3ULUF

Structure of quaternary complex of human tlr3ecd with three fabs (form1)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
217
Chain Sequence
QVQLQQPGAELVQPGTSVRLSCKASGYIFTTYWIHWVKQRPGQGLEWIGEINPNNGRINYNEKFKTKATLTVDKSSSTAYMQLSSLTSEDSAVYYCTRVGVMITTFPYWGQGTLVTVSAASTKGPSVFPLAPCSSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 217
sequence length 220
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uluF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uluF02
3MRJA 4PRBB 2QKIB 2GTZA 2HT4C 2YPLE 3PWJA 1AP2A 5EO9A 1MCHA 1NCCL 1NLBL 2CGRL 5D70H 5I1DA 5AWNL 3S6CA 5DTFA 3LS5H 1LO3H 3FO9B 4RGOH 4P2QE 4APQB 4M5YH 4OSUH 4HLZH 3V0VB 2A6JB 4LHUD 4WTWA 3VDBA 4ZXBB 1GL4B 1NGXB 1VADA 2AK1H 4UT9L 3DGGB 5DZNA 3TIEB 4K94C 3N1PC 1JPST 2V7HA 4J1UB 3GSVA 3CSYA 4UT6H 5T1KB 3LD8C 1WITA 3CVIL 3T2NL 1UCTA 4ERSH 4JQXC 1L6XA 1IQDB 4TNWK 3L7FA 1EH9A 5E6IB 1SYSA 1R3HA 3VW3H 4Z5RA 3ULUC 4XTRD 1CG9B 5LG1A 3KYOB 1GVIA 3MLTA 5CEYA 5IJVA 3ZDXF 4XPBL 5EB9A 4PBXA 5CMAA 4CMHC 5F7DA 1CD0A 4JEGB 1JIBA 3G04A 3BPOB 1AHWB 5MEPA 1U9KA 3T65B 2XG5A 3CJJA 4Z18A 3O6LH 1BIIA 4R7NA 5CBEB 5DMYA 1OQOA 1YYMH 1WWWX 4E9LA 3P4LA 1KEGH 2D0GA 3FO1B 2F58H 3BAEL 4ZFOA 4HQQH 2HWZH 1KXQE 1MCJA 1RZIA 2EXWC 2AEQL 3NBNA 4JHBA 5FCSH 2CIIB 3S4SA 4NOFA 2DS4A 5IEKB 3ARDA 4M6OL 2BOBB 4I3GA 2WUBH 5F3HA 1FYHB 4PJHB 3G5ZA 5DWUH 3MRHA 1S9WB 3T2OA 1I4FA 2NTSP 4J6RL 3VFTB 5KN5B 2JF1A 1B0GA 1P5UA 2X40A 3P4NB 1XIWA 3R8BB 4I48B 3WIHH 2ENYA 4FFWD 4LKCB 3S36X 4ODSL 3RVTD 3H9ZA 1QFHA 2HFFA 1EEZB 2LVEA 4J8RA 5AZEL 1OF2B 4FTVE 5JHLL 1T22B 3OJVC 4IRZH 3IXAA 4I0PA 3TO2B 3NAAL 3SOBH 5ACZA 5I8KH 5EORL 1RHHB 4R8WL 1P7HL 1EJOH 1AY1L 3DOSA 1ITBB 4PJ5E 1CFTB 3RI5F 4IRSB 1UM4H 3CVHA 3CX2A 2ID5A 1DBBL 1UKSA 3OKOA 4OIAA 2HVJB 2IALA 5C1MB 3LZFL 5E2TL 4QRTA 1EHXA 2ICEB 2K1MA 1OSZA 4L3CB 1NAMA 1Z9OA 3O4LE 4QNPF 2DI8A 5FYKU 3AXLB 2VC2H 3GMPA 5DGRA 1ZGLB 4IS6A 3LS4H 4P5TC 1KOAA 1ZT7B 4HPOH 4MJIA 4X8JB 5KOMC 5B8CA 3BT2H 3HMXL 1CFVL 1TZHB 4PJGE 5DHYA 4KU1A 2FO4A 4PJ8D 4ZFFB 3FOLA 2NYYD 3U83A 4I3RH 2ZJSL 4KQ3L 4S1DD 2XRAH 3O2WL 2N4IA 2DQUH 5SV4A 2Z9TA 2RIKA 5T3ZH 1ND0A 5H2BA 2VLME 1OP3K 1FPTL 4PJXB 4Q9CA 3NN8B 4I5BA 4MCZB 5IROA 4M48H 4OGAD 2IH1B 1F4WH 3IJYA 5INDA 3KPQB 3BZ4A 3FT3B 2J6EH 5EU6A 3MBEC 5CEZD 4OZHE 1NC4B 3DARA 5DC0A 3UTOA 2K7PA 5D1ZA 4D2NA 5EUKA 3OAYH 5BV7C 4D9QD 1PGRB 3IFLL 4ONGH 3V8CA 3D3VD 2I26N 5CP3A 3BRFA 1FN4A 5T33H 4YHNA 3ILPA 3K4AA 4HT1H 5DJZA 4LF3B 1W0WB 2IQ9L 3WFHB 4I0PC 3AY4A 1NDMA 3ARBC 4PGJA 5H37H 3LQZB 1KPVA 4OLYL 3QEUB 4X6CF 1A7RL 5DC4B 2A77H 2EKJA 4KFZC 3T0VA 4NGHL 1YA5A 5EBMB 1N8ZB 1RZKL 4G7YL 3UC0L 4D94A 2E6JA 5DS8B 2P7TB 4OIBA 4AENA 2O5ZH 5DMGD 3T4AB 2OX5A 4JRXA 3G5XA 5J3HD 1LNUB 3NGBC 3MUGB 3NFPA 3ABZA 4NSKB 5EC2B 3MYZA 5I8EB 2DM4A 3BW9A 4ZQKA 1KC5H 2PW2B 4N1EA 3IJHA 1WVZA 3K7UA 4Z7WF 1OB1A 1XGPB 3S3SA 3SDAB 3HRZB 4AH2B 5I75C 2VLKA 3IKCB 4RFOH 4U31A 5JHDE 1F90L 3L5HA 3B2VL 3PP4H 3I50H 2NY4B 3DX9A 4H0HB 3GM8A 2DWDA 3TNMB 2VDLH 2QSTA 3FT4B 5IROC 1GYAA 1UXWA 5H94A 4F2MA 5T1DH 5CD5D 2P47B 3E2HC 5IHZA 2C3XA 4GW1A 4ZDHA 1IGFH 2E7BA 1AFVH 2BNRA 4LARH 4OFIA 1P6FA 3D25B 4POYA 4UUJB 4G9FD 3U6RB 2V7NA 2WLZA 3HG1A 4NQUA 1A9EA 5IVXB 5DVKA 3F7VA 5I76A 1G7HB 4F7TA 2G5RA 2QADB 1YEFL 4LCYB 1LVEA 4H20L 3T2QA 4LVOB 2XIDA 4KC3B 1U8KB 1KYOK 2YN3A 4M7KH 3MLWH 2AGJH 4EN3A 1NGPH 1HHKB 4OF6A 5HI3C 3QDHA 5KVEH 3U0WH 1KCUH 2QQLL 4AL8L 1EV2E 3E6HA 4TUKL 2DBLL 4LL9A 4KV5F 2X4SB 5IBTL 1Z0MA 2OK0L 2NY0D 1RIUH 2GUOB 1S7SA 3V52L 4I18B 2JELL 4IIQA 4PJIA 5LGHL 2D31B 3AY4C 3ELAT 2VLJD 1KCSL 3ARFD 3GSWB 4CW1A 3BN9C 5GRWA 2F53D 3MJ8A 3BIKB 5HVHB 5GRVK 3SDXF 3D87B 5DURB 1R5VB 2EH8H 3OKKB 1P7QB 2AVGA 5DUBB 2GJ6E 4FABL 2YUXA 4N0FB 1AO7B 4P2CG 1UZ8A 4KPHL 3CCHB 3O6KH 3MYJA 1VB9A 2B5IC 4X7DC 2QL1A 3MBXL 4HF5L 4YPGA 5GRXG 3T0XA 2G5BB 2R1XA 1INEH 1BVLA 1NEZB 4WWID 1O0VA 2QQKH 2ZOLB 1VCAA 3E3QC 4MJ4A 4D3CH 3FFCD 4D0DA 1XCTA 1KIUA 1WAAA 1NQBA 2HJKA 3ZTJG 4RBPH 1H3GA 1LP9A 3H9SE 4FRWA 4XP9H 1RMFH 4P2RD 3G6JF 4MNGB 4LLVA 4LHJB 3VWKD 4AIZA 2Y72A 3NOIA 1KUMA 4MA3B 3IF1B 5DGQA 4YNYB 5BS0E 2AXHA 1QNZH 5CZVL 4XNXH 4OI8A 4P0DA 1HDMA 3MLSL 3H9HB 5F70A 1F3JA 4ZUUB 1RJLB 4S1QL 2Q76A 1ZGLP 5AD0B 1X5XA 5EU4A 2IFFH 1IBGH 4KROD 1XGUA 4F9PC 5GGVL 3PP3H 1FYTB 4NJ9H 5B39G 3RGVB 1BBJB 5HHNA 4X5WA 4MVBD 5ICZA 4NQCB 4JFYA 5K59E 1MCCA 4EN3C 4E0RB 1BOGB 4ONHB 4XVUD 5ALCL 4B7IA 5I73B 1EEUA 1IGML 3RWCA 5ESQB 5JOPD 1QZ1A 3DRTB 3QQ9D 5IB3A 1JCKA 1MFEH 3QH3B 3KYMA 1PLGL 1G7LA 4IIQC 5IESL 1Q9KB 4FQLL 1CGSH 3D39D 3CDGA 3FQWA 3PV6B 1JWUB 1S7RB 1UM6H 5TQ2L 1DCLA 5D2NB 1QQDA 7CGTA 5IB2A 4PJDB 3NH7L 4HJGB 4JPWL 1WZKA 4YK4B 5F9JA 2ESVA 1ZS8A 1HHIB 2KZ1B 2QQNH 1KJ2A 3KDMA 2ADGB 3QP3A 2EXWD 2DRUA 3IETA 4MAYA 2RR3A 3TYGH 2AJVH 2BVTA 4MAUL 4QHKI 1W72L 3MLUH 3RL2B 5K9OB 3TH3T 4YHMH 3LMJH 5INCA 3L5XL 4HKBA 4PY7B 5C9KA 5K9JL 3FO2B 1J0HA 3BKCL 5D7JC 1HHHB 1MCOL 1ZKAA 5I16A 4UB0H 4OZ4B 1NAKL 4NO2B 4BQCA 3EZJB 1EVTC 3I6KB 3MA7A 4ZUVA 4ODBD 4XNQB 1AKJA 5JPNA 3FN0L 4OM1H 2JB5L 4OLVL 4NFDA 4GAJL 4OFPA 1FDLL 3MCKA 5DEZA 1I9IL 4OV5A 4HCRL 4QEGA 4QGYA 4X6BB 4OBSA 