3ULVF

Structure of quaternary complex of human tlr3ecd with three fabs (form2)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
217
Chain Sequence
QVQLQQPGAELVQPGTSVRLSCKASGYIFTTYWIHWVKQRPGQGLEWIGEINPNNGRINYNEKFKTKATLTVDKSSSTAYMQLSSLTSEDSAVYYCTRVGVMITTFPYWGQGTLVTVSAASTKGPSVFPLAPCSSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 217
sequence length 220
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvF02
4AL8H 2J8UB 4QEGA 2DQUL 3MRKB 1YMMA 2HMID 1CDGA 4HWZA 3H0TB 4R4NC 2H6PA 3F8UB 1A7RL 1HE7A 1JV5A 3QDGD 4P2CG 3BVNA 4G3YL 3S5LA 4JFFD 4YFLF 3MNVB 1NUGA 3NA9H 4GSDH 4G80B 1RUKL 2P45B 4P5TB 5TFSL 4EN3D 5LVEA 1KEGH 3E6HB 3L3HA 2XTJB 3KAAA 5I2IB 3BI9X 2JJUA 1II4E 3BYTA 1NCUA 6CGTA 5DMIH 5CJOL 4ODUA 5D6DA 1U8PA 4WTWA 2D7OA 3KNBB 4L8BA 4PBXA 4ZO6A 3CLFH 3WNPA 3ZHLA 5IKCB 3D85B 3X3FH 4ZMAT 5ADPL 4MA7L 4P99A 5JHDA 5K9QI 1DEEA 3S96B 5KSBB 5CD5C 5J9PA 2A9ML 3OB0K 1JNHB 4KDTA 4O2CA 3RGVD 2YEZA 4NM8L 5B22A 4CAGA 4XZUA 2XQYG 5HJ3A 4Y16C 1OLZA 4QRRE 3MJ6A 4LHUB 4U31A 4R0LB 4PJIB 1SQ2N 3ARFB 1GGBH 1WAAE 2PW1A 4J4PC 4X80H 1FZKB 1B6DA 1HH6A 3QHZH 4K3EH 1BOYA 4RISL 3W9DA 5D7SH 1GGYA 5ACZB 4WWKB 4BKLB 3HKFA 2F5AH 4KMLB 1A0QL 4M9PA 5CEZH 4CMMA 3NCYS 3C6SA 1XZ0A 2EH8L 3O11B 1VFBB 3P9MB 4OGYL 5J12B 2Z35B 2W65B 4NHUB 5CILH 4N8CL 4Z7VA 3AROA 2Z31A 4N0UE 4Y5XB 3ES6B 3UPAA 2J88L 5IBLC 2G60L 3Q6FA 3IFPA 4GUPB 4YHLH 2W60B 4FFYL 3OGCB 3FB5A 4JGMA 2ICCA 4RGOL 1CL7L 4DJMA 1KXTB 1C1EL 5F1NB 5JDSA 4QTIH 3KPTA 4URTB 4M6NL 1G7HA 3FQUA 5HDQL 3PP3K 4JY6A 1J8HD 2QKIA 1G7JA 5MEND 3GUTA 3WNMA 3EYQD 1DFBL 1RZKL 4OBRA 2FECI 4MHHI 3ILPA 4POUB 2NY4D 4CN6A 2ICWI 3BSZH 3BPLB 5HYFA 5J11B 1F4YH 2PYEA 1WCQA 1K85A 5EORL 2FR4A 1RHFA 4UB0L 4QRSA 4KRMB 3VCLB 3QPXH 3RPIB 3ZE0E 4L8SB 1E4KC 4HJJL 4OLYH 1AHWC 2VZ3A 1FNEA 1CS6A 2X40A 3PWVB 4GLRH 3MV8A 3RIAK 4ENED 4CGTA 4Q7DA 1NFDA 1KC5H 1HH9B 4Q2ZB 4LRNL 4X4MA 2AKRA 3SE4C 5KVDL 4OIAA 3CMOH 4GKNA 5GISL 3U9UA 4QY8A 2CO6B 3UBXA 5IVOA 4LDOB 4D0CA 3H8NA 1KEML 4AIXA 1OW0C 2VDOL 1RJZA 1P4IL 2XOTA 4HWBH 5IFAL 3CXDL 3RWJA 1PZ5A 3FHAA 1IC7L 3LHPL 