQUA 3SEMA 1X43A 2I0NA 2EQIA 2HDAA 2KRSA 5EC7A 1GCQC 4LNPA 1Z9ZA 1VA7A 4OMMA 2L3PA 1WA7A 2AZVA 2J6FA 1UJ0A 2DL7A 3H41A 3REBB 1ZUYA 3I9QA 1E7OA 3I35A 2DVJA 2KRMA 3TSWA 1K4US 1Y57A 1PRMC 3RNJA 3EG3A 1VYUA 3LH5A 2A08A 2EYZA 3NHNA 1QKWA 2GQIA 1M27C 1PRLC 3UA7A 1LCKA 3SHWA 2L3SA 1U3OA 4AFUC 2NWMA 4AG2C 1NYGA 2K79A 1QLYA 4IIMA 4IIOA 2PTKA 1M3AA 1HJDA 4J9DA 2EKHA 3NPFA 4Z88A 2HSPA 2V1RA 1A0NB 2JM8A 1NEGA 1YCSB 2J6OA 3PE0A 1UDLA 1ARKA 1WI7A 2FPFA 4D8KA 2BZYA 3VS6A 2KBTA 1I1JA 2DL5A 2ED1A 2DJQA 2RQTA 2RQVA 2C0OA 3H0HA 4OMOA 4D8DA 1T0HA 2KRNA 1PWTA 4LE9A 1E6GA 2FRWA 1ABQA 2KGTA 1WIEA 2DBKA 2FO0A 1AZGB 4WCIA 4JJCA 2DL4A 2YDLA 1RI9A 2A28A 4HVUA 1ZX6A 3UA6A 5IXBA 4LUEA 2LNHB 2CREA 5GJWB 2A37A 1FMKA 4J9IA 3TVTA 1ZBJA 1K76A 1OPKA 2HEQA 4J9EA 1I07A 1MV0B 1OV3A 2BZXA 1NYFA 2BTTA 2GNCA 1M8MA 4JJBA 4K11A 4OMPA 2DRKA 2AK5A 1Y0MA 5IHKA 2ESWA 2FPEA 2K7AA 4ORZA 4RTWA 1G83A 1VYVA 1UE9A 2VVKA 2NUZA 1NM7A 1BU1A 1EFNA 2OAWA 1HD3A 4LN2A 1JU5C 4CC2A 1WXUA 5IXFA 1UJYA 2FPDA 1UGVA 1ABOA 2DNUA 2K6DA 2DL8A 1T3SA 2LQWA 1GRIA 4ESRA 4E6RA 4GBQA 4RTUA 1OOTA 1G2BA 3VS5A 1PHTA 1RLQC 1NLPC 3EHQA 5FWBA 4DEYA 1K0SA 2H8HA 2RNAA 1QWEA 1YNZA 3NMZC 4OMLA 4Z89A 1WDXA 1CSKA 2KEAA 5ECAA 2YUNA 2YUPA 5IH2A 3QWYA 1WX6A 1OEBA 2C0IA 2GTOA 2OJ2A 2ENMA 2CUBA 2CDTA 2EBPA 3EG0A 5GJVB 1JXOA 2HBWA 1SHGA 2G6FX 1JO8A 1AOJA 1T3LA 4KRTA 1RLPC 2V1QA 2J06A 1U5SA 2AZSA 5L23A 2E5KA 2D8JA 1FYNA 2EGAA 1N5ZA 2D0NA 2M0YA 1XOVA 2RQWA 2CT3A 1Z9QA 1UUEA 1SRMA 2ROLA 4FSSA 4J9FA 1AWXA 1GL5A 2D8HA 1BB9A 4EIKA 1WLPB 1UECA 1YN8A 2DRMA 1QCFA 2EPDA 3JV3A 2JS0A 1T0JA 1TUCA 1WXBA 2EVRA 2DILA 2CSIA 2KYMA 1H92A 5FWCA 1M30A 2OI3A 2K2MA 3VS4A 1K1ZA 1JQQA 1E6HA 3U23A 2EYXA 3R6NA 1PNJA 3REAB 1AZEA 2L2PA 2QDLA 3VS1A 1WFWA 3VRYA 1W6XA 1X69A 2DL3A 3M0QA 2J7IA 1QWFA 2CH4W 1GCPA 4HCKA 2C0TA 4HVWA 3QWXX 2JS2A 4CC7A 2GTJA 4AFZC 3M0PA 2KR3A 2LX7A 3ULRB 3M0RA 1X2KA 2YSQA 2VWFA 1B07A 2DYBA 1KSWA 2JMAA 2XMFA 3NGPA 2VKNA 1UFFA 2P4RA 3M0SA 5IHIA 4A63B 2O9SA 4CC3A 4ZNXA 1SEMA 1SHFA 2RPNA 4GLMA 4DEXA 3VS0A 4LUDA 4Y92A 1UHCA 2W0ZA 4JZ4A 4Z8AA 2PZ1A 5IHNA 2CUDA 3PVLA 1ZUUA 2MCNA 2O2OA 1M3BA 1AWWA 2RN8A 2JTEA 3O5ZA 2F2XA 1WYXA 3TSZA 2BZ8A 2FRYA 3UATA 1TUDA 1SRLA 2EYWA 1H8KA 2RF0A 1AEYA 4RTZA 2DLPA 1UG1A 4F14A 2B86A 1IO6A 2LCSA 2J6KA 1GCQA 1X6BA 2A36A 2RQRA 3KFVA 4RTXA 2CT4A 5HCKA 2EGEA 1QKXA 3GBQA 4J9HA 4QT7A 1X6GA 2ABLA 2EYYA 2HCKA 1U06A 2ECZA 1W70A 3CQTA 3I5SA 2LJ1A 3C0CA 1CKBA 2K3BA 4X1VA 1M3CA 2ED0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9G A;  4M4Z A;  3IQL A;  4R0K A;  4AG1 C;  1GBQ A;  3EHR A;  2DA9 A;  1S1N A;  1JEG A;  2KRO A;  5FW9 A;  4F16 A;  2LP5 A;  1H3H A;  4AFS C;  1ZUK A;  1ZLM A;  2KYB A;  2FEI A;  2DF6 A;  2MOX A;  1K9A A;  2JT4 A;  4OMQ A;  1HSQ A;  3EG2 A;  3VRZ A;  1X27 A;  2ROT A;  4RTT A;  2JXB A;  1VYT A;  2EGC A;  2YUQ A;  1AWJ A;  2YT6 A;  2KXD A;  1SPK A;  1PKT A;  1W1F A;  1NG2 A;  3VS3 A;  3A98 A;  3H0I A;  1UHF A;  4RUG A;  2DBM A;  1K0X A;  2LJ3 A;  4J9C A;  1WXT A;  3UF4 A;  1OPL A;  1KIK A;  1BBZ A;  2PNI A;  2AKK A;  2L0A A;  1UTI A;  4JZ3 A;  3H0F A;  3THK A;  1JXM A;  4J9G A;  2DE0 X;  1V1C A;  2IIM A;  4OMN A;  1BK2 A;  2JM9 A;  1AWO A;  1GFD A;  1CKA A;  2GGR A;  1GBR A;  2EW3 A;  2L3Q A;  2FG0 A;  4CC4 B;  4HVV A;  2KT8 A;  1YWO A;  3EGU A;  1KFZ A;  3M0T A;  2J05 A;  2X3W D;  2DMO A;  2SEM A;  2MIO A;  2YUO A;  2AKL A;  4HXJ A;  3VS2 A;  2GBQ A;  1YP5 A;  2CSQ A;  3RBB B;  4AFQ C;  2JMC A;  2M51 A;  4RTV A;  1GFC A;  1KJW A;  1RUW A;  2O31 A;  4J9B A;  3ZL7 C;  1X2Q A;  1NEB A;  2W10 A;  2DX1 A;  2KT1 A;  2KXC A;  1SSH A;  2D1X A;  2JW4 A;  1J3T A;  2O9V A;  4JJD A;  1B3Q A;  4RTY A;  2X3X D;  3I5R A;  1AVZ C;  1AD5 A;  3VS7 A;  4F17 A;  1YWP A;  2LMJ A;  5I22 A;  1MV3 A;  1I0C A;  3FJ5 A;  2F2W A;  1TG0 A;  2LZ6 B;  2CH4 A;  2LJ0 A;  1MUZ A;  3EG1 A;  1ZSG A;  2O88 A;  5I11 A;  2DM1 A;  2F2V A;  1PKS A;  2KNB B;  1NLO C;  3M0U