1A7QH 3O2DH 1ONQA 2ATKA 4GAYA 5H35A 1Z5LB 4ISVA 4OT1H 5C0FB 3RWFA 4LLWA 5SWQA 2PR4L 4JFEE 3HE6A 5M95B 2XKNB 4XPTL 1C5CL 3LKPB 3MV01 2AJXL 4OFKA 2Z93B 4O00A 3OKLA 1MNUL 1A1MB 2P24A 4XI5C 2OP4L 4K94H 2AAVA 2Z4QA 2PYFB 4HWUA 4YDVA 1KTDB 4MD4A 2Y25A 4CRPA 2AKRB 4KTYA 3U0TB 4XVJL 1BF8A 4MCYB 4MNQA 4OZFA 2JB6B 1U3YA 3F12B 3ULUH 1SEBA 2IADA 4JHWL 1U8PB 1GAFH 4P5TD 4J3XA 4Z95H 4F33B 1U0QA 1X5ZA 4R2GC 4YDIL 3G6AA 3B5GA 3VFGH 2QV2A 3QFDA 4QXGL 3GIVB 4LVHB 3I6LD 2HP4A 1N5AA 1BQHA 5D8JL 1CZ8L 4U0RB 1FFRA 1K2DB 4ZAKA 3VH8G 4WDIA 1LGVA 2EKSB 5HI5C 3JV5A 4FN0A 1DL7H 2VAAB 4KDVA 5I1HL 3DVNB 2H32A 1IC1A 5DHVB 1T2JA 3NACH 3ZTNL 3OAZH 1SJEB 3GSRB 4CVZA 2E27H 4UTBL 5F21B 4PJGF 3CFEB 1J1OL 2I60H 4J3WA 5D7LD 3B9AA 5E1AA 2BMKA 3WV0A 4EI6B 2Y07H 2ICWJ 5J89A 1IGCH 4R26L 3HE6C 3HLAA 3REWB 4OZHF 3A6OA 1B6UA 4PRAA 2L0DA 1HKFA 4OCYL 4HPYL 4JM2C 1UWEL 8FABA 1WWCA 3NVQA 5IOPA 5C0BB 1YY8B 3MJGX 1CGVA 3SE9H 1U8NA 3LN5B 4KJPD 4CL7A 1YNLH 3A6BH 5K93A 4ZD3H 1HH6A 5I6XB 1A1OB 4XC1H 3GSQB 3IGAB 4M5ZL 4L4TA 3OGOE 3SJVB 3C60A 2R0ZL 5C3LD 2HMIC 4FNLL 4YXKH 1NSNH 2VL4A 4OIIH 1RZ7L 5HYJE 3L5JA 5HHMD 3WFEH 2X4RA 1KLGA 2X2YA 5HHQB 3F7PC 1T5XB 3FMGH 4ORGB 4PUBH 5C0EB 2YWZA 2LABA 1JGVL 2BDNH 3UZQA 3HZYB 3KWWB 3UYRH 3ULVC 5IGXH 4ZAKC 3PNWA 4P2YA 4ZSOE 1X4ZA 1T3FA 2XFXA 3STZB 1I7TB 3QDGB 3DUSB 4O5LH 3H0TA 5E8EB 5DMIL 2FIKA 4AM0B 4KZEH 4JJ5A 4NT6B 4LRNH 4M1CD 3FJTA 2QSQA 3I3BA 3M17A 5JPMA 2EDKA 5TF1L 4LMQI 1GHFH 1EZVX 2YZ1A 3MRRA 3EOYG 4R96B 4X9IA 3LKOB 4GW5B 5BV7H 3GSNA 3N9GH 2DQCL 3C08L 4JJHA 2G75A 1HINL 1OAYL 3TVMD 3GBNL 3QWOB 2J12B 4V1DB 2YA0A 2HTLD 4Z0XB 3QG6B 4DWHA 3MRFB 5BO1H 4DGIH 4FXKB 3FB5A 3RAJH 5LKNA 2VLRB 3FO0H 1ES0B 3DUUB 1A9BA 4H26A 3BD4A 5BVJA 3MROA 4IOFC 1NCWH 2DQFA 1YEJL 3ZSTA 4NCDA 2F74B 5D1XB 1XR8B 1SEQL 1KB9J 4PJHE 3N06B 4Q97A 2C1OB 2DLFH 3HI6L 1VGKA 4QCIB 4Y4FA 5I30H 5JLZB 4GG6B 1CFNA 3MV8A 1MHHB 1HEZA 4UDUA 5FUCC 4QOKB 3WXVH 4XBEL 4X9BA 4L1DA 2DQIH 1QSFD 1VERA 1F3RB 3MUZ1 3DX6A 1MPAH 1NAMH 4JY5H 3C60C 1EO5A 2NXZB 3D0VA 3JUYA 3UCRA 4ALAH 1FL5B 3HZKB 4C4KT 4Q9QL 4HBCH 1WLHA 2JJUA 4JFHE 2EDYA 4KRLB 2ATPB 3T0AA 4JQIL 4JO2H 4WJ5B 1JRHL 1FL3B 2WWKT 4S2SB 1ORSA 5KTEH 3QEHB 3TNNB 4WWKB 3HZMB 1DQDH 3EHBC 3MV7E 4J4PD 1CDUA 1YQ2A 1MI5B 4K7PL 2MPAL 4ZOAA 2CKBB 5DMKA 1TNNA 2WINA 3MRPA 1FC2D 1I8IA 3GMMA 3MRQA 2CRYA 1GJIA 2A9ML 1P4LB 4TNVK 1CICA 1BVZA 2VR4A 5DJAA 1HQ4A 4IHOB 5D9SB 2RFXB 2QKIA 2VIRB 3O2VL 4LSDA 1WFTA 5CP7B 1V05A 1B4JL 3I02B 4M62H 4OCRL 4PJXE 2FB4L 1ZT1A 4LLQB 3WO4C 4RISL 1RIVH 1M71B 5ITFB 1KPRA 3U9UB 1MCIA 3NIFE 5FEBA 1BZ9A 2YD2A 4LNRB 1YNTA 4RMWA 4QWWD 1OSPL 4U33A 3NIGE 3L3GA 1WFUA 3KPRB 4D8PB 3HN3A 4FQJL 3WIIL 2VQ1A 5K59F 5EU7C 4WW2B 3PWNA 4OD1L 4HIIB 3X11B 2GI7A 3MNWB 5IB1A 4YHPA 5MP6L 1U6AH 5C71A 4JKWA 4POZC 1NCBH 3Q5OA 1J7VR 3KYOA 5CEZL 5JUEH 4PGEB 3S3JA 1AQDA 1OGAA 4XZUB 1AGCA 4WIQA 3TJHC 5C0AD 5IEHB 2NR6D 3P77B 5E00B 4JANB 4NQDD 3E1F1 4KVCL 2MMXA 5BRZE 1KELL 2W38A 2W60B 4XCCH 1E6OL 3RPIA 2VDNH 1K4DA 4U2ZA 4JVPA 4YBLC 4JVUA 5ADOL 1JYVA 4O4YL 3QRGH 1I1AC 2RJMA 5EUOB 3EGSB 1T0NB 3BYYA 1T0MA 4PV9B 5LBSH 3S3PA 1R3KA 4PRNB 5IEKA 1JTTA 1IM9A 5EZOL 3WHXB 4RIRB 3RP1A 1T21A 3QEQA 4QHUA 4Q58C 2ZNWA 3BWAA 4FQQB 1S9WA 4H88H 1OTTC 1A2YB 4U6XA 3O6ML 3MRNA 3S37H 4KXZH 4PRIA 4WY7L 1EEZA 2Q8AH 3RTQC 5CEXB 1CE6B 1GIGH 5DYOB 4P48A 4KUCD 2YC1B 4QXUH 3SQOH 4Y4KC 2XNAA 4FQHB 3D2UA 2Y36L 1SYVB 1RHHA 3MRMB 4HS8H 2NZIA 4RFEA 2AI0H 3THML 4IRSA 2C1PB 5KS9B 5TE7H 1MFAL 5IVXE 1RUKL 2CDGB 2F15A 3TCLB 1D6EA 1IGIH 4O51B 2VN4A 2OJEB 1QR1B 2YN5A 2W9DH 2IBBA 3SKNB 5TFSL 1SJXA 4LAQH 2UWEB 3BPCB 4GW4A 4J2XA 1NC2D 5DHXB 4G6AC 4LLAA 3E6FA 1PAMA 4XXCA 4OCSL 1S7TA 2MWCA 1QRND 5HI5D 4LIQL 2KPNA 4AEHL 2I24N 3P73B 2P5EB 2OQJA 1NGQL 2JIXB 2X70B 2X42A 1FNSH 2W65A 1X6LA 1HHGB 1NFDB 5HGHA 1XGRA 1H3UA 3SY0A 4ZMAT 3MJ7B 2GIYA 4GXVL 1JFQH 4X6DB 5KANI 1F11B 4PY8J 5E9DD 4KGLA 3P0YL 3SDCA 3IFPA 4LNVA 4XCEB 1IQWL 4XCYA 4M8QA 1D5BB 1CI5A 4MCZA 5HYSB 3UTSA 4ZOBA 5AYQA 1WT5A 1DUYB 5L88H 3VD4A 3DUHA 5E94B 1ACYH 4EUPG 1DBJH 1IEBB 1OGTA 2MOVA 3VFWA 3RUGB 1PKQB 2NW3A 2VERN 3TN0B 2RCSH 3QIBB 3UJJL 4DN3L 4JM2D 4MA1B 4S1SH 1Y0LA 2CKBL 5C07D 1MRCL 4Y1AA 4GRWH 5EOTA 1U8MA 3VXRA 1R5IB 4MNGE 1KLUB 4L9DA 2DTML 1W0WA 1DJSA 3IDGB 2B4CL 2MCPL 2HKHL 3KYKL 1ZHBB 4FFVD 3GNML 4ZUTB 3PXJA 5FKAB 5E8OA 1QFWL 2HMID 2BNUB 1UEYA 1X5HA 2NZ9C 3CZFA 1ED3B 3C6LC 1FYTE 4PV8B 5GRUH 5DS8A 5EZLA 4MLSA 5I1JH 1RQ5A 3BE1L 4NJAH 3ZKSD 2CXKA 3KPPA 3EBAA 3QUZA 1GSMA 4MA8L 5CSZA 2HH0H 3LIZH 1K8DB 1DLHB 4GBXC 3BESR 3RDTA 1KB5A 1WZ1L 5F7EH 1E4XL 2H6PA 5E5MB 4JO4H 2AABL 2YRZA 3RWIB 4XBGB 2DWEB 1ZEAL 4FQXA 1IAIL 5ETUB 3EW3B 4QTIH 4AH2A 4PLNC 5CGTA 2PUQT 5D2NE 4JFQB 1WSST 2HJLB 5GS1A 3TGXA 4PJDE 5DVNA 3D18B 3NFNB 5D96B 1FFQA 5EIVA 3ZHLA 1HN1A 4GLRH 3TNMA 1FL6B 4KK9C 3VD3A 4X80H 5DEGA 4OD3H 1GCFA 4X6CA 2IEPA 2CK2A 3E8UH 4O2FB 5EWIH 4N5UA 4PJ9D 1U91B 5F7MC 1Q38A 3C5JB 1CLZL 2AJYL 1PZ5B 1KN2H 4LCYA 1YEKL 1U8KA 4NPYB 1TQBB 3BJ91 3BZFA 1TVDA 1QOKA 4ETQA 4YXLH 2MHAA 5JMOC 2Z31C 3VXUB 4NZUL 4G8GB 1U8IB 3O6FD 5A3ID 4M1DL 1OAKH 4PLKD 3B4NA 1G6RB 