4Q9CA 4C54A 5MEQB 1N7MH 2FGWL 3VDBA 3VXMA 3HTLX 4PJFA 5JLZB 4OI8A 4N5UA 5KVFL 5JUEH 5BRZB 4EN3C 5E4IA 3B9AA 2X4TA 5CIPA 3ZHDA 1C7SA 1RK1B 2BNRE 4D2NA 5I8OH 1MCKA 1A6ZA 1KACB 1UGNA 2EIZB 1FIGL 3NABL 4N8VA 4RFNB 3U48A 5HHNB 2VXSL 4I3GA 3VFUB 5GGQL 4PJXB 1BQLL 1NEZB 1ADQA 4PJ5D 4HDIA 5EZOH 4D9LH 2BVYA 4X8JB 4I0PA 3NN8A 3GSNH 4HLZG 2EDBA 2XNAA 4BYHA 4OM1H 5AZ2L 3MV9E 3WXWL 2J1KA 5FO8A 1MFCL 4YDKH 1UM5L 5GRZA 1QVOB 5KJRH 4DAGH 4ZS7H 2AJSL 2HFTA 4JN1L 4L8DB 4JM2B 2BRRH 2JK5B 1Z2KA 3IFNH 7FABL 4Z7VF 3BH9A 2FH8A 3V5DA 4DKDC 3SY0B 4P2QA 2VDPL 1PVHA 1PKQE 4PRDB 1I7RA 1WZLA 4OCRL 5B21A 5FM4A 1UWXH 4QRTA 2ITCB 3LS5L 5C0FA 4JRYA 1U3ZA 4IHOA 5ADOH 3I50H 5E8NB 1GGCL 1IAMA 5E5MB 3VFMA 5LQBL 5CGYD 2KQMA 1V3LA 2YKLL 3SGJA 4F9LC 3MZTA 3HE6B 2W0LA 4PS4H 3EW3B 4U1LB 3UROR 2NLJA 4P2OB 1GZQA 4PRID 1MVFA 1DANT 3KLAA 4LCWD 1PEZA 2XA3A 3LRHA 4P2RA 4MA3B 1UXSA 5T5NF 3QUMH 4DGYH 3GJFA 4HBCL 3BQUC 3L3IA 3EDJA 2XZCH 5IESH 2LTQC 4YO0A 5C0CD 2RFXB 3JVGA 3DNKA 1NC2D 4HWEL 3EYQC 2BNQA 5D2LF 2NXYD 4MQSB 1MH5B 4OLVH 4X0KB 5TE7L 4OV6F 3KWWB 1VFUA 3ARWA 4JZJC 4EXKA 2DIJA 5F8RC 2NY4C 5EU7E 1DDHA 3GSRB 3CFCL 1J0IA 5ETUA 5B39G 1G6VK 4JKMA 3FQTA 3BEWB 4LSTL 2XY2A 4Y19D 1P5UA 2WSKA 1CE1L 1MHCA 4KI1A 4QT5B 4WI2A 3DOSA 1C5DB 4WDIA 5LAXB 1N59A 3G9AB 3LEVH 5A43C 2YD4A 4NQVA 4JFEB 3WKNA 2HH0L 4MQXD 5T1KB 1EGJL 3VXPB 1Z9OA 3RX5A 5J6HB 1NAML 4KU1A 4GBXD 2R1YA 1MRDH 1OAUL 1TJIL 4XNZC 4A6YH 4Y89A 4ZFOA 3JV4A 4IIQB 5EO0B 1D5MB 4LSUH 5DD6A 5EBGA 5TQ0L 1X44A 4JFPB 2FL5A 5KS9A 1VGKB 2E7BA 2EDWA 4OTXH 2BVOA 4HHAB 2A6KA 2EDOA 4QKXB 2YK1H 1KXVC 1QSEA 3S88L 5EOQH 4O51A 2KQNA 4ONHB 5IK3B 2WBJD 4J3OC 2HN7A 3V52H 3QXAB 3S4SA 4OSUH 1NBQA 3LD8C 1CDIA 1P84J 5D7JD 1IC4H 3S37H 1U3HB 3BO8A 5C92A 3WDJA 1UKSA 4M7LL 3QFJB 2XQYK 4TUOB 4ZOBA 5D1ZA 3VWKB 3VXQB 2CK0H 4YHNB 2NW2B 3LN4A 1NH6A 1J10A 3C09B 3P77A 2OS7A 2VDML 5IVXA 2WQRA 5DJ2A 4FOMA 4NQED 4KK8D 1Q9LA 2E8YA 3HPJA 2AJUL 4NQDA 1K4CB 3MZGB 4WI9A 2XWJA 4XPHL 1U6AH 4RGNB 1T22A 1UWEL 3BGAA 3GI9L 3MO1A 1T5XA 4Z5RA 1I7UB 2VDKH 5JQHC 4U7KA 5IM7B 1Z5LB 4KDVA 1BVKA 