A;  4JPB W;  2RMO A;  2SRC A;  2KE9 A;  2LQN A;  3PVQ A;  2RQU A;  3SEM A;  1X43 A;  2I0N A;  2EQI A;  2HDA A;  2KRS A;  5EC7 A;  1GCQ C;  4LNP A;  1Z9Z A;  1VA7 A;  4OMM A;  2L3P A;  1WA7 A;  2AZV A;  2J6F A;  1UJ0 A;  2DL7 A;  3H41 A;  3REB B;  1ZUY A;  3I9Q A;  1E7O A;  3I35 A;  2DVJ A;  2KRM A;  3TSW A;  1K4U S;  1Y57 A;  1PRM C;  3RNJ A;  3EG3 A;  1VYU A;  3LH5 A;  2A08 A;  2EYZ A;  3NHN A;  1QKW A;  2GQI A;  1M27 C;  1PRL C;  3UA7 A;  1LCK A;  3SHW A;  2L3S A;  1U3O A;  4AFU C;  2NWM A;  4AG2 C;  1NYG A;  2K79 A;  1QLY A;  4IIM A;  4IIO A;  2PTK A;  1M3A A;  1HJD A;  4J9D A;  2EKH A;  3NPF A;  4Z88 A;  2HSP A;  2V1R A;  1A0N B;  2JM8 A;  1NEG A;  1YCS B;  2J6O A;  3PE0 A;  1UDL A;  1ARK A;  1WI7 A;  2FPF A;  4D8K A;  2BZY A;  3VS6 A;  2KBT A;  1I1J A;  2DL5 A;  2ED1 A;  2DJQ A;  2RQT A;  2RQV A;  2C0O A;  3H0H A;  4OMO A;  4D8D A;  1T0H A;  2KRN A;  1PWT A;  4LE9 A;  1E6G A;  2FRW A;  1ABQ A;  2KGT A;  1WIE A;  2DBK A;  2FO0 A;  1AZG B;  4WCI A;  4JJC A;  2DL4 A;  2YDL A;  1RI9 A;  2A28 A;  4HVU A;  1ZX6 A;  3UA6 A;  5IXB A;  4LUE A;  2LNH B;  2CRE A;  5GJW B;  2A37 A;  1FMK A;  4J9I A;  3TVT A;  1ZBJ A;  1K76 A;  1OPK A;  2HEQ A;  4J9E A;  1I07 A;  1MV0 B;  1OV3 A;  2BZX A;  1NYF A;  2BTT A;  2GNC A;  1M8M A;  4JJB A;  4K11 A;  4OMP A;  2DRK A;  2AK5 A;  1Y0M A;  5IHK A;  2ESW A;  2FPE A;  2K7A A;  4ORZ A;  4RTW A;  1G83 A;  1VYV A;  1UE9 A;  2VVK A;  2NUZ A;  1NM7 A;  1BU1 A;  1EFN A;  2OAW A;  1HD3 A;  4LN2 A;  1JU5 C;  4CC2 A;  1WXU A;  5IXF A;  1UJY A;  2FPD A;  1UGV A;  1ABO A;  2DNU A;  2K6D A;  2DL8 A;  1T3S A;  2LQW A;  1GRI A;  4ESR A;  4E6R A;  4GBQ A;  4RTU A;  1OOT A;  1G2B A;  3VS5 A;  1PHT A;  1RLQ C;  1NLP C;  3EHQ A;  5FWB A;  4DEY A;  1K0S A;  2H8H A;  2RNA A;  1QWE A;  1YNZ A;  3NMZ C;  4OML A;  4Z89 A;  1WDX A;  1CSK A;  2KEA A;  5ECA A;  2YUN A;  2YUP A;  5IH2 A;  3QWY A;  1WX6 A;  1OEB A;  2C0I A;  2GTO A;  2OJ2 A;  2ENM A;  2CUB A;  2CDT A;  2EBP A;  3EG0 A;  5GJV B;  1JXO A;  2HBW A;  1SHG A;  2G6F X;  1JO8 A;  1AOJ A;  1T3L A;  4KRT A;  1RLP C;  2V1Q A;  2J06 A;  1U5S A;  2AZS A;  5L23 A;  2E5K A;  2D8J A;  1FYN A;  2EGA A;  1N5Z A;  2D0N A;  2M0Y A;  1XOV A;  2RQW A;  2CT3 A;  1Z9Q A;  1UUE A;  1SRM A;  2ROL A;  4FSS A;  4J9F A;  1AWX A;  1GL5 A;  2D8H A;  1BB9 A;  4EIK A;  1WLP B;  1UEC A;  1YN8 A;  2DRM A;  1QCF A;  2EPD A;  3JV3 A;  2JS0 A;  1T0J A;  1TUC A;  1WXB A;  2EVR A;  2DIL A;  2CSI A;  2KYM A;  1H92 A;  5FWC A;  1M30 A;  2OI3 A;  2K2M A;  3VS4 A;  1K1Z A;  1JQQ A;  1E6H A;  3U23 A;  2EYX A;  3R6N A;  1PNJ A;  3REA B;  1AZE A;  2L2P A;  2QDL A;  3VS1 A;  1WFW A;  3VRY A;  1W6X A;  1X69 A;  2DL3 A;  3M0Q A;  2J7I A;  1QWF A;  2CH4 W;  1GCP A;  4HCK A;  2C0T A;  4HVW A;  3QWX X;  2JS2 A;  4CC7 A;  2GTJ A;  4AFZ C;  3M0P A;  2KR3 A;  2LX7 A;  3ULR B;  3M0R A;  1X2K A;  2YSQ A;  2VWF A;  1B07 A;  2DYB A;  1KSW A;  2JMA A;  2XMF A;  3NGP A;  2VKN A;  1UFF A;  2P4R A;  3M0S A;  5IHI A;  4A63 B;  2O9S A;  4CC3 A;  4ZNX A;  1SEM A;  1SHF A;  2RPN A;  4GLM A;  4DEX A;  3VS0 A;  4LUD A;  4Y92 A;  1UHC A;  2W0Z A;  4JZ4 A;  4Z8A A;  2PZ1 A;  5IHN A;  2CUD A;  3PVL A;  1ZUU A;  2MCN A;  2O2O A;  1M3B A;  1AWW A;  2RN8 A;  2JTE A;  3O5Z A;  2F2X A;  1WYX A;  3TSZ A;  2BZ8 A;  2FRY A;  3UAT A;  1TUD A;  1SRL A;  2EYW A;  1H8K A;  2RF0 A;  1AEY A;  4RTZ A;  2DLP A;  1UG1 A;  4F14 A;  2B86 A;  1IO6 A;  2LCS A;  2J6K A;  1GCQ A;  1X6B A;  2A36 A;  2RQR A;  3KFV A;  4RTX A;  2CT4 A;  5HCK A;  2EGE A;  1QKX A;  3GBQ A;  4J9H A;  4QT7 A;  1X6G A;  2ABL A;  2EYY A;  2HCK A;  1U06 A;  2ECZ A;  1W70 A;  3CQT A;  3I5S A;  2LJ1 A;  3C0C A;  1CKB A;  2K3B A;  4X1V A;  1M3C A;  2ED0 A; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  3RIR A;  1GBQ A;  2DA9 A;  3EH1 A;  1NJI R;  5FW9 A;  1H3H A;  2LP5 A;  4AFS C;  2FYK A;  3H8Z A;  2KYB A;  2DF6 A;  3CCE T;  