4LQFL 1U3HA 5MEOA 4I18A 1ZVSB 1RZGA 2WIMA 5E2WL 5C6TL 2D31A 4Y5XA 5C08A 1AE6H 4WUUA 3O81A 5F7UA 3GSWA 3WFCL 4FXLA 3PIQA 2V5RA 1LO4L 2EH7L 2VR5A 1KN4L 2W0PA 3QG7H 1R3IL 3GMOB 1IAOB 3MA9L 4LBEB 1ZHNA 1SJHA 2A1WH 2O5YL 1FJ1A 1P7QA 5DUBA 3BKYL 1AO7A 1S3KL 4ZFZB 1XF5B 5IQ7L 1AI1L 5KSAB 4PJHF 2P5WD 3QUZC 4X4YA 3RZCA 2R0KH 1TCRB 1U95B 4I4WB 2OLDA 4JZJA 4LLYB 4M7JH 5DQJB 4EI5B 1JZ8A 5B38G 1LEGA 2O26U 1NEZA 1KG0A 4M7ZC 3TIDB 2D7TL 3L1OH 1QEWB 1LO5A 5CSGA 4HIEB 3PP3K 4MNHB 3V7AG 4FQXC 4FZEL 4LU5L 4JRYD 2M8XA 4X98A 1VKXB 3RL1A 3WKML 1JBJA 2ORBL 1NGZA 3QUXD 5IR1B 4YHYC 1K4CB 2MNUA 4F80A 3CX5J 1AGEA 5GGVY 5ECJE 4WFED 4F7PA 1ZLSL 3TZVA 1M6OB 1E4XI 5ENWB 1RJLA 1U8OA 1SY6A 1AR2A 4F7CA 4JGMA 4PG9A 1CGUA 5BZWB 5SWSB 2XN9D 2EYTA 2WZPD 2H26A 3RGVA 1BBJA 1Q9WB 2XZAL 3L5WA 1A5FL 2AV1A 4NQCA 2A6KA 4L4VB 3W2DL 4L3EB 5E4EC 4YO0A 5CINH 2HJFA 5ESQA 3OB0H 3DRTA 3RA7L 3VGDA 2BHUA 2BNQD 4PG2C 1H5BB 3QBTB 4EVNA 3C5ZB 3FB7B 4Y5XC 1FO0B 1BAFH 3QHFL 3CFBB 5ANMB 5HPMA 1SMOA 1I8LA 4PJXF 1Q0XL 3TJHD 5DJ2A 2VAJA 4E5XB 4S11A 5I1LA 3NIFF 3AS0A 1BGXH 3PHQB 4P5MA 2A74B 1QACA 4FQPA 4JFFB 3L6FB 1FZOB 3ORJA 3MC0A 3ROOB 1CTNA 3NIGF 4ACPA 1P7KB 4LSQH 4AYFA 4ZYKA 2Y6SC 1L7IL 1HE7A 4P4KB 2XTJE 3VCLB 3GM0A 3GFUA 3ARGA 1N2RA 1I1AD 2DB8A 3DMMC 4N8PA 4KZDH 1DSFH 4Y16C 4CDGC 4K3DL 1I9JH 3T0EB 2EYRA 3NIDE 1S5IL 4QHLA 1MSPA 1NL0H 4KKCD 1EMTH 5CEZE 3ZHDA 4Y5VA 3EJYC 2C4XA 3RL2A 3T4YA 2BVYA 4UMGA 3S35L 4K7FA 4D9QE 3X3FH 3FO2A 3SJVE 1BFVH 1OTTD 1G7MB 5HGAB 5E99L 3VXQA 2CMRL 3LKNB 4OZ4A 2GK2A 1FVDB 5EA0H 3I85A 4TPRH 3REVA 3KPOA 3P9LB 1S78D 4OQ1A 2VZUA 4OTXH 1F13A 4K2UH 2XWBB 4WTZA 4UAOC 4PJCE 4M8VA 3TZVC 4Y4KD 3VXMB 4G6ML 3WFZA 2VZOA 4KJWD 4R4FH 4RCAA 3S7GA 1GXEA 3HRPA 4JG1H 3QFJD 4P57B 4Z7VB 1XF2B 4FQ2L 4CU6A 1WCBB 1Z5LA 1JGLL 2IC2A 5JW4R 3BXNB 1JPFB 1MJUL 2XKNA 3DX8B 1KBGL 3AS2A 3MFGB 3GHBL 5DA4A 2OTWA 1RY7B 3LAFA 3QUYB 4CN1A 3M8OH 2E3VA 4CUCA 1A1MA 4G6AD 5DMJB 1Q9OB 5FUOL 5FF6A 2H41A 2RQ8A 2PYFA 3LQAC 1M7DA 1KTDA 1HCVA 2DQTH 2AKRA 1C1EL 4DGVH 3JV0A 1OTUD 4IRJB 1QTYT 1I8LC 1BEYL 5F88B 2PN5A 1U8PA 4OGXL 1U58B 5FGSA 4PLOB 3GIZL 1QLEL 4F33A 3MTRA 1J8HD 5J1TC 4U3HA 1N3NB 2YD6A 3GDBA 1AQKH 5EU3B 4W81A 4CNIB 4D0CB 3V5HA 4MQTB 2CJUL 2V5SA 4KUZH 2ZWLT 1NJ9A 1V3KA 3H42L 5EPMA 5IMKB 25C8H 3HNSH 4LIQE 4R7DB 4YIQB 4GG6E 1CF8H 4QRRB 1RJCA 3BP6B 1AIFB 5IBUB 3TBYA 3GI9H 4GMTH 3LN9A 1LO0L 4WUKH 2WBJD 5L2KA 3CPLA 3MODL 2DYPB 1KACB 4UZGA 3GSRA 1ZLVK 3WDHA 3MRIB 2X44D 2EDDA 3QO0B 5I1IL 4UILH 3WEXB 1UACH 3LRSB 5HVGB 4DOHE 1KJVB 1DVFD 2F8VA 2PO6C 1TVHB 4YDLC 2AEPL 2VLJE 4I8DA 1U42A 4XNYH 1UJ3B 2AK4A 1A7NH 4EI6A 3R06B 4XWGL 1YPZB 1FAKT 4NHUA 4PGDB 3REWA 2XPGA 1YQVH 3T0BA 4KMTL 3C6LD 1FAIH 5J13B 3GGWB 3QYCA 3U79A 1Q9LB 1YMMA 4KTEL 5GS2H 1ETZB 3VU2A 3VFRB 4DEPB 3IXTA 2Q86A 4KRPC 3OPZH 1L6ZA 1DFBL 1Q94A 1UCBH 1P4BL 2HVKA 2AQ2A 2CDEA 2VE6A 4GKNA 1IGYB 2UZIL 3LN5A 4L29B 2V2XA 4Y4HA 5GS0L 4NCC1 3WLWD 4GBXD 3EFFB 3FFDA 3GMQA 3FQRA 3HC3H 1A1OA 3GSQA 3IGAA 1FNAA 5JIIA 1BWWA 1EBPA 2NY7H 1T5WA 4OCWL 3WN5B 3O3EA 2B39A 3EOTH 2DD8H 1JNLL 4NHCL 2BHZA 4LPWA 3BGMB 4N9GB 1X5AA 1ZT4B 1BX2B 1T5XA 4X0KA 4KY1H 5C0EA 3OB8A 5EFIB 3QR2A 3GJFA 5GSRA 1K5NA 5EO1A 1OAQH 2BY2A 3O3AB 2NY1C 1N0LA 4P23A 1TTGA 2BX5A 3FT2A 1OPGL 1UKQA 3ZZ1A 3IJSA 1QKZL 4HD9A 4YHLL 1LDSA 3PQYB 3MLXL 4A6YL 2NQCA 2EIZB 3CU1A 3VFPA 4X7TA 4NKMB 3HNTL 5EH1A 1S9KC 4BZ2H 4UIMA 1NBVH 2ADFH 2PXYB 2IPUG 4FQ1H 1D5MB 5HHOB 3NCEB 4JB9L 1MFDL 5DD0L 3Q1SL 3V9FA 4W68A 3CZJA 1LK2A 3C6SB 3SO3B 4FOMA 2J8UB 3P40A 3RWGB 3W39B 4OQTL 4PJDF 4YEEA 3F58L 2J2ZA 3AU1A 4PJFE 3QWOA 4V1DA 3D39E 5GGUA 3CDYA 5IF0B 3VXSB 1RJZA 4NM8H 4U6HB 1N6QL 2EYSB 2IAMD 5EUOE 1ZANL 4BKLA 3HAEB 3D85B 4X83A 5LGKA 1TJGL 3QEGH 1PZUB 1ES0A 4LOUD 2F54B 4LSRL 4H25B 5E08L 4MXWH 3C2SA 3D9AL 2H1PL 2VRAA 4OLEA 5MEQB 4GSDH 3TO4B 3BEVB 1JF5A 1Z9MA 3FQUB 3G9VA 7FABH 2IPUK 4M6NH 2WUCH 1BFSA 4BZ1H 4LPTA 1FG2A 5HY9B 2UY7A 3WDJA 4Q9RH 4JVWA 4XRCA 1HXYA 2KL6A 1DLFH 3X3GH 3K3QA 4KHTL 4Z7UA 3NCJL 4CBPA 1XCQA 4JDVB 3KR3H 3V6ZA 1LE5A 1CDBA 4DVRL 5HGGS 1FL5A 3HZKA 1A7OL 2QBWA 1MAMH 2EE9A 2ZG1A 5C0IB 4G3YH 1NDGA 4EDWH 1QPXA 5GGTL 4GKSB 1NMBL 5F7WC 3GBML 1DBMH 1FFPB 3R0NA 5TGBA 3DIFB 4NQSA 1BD2B 4XB8A 1OLZA 3GI8L 4OFYD 1OCWH 1GZPB 4G6KH 3DURA 2VZ1A 4K7PY 3A67H 3DTXA 4WJ5A 4Z7OE 1EHNA 2UWEE 3OX8A 2L7JA 3BQUC 3P11H 5GGRB 5FFLA 3F8UB 5FUZH 3QEHA 3TNNA 2XWJB 4K8RC 5D6DA 3VFVA 5ERWA 3ZKXC 4TSBH 1CWVA 3MUJA 2CUHA 4QRSB 3FONB 1ZLUH 4JFDB 3NPZB 4PRPE 1U8HB 4BK5A 1P4LA 4KI5D 1IE5A 1A1NA 5IMLB 3DXAB 4IHOA 3MLYL 1RU9H 4OZGB 4H0GA 4Q6IB 5A2FA 1RK0B 1EFXB 2DJSA 5H8DA 1ZWIA 5ITFA 1AGDA 4L5FH 5T5NG 4B41A 4GKZB 1H15B 5E70A 4YAQB 1IEAB 4RGNB 5ICXA 2J88L 4FMKA 4O2EB 4F9LA 4NYLB 5FKPB 4EOWL 1E6JL 1PKQE 1BP3B 2DQDH 5SX5H 3RUGE 1BFOB 3I6LE 4WW2A 3SDDA 4H5SB 4YDJB 4PJEB 2IAND 1M05A 3MNWA 3DMMD 2P8PB 2VXVH 4KAQH 3RBSA 2GJJA 4Y16D 5D71L 1S9XA 3QNYA 3VXOA 4MS8D 5KZCD 4OM0H 2X41A 3BX7C 2PTTB 4OUUB 4DJMA 4RWYL 4PP2B 5FV2A 2YUVA 1ZA6A 3C2AH 2ADIA 1N6UA 4I77L 4Q2ZA 3NTCL 3OXRA 3F5WA 5MI0C 4GS7C 3QDMD 1IEHA 5HDQH 3HUJE 3KS0J 4EIZC 1KV3A 3ESUF 1B0RA 