3B8SA 2HVJB 3KHQA 4YBQD 4M43L 4M3KB 1X3DA 3IFOB 5FV2A 3K7UA 3NAAL 3FN3A 3QIWD 1A3LH 1FH5H 3RWFB 3KPPB 3LEXA 5C07A 2QEJA 3MRCA 3U6RB 2NYYD 2V17H 2IC2A 4K3DH 5DD5H 2QSTA 2ADGB 2MPAH 2B5IC 3JWNC 4R3SA 5C0BB 1D5XB 2MQ0A 3BEVB 3QUZA 4LGRB 3QNYA 1KF9B 3WV0A 4EQ3A 2ARJQ 2HLAB 5ICXB 3V6ZB 1TZGL 2GITA 1A6TA 1C5CH 3OKDA 1MCRA 2FNBA 3WD5H 5C86A 3M45A 2GEEA 1T21A 2HKFL 3NH7H 4NO3B 4PJGB 1A1NB 3DLQR 5DEZA 5CEYA 4DUVA 4M7JL 4ZFGH 4PJDA 4XMPH 1F90L 2P8MB 3BW9A 3SO5A 3OGOE 1KIPB 3LEYL 4H88H 3QWOB 3LDBC 3D0LB 1NBYA 1X5LA 4C4KO 5KSVA 4GLRI 4DCQA 3T0DA 1NCCH 3ARBA 5EWIL 5IGXH 3QXDA 4W81A 5C1MB 3OAZH 1P7QD 1UT9A 1D9KB 5GGRB 3DVNA 4L4TB 3ZT5A 3QDHA 2DM2A 4ONFL 4YFDB 2DLGA 1A9BB 2NXZD 2AJVL 3GSOA 5J0BA 2LQRA 1TZHB 1YY8B 4UQ2B 3O6FD 3ROOB 1NKOA 3TVMB 1EXUA 1NBVL 3HLAB 1LO5A 2NXYC 2EDEA 5HGBA 1KB9K 1MI5B 3MJ8B 3TV3L 3W2DL 2ZKHH 1N5AB 1X5AA 3PWJB 4FFWC 5J6GA 4O02H 4POYA 1UB6B 3MRNB 3QDAA 4M7KH 3B6SB 3WKMH 5C71A 4OF5A 5L2KB 1I3RB 2WUBH 4L3EA 3LAFA 5ESAB 4XNMA 5KS9F 4KHTH 3RWIB 1MEXH 3UTOA 1CVRA 4MQXC 4JVPA 2X6MA 4PD4K 4ERSL 1MCJA 2X4OB 4YHIB 3S34H 1AH1A 3S36X 2AJXH 1KGCE 4XNQA 1PBYA 5EBWB 2IFFL 1FFQA 1YA5A 3SCMA 3QIBB 5CJXA 1QQDA 2Z9TA 3JTSA 5IVXF 4JKPH 1IGYA 2H2SD 4BFEA 1R3IL 4AENA 1QLRB 2WBJC 4D9QE 3FQRA 1H5BB 1M71A 5D7JC 3TBSA 4M7ZB 1MJ7L 1U8QA 2GSIB 3BWAB 3ABZA 3OJDB 1K4DA 2MCPH 3LRSA 2XTJD 4YH6A 5DMJB 4PY7A 4OAWB 5EN2B 1S7VB 4PJEE 1OAKH 4HUKB 3LPWA 5DQJB 1OAZL 4NN6B 4HKXB 1VKXA 5GQBA 3F58H 3TC9A 4KVCL 1FL3B 3D85D 4Y4KA 4YHYC 5F72S 2DQFA 1HOCB 5IB4B 2CDFB 4M4PA 4BZ1L 4DW2H 4GG8B 1P4BH 1Z3GL 2E6JA 1BFVL 3KR3L 4YBQC 4XCCL 2FJGA 5D96B 3QIWC 1A6WL 1NLDL 3QRFM 1ZKAA 2YD1A 5F6IC 2NYYC 4ODTL 4X4YB 1RURH 4G7VL 4N8PA 3WBDA 4NJAL 2NMSA 2UVFA 3ARFD 2V2WA 3LKRB 4HFUL 1FYTA 3SBWA 5DD0H 4BZYA 3T77B 4XVTL 5EOCJ 2DYPA 5GS1B 4OUOA 4ODSH 4PG9A 1DN2A 3MUY1 1A7PL 1JPGA 4OCYL 5DJDA 3SHSA 2VWEE 4WWKD 4LPYA 3SO3C 4XPGH 3DWTA 5TQ2H 4Z7OE 1A6AA 5EU6E 2R29L 3H42L 3F12A 4ZFZB 5IWLC 4R9HA 1YNLH 3TIEB 2J6EL 2I5YL 4QHLA 2P5WE 2FYYA 1MHEB 5DJZB 2NX5B 4KVNH 4PRPE 3FT4B 3TESA 5A2LH 4GKSA 3LVEA 