4PJO C;  3G71 Q;  1K9A A;  1VQO Q;  3JCM Q;  4PJJ A;  2JT4 A;  1WJQ A;  3EG2 A;  3J81 E;  3VRZ A;  2EIF A;  3CBP A;  3CPW A;  1N27 A;  4M7D C;  1AWJ A;  2YT6 A;  1C1A A;  3QZ9 B;  5GAO p;  4M78 E;  3VS3 A;  2QTV A;  4RUG A;  2DBM A;  3JB9 D;  2LRQ A;  1BBZ A;  1YI2 Q;  4XTZ A;  4QQD A;  4JZ3 A;  4WTO B;  4J9G A;  3DB3 A;  1VOM A;  3KBG A;  2DE0 X;  5LJ5 e;  3P8B B;  1OX8 A;  3X26 B;  2OTL Q;  3M5A A;  1QVG S;  3R6O A;  3CBO A;  2GGR A;  4LDV A;  1M2V A;  4OGC A;  8ATC B;  3BE3 A;  4M75 D;  4HVV A;  2QXF A;  1YWO A;  2J05 A;  2C06 A;  4ANJ A;  2DMO A;  1K8A R;  1TSF A;  3CPW P;  2P4T A;  3RMS A;  1B34 B;  2GBQ A;  1OYX A;  1PCX A;  5KYW B;  1QW1 A;  3PNW C;  3G71 A;  4N0A C;  1RUW A;  2MPX C;  2O31 A;  1YJ9 Q;  1YJN Q;  1NEB A;  2DX1 A;  2O9V A;  4JJD A;  4XQ3 A;  2X3X D;  1Q7Y R;  2GQV A;  3VS7 A;  3OBW A;  2DET A;  4A4E A;  3OA6 A;  2CS7 A;  3FJ5 A;  2COY A;  1MHN A;  4Z02 A;  1MUZ A;  2E70 A;  1ZSG A;  4KGZ B;  2O88 A;  5I11 A;  2F2V A;  1PKS A;  1HYO A;  2K5L A;  1IRE B;  2Y90 A;  1MGQ A;  3CPF A;  2LQN A;  1Q81 R;  4NS5 A;  3LX7 A;  3PTA A;  2NUT B;  3CXC P;  1WA7 A;  2QQR A;  2DJZ A;  3H41 A;  4M75 F;  1E7O A;  4ZGD B;  1BKB A;  1MMN A;  1PRM C;  2EWN A;  3L2Z A;  4F7U A;  4M77 F;  4C8Q F;  2ZPB B;  4JS4 A;  3SD4 A;  4QVD A;  1OUL A;  2HBP A;  1R0B G;  2RM4 A;  1YBY A;  2OTL A;  3FIF A;  1D1B A;  4AG2 C;  1QVP A;  4C0D C;  4JRP A;  1QLY A;  1KQ1 A;  4IUV A;  2PTK A;  4RCC A;  5CO7 A;  1Q86 U;  1RAA B;  2JOY A;  2E1H A;  1M3A A;  2PU9 B;  1YIT A;  2NUP B;  1FX7 A;  2QGG A;  2DKG A;  3M59 A;  4RKU E;  4FL6 A;  2MWP A;  1A0N B;  4XAX B;  1UDL A;  5KYU A;  1M1K U;  5GMK m;  4C0G A;  4DOV A;  1I8F A;  1VQP T;  2V26 A;  2HSE B;  4M7D D;  3TEE A;  4M78 A;  3PMI A;  4DBR A;  2C0O A;  3H0H A;  2DIG A;  2D0Q B;  4LE9 A;  1ABQ A;  2KGT A;  4J6W A;  1SSF A;  1AZG B;  2E10 A;  4BDZ A;  4KH1 B;  4HVU A;  3SWN B;  1WHL A;  1M1G A;  4NOY A;  2XDP A;  3CC4 T;  2RA2 A;  2CRE A;  1RAE B;  3C12 A;  4OB1 B;  3VKI A;  2IVW A;  2QI2 A;  1JRI A;  5KCH A;  2K3X A;  4E2F B;  3CCR A;  1NYF A;  1M8M A;  1PD1 A;  2OAU A;  3WVE B;  2DD5 A;  4OMP A;  5IHK A;  2VB6 A;  1WNL A;  2FPE A;  3EFS A;  2E6N A;  3LGL A;  3RR6 A;  2YLB A;  4OVA A;  4RTW A;  2CP3 A;  3V8J A;  1M5Q 1;  1EFN A;  2OAW A;  2XK0 A;  1JU5 C;  4CC2 A;  4JJN K;  1WXU A;  3OYD A;  1UJY A;  1UGV A;  1XJW B;  4X9C A;  4CRI A;  4BUG A;  1UEB A;  1Y96 A;  2DL8 A;  2LVM A;  4KGX B;  2LQW A;  1O9S A;  5KYX B;  3I55 Q;  1GRI A;  1BCM A;  1G2B A;  1Y96 B;  3VS5 A;  1G3S A;  3LYI A;  2R58 A;  1NPR A;  1OQK A;  5FWB A;  5FU6 B;  3EH2 A;  4M78 F;  1S72 A;  3RER A;  3NMZ C;  1G5V A;  2RJD A;  4EMK A;  4JLG A;  1VQ4 A;  1WDX A;  2DZC A;  3L42 A;  1UGS B;  3LLR A;  3QWY A;  4HCZ A;  2C0I A;  2GTO A;  1WPY A;  2ENM A;  3EG0 A;  2CDT A;  3A8L B;  3V7C A;  3JCM J;  1G3W A;  1SHG A;  2YRV A;  2V8K A;  2MF2 A;  1RLP C;  2XDB A;  1PG5 B;  5GAN f;  5J3B A;  2E6Z A;  1LPL A;  1FYN A;  4C92 F;  1N5Z A;  2D0N A;  2M0Y A;  3L2U A;  1C6V X;  4C92 G;  5LJ3 j;  3CCE Q;  3PT9 A;  4C8Q A;  3JCM c;  3JB9 J;  2E4H A;  1VQK Q;  5FRO A;  5A2Q E;  3CC4 Q;  1M1K R;  1VQN A;  4J6Y A;  2D9T A;  5DLO A;  1IXD A;  1SKU B;  3CC7 A;  1YJ9 A;  2COW A;  1LOJ A;  2M9U A;  4XTV A;  5GAN g;  3I55 A;  1K73 R;  2D8H A;  4EIK A;  1BYM A;  1QCF A;  2QDY B;  1YIJ A;  3JV3 A;  3QII A;  5A0L A;  1G3Y A;  2P0Q A;  2DIL A;  3LGF A;  1WQW A;  4MMK A;  4L59 A;  2HQH A;  2XIC A;  4C92 E;  2ZPE B;  1S72 Q;  2K5F A;  3HRS A;  4B9X A;  1E6H A;  3GF5 A;  3HL8 A;  3OS0 A;  1JBM A;  1VQK T;  2PQW A;  3MEA A;  1WFW A;  4KUL A;  4BE0 A;  1W6X A;  3M9Q A;  1X69 A;  4M7A C;  3PIP A;  2JJ9 A;  3BFM A;  1GCP A;  1FMW A;  3UT1 A;  2GTJ A;  1RL2 A;  3M0P A;  2IG0 A;  2LX7 A;  5LJ5 f;  3MEW A;  1X2K A;  4M75 E;  3MPU B;  2YSQ A;  2VWF A;  4FT4 A;  3EGD A;  2RHI A;  2XMF A;  3NGP A;  2VKN A;  4M77 B;  1KC8 R;  