3BDYL 4KK5D 2OI9B 2XA8H 5JOEA 2QSCL 1G7PA 2B1HH 4JAMB 3BO8A 4MDIA 4RMQA 3S98A 2BP3A 3NIDF 2R9HD 2ZCLH 3QULB 3MZGB 4GAFB 4CU7A 3QIWC 2AERT 3AB0B 4FQQA 2NX5B 3UO1H 5CJ8A 3BD3A 4Z7NE 3FL7A 1A2YA 3MMEB 5FHBH 3UTQA 2ADJA 3ILQD 1XIWD 1S9VA 3Q2CA 2R4SL 1MCWM 5DJDB 1K6QH 1UB5B 3LHPH 5ISZD 3O8XB 4F57L 1CE6A 5DYOA 1G84A 4PBVC 5I0ZA 2YXMA 4M3JA 3EDJA 4P3DB 2MKLC 4PJCF 1M7XA 4CMMA 2C4FT 3IDYB 1NFIB 1U8LB 1SBSH 2C1PA 5EU5B 1J0ZA 4F9LC 5I19L 3TCLA 2OJEA 2VITB 4NQEB 4XMKL 3SDDC 3KPNB 5JTWA 4LEOB 5FA3B 5B3JE 4OLUL 1KGCD 5IQ9A 2F9BT 1WUNT 1K85A 3OKNA 4ZS7L 2P44B 2NY2C 4PBWD 3T0WA 1R3JB 5DI8A 4P4RB 5D1QC 4Y19D 2X7LB 5JORA 4OI9A 1OW0A 4I9WD 4WI3A 5DF0A 5L9DL 2AXFB 3WUWB 3KPSB 1X3DA 2HT3D 4XPGL 2MSPA 1AXTH 3NZHH 4HC1H 1SM3H 4N8CL 1KFAL 3OJ2C 1HHGA 1B2WH 1NFDA 4HJJL 4PREA 2X4OA 5TDNB 4O02L 4HWZA 4MJID 1Q72H 1CXHA 1A6WL 4X6DA 4ZODA 5IBLC 1S8DB 4XAWH 4X9HA 1FVCB 4GMSL 3HE7A 4XCNA 3SGEH 5BOZG 2YPLD 3AS1A 2PO6D 4XWOD 4XCEA 1EHLH 3S36L 2VL5A 4JZOB 5HYSA 5I71B 4HXBL 1XAUA 4P2QD 3AVEA 12E8L 2WW8A 3ZMRA 1JUFA 1WBXB 5ID0B 4NZRH 1JPSH 1IEBA 4XPAH 2DQJL 2A9NH 4JFEA 4C83A 3OF6D 5C0CD 3N1QC 4AK1A 5ILTL 2KUTA 3P30L 1QSEB 3UAJC 4NWTH 4F58H 3TM6A 5C0NC 4KWUA 4WGWB 3QHZH 1ZHKB 2BSSB 3PGDA 1KLUA 4HK0B 2YPKB 1C5DB 5LWYL 1CT8B 4UT7L 1QSFE 3LEXB 2HLAA 3LQAH 4PRHB 3RX5A 3PWPD 2R0LL 3K2UL 4HFUH 3ZL4H 2CPCA 4DK6A 2CLVA 1RJYB 5FKAA 4NC0B 2VC2L 3MNZB 3AM8A 3LS4L 4DZ8A 3W0WB 3BHBA 3F6IA 1ED3A 4HKZA 3DRQB 1MHCA 1W0VB 5MENB 1KT2B 3VFSA 5BOPA 1ZK9A 4HS6B 4L4VE 4MHHI 4L3EE 3HCVA 2FD6L 2P8LA 1IFHL 3W5MA 2NY1D 1I7RB 1OW0C 5HBBA 3PWUB 1MRFL 2ZOKA 1LEKA 3VFNB 3GO1L 3OGCA 2BY0A 2IG2H 4Y7MA 2JCCF 4OZFG 1XGTB 4HMCA 1DE4B 4C56A 4ZUSA 5BZDA 1FV1A 1P9MC 4U1IA 2B7DT 1X5JA 4YLQT 1PEZA 3V4VL 5CJ5A 1HWHB 2IGFH 1PW3A 2DMBA 4UNTA 5ANME 4XBGA 3RWIA 4HG4J 3C9NA 1EO8H 2DM7A 4ZUWB 4MA7L 1DQMH 3D18A 1UH2A 2GSGA 3DSFL 4O58L 4WRLA 1LD9A 1MIEL 4GRLC 1W0YT 4N5EC 4XH2B 1MF2H 4FTVD 1BPVA 1LWRA 1MJ7L 1DBKL 2HT2D 3VG0H 3QIUB 5T5FL 3GK8H 4NO0A 4J3VA 4O2FA 1QLFA 4XMLH 5EBLB 3T0EE 1MHPH 3DPBA 4Z78A 4PJ5D 2DAVA 1PZ5A 5MERB 3ZDZF 2X4TB 2XQBH 5LJYH 1OAXL 3DVGB 1TPXB 5DJCA 1FVEA 1INQB 1P4IL 2FR4B 2WV3A 3VXNB 2PYEA 3VXUA 4G8GA 1U8IA 3IFOB 4MX7B 1G6RA 4LEXL 1GRWA 4X7SL 1V7MH 3IU3A 5HYEA 3O0RH 4HGKC 3O4LD 2ARJQ 4NP4H 4PJFF 1S7UB 3B9KA 2FH6A 4CU8A 1HQRA 5JQ6L 3AM8C 5EUOF 2NTFA 3MV9A 4Z7VE 2GITB 4KK8C 3GB7B 4UQ2B 1T4KA 4IMKA 5HYJA 3SGJA 1AXSB 2W9EL 3LN4A 1I8MA 4LSSL 5T1LD 3VWKB 5C9JA 4ZFZA 4X6FB 5C8JA 4DGYH 1YECH 4XC3L 1FNHA 2VLMD 3PL6D 1UYWL 3ZYOA 5TF0A 3BQUD 4TRPL 4GQ9H 1R0AH 4YR6A 4I4WA 4U1KB 4LKXB 1AFVL 5DXWA 5DQJA 2O5XH 2W91A 1AJ7H 4Y2DA 1HILB 1R3LB 2JK5B 4DKEL 4F8QA 5DDHA 2G9HB 5CLTA 3L95A 4MNHA 4XMPL 1MVFA 1FLRL 1FZMA 1JN6A 2FLBT 4LASH 4CN6A 4L8SC 5ACMA 1YDPA 4P2OB 3VMPA 5LCVH 3LD8B 1DQJA 2NY3C 1D5ZB 3GMNA 1K4CA 3OB0K 4XVSL 5KJRL 1UM5H 3O11B 4L9LA 5SWZB 4M3KB 2YEZA 3VFUB 2VDRL 5IIEB 1E28A 3OKYA 1M6OA 5KSBB 3N0PB 4HGMA 1YYLH 1IGJB 2UWEF 3QDJD 4G5ZH 3WLBA 5IHUL 4CMHB 5BZWA 1A0QH 5BW7C 4M1GH 5F6HJ 5HGDB 5HD8C 5DRNB 5E6YA 2CD0A 2GT9B 4M7LL 1JHLL 4JM4H 3EIFA 3MOAH 5E4IA 5CJQL 5GZOC 4HWBL 1VPOH 5EBGA 3O6KL 1CGYA 3A6CL 3HI1A 2YPVH 5DVOA 1QRNE 1PG7X 5EOCH 3WHE1 3C5ZA 2DMKA 3VJ6A 3FB7A 5A40E 1FO0A 5CGYC 2ICES 4Y8AA 3HMWH 3CFBA 1IC7H 1L0YA 3B9KC 1FFNA 1IILE 3SE8L 4APQC 5E1HB 3ARWA 4E5XA 1L4IA 3UXFA 3SGJC 2AJSH 1RZKC 1ADQH 5JHDD 4GOSA 5C09D 1OQXA 3QQ4A 1T1WB 1GH7A 3BSZH 3N50A 4RAVA 2I07A 3L6FA 1RMFL 4ZXBC 3IYLW 3MRJB 5KVDH 1QUNA 4RGMC 3PGFH 4TYUA 3QI9A 4P4KA 1P84K 4AIOA 3ZSSA 1AP2B 5EO9B 3RUGF 3VCLA 3TWCH 3GJFH 5DTFB 4XNXL 3Q6GH 3R4DA 1S7WA 4K23H 4MAYD 1FZKB 5E6IC 1T20A 2JJWA 5IWLC 3CFCH 1VADB 3VWJC 1J0YA 4OF7A 5IFAL 4K8RH 4N8VA 4DAGH 1FNLA 4OJFH 1IAKA 2OZ4H 3EAKA 2V7HB 1T2QH 1F2QA 3GSVB 4OKDA 1G0XA 2FSEA 1FVDA 5FDYA 4L9LC 5J57B 2GCYA 1YZZA 2H3NA 1V5JA 3L7FB 1LO2H 3HUJF 1SYSB 2GSIA 2CK0H 2QTEA 2WWMC 3H3KA 4U1SA 1N4XL 3HC0A 1AKJD 4GQPH 4XP6H 5D7KD 4Z5RB 4FP8H 3VXMA 2LU3A 5J12C 3MLTB 4DCQA 3QPXH 5CEYB 5IJVB 2EIDA 1G0YR 2BCKA 5CMAB 4PJBF 4TULH 4P57A 1IL1A 1MCFA 3NPSC 1XF2A 4X6EB 5CCKL 4P5TB 4K9EH 1WCBA 4PPTA 5MEPB 4S10A 4CADA 4E41B 4R7NB 1BIIB 5GGSY 1TZIB 1WCQA 1BFTA 2GKIA 2FEEL 4JFPB 4OCXH 4UU9A 5HHOE 1QBLL 1UWGH 4Z7NF 5KVGL 1RZIB 1F4YL 1KJ3L 4Z76A 3QUKA 5D1QD 2EDTA 4G6JH 4D0BB 1UXSA 3S4SB 3V4PL 2J8UE 3WJLA 3ARDB 3JVGC 3QJFA 4UIKL 1LE9A 3MBEB 4B50A 2Q8BH 1CE1L 5D7IA 3VFMA 5F3HB 3VXSE 3G5ZB 4QRPD 1BIHA 1I4FB 3HFMH 5BV7B 4MNQD 1B0GB 1NMCC 3RX7A 4OFVA 1MFCL 2VO5A 3H9SD 1NMAH 3C09C 1CFSA 4U1HA 2D4FA 4XPFL 2X4QA 3GZKA 5CKGA 5HDLA 2HFFB 4N1HB 4J8RB 1F02I 5B4MC 4LSPL 5BS0D 4NKQB 1RVFL 3IXAB 3PDGA 4I0PB 4WO4C 5B3JF 1XEDA 2R56L 5TPWH 5ACZB 3CAFA 4R7DA 3BKMH 4RRPA 3U7WL 3ARBB 4NNYB 3TH4T 1W72A 2R29L 3S34H 3BP6A 1BQLH 1UFUA 3CVHB 1QP1A 1JNNH 3MJ9L 2GTWA 5E8DH 3OKOB 4XGZB 1XFPA 2IALB 2DYPA 3IRZA 4LPVA 4QRTB 4DW2H 3UAJD 2E9WA 3G6DH 4ZTPL 3SKJL 1XF3B 4LVNC 3S5LA 3U1SH 1GZQA 3WEXA 3LRSA 4R90H 3NGBB 1NAMB 1KJVA 5GHWL 3UDWA 4YQXH 1UB6A 3WD5L 3U0PA 2AJUH 1UJ3A 4ENED 1FORH 3GMPB 5IMOA 5AUMB 1A6UH 1YPZA 2YMXH 4MWFA 5B8CB 4KVNH 2EE6A 5DHYB 