4MJ6A 1A22B 1RULL 4NKDB 4EBQL 4LCYB 3OKLB 3P30L 4OQTH 3MRQA 3OF6D 5EUOE 5KAQF 3K8MA 1OCWL 1OSPL 1U2HA 3DI3B 3EJJX 3RTQA 2R0KH 4LRIA 4PJHB 5IW6A 2A77H 1I8LC 5FDYA 5HYQA 2NXZC 1QPXA 1DLHB 2R0ZH 1CVSC 3O8XA 3QEQA 3O6FC 3KGRA 4EDXA 3AVEA 4HXAH 5ANMA 5TE6L 4JGJA 3H9SD 5ACLA 2VXTH 3ZLQC 2QQKH 1A1OA 1BVLA 1L7IL 4WU5B 1IKFL 4P4KA 3RNQA 1R5IA 3B8YA 4PRHE 1D5ZA 4HS6B 3O3AA 1EEZA 2A38A 5T3XD 3VFOA 1S9XA 4EUPH 1AGEB 3EOBA 5DWUH 4TTGA 3CFDA 3MRMA 4TPRL 5AYUH 5IT2H 4XBPB 1F4HA 3KXFA 4PJ8B 2OL3L 2LVEA 1HXMB 3EYUH 5H35B 2WP3T 4JM4L 5KVMC 4XX1E 2MHAA 2UZIH 5HXMA 3MLUH 4U05A 3BFOA 4F7EB 3S37X 1WJ3A 4JQXA 1FPTL 1BBJB 1F6LL 1CD8A 1ZVSA 4HC1L 5HHVH 3QWRA 4F58L 1HI6A 2H2SC 1FIEA 1YEKH 4XBEH 2ESVB 4B5EA 5SX4H 2HWZL 3WFEH 2R69H 5FUCE 1O7VA 3MMEA 4JANB 1EFXD 4HUMB 5BRZD 2YRPA 3T1FB 5CBAA 3O6LH 4U1SA 2XTJC 4AG4L 4AYFA 4LKXA 1VGEL 3Q6GH 4L3CA 4NZTH 1XF4B 1G0DA 1TTUA 3FO2A 3VWJA 3DECA 3N85L 4ZAKB 3GSXA 1C16A 1BPVA 2VLJA 4WHCA 5EB9A 5F1IA 5TFSH 3CVHL 3PGCA 5E9DE 3WSQL 4FQCH 2PCPB 2ADIB 3R0NA 3GKWH 1CDUA 2F74A 3BP5B 2PXYC 1A3QA 4YR6B 3U46B 4OM0H 4JM2D 4KY1L 1CF8H 4R90H 1QO3B 4PJBA 3EOAB 3CZFA 1KJMA 4LARH 2ICWB 1FV1B 3OXRA 3IDMB 4RIRA 4MA7H 2EE2A 1MLBB 3LKQA 2IF7A 3T8XB 1CXHA 5GGSY 1IM3A 3MRIA 4LL9A 3G5YB 1ORSB 1UWXK 5IQ9B 1MHPH 4MS8D 4I3RL 2AEPH 5EU4A 3TBVA 1UADC 1MELA 1VB9A 1WIOA 1T2QL 4WWKC 2Z8RA 4JG1H 3NPSB 4OD1L 3BAEL 4JDTL 3WFBH 5F96L 4MD5B 1EO5A 3PDOA 5J12C 3CC5B 1XGUA 1A6UL 3HG1B 3KS0J 4Q9RL 3HE6D 4PJCF 4RISH 4I13B 4Y5XC 4P2OD 5SWSB 3L1OH 1F58L 1BMGA 1KPUA 2AGJL 3OG6B 4LPUA 2AERT 3IGAA 2Y6SD 2YUXA 4LNRA 1T20B 1XF3A 5TDOA 3MOBL 1KCVH 1F4WL 1RJLB 2H3NB 3KPOB 3PL6B 4UT7H 4MJIE 2EYSA 5FA3A 1JL8A 4XC3L 1FSKB 5D2NA 15C8L 3EYOA 3HZYB 4ZYKB 3KPNB 3BIAX 5ALBH 1FLRH 4RGOH 2VLLB 4NZUH 5KSAA 2AP2A 2C3VB 3BPLC 4BA8A 1LK3L 5J11C 1SY6A 5C0DA 1D5BB 2FATL 5HDQH 1P2CA 1T66D 3GSWA 1RZ7H 4L8SC 5ID1A 1DFBH 1RUQL 1J8KA 2VSCA 1YPZA 4PGEA 1WLHA 1YNTA 1U93B 2KDGA 5IBUG 4ELMB 2ICEB 4RAHA 5IB5B 3IJYB 5T1KD 2RBLA 5IG7B 3T0EB 1SJEB 4A2MA 4JFHD 5IFJB 4G42B 1WVZA 2GYSA 4MLIA 5EORH 1FP5A 1UVQA 