5GAN 3;  1M90 R;  2P4R A;  1VIF A;  3SWN C;  1NZ9 A;  5IHI A;  4A63 B;  3G71 T;  4ATO A;  2O9S A;  1YI2 T;  4CC3 A;  4XU0 A;  1QP3 A;  3NFC A;  4A4K A;  2RJC A;  4LUD A;  3OQ5 A;  1UHC A;  2YWW A;  2W0Z A;  4JZ4 A;  2O01 E;  4Z8A A;  2XDD A;  2PZ1 A;  2CUD A;  3PVL A;  6AT1 B;  4E7K A;  2MCN A;  1YJW A;  2O2O A;  1M3B A;  1YIJ Q;  4QW2 A;  4ZN1 A;  1YIT Q;  1HXD A;  4M75 G;  2JTE A;  3O5Z A;  3QHS A;  2CZ7 B;  1WJR A;  2F2X A;  2Y4Y A;  1WYX A;  3UAT A;  1WHM A;  4D6W A;  2RF0 A;  2R57 A;  1AEY A;  2VAS A;  4EMK C;  2DLP A;  4E7S A;  3UPU A;  5CKD A;  3JSC A;  5GAN 2;  3GOX A;  1WHH A;  2LCS A;  1D0Y A;  1H3Z A;  4FW2 A;  3KFV A;  1V29 B;  4QT7 A;  1X6G A;  1GXI E;  2EQU A;  3MEV A;  2RB6 A;  1W70 A;  3CQT A;  4BY6 C;  2LJ1 A;  3JB9 H;  3CCV T;  9ATC B;  2CP7 A;  1KQS A;  1M90 C;  3OYL A;  2E5Q A;  3GIB A;  3IQL A;  2MI6 A;  3EHR A;  1S1N A;  5GMK h;  3NTK A;  1KQ2 A;  3HTR A;  2YHT A;  3NTH A;  4F16 A;  3ZBD A;  2FEI A;  5HK0 A;  3LH0 A;  4BI3 A;  5GAN h;  5KE2 A;  4PFZ A;  1M4Z A;  1HSQ A;  3CCR Q;  4UC4 A;  2X51 A;  3G4S A;  2QAS A;  3VU3 C;  2YUQ A;  2EGC A;  4V2S A;  3QG1 A;  2DPP B;  5FU7 C;  4BB7 A;  3CMA Q;  5GAO l;  1PKT A;  1NG2 A;  4N4H A;  1RAG B;  1FXX A;  4FYX B;  3QBY A;  3S3M A;  1K0X A;  3UF4 A;  2RHX A;  3E19 A;  1OPL A;  1KIK A;  1Q82 R;  1X75 C;  2VYT A;  2QQS A;  2ZGW A;  4LDY A;  4M7A F;  4OMN A;  1AWO A;  1SF9 A;  2JTF A;  2FG0 A;  1O75 A;  1KFZ A;  2A0F B;  3HP9 A;  3OYA A;  1Q95 G;  3RKW A;  3OW2 S;  2MIO A;  4C92 D;  5GAM g;  3CCQ T;  1D0Z A;  5GAM e;  1YP5 A;  1BI2 A;  1QVF A;  2CSQ A;  3RBB B;  3OYB A;  3MJX A;  4AFQ C;  2JMC A;  5KH6 A;  1MMD A;  4RTV A;  3V8L A;  1ZSZ B;  2EKO A;  2M0O A;  1VQO A;  3ZL7 C;  1X2Q A;  2QQA A;  3OYF A;  2LDM A;  1ACM B;  4RTY A;  3I5R A;  1AVZ C;  1AD5 A;  1EZZ B;  2CP0 A;  2LMJ A;  4IKF A;  1M8V A;  4M77 C;  5I22 A;  1MV3 A;  1I0C A;  2Z0W A;  2DIQ A;  1TG0 A;  3S3N A;  4M7A A;  2CH4 A;  1QCO A;  3EG1 A;  3CCQ Q;  3CCU A;  2JNG A;  4C92 C;  2KNB B;  3A1P A;  5KE3 A;  2CYZ B;  3M0U A;  4JPB W;  4E7H A;  3PVQ A;  2RQU A;  5C0M A;  2P0P A;  3EGX A;  4B9W A;  2O4X B;  2HDA A;  2KRS A;  3ASK A;  4QQG A;  5EC7 A;  1PC0 A;  1VA7 A;  4OMM A;  3CCM A;  4E47 A;  1NE8 A;  2J6F A;  1UJ0 A;  5FU6 C;  1ZUY A;  3I35 A;  3X20 B;  3UWN A;  3TSW A;  2R5A A;  2KAF A;  3LH5 A;  1QKW A;  4M78 C;  3CCL T;  2PVD B;  1KK7 A;  2GQI A;  3JCM g;  2ATC B;  2CP6 A;  3SHW A;  1IGQ A;  3A8O B;  2BUD A;  3E2U A;  5FLX E;  3OW2 P;  3FDR A;  5KYN A;  4DA4 A;  2EQJ A;  3JCM V;  1QVG P;  2L89 A;  1VQP Q;  1NEG A;  1YCS B;  3CC7 T;  4BE1 A;  2A7Y A;  1ARK A;  1WI7 A;  3JCM b;  1Y71 A;  2LC4 A;  2B8A A;  1I1J A;  2ED1 A;  4BI4 A;  2DJQ A;  1E6G A;  2FRW A;  1WIE A;  4ZGJ B;  4JJC A;  5GAN e;  4GLK A;  4E7L A;  1B7T A;  2A28 A;  1BIA A;  1ZX6 A;  3UA6 A;  5IXB A;  1MND A;  4IUP A;  2MYS A;  2XD0 A;  2LNH B;  2GFU A;  3GNF B;  2X4J A;  5GJW B;  1NPP A;  5CQY A;  3I56 A;  2A37 A;  1FMK A;  3TVT A;  3CXC S;  2QEX A;  2FZC B;  1WGS A;  2HEQ A;  4J9E A;  1OV3 A;  2BTT A;  4FU6 A;  1JJ2 S;  3A8H B;  4P5N A;  1TUG B;  4M78 B;  4PKC C;  3G6E Q;  3CD6 T;  3MO8 A;  1VYV A;  2YXY A;  2E3I A;  1U1T A;  1HD3 A;  4LN2 A;  2LT1 A;  1ZBX A;  1NBE B;  1VQ9 Q;  3OSS C;  4N0A A;  3CCL Q;  1RAH B;  5GAM h;  2P84 A;  2HKN A;  3EGX B;  3QXE B;  2K6D A;  2COZ A;  2K3Y A;  2HQX A;  2MMP A;  1TS9 A;  5GAN 5;  3L2R A;  4E6R A;  3BY7 A;  1X6O A;  3M53 A;  1PHT A;  1RLQ C;  1NLP C;  1M1K C;  2H8H A;  2V8J A;  2D6F A;  4OML A;  2LX9 A;  1W2B P;  5LJ5 h;  2KSS A;  1CSK A;  1BI0 A;  1KC8 U;  2DAQ A;  3ER0 A;  2YUN A;  2YUP A;  5IH2 A;  4AT1 B;  3M57 A;  3QYH B;  4IUQ A;  5GJV B;  2CUB A;  2HBW A;  3QPH A;  1QP2 A;  3QSU A;  4FT2 A;  4PLL A;  3RUX A;  3PMT A;  4DBQ A;  1VQ6 A;  4MZM A;  5DY9 A;  3TU4 K;  2KI7 A;  3HFN A;  2EGA A;  3MP6 A;  1EIF A;  4BDY A;  1BCO A;  2DXT A;  2RQW A;  