2FO4B 4Y5YA 3VE0A 3FOLB 5DD5L 3U4BH 1WEJH 5EIQA 5E8NB 3O41A 5D6CB 3VFRA 1ND0B 1RURL 3I9GH 5H2BB 3WSQH 3B5TA 4JFDE 4I5BB 3F7RA 3IJYB 4I13B 4L29A 5INDB 3OR6A 1G9ML 5K33A 1R24A 3BZ4B 3WJLC 3CMGA 2EC9T 2I5YH 5EU6B 3DXAE 4NC1E 4KRMB 4DKAA 4OZGE 3PDDA 1VFBA 1J1PL 5D1ZB 3TP4A 2HLFC 1PVHA 3MZTA 3BP5A 2ZSVA 1FN4B 3CUPA 3BGMA 4YHNB 2BVOB 3ILPB 1KTLA 2VN7A 5DJZB 4JRWA 4GRLD 4N5ED 3B2UC 5GJTL 4WFEE 3RFZC 3ZLQC 4W4OC 4PJEE 1NDMB 2PCPA 1KPVB 3PQYA 1J1XH 5JA8B 1OAUH 1D6VL 1CD1B 2OL3H 5F9OH 2XN9E 3WHE0 1TVBA 5F9WB 4W70A 3SDAC 4WHYG 4AENB 1UA6L 3E0GA 4HUWB 2J4WL 4JRXB 5ICYB 2NY6B 2XICA 2B5IB 3W39A 1I1YA 3FOMA 3MQIA 3BJLA 3ARED 4XCFL 4ZQKB 3N1GC 4XBPA 1NCCH 1NLBH 2C3GA 4JFZL 3IJHB 5I66A 5AWNH 1OB1B 3G5VB 1UWXK 5F97E 2JJSC 2P49B 2EZ0D 2NMSA 2VLKB 4H25A 4Y5YC 5J9PB 3FB6A 3UTTB 4P5KA 2EEDA 5CIPH 4UT9H 3V79C 2QADC 3DX9B 1YEEL 4B7LA 4LVOC 4PUBL 5GGQL 2DWDB 2NX5E 4X99A 1S7XB 1D9KA 1PY4A 4F2MB 4DTGL 4P3WA 4GW1B 4ZDHB 2OXGA 4LGRB 3CVIH 3T2NH 4NDMB 2DDQL 2BNRB 4ZFOL 3BI9X 5TE4L 3HG1B 4KDTC 5KSVA 1D5XA 3F7VB 3ZE0E 5C3TA 1DN0A 1BQSA 3Q48A 1HIMH 3UYOD 4XPBH 5FYLL 3RI5K 3WIHA 3O9WA 4EN3B 4ZNCD 3EFDL 4GKSA 1QFWM 1ZLUK 4Z7VF 3E6HB 5FYKL 5GPRA 2IMNA 4WV1A 1BD2A 1QYGL 1S7SB 4IIQB 4NQEE 4Z8FL 3BAEH 3OXSA 1CL7L 3QXDB 1NLDL 5FCUL 2AEQH 3ETBF 3FRUB 5JIHA 5GGRA 4CW1B 4LCUB 3MJ8B 2XWJA 5KW9L 4LHUA 5TDOA 2A83A 4M6OH 4Q9BA 3MPCA 1WGOA 3FONA 4HWNA 1UZ8B 3CVHL 2LTQC 3TF7C 4J6RH 2BVEA 2OR9L 3MYJB 3NZ8A 3RIAK 3LB6D 4NRXA 3EO0A 3GHEL 35C8L 4L8BB 4R4NC 1IAIM 4O2CA 4ODSH 5KSUA 1CICD 5AZEH 5A16A 4BQ9A 1BVLB 4OLWL 5CGYD 4KUCF 4NCC2 2DQIL 5FDWB 2MQCA 3NAAH 4PS4L 5DD6A 5FOBA 3PDOB 3EDEA 5EORH 1HI6B 4R8WH 4D0DB 1AY1H 4GT7A 4APQD 1LP9B 4KHXL 5D7JB 5F7FA 4O2EA 4LLVB 4AIZB 1DBBH 4NYLA 4ZXBD 2BVUA 1EGJA 4LCIL 2ICWA 1BFOA 2P43B 3FZUC 3LZFH 5DJ6A 3MX0A 5F9AC 2I9TA 5E2TH 1B4RA 4MJ6A 5DA0B 2YD3A 1QSEE 1EDQA 4BSWA 1HDMB 3L3KA 2IF7A 2J6EA 4NWUL 4JKMA 1F3JB 5T1KD 1VESA 2Q76B 5EU4B 4PJ7F 1XGUB 5CJXA 4YUEH 4QRUA 5E6ID 5EOCJ 5HHNB 4OUUA 1T89A 4G9DA 4UINL 5ICZB 3JUZA 4PRHE 4JFYB 3EKCA 4NKOA 2YUZA 4LPXA 3C8KB 4PR5B 3HMXH 5D2NC 1CFVH 3B5HA 1PEWA 5IB3B 4WV1C 3W0WE 1RUAL 1E4KA 1GGIH 3OHXA 3TPKA 1G7LB 5MENE 2ZJSH 4KQ3H 2OS7A 3O2WH 1FPTH 3CDGB 3QUMA 2CUIA 2XG4A 4F7EA 1LILA 4JAMA 1NEZG 3SN6N 1QQDB 4M9PA 4YC2B 5IB2B 2A2QT 2MFNA 4R2GB 4JPVL 2C7UA 4Z0BH 1P6AB 5F9JB 2ESVB 4JFXA 1ZS8B 4I2XA 3IFLH 3QPQC 2ARWA 3KXFE 5GQBA 1G7IB 2J3SA 3IETB 3HTLX 1ZSDB 5JW3L 4JR9L 4XTRC 1C7TA 2IQ9H 4CKVX 2Y7QA 2XWTB 5INCB 3PABA 4HKBB 2FBJL 3Q6FA 2AJ3B 3P4OA 2ZZUT 3WCYA 1YJDL 3CMOL 1NFIA 4OLYH 5ADPL 1UGNA 3TT1L 4UV7L 1A7RH 4NN7B 2BVQA 3JV6A 4IRSD 3V7AE 3OG4B 4PJ8A 2VJXA 4NGHH 3V0WL 3L3DB 2B1AL 3MA7B 4ZUVB 4TVPD 5E9DB 1RZKH 3UC0H 4G7YH 5JPNB 4M6ML 5B4MD 2EDBA 3K8MA 4J3OC 4M9OA 4TNVF 2X9WA 4UTAL 4D9RD 1NCAH 4K3JH 3MCKB 2A73A 4OV5B 3K74B 4RMRA 3WXWL 1OP5K 1G7QA 2IPTH 2CQVA 1W2KT 5GJSL 2N7BA 1KCVH 3DLQR 4M7LT 3CLFL 4GAYB 3U30C 3FHAA 5H35B 4JLRA 4ISVB 3WUWA 1OAZL 2ITCB 1E4WL 5SWQB 2J8UF 3GEWB 3HE6B 4YHIA 2ZCHL 4TUOA 3EJZC 3WFBL 3D3VA 2BVPA 5TDNA 4ELME 1T7XA 2P24B 4JQVC 1F90H 1IKNC 5C2BL 1CIDA 2Z4QB 4YDVB 3B2VH 3NABL 3MJ6A 4MD4B 2Q8AL 4XNZB 1CDCA 3VXTA 3DHMA 3WNLA 1T83C 1ZTXL 1T6VN 1C8PA 1SEBB 2IADB 3O3BA 5EN2A 4I0CC 4JKLA 4JE4B 5IT2L 2VXTH 3G6AB 5J1SC 1NC4D 1GGCL 3QFDB 5D5MA 3ARPA 4J3UA 1YEFH 4H20H 4XP5L 1BQHB 2MKWA 5L8LB 3AMKA 4ZAKB 2QQLH 4AMKL 2Q6WA 4AL8H 2WP3T 4TUKH 4WDIB 2GQHA 5HYFA 2DBLH 5IBTH 2OK0H 3T3PE 3VI4E 1C5DA 3B8YA 3V52H 1FHGA 2JELH 3TCXA 4M4RA 5LGHH 5FYJL 3X14A 3OJMB 2H32B 1MFBL 1KCSH 5CILL 1NCDL 1JWMA 5KSBE 1NBQA 2HLFD 4U49A 1XZ0A 2D0HA 4CVZB 2PTVA 3FN9A 3LKRA 5BRZD 2NYYC 1KT2A 2DBJA 3QWQB 3RIFK 1I9RL 4WNQA 3FQXA 4HAGA 4DVBA 5C7XL 5D7SH 1MCPL 2XTJC 3M07A 4KPHH 3IS1X 4QGTA 5E1AB 4LCCA 2XY1A 3BDXA 2AXJA 2BMKB 1J87A 3PWLA 1FRGL 2XZQL 1MCBA 3KJ6L 3DYPA 3EYQC 3MBXH 5L88L 4HF5H 2KBGA 4G9FA 1IKFL 2Q87A 3RY6C 1CGXA 3HLAB 2VISA 3RWEB 4PRAB 5JW4N 1QO3A 8FABB 3SDAD 1W8OA 5IOPB 4KI5E 4F15C 4TQEL 3NFSL 1U8NB 2EDEA 4G8FA 1KCRL 4Q0XL 4NM4L 4HGWA 4YBQC 1HH6B 1NGWA 2NY4D 3MOQA 2ZPKL 2FX8L 4L4TB 4ODXB 5CZVH 5IG7B 3C60B 4NO3A 3MLSH 3ARFA 2ZUWA 4JG0L 4OD2A 3S97C 4ZTOL 4PJEF 2F53A 4S1QH 1UH3A 4TTDD 1MIML 1VEMA 2X4RB 5GGVH 1KLGB 5EIIA 1FIEA 4AT6A 1H3TA 3QNXB 2QADD 4R3SA 4CN4A 1IGMH 4NO5A 3GJEA 1NUGA 5J06A 4KKBC 2B2XL 5TE6L 1KJ2L 1PLGH 4OZIB 2JCCA 3V6OA 5IESH 1ERNA 2FIKB 2FZ3A 2BY1A 4JJ5B 1A47A 4C4KO 3DBXA 1T2XA 3OKMA 5JPMB 3FFCA 3EYVB 3ULSB 1ODAA 5TQ2H 5KANG 2GITA 4UQ2A 3MRRB 2P8MA 4JN1H 3SQBA 3NH7H 4P2RA 5DURD 3VRIA 4JPWH 1T7ZA 2YR3A 3VWKA 2HA1A 4WI6A 4BFEA 1P7QD 2G75B 1AO7D 2WWKO 3TBSA 5CD5C 2FWOB 2ICCA 4F3FA 4U1KA 3OBAA 4W4NA 2Y1VA 2FATL 3QNZA 5E2UL 4H26B 5BVJB 1R3LA 3OAUL 1W72H 3MROB 5FYLE 2G9HA 4WHCA 2DQFB 5J11B 3OZ9L 3QWRD 4HIJA 1ZVHA 5K9JH 3ZT6A 5HYIA 3BKCH 5FYKE 5EO0B 5DLML 1KTRL 4HDIA 2RHEA 1MCOH 3ARXA 1CFNB 2NY0C 1NAKH 3MV8B 1HEZB 4KJYA 4R4ND 4UDUB 1ZAGA 4JQXA 2BNQB 3O11A 2FLRT 3T2PA 3CFJA 4LLMA 3FN0H 3H7LA 4OLVH 6FABL 4PJFA 3U2SB 4DQOL 3D39A 2ZSWA 4GAJH 1FDLH 3MLZH 1I9IH 32C2B 4HCRH 1RAMA 2EO9A 4FQCL 3LY6A 4TUJA 2B8OT 