4EDWH 1QLEL 3KLSA 4FQ2H 4LCUA 5ALCL 2C1PB 3MXWL 2N7AA 4YXHL 1QR4A 1TNNA 2PKDA 1KTDA 3J8F7 5JW5A 4Y5YB 2CLVA 2BVQB 4I18A 5C6WH 2I9TB 2K3TA 3BD5A 3NCJL 4BFIA 3FB8B 4YE4L 4LRNH 4XXDA 5KVDH 3G08A 1J1PL 1U3HD 1ZA6A 1MHHB 3QFJD 4KI5E 3VWKD 4H20L 2UUDH 3NCCB 4NN7B 3IF1A 1FCGA 2IPUG 1P4IH 3K8LA 5EO9B 2ARJB 2VITA 3N1GC 2F53D 2CR6A 4RFNC 5DGQA 1IC7H 5JDJA 3ARTA 3S98A 4RGND 4RFEB 1KJVA 4K7PY 3N50A 3LRGA 1H8NA 4PJBF 1K9TA 2I24N 2Z92B 4XT1C 1EHLH 4IMLB 1BJ1H 3MLRL 4N0RA 2WWKO 4Y88A 4C55A 4HZLA 2PYFA 2VQ1A 1O0VA 4G8GA 5GGQH 5ID0B 5DJCB 4XVSL 4H8WC 3C2AH 1U36A 2P5EB 3RVTC 4PTTB 2D7TL 5HI5C 3VFPB 4WIQA 5C0BD 1O5DT 1RIUH 2Q3ZA 3RI5K 3QCVH 5KG9B 2YD3A 5IP4A 1KBGL 3WXWH 3MFFB 4G8IB 3MROA 2VRAA 5L88L 1DQTA 3MA7B 1UM5H 4Q74A 5DQDH 4NSKB 1T7YA 4UILL 6FABH 4MS8C 3HZVB 1IAIH 4MNQE 3E6FA 4OLWL 5FGSA 5DD3H 3MLSL 4PGJA 5DA0B 3U30B 3AM8C 4X4XB 4WUUE 5HGAA 4GRWE 1E4XL 1I85A 3L3OA 1A47A 2VDPH 4XCFL 1RJYA 3HE6C 1ZXQA 4F3FB 3V8CA 2EC8A 5FOJA 1M05B 4HMCA 3QDMB 3KPSE 1C12A 3LS5H 1S7QB 5IB3B 4YXLL 4D0DA 2BFVH 1XGTB 4DKEL 5DXWA 1D9KD 5K9KB 4L4TD 4Y4FA 2Y6SC 1RK0A 1JNNH 1Z9SA 4RQQB 2VQTA 5EZLA 3B9VA 3I2CL 1KLUB 5AEAA 3ZKMD 4U4BA 4NKOB 5IIEB 3TVMD 3VFWA 1YPZF 4L4JA 1GRWA 1S7WB 1BM3L 5TH2A 4E42B 1IM9D 1FYHB 4MYWB 3GMRB 1MI5D 3MPCA 2A74B 3D2UB 5D7KD 5I71C 2E9WA 4UT6H 5SX4I 3CXHK 4XX1G 2VLKA 2FJHA 4MXVF 4CU7A 4NP4L 1T66C 5L2KD 1EO8L 4PLOB 1L4IA 1PYWB 3TIDB 2Y1VA 4LPTA 1WFTA 1UCBH 1CZ8L 2WV3A 3VW3L 3MV7A 3CFCH 1HHHA 1KT2B 3RIFF 5B39B 2R15A 3BUYB 2PR4H 2WMPA 4B0MM 4OZ4B 4QRPB 4JPKL 4FXKB 4IIQC 4GMSL 2VIRB 2DTMH 3QIBD 2VDLH 4IRSB 1XT5A 2QQLL 3L6FA 3WN5B 4DQOH 4M1GH 3K8KA 1FO0A 3PDGA 1INQB 3GMMB 1SJVA 2EDFA 3O3DB 3MJ9H 5CGMA 1R3HA 5IMLA 4KTDL 1SMAA 4NQSA 4JDVB 4LP5A 1GOGA 1U3HC 3HI1B 2CKBL 5JR1L 1SEQH 4TNWK 4UUJA 4Q9BA 2C4FU 5E00B 3NCMA 1HHJA 4P4RB 5DRXA 3ULVD 4KC3B 4GRWH 1MWAL 3S88H 3HE7A 1OAYL 5HVWA 2Q87A 5BZWA 3LKOA 4I1NB 2F54A 1FJ1B 4RGNC 1NBZA 1I75A 1Q94A 4R96A 3I84A 2OXGA 4IDLA 1JGUH 1FFOA 4X7SH 2X70B 5IEHA 5F7DA 1L0XA 4OZIB 1P7KB 1OGTA 1T0MB 4UBDC 1EFQA 2VDMH 1RUAH 4QRRB 4X5WA 1JK8B 