3OYK A;  3QJY A;  1V76 A;  4FYV B;  3CBM A;  4HKE A;  4OB3 B;  4PJM A;  1W2B A;  4J83 A;  2K4Y A;  1N8R C;  3OY9 A;  4FSS A;  2M1H A;  1F1B B;  1GL5 A;  4ZN3 A;  3OYN A;  1WXB A;  2EVR A;  5EG2 A;  2CSI A;  1UGP B;  3G1J A;  1H92 A;  2BIV A;  2QA4 Q;  5FU7 B;  1YJN T;  1X01 A;  2K2M A;  4MZT A;  3VS4 A;  4PFP A;  4C0F A;  3U23 A;  3M56 A;  3CCU Q;  2AT1 B;  1PNJ A;  3JRZ A;  4C5G A;  1IGU A;  3CCU T;  2LTO A;  3EG9 B;  3M55 A;  4M75 A;  1QWF A;  4HVW A;  4IUR A;  5CK9 A;  1MMG A;  4PJO B;  4EMK B;  3HKS A;  1YIT T;  3O8V A;  1KD1 C;  4PK4 A;  4LDU A;  1KSW A;  4Q5W A;  4JS5 A;  1D1A A;  3M0S A;  2RH2 A;  3CCE A;  1K9M C;  1VQO T;  1VQL Q;  4FM4 B;  3VV0 A;  4ME7 A;  1LNX A;  5C6S A;  3C95 A;  2V8I A;  4LDW A;  1D3B B;  4Y92 A;  1VQ4 T;  2DER A;  3ME9 A;  1YIJ T;  3GLX A;  5IHN A;  1Q86 R;  1ZUU A;  2DEU A;  3CCV Q;  2DTI A;  4HT9 A;  2K57 A;  2HZY A;  1KQS S;  3TSZ A;  2XI9 A;  3OMC A;  1TUD A;  4M78 D;  4J8O A;  5CKB A;  2AHJ B;  3KUF A;  3CCS Q;  2LT4 A;  1UG1 A;  5GAN 7;  3SDZ A;  1IO6 A;  2R5M A;  2RK2 A;  2VXE A;  1X6B A;  4PJO G;  4R55 A;  2RQR A;  3E9F A;  4M7A E;  2CT4 A;  4A53 A;  4E7Z A;  2EYY A;  3PGG A;  2RK1 A;  1HK9 A;  3VUB A;  2XU8 A;  4C8Q E;  2ED0 A;  4A54 A;  2K9G A;  4M4Z A;  4RMO A;  3L2Q A;  1WHJ A;  1JEG A;  5AT1 B;  4M77 A;  2OTJ Q;  1ZLM A;  4DBF A;  1IHV A;  2F5K A;  3L2V A;  2FVU A;  1Y07 A;  1N6A A;  4RG8 A;  3OMG A;  2HL3 A;  4M77 E;  2X4W A;  4A4G A;  4BE2 A;  2ROT A;  3BDU A;  4RTT A;  1VYT A;  1NJI C;  5DM7 R;  1I81 A;  1YJW Q;  4PJL A;  5LJ5 d;  2VV5 A;  1SPK A;  3CCM Q;  3A98 A;  3H0I A;  1UHF A;  1G8X A;  1WXT A;  2HQE A;  3OYJ A;  2RI2 A;  3JCM X;  2AKK A;  4N4G A;  1UTI A;  4HA8 A;  3THK A;  2A3L A;  2M16 A;  5CQX A;  2QK0 A;  2IIM A;  3S3O A;  2HKQ B;  2JM9 A;  2EAY A;  4FYW B;  1GFD A;  3CC2 A;  2L3Q A;  2KY9 A;  1KC8 C;  4CC4 B;  2ZPI B;  1Y7X A;  2KT8 A;  3EGU A;  4MDW A;  2WSF E;  3M0T A;  2BE9 B;  2G3R A;  3CME A;  2YUO A;  3OB9 A;  3V8K A;  2VUB A;  1I4K 1;  1PM3 A;  3M4Y A;  1VQN T;  4E7J A;  3CCS T;  1WQ7 A;  4FW1 A;  3QDR B;  1GFC A;  1R77 A;  4C5E A;  4J9B A;  4GY5 A;  5IN1 A;  2W10 A;  1K8A C;  2ZPF B;  1QMC A;  2KT1 A;  3OYI A;  4XU3 A;  4KUI A;  3P8D A;  1KHI A;  2E12 A;  2D1X A;  2JW4 A;  2DYI A;  4R56 A;  2X4X A;  1B3Q A;  3CCJ T;  2KK4 A;  2NYS A;  2DK3 A;  1YWP A;  4F04 B;  3A8M B;  1TU0 B;  2EJ9 A;  4EDU A;  2FHD A;  1ZQ1 A;  4J7F A;  2F2W A;  7AT1 B;  5D7U A;  5GMK j;  1VQK A;  2EFI A;  2LZ6 B;  2ZAE A;  1VQN Q;  2OTJ T;  1XNI A;  2CZ1 B;  3CD6 A;  2JN0 A;  2RMO A;  2SRC A;  2KE9 A;  5GAO q;  1OU9 A;  1D09 B;  5KYW A;  1Q7Y C;  1OZ3 A;  2X4Y A;  2YLC A;  1X43 A;  2PUO B;  1QCN A;  1VIE A;  3MHX A;  3BW1 A;  1AHJ B;  4LNP A;  3CC2 Q;  1VQ8 Q;  4O5V A;  2AZV A;  5J39 A;  1IHW A;  3E1S A;  4OB0 B;  3I9Q A;  1K8A U;  3I55 T;  2DVJ A;  1K4U S;  1Y57 A;  4ZTF A;  1VQ9 T;  4PJO D;  3CME Q;  2A08 A;  2EYZ A;  3DB4 A;  1M27 C;  2KVQ G;  3UA7 A;  1LCK A;  3GPL A;  2DZ9 A;  2L3S A;  3HRU A;  5CVI A;  1U3O A;  4AFU C;  3N5B B;  4ZTJ A;  5CIU A;  5GAO n;  1VQM T;  4C92 B;  1YJ9 T;  3FEO A;  3AHU A;  1HJD A;  4J9D A;  2EKH A;  4A4H A;  3NPF A;  4Z88 A;  2HSP A;  2JM8 A;  3VUZ A;  3AT1 B;  3SWN A;  1UGR B;  2DXC A;  3CXC A;  4HCC A;  3M58 A;  2MK5 A;  2KBT A;  2DL5 A;  5FRN A;  2RQT A;  2RQV A;  1T0H A;  1PWT A;  5GAN 6;  5LJ5 j;  3OS2 A;  2KDS A;  2DL4 A;  4JDS A;  4BAC A;  3E9G A;  1NJI U;  2QG9 B;  2YDL A;  3EG9 A;  4M7D B;  3X25 B;  3JCM f;  4LUE A;  3QKJ A;  1FWZ A;  3CCL A;  1WHK A;  3CPW S;  1KD1 U;  2NUP A;  3INZ A;  5LJ3 g;  4J9I A;  5A0D A;  5GAM d;  2JUF A;  4XTY A;  2DFU A;  1BI1 A;  1MMA A;  1I07 A;  1MV0 B;  2RI3 A;  2VGM A;  1PD0 A;  4PJN A;  2GNC A;  3EGD B;  3OYY A;  4K11 A;  4M7A D;  2AK5 A;  3S6W A;  2FB7 A;  5CKE A;  2ESW A;  4PLI A;  4PL6 A;  3OYC A;  1G83 A;  3D7S B;  5HY6 A;  2K2V A;  2VVK A;  2NUZ A;  1NM7 A;  