4UV4L 2L7UA 2PR4H 3VRLE 1FYTD 4ZFGL 2YA1A 4XPTH 1C5CH 1GC1L 3P0VL 2AJXH 4NQCD 3SBWC 4YBLB 1KGCE 3FZUD 4LSUL 5EC1A 3WYRA 1MNUH 1PFCA 5DJ8A 2OP4H 1K8IB 1ZV5A 2B4CC 2PW1B 4I9WE 1ORSB 2V5YA 5E24E 3GJFK 3U82B 3MCLL 3ULVL 4K55A 5JXED 2IFGA 3C87A 5C0JA 4HMEA 3GSOA 4RFNC 4XVJH 2AV7A 1C7SA 5DMKB 2WINB 3MRPB 1CDJA 4RMVA 2DIBA 4JHWH 3BP7A 1I8IB 3GMMB 3QCVL 4MJIE 1G7JA 1H3VA 4YDIH 1B6DA 1U8JA 3PF2A 3QHTC 2HKFL 4JGJA 1HQ4B 3RBGA 4QXGH 5FO9A 3MLVL 3RTQB 2Z35A 4JKPL 5IB5A 4WW1B 2D3VA 4XPHL 5D8JH 1CZ8H 1INDL 1ZT1B 1KPRB 3JZ7A 4JPKH 1BZ9B 3PGCA 1RULL 1YNTB 1FZKA 4KROC 3LV3B 4NFBA 5EU6E 1L9NA 5I1HH 3L3GB 4MVBC 2D4DA 2FX7L 3FKUS 5C0CE 4H8WL 2VQ1B 1D7FA 4XVUC 1S7QA 3FQTA 4FFYL 3PWNB 3QPQD 3ZTNH 3QQ9C 2QR0A 1I3VA 2DF3A 4G43A 5IB1B 2YSSB 4ODVL 4RQQA 4YHPB 4WU5B 1TTUA 4UTBH 2ZUQB 3NCBB 2E7HA 5J6HA 1J1OH 4ODWA 3I75B 4YGVB 3PWPE 4HK3J 3MRBA 1XGQA 3WJJC 1AQDB 1OGAB 1AGCB 4X6EA 2VR9A 4P5TA 3SHSA 5FOJA 1KF9B 4R26H 1ZLWH 4E41A 2CDFA 2OMBA 1TZIA 4JFPA 3RPIB 1K4DB 2VDKL 3IDMA 3LDBC 2H2SD 3QXAA 4HPYH 4NUJA 4OCYH 5DJYA 1UC6A 1UWEH 3UBXB 1N59B 1F4XL 3I6GA 4YFLI 3W82A 1T0MB 2R0WH 3DO3A 3IU4L 2UZXB 4PD4K 3QXVA 4PJAE 4D0BA 5LQBL 1R3KB 4IEFB 4RMSA 4ETYA 3MRDB 5LXGL 1JHKL 3MBEA 1IM9B 2AXGB 2ZUSA 2UUDH 3S96A 1T21B 3QEQB 4QHUB 4M5ZH 3BWAB 4OF0A 4XVTL 4PB9L 2DL9A 2EECA 2R0ZH 3V5KA 4FNLH 4MB5A 4U6XB 3EJZD 3KLAB 1IC4L 1RZ7H 3RY4A 1BZ7A 5D2LA 3MRNB 4PRIB 2PKDA 3GSNL 5D7LA 4K07A 2XNAB 1MUJA 3BMWA 2EDNA 3CSGA 3D2UB 3LH2L 4MQXD 4PJBA 3JSSA 3ARBA 4NNYA 4BYHA 2WIIB 4G6FB 4RFEB 2BNRE 1HKLL 5IVNA 1UJTA 4RSVA 4U1MA 3HG1E 3ECBA 5FHAL 2VTFA 1D6EB 4PGBA 4XGZA 1DDHA 2X4NB 4TSAL 2YKLL 4PB0L 2W0FA 5TF1H 4GW4B 5DD3L 5HYQA 2EIEA 4XNMB 1XF3A 3E6FB 3G9AB 1IAMA 4ELMF 1GPOL 1S7TB 3U4EA 4QY8B 2DQCH 3C08H 4GBXB 5IV2A 2DQTL 1HINH 1OAYH 4PJIE 2OQJB 3UJIL 1FGVL 1WWAX 5AUMA 4XAKD 3U7YL 3HPLB 2W65B 5T3XL 2FBOJ 5HGHB 2VOTA 1XGRB 4FXGA 1IRAY 5DUML 3SY0B 1F58L 1MWAL 2G2RA 1FCCA 1YEJH 5E8NA 3SDCB 5HSFA 5D6CA 3TN0C 3IFPB 1MRDL 1ZHLB 2XTJD 3QIBC 4XCYB 1EGJH 2VKXA 4M8QB 4MA1C 3HI6H 4F37F 4F8TA 4KUZL 3UTSB 2LE9A 2BC4B 4U1JA 5E7BA 5C0BD 3UTZB 5FYJE 3EYQD 1WTLA 4XBEH 3T3PF 1OGTB 3VI4F 3VFWB 4PLJD 2NW3B 3TBVA 4IBLT 3SJVD 2D7PA 2WAHA 3BPNC 4Q9QH 1NBZA 5DT1L 5B39A 1Y0LB 5KSBF 4DN4L 4WEMB 1FLTX 1WAAE 2Z31B 3W81A 4Y1AB 2BVOA 1LP9E 2R69L 4QHKJ 1KIQB 1U8MB 5EOTB 3VXRB 4OLXL 5DUPL 1UACL 4JQIH 3TVMA 1X4XA 4YBQD 1PSKL 3KYAA 5CS7A 4OGZA 1JRHH 3QDJE 2DM2A 5E8OB 3TPUA 3QUMH 5FO7A 1KIPA 4H1LH 4WI9A 1MHEB 3QZWA 1CD1A 3UP1A 3CZFB 1JTOA 3QDGD 4K7PH 4HX1A 4QXWA 5KG9A 1JMZA 3MNVA 5EZLB 3W9EA 3KPPB 4HUWA 5BMFL 3OTTA 3CFKA 2A9MH 3QUZB 5CSZB 5ICYA 3EDFA 4KJPC 4KI5F 4KKBD 5JW4M 3RWHA 4K71C 5HYSG 1KCLA 3RDTB 3QA3A 1KB5B 1VACA 2FNBA 3O2VH 1QSFA 4FFZH 2H6PB 3ZE1E 1B4JH 4V1DD 4OCRH 4M7ZB 3B3IA 1I75A 2FB4H 3G5VA 4RISH 4FQXB 5HDOA 1FZJA 2VLRD 5J9PA 5C09E 1QRKA 5GS1B 1OSPH 3UTTA 1MH5A 1HSBA 2BSRA 4P46C 4EKXA 3DSNA 4FQJH 2IBZY 3WIIH 3OKEA 3KNBA 5D1XD 1S7XA 2HYMA 1MQ8A 2ESVE 2VKWA 4OD1H 3P4MA 1A3LL 2FECI 1CTOA 5DEGB 5MP6H 4NDMA 1D3CA 4P3CL 2D03L 4X6CB 4ODHL 3TYFA 1YN6B 4QOKD 2FJGB 3MUY1 4F9PA 3D0LA 4J4PA 4M1CC 5CEZH 2GW5A 5F6IC 1Z3GL 3MXVL 3KLDA 4U0QB 3BZFB 4ETQB 4FQ1L 4I0KA 2DKSA 2MHAB 5CHNA 5E4EB 1K3IA 2APFA 4BUHA 4FS0A 4LCWB 4KVCH 4OGYL 1KELH 1U3HB 1E6OH 4PYHA 5MEOB 3TVMC 1RZGB 5D7KE 2HTLC 3JTTA 4Y5XB 5C08B 3ZKMD 1MCRA 1OOAA 3QXDA 3VRJA 5ADOH 4O4YH 4WUUB 5KSAC 4Z7WB 3FRUA 1L7TL 1JYWA 4A6YA 1KSRA 4LCUA 4U1GC 3PIQB 2CO7B 2NLJB 1A8JH 2EEBA 4QXTA 4EI5C 1ZHNB 4WWKD 5EZOH 1PY9A 1SJHB 2A6DB 1FJ1B 1CK0L 1LDPH 1MI5D 1CYGA 1MCQA 4ODTL 3EDKA 3BKJH 3RVWC 4TVPL 3UX9B 2K7QA 3O6MH 5CJBA 4X4YB 4GFTB 4PGCA 3RZCB 3UMTA 4L8BA 4WY7H 2ZG3A 4JZJB 3SCMC 1XF4A 1DLFL 1SVZA 1CFQA 4GUPA 1LEGB 1RZFL 3VH8A 4BQBA 5IKCB 1KG0B 5J8OA 3KYNA 1I1RA 5FDWA 2VXQL 4QRPE 1LO5B 3BPLB 4XP1L 1E4JA 2Y36H 5EBWB 3PDOA 4CVWA 5JO5B 4MNQE 4Y89A 1HI6A 3ZKQD 5C0AA 1U3JA 3THMH 5D7JA 4X98B 2HFGH 3RL1B 4NQDA 1MFAH 1NGZB 1RUKH 1UADC 1JZ4A 5HTSA 1V7NL 3ARVA 3KPRD 3VRLF 4MD0A 1AGEB 3IDNA 2EDQA 1KPUA 4MSWA 4G6KL 4UAOB 4F7PB 5GS0C 5J7CC 3TZVB 2VDOL 4YDKL 1K9TA 4IDJL 3ULVE 2VLLA 1U8OB 1KENH 4F7CB 1LHZA 4OCSH 3MFFB 4PG9B 2AW2A 4LIQH 2Y4SA 4J4PC 5DVLA 2EYTB 4AEHH 2H26B 2OM5A 3L5WB 1A14L 2AV1B 1OT1A 2A6KB 1NGQH 1RZ8A 3C8KA 4PR5A 4YO0B 1NGYA 2HJFB 3EYUL 2FHFA 5FYJU 4QF1A 4GXVH 1FP5A 3EOAB 3RWJA 1FIGH 4EVNB 2WK2A 3P0YH 4X4XA 4ZOEA 3UBXI 1J11A 1IQWH 4NBXB 3VGAC 1QG3A 5HPMB 1AGFA 2EXYC 2W1NA 4HJ0D 4DKFL 3T0EC 3SDYL 5DJ2B 3U36A 5F89A 3ESVF 3ARRA 5I1LB 4QWWC 3G6JB 2R2BB 4P5MB 2J1KA 3BGFC 1H0DA 2YK1L 1XMWA 1YC8A 5HHVL 4ZYKB 4NKDB 2FJFA 3UJJH 4DN3H 1NC2A 3ARGB 1N2RB 1G7IA 5CD3B 2CKBH 3SGKC 1MRCH 1ZSDA 2EYRB 4QHLB 3ZE2E 4PJ7A 5E5UB 2DTMH 2BSTB 4Y5VB 2B4CH 2MCPH 2HKHH 2XWTA 3KYKH 3T4YB 2O61A 3GNMH 2AJ3A 4K7FB 4L4TE 5BCAA 2N1KA 3BH9B 1KIRA 1KB5L 1QFWH 4ZOCA 2NR6C 4ORZC 5E95B 3BMVA 3VXQB 4GRMB 4M4PA 2GHWB 4UDTA 3REVB 2E7CA 3L3DA 3KPOB 5E9DA 5HJ3B 4OF3A 3F62A 3U4AA 1CR9L 3BE1H 3K4DA 1PQZA 2PETA 3QUYC 4B0MM 3QQ3A 2Y5TA 4YDLB 2LU7A 4MA8H 4IM8A 4JREB 4MQ7A 4PJAF 1CCZA 2ITCA 1P1ZA 1WZ1H 1E4XH 5F1NB 3BUYA 