3BHBA 3SDXA 3L3GA 5HHPA 1IGCL 2Z91B 3FT2A 4MZ3A 1UWEH 3JV0A 2G75B 2XY1A 5KW9L 2W1NA 3L5WA 4Z7QE 4NNYB 1Q9OA 3DXAE 5D1QA 1OGAE 3DV4A 4HG4K 3LIZH 4MSWA 4JO2L 1FL5B 4M43H 1PFCA 2IGFH 2WBKA 2QSQA 3M1BA 3VGBA 1YMME 1YN6B 3KJ6H 3DO7B 1CL7I 1L7TL 3RUGA 1QBML 2EO9A 1AP2B 3VXSA 4MCZB 1ZLUH 3ZKQD 1BIHA 5GIRB 5DHVA 4K94H 2BCKB 2BP3A 2APBA 5IB1A 1YMHA 4UT9L 4HT1L 2YUZA 1S5HB 5DRZB 2L4OA 3IRPX 3VGAB 1JZ6A 4KROB 5TF1L 5MEPA 2OXHA 4GJTB 3C6LB 1AQKH 3TJHD 4HFWA 4HKJA 4U1JB 1G7PA 2P42B 2R0WL 4LVOC 5BV7H 1D9KC 4EVNB 4X98A 3GMPB 2BSRB 4J3SA 1F90H 1MCCA 3V5HA 4S1RL 3WIFB 3SKNA 2F8XC 1DN0B 2LAAA 4I2XE 4M9OA 4Q0XL 4FZ8L 3PXHA 3ZKMC 1NDGA 1CDCA 1ZHKA 1LEGA 2DKMA 2ZG1A 5FB8A 3TVMC 3CFJB 2R2EB 1F4XL 2MQCA 1CGVA 1B6UA 2VDRL 3QDGA 4XCEA 1FVCA 4U1MB 3ZHKA 3N1FC 4PB0H 1MFAH 4JFFA 4WI7A 2CO7B 3FFDA 2FD6H 3BPNB 4KH2A 3B3IA 3GI8L 3IJSB 3GBNH 1I9IL 4JY4A 4KRNA 2AJVH 4IRZH 2V7NA 3D3VB 3QEGH 4P46A 4YDJB 3ZKND 3IFLH 4RX4D 4WJ5A 4X4ZA 1QBLH 1NFKA 4YAQB 3TV3H 2RHEA 5H8DA 3VFNB 2IPUK 5HGHA 1BIIA 4Y1AE 1CGSL 5IV2B 1HHGA 4ZUSB 4PJ8D 3DETC 3ARSA 4DUXA 3UYPA 5GS3A 2Y5TA 4Z7VE 5DK0B 1DQLH 2IQ9H 3RGVA 4R8WH 2BSSA 3QIBC 5HY9B 5HYSA 3BZ4B 2CLZA 5DO2C 1IQDB 1HQRA 1NGYB 2OSLA 1FNLA 1A2YB 5I76B 1JPTL 4QWWD 2DICA 1PG7X 1GZPA 3LZFL 3PGDB 5F88A 4BFGA 4GW1A 2VISA 4HUVB 3DX8B 4V1DA 5F9AC 4P9MH 2IFFH 2O5ZL 3GIVA 1GHFL 3OXSB 4PFEA 2AJ3A 2OZ4L 5DMGD 1CCZA 2ENYA 4XPFL 5I1EL 3IKCB 4QF1A 3U2SB 1BREA 3AS3A 3ULVC 4OZHA 4BH7A 5GRXG 1JGLH 1BF8A 2FX8H 2DDQL 3BE1L 3V4PH 4WHTB 2OMNA 2PYEE 4NN6C 5L2JB 2AXHA 1OQOA 4ZAKD 4JCLA 1CU4H 3O2DL 3TYGL 4BQ6A 1XCTB 2PNDA 2XWBB 4EEEA 5D72H 3CLEL 2DL2A 3I6KB 3QO0B 2D7NA 4H26A 1NFIA 2D4FA 2BJML 4A6YB 2DN7A 3EIFA 1QSFE 3MUHL 1WWWX 3T3PF 1F3RB 1M7DA 1OAZH 1T89A 5D96C 1CDHA 1S7UA 5FA4A 2RB8A 3GSUB 4MD0B 1NFDE 2BZDA 4KQ4L 4X99A 4QO1A 4KVCH 4GAYA 1RVFL 4HH9B 4X4ME 5DUBA 3THMH 5MENA 4OCXH 1K8IA 2N56A 1M7XA 4K7PH 3M17A 5IHZB 1PKQB 4M6MH 1OAXH 2FB4L 5C2UB 3CFKA 1Z3GH 3KR3H 1A7NL 5I19L 1IRAY 5IMKB 5GS1C 1NLDH 2DS4A 1VACB 3MCKA 4OLXL 5DVKA 1T1WA 3LKNA 4ODTH 3QG6B 1WZ1L 4HF5L 4J3TA 