1BU1 A;  2FZG B;  3LWH A;  2QAZ A;  2ZPH B;  5IXF A;  1W2B S;  2FPD A;  1R8O B;  3SFM A;  1ABO A;  2HL5 C;  1T3S A;  3CCJ A;  4TVR A;  4RTU A;  2HMA A;  1OOT A;  4M7D G;  2M02 A;  1VQM Q;  3P8H A;  2WSC E;  1I5O B;  1K0S A;  2RNA A;  1QWE A;  3MP1 A;  1YNZ A;  5GMK l;  4Z89 A;  3G4S T;  2KEA A;  2H3E B;  5HK3 A;  2X9H A;  3PIO A;  1VQL T;  5LJ3 e;  2XHC A;  4Y91 A;  1QVF S;  2OJ2 A;  3I56 Q;  2GF7 A;  2HD0 A;  2G6F X;  1JO8 A;  1AOJ A;  1T3L A;  2RHZ A;  4KRT A;  4XK8 E;  3MCA B;  2WSE E;  1PSF A;  2AZS A;  5L23 A;  2E5K A;  2D8J A;  3RKX A;  1OZ2 A;  1Q81 U;  1BIB A;  2QA4 A;  2AIR B;  4ELZ C;  3G6E A;  2JTM A;  3RMQ A;  4L5G A;  2CT3 A;  8AT1 B;  4M7D E;  2F5T X;  3FC3 A;  1Z9Q A;  1UUE A;  2ROL A;  4B6M A;  2F1L A;  1M1F A;  1M2V B;  1TTH B;  2JZ2 A;  3OS5 A;  1AWX A;  1YJW T;  3CCJ Q;  3MEU A;  1BB9 A;  1WLP B;  1YN8 A;  5L8R E;  4YTL A;  1ZA1 B;  2EPD A;  2E65 A;  5LJ3 f;  2JS0 A;  3BDL A;  2GFA A;  2RD1 A;  2YRD A;  2KYM A;  3JB9 F;  5FWC A;  1M90 U;  1M30 A;  5I21 A;  4ZGE B;  5KYX A;  2OI3 A;  1K1Z A;  1JQQ A;  3OW2 A;  3TRE A;  2FL7 A;  5GAM f;  3R6N A;  3REA B;  1AZE A;  2QGF B;  2QDL A;  5CR2 A;  4C92 A;  3MKD A;  3MP8 A;  3VRY A;  3L2W A;  5CKF A;  3KXT A;  3CMA T;  2DL3 A;  2HNI A;  2J7I A;  1VQ6 T;  3CCV A;  2CH4 W;  4HCK A;  2C0T A;  4FYY B;  2LCL A;  4AFZ C;  2KR3 A;  1VQ8 A;  1VQ6 Q;  2MWO A;  3ULR B;  3M0R A;  2XKO C;  2JMA A;  2IPO B;  5GAN 4;  2XID A;  2LNV A;  3QUI A;  3OYH A;  5IT9 E;  3EFO A;  3URG A;  1SEM A;  1SHF A;  2CP2 A;  2RPN A;  4GLM A;  4C0Z A;  4DEX A;  1RI0 A;  3VS0 A;  3GP8 A;  1VQ7 T;  1VUB A;  4PJO E;  4II1 A;  3OSV A;  4M7A G;  3WVD B;  3PFS A;  1OX9 A;  4RG2 A;  2RN8 A;  1TXQ A;  3QZ5 B;  4KBM B;  4O6J A;  2QYZ A;  2BZ8 A;  4EPC A;  1SRL A;  2EYW A;  4IUT A;  2CGH A;  4ELY C;  2QEX T;  1VQ5 Q;  1YHQ T;  5KYU B;  4AMC A;  5LL6 S;  3OBY A;  3JAM E;  1IZ6 A;  4EMH A;  5GAO r;  5GAN d;  2EGE A;  3FJP A;  4J9H A;  1VQ8 T;  2O4X A;  3JCM P;  2ECZ A;  3I5S A;  1CKB A;  2K3B A;  2DXB A;  3HSB A;  1M3C A;  1FMV A;  2F69 A;  4AG1 C;  4R0K A;  3DLM A;  5KYY A;  4FSX A;  1N9R A;  1MNE A;  2LQ8 A;  4OMF B;  3OYM A;  2KRO A;  4M7A B;  2PVG B;  4XTX A;  1TWB A;  1Q82 U;  1DJ7 B;  2EJF A;  1ZUK A;  5CKH A;  2QEX Q;  1VQ5 T;  4JRQ A;  2MOX A;  4F7U B;  1S72 T;  2ZCF B;  4OMQ A;  4C8Q C;  3WXM B;  3CD6 Q;  1Q82 C;  1X27 A;  4JUV A;  2CKK A;  2JXB A;  2CZ6 B;  2KXD A;  2EYQ A;  1W1F A;  1RAC B;  3ZFJ A;  4A4F A;  4LD9 K;  3HHT B;  1H64 1;  3G7Z A;  2QTX A;  3CME T;  2LJ3 A;  4J9C A;  1VQ9 A;  3EFO B;  2PNI A;  1BI3 A;  3CCS A;  2DVE A;  2EJG A;  2L0A A;  1UB4 A;  3EFR A;  3H0F A;  1JXM A;  1UGQ B;  1V1C A;  1BK2 A;  3OYE A;  1WHG A;  1CKA A;  3H6Z A;  1GBR A;  2EW3 A;  3OS1 A;  1WJS A;  2X3W D;  1K9M R;  4OF1 A;  3VYH B;  2SEM A;  1VQ5 A;  3J80 E;  4F7U G;  4M77 G;  1D3B A;  3DKM A;  2AKL A;  4HXJ A;  3FB9 A;  3VS2 A;  2RHU A;  4J7I A;  4PNO A;  4MZP A;  2OTJ A;  1SG5 A;  4EMG A;  4XU1 A;  2M51 A;  4LD6 A;  2VC8 A;  4PFO A;  1KJW A;  3CEY A;  5HKC A;  1Q86 C;  2PUK B;  2PVO B;  1N9S A;  2KXC A;  1SSH A;  5DLQ E;  1J3T A;  3C4S A;  4PJO A;  3VYG A;  1U8R A;  4F17 A;  2VXF A;  4M75 B;  3JCM h;  5GAM j;  4C0D B;  2LJ0 A;  2I2L A;  1D1C A;  4QKU A;  2DM1 A;  4RCB A;  3EAE A;  1NLO C;  1AT1 B;  3Q1J A;  1Q7Y U;  4F7U E;  3CC2 T;  3JB9 I;  3SEM A;  5GAN 8;  2E64 A;  1C0M A;  2I0N A;  3ZEH A;  2EQI A;  1GCQ C;  1Z9Z A;  3HPW A;  2L3P A;  2OTL T;  3X28 B;  3VJP A;  2DL7 A;  3REB B;  4L6V 5;  3TQ7 P;  2KRM A;  2RJE A;  3JB9 G;  2BKD N;  3I56 T;  3RNJ A;  3EG3 A;  1XTD A;  1VYU A;  3NHN A;  3HRT A;  5CCA A;  1KHC A;  4FIB A;  4WF2 A;  1PRL C;  1TOV A;  5KCO A;  1LJO A;  3CCM T;  2DTO A;  4NL3 A;  2QA4 T;  2EQK A;  2GCX A;  2NWM A;  1NYG A;  5LJ3 h;  3G6E T;  2K79 A;  2KQW A;  4IIM A;  2DTH A;  4IIO A;  4FCY A;  3DLL A;  1RAB B;  5IAY A;  4J5Y A;  4CI0 C;  2V1R A;  