4IRJC 2P5ED 2AABH 2OTWB 2KKQA 2JIXD 1A21A 2HFTA 4JM2A 1ZEAH 1IAIH 4PRPD 5EG6C 5C0RL 1HH9A 3DROA 5C07A 2WBWB 2QJDA 4KRPB 2V17L 5FF6B 4NKIL 1M7DB 1I7ZA 2AEIT 1OP3H 2GYSA 4N0UA 1JL8A 3T3ME 3UJTL 2CIKA 4FHBD 3MREA 1ACZA 5TQ0L 2AJZA 1ROWA 5DRWA 2ERJC 2DQEL 5JR1L 4KMQA 2HFEB 1CLZH 2AJYH 3BDBA 4J7RA 2FX9L 1FH5L 5T5NF 1MVUA 1YEKH 1RIHL 1BM3L 3TN0D 1T04A 2DQGL 3T09A 4U7SA 3V5HB 4YXHL 2H8PA 3QIBD 1NJ9B 5EPMB 4NZUH 1BECA 1HOCA 4K3EL 3SE4C 2EE3A 4M1DH 4LQFH 1HNGA 3MV8E 1A6VL 4GXUN 5CJOL 5E2WH 5C6TH 3TBYB 4WEBL 3H7BA 3QCTH 5T3XE 4PJIF 3SPVA 1AXTL 2B20A 5L2KB 3CPLB 1QHPA 1MELA 2XKUA 5DSCA 1G1CA 4JPIB 3WFCH 1LO4H 1KN4H 4LSVL 1R3IH 1B2WL 3MA9H 2DN7A 2O5YH 3VXPA 2DKUA 3BKYH 5J13C 1S3KH 2UV3A 3LEYL 1HXMA 2ZKHL 5IQ7H 1T1ZB 4AIXA 4DEPC 4Q74A 2AK4B 1N5YL 1CXFA 1PKOA 4X4ZA 4NHUB 2BRRL 3X17A 5F7YC 1JPSL 2XPGB 1FNEA 1SY6L 3RWEA 3CXDL 2D7TH 1TETL 1AR1D 1YMMB 3PHOA 4FZEH 4KKAD 4LU5H 3IXTB 3AMLA 2F19L 3WN5C 1G9NL 4HFWB 4OB5L 2Q86B 4NWTL 3WKMH 1Q94B 2ORBH 2HVKB 3QJHB 4GKNB 2CDEB 2VE6B 1WAAF 4Y4HB 2V2XB 4CAGA 5CWSA 1JP5A 1CU4L 2LU4A 3FFDB 3GMQB 4ZO6A 3FQRB 3LPWA 3TA3C 1EUUA 4FFVC 4ODXA 1I3RA 3ARUA 2MTPA 5IG7A 1ZLSH 5I9QC 2QEJA 3K8KA 1T5WB 5IBUG 4LSTH 4N1CA 3O3EB 4IJ3B 5I8OL 4JDZA 4OUOA 2VQTA 2X9YA 4PJGB 5DK3A 3RVXC 4CVUA 4UBDD 3GKZA 3TFKC 4X0KB 3QNXA 2XZAH 4P46D 1A5FH 4R0LC 3GJFB 4WHTA 5GSRB 3W2DH 1Q1JH 4ZO9A 1K5NB 5EO1B 3UPRA 1U93A 4P23B 4HKXA 2P5WA 3FT2B 3Q5TA 3RWDA 4V2BA 3RA7H 2O93L 4MLIA 3VXUD 2C3WA 4G8GD 3IJSB 4PTTA 2FHBA 4OZIA 3VFPB 4X7TB 2V2WA 4OZHB 1VENA 1EAPA 2X4UB 5F3BA 2ZUYA 3Q5YA 4UIMB 1R6VA 3QHFH 4OKVA 3ZKXB 1CIUA 3QO1A 3ZE1F 3EYVA 3ULSA 1F42A 4JRYA 1OGAE 1Q0XH 3MOBH 1S5HB 4KKNA 2IQAA 1LK2B 3QUXA 5FM8A 3K1KC 3AU1B 3N1MC 1L7IH 5L7XH 5GGUB 1RJZB 2FWOA 4JGUA 5KSAD 1I8KA 4BKLB 4RX4D 3D69A 1S5IH 3IDIA 4NNXA 3S35X 4PJ9C 4RDQG 3FCTA 3EO1A 4EI5D 2XN9A 5IP4A 3BVNA 3S35H 3QEQE 5I1GL 1BLNA 3EYSL 5GISL 3RVWD 5EO0A 5E99H 5EOQL 3KPLA 3O6FC 1FG2B 4P49A 5HHPA 5A3IC 4PLKC 4TOYL 2CMRH 4XRCB 1HXYB 4N0CC 4IOIB 2BNQA 4PRIE 3SCMD 4HLZG 2NXYC 4Z7UB 3U2SA 1XCQB 1F00I 4G6MH 3V6ZB 1LE5B 32C2A 4NP4L 4BA8A 2JJVA 3U9PL 3DNKA 2ED9A 4FQ2H 1NDGB 1JGLH 3AFLA 4MHHG 5TGBB 5SWSD 4NQSB 1MJUH 4TVPE 1KBGH 3GHBH 4JHAL 1JPGA 3CXHJ 4L4VD 2OJZL 3DURB 5E5RB 4L3ED 4PTUB 4D9RE 3DTXB 2BFVL 3ZTJH 5GS0D 3OX8B 1I1AA 4W6WB 3WS3B 3EO9L 1K8IA 1AD9A 5I17A 5FUOH 2PW1A 1IZKA 3RY5A 2OR7A 4JY6A 4NC1C 3C8DA 3MCG1 5JIKA 3VD5A 1C1EH 2UYLA 3VFVB 4R6UA 4HWEL 5ERWB 3QIWB 1X5GA 3HAEG 4U6TA 1BBDL 3IAGC 1BEYH 4HHAA 4XX1G 1FQ9C 4OGXH 2XT1B 2XY2A 3LRHA 1QLEH 1MJ8L 4YJZL 2ZUTA 5AYUL 1RHFA 4HUUA 2GY7B 3QUXC 5DQDL 2D9QB 3BH8A 1A1NB 4JFFD 3C5SA 5L8JB 3RTQA 1QFUL 5DRZA 4RAUA 4MQSB 4WW1A 1T03L 4P4KD 4Y4KA 3H42H 8CGTA 1ZWIB 2XYCA 2NW2A 1YEGL 4U1NA 1AGDB 2EXYD 4NQXA 3UTSE 4HUVA 3QFJA 2D0FA 3W9DB 1A6PA 3T0ED 3LV3A 4LHQB 5E2VL 1BF2A 3GMLA 1XGYL 5DRXA 5ICXB 5DFTA 1I7UA 1LO0H 1RUQL 2GJ6B 1CBVH 3BFOA 2KQMA 1OTSC 3MODH 4FQIL 3SDDB 1MQKL 1M05B 4UNUA 2R23B 2YSSA 4ELKB 4OF8A 4WU5A 2NY2B 3FB8A 4TSCL 4YWGL 5D1QB 5I1IH 1S9XB 3QNYB 3VXOB 5L0QB 4HS3A 3HS0A 1BVKA 3I75A 5AZ2L 1PJ9A 4YGVA 2YOCA 3EYFA 2AEPH 1F3DH 3RNQA 1B9ZA 2OI9C 1PG7L 1FGNL 1ZA6B 2C9AA 4U1LB 3VXMD 4XWGH 4G7VL 2ADIB 2QHLA 4R97C 1TJIL 4Q2ZB 3OXRB 3F5WB 4R4BA 1J8HA 5D93C 4KMTH 4PIRF 4HWBA 3NCFB 4LRIC 4HH9A 3MRCA 1GGUA 1B0RB 2WNGA 4KTEH 5IW6A 3UBXA 1N59A 4EDXA 3HR5A 3QUYD 1JF1A 1JPTL 5I74C 1DFBH 4FG6D 4KKCC 1G7PB 1P4BH 2OL3B 4JFOA 5GS0H 3BO8B 2UZIH 4MDIB 5KVFL 1X9QA 3MRDA 3ZE2F 3RKDD 5DK2A 2AXGA 3I2CL 3ZDYE 1CS6A 4P9HC 2VABB 4IRJD 4PYGA 4YHKL 3S37X 1U41A 2WBJA 1F5WA 2XQYG 3CD4A 2ZUVA 1J5OL 4OCWH 3KLAA 1QFOA 3IDYC 3O45A 4HV8A 2ARJA 2LQRA 2ADJB 2LAAA 1KEML 3UTQB 5I1EL 1JNLH 1S9VB 3KVQA 1S78C 2B0SL 3DETD 1NCNA 1TJHL 4X9GA 3STLA 3BEWA 1DVFA 5F72S 4XP4L 4MJ2A 2X6MA 4KJWC 5I15L 1OPGH 5GIRB 3S8WA 15C8L 4CMMB 1QVOA 1QKZH 4YHLH 2WIIA 3MLXH 4X6CE 4A6YH 1BJMA 5CIPB 4M61A 3HNTH 4QRRD 2ZCKH 1KJMA 1A6ZB 3C6LA 3B9VA 2Z0BA 4CJ1A 2X4NA 5J6GB 3ME0A 1B88A 2OTUA 3SO5A 1DANU 4JB9H 3CK0L 1W8NA 5FO8A 3LSOB 3QCUL 2XQYK 2DYPD 1MFDH 3HHRB 5IQ9B 4XNMA 5DD0H 1S7VA 3OKNB 3Q1SH 4KJQC 5DI8B 5I8CB 5TH2A 5JORB 2XACC 1TLKA 4N90E 5H37G 3OJDA 4QY8A 4OQTH 4GBXA 5EZIL 3JWOL 2BOCA 1OTUC 3F58H 1KNOA 2EC8A 5F96L 4YX2L 5C08E 2QLVB 4WUUE 4LLUB 1UQSA 2X89D 1WFNA 1N6QH 2ITDA 1ZANH 3HPLA 4NZTL 3A0OA 4LMQE 4PREB 2X4OB 3OAYK 1TJGH 4HWZB 5EZJA 4LSRH 3IDXL 5E08H 3D9AH 2H1PH 3U7AA 3HE7B 4XCNB 3WDIA 1OARL 1AO7E 1ZHLA 5MHSE 4BFIA 4L8DA 4MYWB 1N26A 1T1YA 2VL5B 3KHOA 1OVZA 2BC4A 1SMAA 3UTZA 1JUFB 3VGEA 1ZA3B 4ONFL 4KHTH 5DQ9A 3NCJH 3WL9A 1N7ML 4JFEB 4C83B 2WBJC 4DVRH 1LEIA 2FRGP 4C59B 3RVUC 3P9MA 1A7OH 3X13B 2VMFA 2CSPA 2Z31A 3FTGA 1IM3A 2V5MA 5GGTH 1H8SA 1KIQA 1NMBH 3GBMH 3HNVH 3QAZC 3PGDB 1CLOL 1RZJL 1DVFC 3VDAA 1U8QA 3GI8H 4JO1L 2P45B 2HLAB 4YHZL 3TA3D 4WGVB 2CLVB 2IAMA 3WUWG 1FORL 5IMMA 3N85L 1QLRA 4XHJD 1MHEA 4DZ8B 3BHBB 3PQYD 2SEBB 4HKZB 1MHCB 3RVXD 3VFSB 3TFKD 3JTSA 3GKWL 1F97A 2PXYD 4NQCE 1WEJL 1X5LA 5HHOD 3HCVB 3SGDH 4NC2B 1O5DT 2P8LB 3GSXB 5HHXL 2FJHA 4ONOA 2ZOKB 1LEKB 1P69B 1S9YA 2OBGA 3WLWC 3OGCB 3MLYH 1WTGT 