3STLB 3W5NA 5I74C 3VXME 3B5TA 2V2XB 4HUXB 2P24B 1HILB 4PJFE 4Q6IB 2BXZA 2YN5A 2V6HA 2VL5A 1FE8H 2AABH 2XWTB 2GJ6E 4S0SD 1WWBX 2E27H 2Q86B 1AXTL 1M7IA 2NW3B 3ARDA 5SWSD 4TUKL 4WY7H 1I1YA 3LMJL 1B2WH 1YN7A 1IEBB 4QCIB 4R26H 2P48B 2R29H 4ODVL 2VN7A 3K4AA 4LPCA 5EZIH 3MLPA 2J6EH 2I5YH 4AH2A 4LLDA 4H8WL 4NC1E 5F7EL 25C8L 4LKCA 3PL6D 2ICWJ 3CDGA 5GRVK 5FM8A 1PKOA 5F7NC 1JHTB 5EDXA 4GAGL 4MAUH 4UV4L 5C8JB 4DK6A 3ROLB 1M4KA 4RAUA 1ZGLP 2VZSA 1LDPL 1N0LA 3GBML 1FG2A 4MQ7A 3B2VL 1WCBB 1T1XB 4OGZA 1H15A 2PO6C 1Y18A 5GS2H 4NDMB 2CXKA 1QA9B 5IHLB 2FGZA 4W4OA 4JQIL 1U8KA 3FO9B 5ENWA 3T0ED 4PJ5A 1UQSB 4X6FB 4LFHD 4JR9H 1S7SB 3PG2A 3P9LA 4JRYE 3O9WA 1NGPL 4RSVA 3O6KH 5TPWL 3KYMB 4I48B 3WEXB 1PY9A 1MJJB 4RZCB 4UAOB 1YQ2A 2JB6A 3V4UH 4NNPL 3BJ91 3SPVA 4TPRH 1T7WA 4M8QB 2A83A 4CVZA 3CPLB 2DBLL 5I18H 1KELH 4P2RE 2YR3A 3B9KB 1R24A 1DQMH 5DJXA 4QWWC 2BNUA 3HNVH 2HJFB 1LEKA 3ARRA 5CSZA 1F3DH 2RJMA 2YD2A 5J3HD 1QR1A 3C8KA 4PLJD 3VXTB 2HRPL 4PJ9C 4KV5E 1W72A 4NRZA 5EBMA 3DUSB 2BNQE 5DMGC 1A7QH 1X5JA 4RWYH 1RFDL 2A6JA 3DYPA 5CIPH 2QHLA 3DUHA 4JAMB 5DRNA 1J87A 3SDDB 3MRLB 3WS6C 2BC4A 1AQDB 3ULUE 2EDKA 2EIBA 3MUGB 3RKDD 2AK1L 3G5ZB 1T1ZA 3IDNA 2AS5M 3RKPA 3HRPA 4LSQL 5EU3B 2NNAB 4PRIA 1MCWM 3IS0X 2ADJB 1V7ML 1VGEH 3V7AG 3F7RA 2D9QB 4ZG1A 3FMGH 5IFHH 3BESR 3OHXA 4JFXA 4PUBH 4DOHE 5I1KL 4ZUUB 4Y2DB 5DHYB 4EJ1C 3FFCB 1R5WB 1KTKE 2OI9B 3N85H 1S7XA 5E5UB 4OFPA 5C0CA 5ICYB 4NRYB 4X6EA 3TJEH 1XR8A 3FQXB 1VENA 2B4CH 1NCDL 2M2DA 1KB9J 4UV7H 1PQZB 1QSEE 3BZFA 1NMAL 4N5ED 1DUZB 4XGZB 1V3JA 2H9GB 4KJYA 4ELKA 3NPSC 2EYRA 1OARH 4G9FA 1JE6A 1YEFL 2X4UB 3TGXA 5DJ0B 5BS0A 1LEIB 5JPMA 3QI9B 4HBQA 4YGAB 4H5SA 5E0QA 2ADFL 4G6FB 5IOPA 3QDJA 5IVXE 5LXGH 4I3RH 2FIKA 3MLTB 4PD4J 3FO0L 4GBXA 2VC2H 2ZUVA 4NQDE 3QDMD 2E9JA 3BAEH 3ARGA 1UJ3A 3A67L 1LWRA 1AE6L 4XP6L 4D8PA 2ITDB 4GXUM 4LDLB 1QYGL 5DK3A 4Y5VB 4GW5B 1ORQB 2HT3D 1UWGH 1AGFA 1HHIA 3GJFH 3PJSB 3PL6C 4X5XB 4LSVH 5DTFA 3ALXA 5E2WH 1DBKH 1FSKC 2P8LB 1INEH 4JQVA 4OV5B 1LE5B 2AGJH 2IPTL 5IMMA 1PGRB 3D2UD 4RCAA 5C07E 4JHAL 5T3ZE 4XMKL 5I16B 