1Q81 C;  3L1A A;  2J6O A;  1VQL A;  3PE0 A;  4C5H A;  2FPF A;  2WAC A;  4D8K A;  2BZY A;  3VS6 A;  1YJN A;  1KG1 A;  3V7R A;  2LCC A;  3C94 A;  3NTI A;  2K5I A;  4X9D A;  4OMO A;  4D8D A;  2KRN A;  3GNG A;  4C8Q B;  4M75 C;  4J6X A;  2DBK A;  1K73 C;  1JB0 E;  2FO0 A;  4WCI A;  2ZPG B;  2RHY A;  1RI9 A;  3UDC A;  2CP5 A;  1VQ4 Q;  3QYG B;  2H3J A;  4BI8 B;  4VUB A;  5GMK i;  3LWI A;  3F70 A;  1VQP A;  1ZBJ A;  4N4I A;  1K76 A;  3FLG A;  1OPK A;  2NLU A;  4JRI A;  1IB8 A;  3LW5 E;  1JJ2 P;  3OYG A;  1VQM A;  3MET A;  2BZX A;  1ZHI A;  4JJB A;  1PSE A;  5GAO m;  2DRK A;  1Y0M A;  2DD4 A;  2K7A A;  1LVK A;  3RES A;  4DOW A;  3A8G B;  4C5I A;  4ORZ A;  3CMA A;  3X24 B;  1RAF B;  1UE9 A;  3A5Z B;  3FRN A;  1U1S A;  3JCM d;  1W4S A;  4KT0 E;  3RDV A;  1EX4 A;  4C8Q G;  3CC7 Q;  2DNU A;  1RAD B;  5M9O A;  3H9N A;  1ZSZ C;  4ESR A;  4GBQ A;  4M77 D;  5D6W A;  4OP0 A;  2L3R A;  3EHQ A;  4DEY A;  5D6Y A;  1QQJ A;  2XG8 D;  3TCJ A;  1G3T A;  5ECA A;  3JCM e;  1WX6 A;  4F7U F;  1OEB A;  2EBP A;  4JLI A;  1JXO A;  2FZK B;  2CZ0 B;  5AYF A;  2V1Q A;  2HAX A;  1P92 A;  2J06 A;  4LXC A;  1U5S A;  2RI5 A;  2RO0 A;  1N8R R;  1I5L A;  2L5Q A;  2Y4X A;  4M7D F;  4E7I A;  3JCM W;  3QO3 A;  1K9M U;  3SB2 A;  1XOV A;  2YRC A;  4QVZ A;  1M9S A;  1VQ7 Q;  4DBH A;  1YFN A;  1KQS P;  4HT8 A;  1TH7 A;  1SRM A;  3CCQ A;  4PJO F;  1YHQ A;  3HFO A;  3RKY A;  2LQK A;  4KGV B;  4OGE A;  4JRK A;  4J9F A;  1UEC A;  1OU8 A;  2DRM A;  1T0J A;  4QVC A;  1TUC A;  3M54 A;  5GAN j;  1R0C B;  2MAM A;  2L8D A;  4MML A;  5J26 A;  4XTU A;  3CCR T;  1M2O A;  1OI1 A;  4XU2 A;  2E3H A;  2EYX A;  5I2S A;  5CAI A;  1KD1 R;  2EQM A;  3M4G A;  2L2P A;  1K73 U;  3VS1 A;  4NL2 A;  4KH0 B;  5LJ3 d;  1QVG A;  3M0Q A;  2ZZD A;  2OX7 A;  1XQH A;  2E41 A;  4X34 A;  4QQ6 A;  3QWX X;  2JS2 A;  1RAI B;  4CC7 A;  1IRX A;  1N8R U;  2QQB A;  4C8Q D;  1B07 A;  5FRM A;  2DYB A;  2JVV A;  1D0X A;  5LJ5 g;  2NUT A;  2RJF A;  1UFF A;  4M78 G;  1JJ2 A;  5KYY B;  4LDX A;  4MDX A;  4KUD K;  3QJ6 A;  4ZNX A;  4BY6 B;  2DEQ A;  3T9N A;  2DO3 A;  4IUU A;  4BD3 A;  3G4S Q;  5I2M A;  4HCB A;  2P0K A;  1AWW A;  4Y28 E;  5A0G A;  1VQ7 A;  3QDF A;  4DQ2 A;  2FRY A;  5D6X A;  3CC4 A;  1H8K A;  5GMK e;  1YHQ Q;  1YI2 A;  4RTZ A;  2KMT A;  4XTW A;  4F14 A;  2B86 A;  2VGN A;  1WZO A;  4OB2 B;  3V7S A;  2J6K A;  1GCQ A;  2X35 A;  2A36 A;  4RTX A;  5HCK A;  1QKX A;  3GBQ A;  1ZA2 B;  2ABL A;  3J7A F;  2HCK A;  1B34 A;  1U06 A;  1ZSZ A;  2DXU A;  3C0C A;  2BE7 D;  4X1V A;  4M7D A;  1YCY A;  1QVF P; 
#chains in the Genus database with same CATH homology
 2K9G A;  4M4Z A;  3IQL A;  4R0K A;  4AG1 C;  1GBQ A;  3EHR A;  2DA9 A;  1S1N A;  1JEG A;  2KRO A;  5FW9 A;  4F16 A;  2LP5 A;  1H3H A;  4AFS C;  1ZUK A;  1ZLM A;  2KYB A;  2FEI A;  2DF6 A;  2MOX A;  1K9A A;  2JT4 A;  4OMQ A;  1HSQ A;  3EG2 A;  3VRZ A;  1X27 A;  2ROT A;  4RTT A;  2JXB A;  1VYT A;  2EGC A;  2YUQ A;  1AWJ A;  2YT6 A;  2KXD A;  1SPK A;  1PKT A;  1W1F A;  1NG2 A;  3VS3 A;  3A98 A;  3H0I A;  1UHF A;  4RUG A;  2DBM A;  1K0X A;  2LJ3 A;  4J9C A;  1WXT A;  3UF4 A;  1OPL A;  1KIK A;  1BBZ A;  2PNI A;  2AKK A;  2L0A A;  1UTI A;  4JZ3 A;  3H0F A;  3THK A;  1JXM A;  4J9G A;  2DE0 X;  1V1C A;  2IIM A;  4OMN A;  1BK2 A;  2JM9 A;  1AWO A;  1GFD A;  1CKA A;  2GGR A;  1GBR A;  2EW3 A;  2L3Q A;  2FG0 A;  4CC4 B;  4HVV A;  2KT8 A;  1YWO A;  3EGU A;  1KFZ A;  3M0T A;  2J05 A;  2X3W D;  2DMO A;  2SEM A;  2MIO A;  2YUO A;  2AKL A;  4HXJ A;  3VS2 A;  2GBQ A;  1YP5 A;  2CSQ A;  3RBB B;  4AFQ C;  2JMC A;  2M51 A;  4RTV A;  1GFC A;  1KJW A;  1RUW A;  2O31 A;  4J9B A;  3ZL7 C;  1X2Q A;  1NEB A;  2W10 A;  2DX1 A;  2KT1 A;  2KXC A;  1SSH A;  2D1X A;  2JW4 A;  1J3T A;  2O9V A;  4JJD A;  1B3Q A;  4RTY A;  2X3X D;  3I5R A;  1AVZ C;  1AD5 A;  3VS7 A;  4F17 A;  1YWP A;  2LMJ A;  5I22 A;  1MV3 A;  1I0C A;  3FJ5 A;  2F2W A;  1TG0 