4CVXA 4MDJA 2C26A 4LDEB 2G60H 4ZUSB 4C56B 5BZDB 1FV1B 4U1IB 4P9ML 4BK4A 3VXSD 4P59H 1KB9K 2J5LC 1JZ6A 3C9NB 4J3SA 2F5BL 4KTDL 5JOFA 2R2EA 3OR7A 1J12A 3T8XA 3D85D 1B0WA 2R8SL 4HK3N 3MRLA 1U92A 3BUTA 4HIXL 3L3IB 4F7MB 2F54D 2GSGB 2J88H 3L9RB 1LD9B 1G1YA 2NY3B 1YEHL 4EOWH 1E6JH 5L6YL 1HYRC 1YEIL 1GOFA 3TO4D 1KYOJ 1TPXC 1VEPA 1F45A 3GRWL 4EBQL 4NO0B 2CLZB 3HR6A 5D71H 1QLFB 3L5IA 4Z78B 1YN6A 2FJGA 3EYOA 4WI4A 5GRJL 4NN5B 2P4AB 1RUPH 2PTUA 4RWYH 4PRDB 2YD9A 2RBLA 5DJCB 1FVEB 2I9LA 4I77H 2PYEB 3DV6A 3NTCH 2H45A 4LCWA 4MJ5B 1PX3A 4N0CD 1IARB 4PG2A 3IU3B 4QYOA 4G8IA 1BD2D 2NXYD 3BDYH 4KDWA 4X5LA 3TJEL 4Z7WA 2DQHL 2IAMC 2BY3A 3B9KB 3SKMA 1VA9A 1R5WA 4KI1A 2NY5L 1HQRB 2QSCH 3R1GL 1YEDA 1DEDA 2NLJA 2NTFB 4Y8DC 3MV9B 1AXIB 4LOUC 5J4MA 1TZGL 1T4KB 5HYJB 5FECA 3RU8L 1DQLL 2A6DA 4BH7B 3LN4B 1I8MB 1PYWA 1J88A 1DEEA 2KQNA 4RBPK 2VZVA 5C9JB 4RGMB 1QBAA 3INUL 5C8JB 1JNHA 4JFDD 2FGWL 1GOHA 2IANA 4A2MA 3DMMA 5C70A 1WBZA 4Y16A 4P2OC 1UVQA 2R4SH 4YR6B 1A7PH 4ZSOB 5IVZA 3MRGA 4F57H 3DXAD 4HC1A 3CH1A 4Y2DB 1Y6KR 4ZNEA 4X4MA 5DDHB 5IKCA 3VWJB 4AQ1B 3L95B 4DUVA 1CGTA 1HIML 5EBWA 5JO5A 1EJ6A 1EFXD 1FZMB 1JN6B 1BOYA 3PV7A 1YDPB 3QDMA 3V6FB 1DQJB 1WICA 5I19H 3MR9B 2XTLA 3HAEH 3GMNB 4RGND 5ESAB 1EEYA 4L9LB 3ISWA 4IMLA 2YEZB 3SEPA 4XMKH 5T3ZD 1YN7B 3DV4B 1CFBA 4OLUH 1G9MC 4HKJA 1E28B 2CLRA 5J12B 4ZS7H 5F7KC 5CBAA 1ZMYA 3MGTA 4AG4L 3WLBB 3SDXA 5DFVD 3MFFA 4HBQA 1QBMH 2E6PA 3NPSB 5L9DH 4NN6B 2HRPL 5JXAL 3CC5A 4XPGH 1CXKA 4N8CH 5CUSL 3DX7A 1OTSD 5L2KE 1KFAH 4HJJH 5I1KL 3AS3A 4KI5C 4O02H 2APVA 3HI1B 1A6WH 2VDPL 5IJKC 3EOAA 5ISZA 2VDQL 5JNYA 3VJ6B 4GMSH 3X12A 5C86A 4M93C 3S36H 1FFNB 4HXBH 1QSZA 5GRVL 2R4RL 5GXBB 2AK4E 4XAKE 3WFDL 5DR5L 3TC9A 12E8H 2DMCA 2OSLB 2C5DC 3GUTB 3KS0H 1NMCB 3G6JA 5ALBL 2R2BA 3QQ4B 3C09B 3KHQA 1P53A 2DQJH 2I07B 4RAVB 1QBBA 2OR8A 4NNPL 1E27A 2DI9A 3QI9B 2VXUL 4NKDA 2NX5D 5ILTH 3P30H 1YMME 5CD3A 4WO4B 2X5PA 1CGWA 4HIHA 4Y19A 5C0BE 2LV4A 1S7WB 1NCTA 4MS8C 2BSTA 5FB8B 5LWYH 1VGEL 2Y06L 3O8XD 4UT7H 1JTPA 1T20B 1IC5L 3MV7B 4YUEL 2R0LH 4YBHA 3K2UH 4N8VB 3BH9A 3FRPG 5ESVB 1IAKB 4JDTL 4U6VL 5D72H 2HG5A 1F3DJ 5DEFB 1H3XA 4GRMA 1RUML 2FSEB 3PJSA 4JZNA 3RRQA 4LVNB 2GCYB 2H3NB 1GGIL 3RIAF 5HJ3A 5M94B 1YUHB 2GSIB 4U1SB 4NQED 1T66D 2YPLA 3HC0B 2V6HA 2PO6A 4YE4L 2FYYA 2FD6H 4KK5C 1IFHH 4DCQB 2UVFA 1AGBB 2BCKB 4P2QA 1IL1B 1MRFH 1HHJB 4HUXB 2R9HC 4DZBA 4KMLB 2VXSL 3GO1H 1Q0YL 1N0XL 2GAZA 3QDGE 4CADB 3ARDC 4RZCA 3KPSD 5F1NA 3OF6A 3ZDYF 3V4VH 1A3RL 4UU9B 5C0CA 2VH5L 1ORQB 4Z0BL 2W07A 5F7NC 3ILQC 1XIWC 1BJ8A 1RFDL 4Z76B 3QUKB 4MA7H 4KJQD 2DLGA 1ZVYA 5DJ0A 3DSFH 1UXSB 4O58H 5FGRA 3IFNL 1MIEH 4NFCA 3QJFB 1LE9B 1HYSC 1G6RL 4XT1C 5D7IB 3VFMB 3PWPA 5LGJA 4V1DE 1MJ7H 1YNKL 2AEWA 1DBKH 1MLBA 1REIA 3BP4A 5IW1A 4KGJA 3L3JA 4AQOA 5T5FH 3ALWA 2CRZA 2HFEA 3IAQA 1DBAL 1T7YA 5JDSB 4MZ3A 5JA9A 2VLRE 5AAMA 3BIAX 4Q7DA 1CFSB 3S88L 4U1HB 3AAZB 5BRZB 2X4QB 3OAZK 5IVXF 1X7QA 3O3DA 4JO3L 3MLRL 4JY4A 1OAXH 4NRZA 3JV4A 5DK0A 3LEVL 4K3GA 1P4IH 1QSED 1NCAL 4K3JL 5BXFA 2E7LA 1A4JA 4PJAA 4LEXH 2IPTL 1W72B 4X7SH 4BQ8A 3EOBA 1NKOA 1KCVL 4QOKE 2HT3C 3BN3B 3LVEA 4LDOB 2GTWB 4J23A 4JKKA 4Z7UE 4PRHD 1MCDA 4YFDB 2ZNXA 4JPIA 1FFOA 3B6SA 3RVUD 5I1CL 5JQ6H 4P9HH 4EUPH 5B8CC 5F71A 3W0WD 2W9EH 1DUZA 1GZQB 1MEXL 4LSSH 3S5LB 1GGYA 3T04D 3NA9L 1Z9LA 3TV3H 5MEND 4FTVA 4XWOC 5BVPL 1T1ZA 1UB6B 4WCYL 3U0PB 4XC3H 1CQKA 3S4SG 5C0DB 1UYWH 5IMOB 2CH8A 4TRPH 4MWFB 3KLHD 2UVEA 3KPMA 4PJ5A 5I18L 4HXAL 4Y5YB 3OSKA 4DKEH 3HPJA 2VXTL 3VE0B 2BJML 1MI5E 1MREL 1M4KA 4NUGL 1BJ1H 5D1ZC 2ED7A 3O41B 4X7CC 4XMPH 1FLRH 1A7BA 3WIFA 3HZVA 3KXFD 4HFWA 1GGBL 3QJHA 3OR6B 3LPFA 1R24B 1JK8A 4XVSH 5KJRH 2HTKC 5ITBL 1IMHC 4Z77A 5E03A 3O4LA 1VFBB 2VDRH 4E42A 4D9LL 3ZYJA 1NUNB 1ADQA 1FO0L 2D9CA 3I3DA 3BP5B 1LK3L 3QIUD 2ZSVB 5IHUH 1D5IL 3CUPB 3IVKA 5E8PA 4N0RA 4PJGA 3VG9B 1KTLB 2R2HA 1B90A 5T1LA 3KPRE 5F9WC 4M7LH 1JHLH 3P3YA 3OV6A 4HUKB 4HWBH 5CJQH 5D7SL 3PL6A 3L3HB 3WS6A 1C5BL 3A6CH 2PCPB 3BQUA 2E7LC 4G8EA 4XNUH 1VHPA 2NY6C 1OM3L 4S0TD 1O7SA 2VNCA 4BZYA 4OZHA 5CZXD 1TVBB 2X4UA 1YJDC 2OZ4A 5DD1L 2W0LA 1J0JA 2LTQB 3SE8H 3HI5L 1H3PL 1S5HA 4GAGL 2NPLX 5IFHL 1I1YB 3FOMB 4L4JA 1QHOA 5SX4H 1F8TL 4GH7B 3P0GB 4U3CA 4XBPB 2DLIA 2DL2A 2HT2C 4EZMA 2HT4D 5I66B 3M1BA 2X1QA 5IUSA 3H3PL 3QDJA 3VMOA 3FB6B 4CDHA 2IPKA 4P5KB 4I3SL 4OAWB 3QSKB 5IFAH 3CX5K 1RK1A 4X99B 1D9KB 4S1RL 3Q3GA 3RIFF 5F1SA 4NQTA 5IFJB 4WFGD 4P2OD 4IOIA 4M43L 5KSVB 1D5XB 4HULB 5K9QI 1N4XH 5SWZD 1DN0B 2CXGA 2A38A 2XZCL 4O9HL 4BELD 3QZWG 3ULUD 3KJ4C 3O9WB 1A4KB 4L8CA 5CCKH 1MJJA 1I3GH 3F7QA 4JN1L 2IH3B 5C09A 5JHDA 5KS9E 4WV1B 1AH1A 5HPOA 2YA2A 3K4ZA 4PTUA 3PL6C 3OXSB 1QBLH 3WS6C 1C08A 4YZFE 5KVGH 1F4YH 4C58B 3WS3A 1KJ3H 1EEQA 2F5AL 4HEPG 1N64L 1IT9L 4LHUB 5TDOB 2EDFA 3V4PH 2Q3ZA 1YC7A 2A83B 1FNGA 2BRQA 4UIKH 1I1FA 1JI2A 4AEIH 3QIWA 1CE1H 2P5EE 2Z8RA 3PWVA 5FGCB 2GK0A 1CLYL 3MXWL 3NZ8B 3C8HA 4NRXB 1NFDE 3EO0B 1MFCH 2R1WA 4O2CB 3LRGA 4XPFH 5KSUB 4X6DE 3SKOA 1I85A 3TT3L 5A16B 4LSPH 1RVFH 4YPJA 4K9EC 3JWDL 5I2IB 5DD6B 5FOBB 2R56H 2WLYA 3MLZL 3U7WH 3W9DA 2R29H 3VFOA 4FZ8L 2FL5A