A;  2LZ6 B;  2CH4 A;  2LJ0 A;  1MUZ A;  3EG1 A;  1ZSG A;  2O88 A;  5I11 A;  2DM1 A;  2F2V A;  1PKS A;  2KNB B;  1NLO C;  3M0U A;  4JPB W;  2RMO A;  2SRC A;  2KE9 A;  2LQN A;  3PVQ A;  2RQU A;  3SEM A;  1X43 A;  2I0N A;  2EQI A;  2HDA A;  2KRS A;  5EC7 A;  1GCQ C;  4LNP A;  1Z9Z A;  1VA7 A;  4OMM A;  2L3P A;  1WA7 A;  2AZV A;  2J6F A;  1UJ0 A;  2DL7 A;  3H41 A;  3REB B;  1ZUY A;  3I9Q A;  1E7O A;  3I35 A;  2DVJ A;  2KRM A;  3TSW A;  1K4U S;  1Y57 A;  1PRM C;  3RNJ A;  3EG3 A;  1VYU A;  3LH5 A;  2A08 A;  2EYZ A;  3NHN A;  1QKW A;  2GQI A;  1M27 C;  1PRL C;  3UA7 A;  1LCK A;  3SHW A;  2L3S A;  1U3O A;  4AFU C;  2NWM A;  4AG2 C;  1NYG A;  2K79 A;  1QLY A;  4IIM A;  4IIO A;  2PTK A;  1M3A A;  1HJD A;  4J9D A;  2EKH A;  3NPF A;  4Z88 A;  2HSP A;  2V1R A;  1A0N B;  2JM8 A;  1NEG A;  1YCS B;  2J6O A;  3PE0 A;  1UDL A;  1ARK A;  1WI7 A;  2FPF A;  4D8K A;  2BZY A;  3VS6 A;  2KBT A;  1I1J A;  2DL5 A;  2ED1 A;  2DJQ A;  2RQT A;  2RQV A;  2C0O A;  3H0H A;  4OMO A;  4D8D A;  1T0H A;  2KRN A;  1PWT A;  4LE9 A;  1E6G A;  2FRW A;  1ABQ A;  2KGT A;  1WIE A;  2DBK A;  2FO0 A;  1AZG B;  4WCI A;  4JJC A;  2DL4 A;  2YDL A;  1RI9 A;  2A28 A;  4HVU A;  1ZX6 A;  3UA6 A;  5IXB A;  4LUE A;  2LNH B;  2CRE A;  5GJW B;  2A37 A;  1FMK A;  4J9I A;  3TVT A;  1ZBJ A;  1K76 A;  1OPK A;  2HEQ A;  4J9E A;  1I07 A;  1MV0 B;  1OV3 A;  2BZX A;  1NYF A;  2BTT A;  2GNC A;  1M8M A;  4JJB A;  4K11 A;  4OMP A;  2DRK A;  2AK5 A;  1Y0M A;  5IHK A;  2ESW A;  2FPE A;  2K7A A;  4ORZ A;  4RTW A;  1G83 A;  1VYV A;  1UE9 A;  2VVK A;  2NUZ A;  1NM7 A;  1BU1 A;  1EFN A;  2OAW A;  1HD3 A;  4LN2 A;  1JU5 C;  4CC2 A;  1WXU A;  5IXF A;  1UJY A;  2FPD A;  1UGV A;  1ABO A;  2DNU A;  2K6D A;  2DL8 A;  1T3S A;  2LQW A;  1GRI A;  4ESR A;  4E6R A;  4GBQ A;  4RTU A;  1OOT A;  1G2B A;  3VS5 A;  1PHT A;  1RLQ C;  1NLP C;  3EHQ A;  5FWB A;  4DEY A;  1K0S A;  2H8H A;  2RNA A;  1QWE A;  1YNZ A;  3NMZ C;  4OML A;  4Z89 A;  1WDX A;  1CSK A;  2KEA A;  5ECA A;  2YUN A;  2YUP A;  5IH2 A;  3QWY A;  1WX6 A;  1OEB A;  2C0I A;  2GTO A;  2OJ2 A;  2ENM A;  2CUB A;  2CDT A;  2EBP A;  3EG0 A;  5GJV B;  1JXO A;  2HBW A;  1SHG A;  2G6F X;  1JO8 A;  1AOJ A;  1T3L A;  4KRT A;  1RLP C;  2V1Q A;  2J06 A;  1U5S A;  2AZS A;  5L23 A;  2E5K A;  2D8J A;  1FYN A;  2EGA A;  1N5Z A;  2D0N A;  2M0Y A;  1XOV A;  2RQW A;  2CT3 A;  1Z9Q A;  1UUE A;  1SRM A;  2ROL A;  4FSS A;  4J9F A;  1AWX A;  1GL5 A;  2D8H A;  1BB9 A;  4EIK A;  1WLP B;  1UEC A;  1YN8 A;  2DRM A;  1QCF A;  2EPD A;  3JV3 A;  2JS0 A;  1T0J A;  1TUC A;  1WXB A;  2EVR A;  2DIL A;  2CSI A;  2KYM A;  1H92 A;  5FWC A;  1M30 A;  2OI3 A;  2K2M A;  3VS4 A;  1K1Z A;  1JQQ A;  1E6H A;  3U23 A;  2EYX A;  3R6N A;  1PNJ A;  3REA B;  1AZE A;  2L2P A;  2QDL A;  3VS1 A;  1WFW A;  3VRY A;  1W6X A;  1X69 A;  2DL3 A;  3M0Q A;  2J7I A;  1QWF A;  2CH4 W;  1GCP A;  4HCK A;  2C0T A;  4HVW A;  3QWX X;  2JS2 A;  4CC7 A;  2GTJ A;  4AFZ C;  3M0P A;  2KR3 A;  2LX7 A;  3ULR B;  3M0R A;  1X2K A;  2YSQ A;  2VWF A;  1B07 A;  2DYB A;  1KSW A;  2JMA A;  2XMF A;  3NGP A;  2VKN A;  1UFF A;  2P4R A;  3M0S A;  5IHI A;  4A63 B;  2O9S A;  4CC3 A;  4ZNX A;  1SEM A;  1SHF A;  2RPN A;  4GLM A;  4DEX A;  3VS0 A;  4LUD A;  4Y92 A;  1UHC A;  2W0Z A;  4JZ4 A;  4Z8A A;  2PZ1 A;  5IHN A;  2CUD A;  3PVL A;  1ZUU A;  2MCN A;  2O2O A;  1M3B A;  1AWW A;  2RN8 A;  2JTE A;  3O5Z A;  2F2X A;  1WYX A;  3TSZ A;  2BZ8 A;  2FRY A;  3UAT A;  1TUD A;  1SRL A;  2EYW A;  1H8K A;  2RF0 A;  1AEY A;  4RTZ A;  2DLP A;  1UG1 A;  4F14 A;  2B86 A;  1IO6 A;  2LCS A;  2J6K A;  1GCQ A;  1X6B A;  2A36 A;  2RQR A;  3KFV A;  4RTX A;  2CT4 A;  5HCK A;  2EGE A;  1QKX A;  3GBQ A;  4J9H A;  4QT7 A;  1X6G A;  2ABL A;  2EYY A;  2HCK A;  1U06 A;  2ECZ A;  1W70 A;  3CQT A;  3I5S A;  2LJ1 A;  3C0C A;  1CKB A;  2K3B A;  4X1V A;  1M3C A;  2ED0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...