5T33L 1OT2A 1RI8A 4AY0A 5I1AA 1UM6L 5B3JF 1KB5A 4MNHB 5DQ9A 4ZTPH 5LBSH 2HFEB 3MBED 3UZQA 3WLBB 3ULUH 5CEZD 4AMKH 2DLFH 1ND0B 3HPLB 1F45A 4J3UA 4LMQE 4OZGA 4XXCA 4R4BA 4KAQL 1QZ1A 1JZ7A 3I6GB 5I1LA 4GAJH 3T0EC 3IAPA 1SYVA 3IVKB 1AXSA 1LK3H 4HX1A 1JPSL 4AEHL 3IAQA 2AJYL 4QXTB 5C2BL 5DJYA 4LCIL 1C5BL 1B0GA 4PJDE 3CFIC 2IH1B 1TQCB 4WO4A 2Y4SA 3DVFA 3DURA 4IRSD 5D7LA 5IBUB 1RSFA 3BGMB 3R1GL 3VXUA 2LFGA 1SVZA 1WBZA 3FN0H 2X42A 2ZOLA 3MXWH 2DQEL 1F6AA 4F7MB 1JWMB 5J3HC 1A5FL 1DSFL 1RIHL 4JRWA 4PJEB 4QNPF 1OB1B 4NN7C 5GRJH 1FVDB 1IQWL 5HYIA 1NCBH 5DD1L 3W5MA 3DIFB 3DSFL 3GHBH 5JQ6L 1ZSDA 3C5JB 1Q0YL 5CJQH 1G7MB 2C3XA 1IBGL 3UTTA 5IWLA 4XH2B 4C57C 5L6YH 5I0ZA 3H9YA 1P4LB 2AAVA 2O61A 3RKDC 5CZXD 3A6CL 1KFAH 4L29A 4H20H 1NLBL 2Y06L 2F58H 2CRMA 2XKNB 1Q72H 1FFRA 3WXVH 1P7QA 5CGTA 4QRRD 4G9DB 2DWEB 4QTHA 1DLFL 3RDTB 3QZWG 3VI4F 3VJ6A 4RGMC 3QUKB 3Q5OA 4JJ5B 3I75B 4QXGH 3BZEA 4DZBA 1FGNH 1GSMA 4M7LT 5T3ZH 1MNUL 5B38G 4QYOA 1A14L 3D9AH 4HJGB 4JN2B 5C0IB 1RU9H 2VKXA 3RWEB 4X7TA 4GQPH 1LNUB 5E7BA 3N1MC 3UYRH 4HCRA 2DQHH 4P23A 5CWSB 1EPFA 4OLEA 5FKAA 5BJTA 4XVSH 2WIIA 3QFDA 4N5EC 3MRDA 1AY1H 4IBLT 2WIMA 1YY9C 2HJLB 2P5WB 2OR8A 1CFVH 1RZFH 1CBVL 4XP5H 5FYLL 5E94B 3U30C 3V6OC 3NZHL 1XF1A 3GSVB 3BPCB 4LIQL 1MCFA 2DI8A 4FQXA 4DVRH 5HYJB 5E6IB 5EUOB 4MDJA 4KROD 3I02A 1HHKB 1CLZH 4ZDHB 2ZSWB 4KJWC 4OLWH 2JELL 3X12A 4NUGL 3VFVB 3OAUH 3FN9A 3HR6A 3T65A 4M8VA 1T0NB 3P40A 5I6XC 2J8UA 4UNVA 1NL0H 2HT3C 3V6FB 5CCKL 1AC6A 3IB4A 3R06B 1KNOB 3WHXA 1Y6KR 2FO1A 3AAZB 1GC1L 1Y0LB 4YXLH 1NGWA 2GTWA 3MNVA 1BGXH 4BFBD 5KVEH 1UACL 1SJHB 4P5TA 3GSQB 4QHUA 5BMFH 3AREA 1T7ZA 3IRZA 2CXGA 2ZCHL 2FO4A 3PDDA 1QNZH 1R0AL 3C60D 3EDEA 3MBEC 2V9RA 2Y36L 3MXVH 4OIBA 2JKXA 2AK4E 1AIFA 3KNBA 4YLQT 3LKPB 5CJ8A 3T4YB 2V2TB 3BN9D 3B5HA 2EC9T 3UPRB 5IKCA 4X6CB 5SWQA 1MFBL 1OP9A 3U9PH 2W9EH 4JRXA 5B8CB 4Z9KB 1N64H 2VYRE 4N90E 3S96A 3QEHB 5KSBA 5F7MC 5E2VL 1EO8H 2QQNL 4IRSC 4B41A 4U6VL 4S1DD 1CZ8H 1S9YB 1MIML 4KMQA 1FZOA 5AG9A 2B39A 2UYLB 4LGPB 4LHUA 1MSPA 2QBWA 4R0LA 5F3HA 4J6RL 1BWWA 3HR5A 3RWCB 4NBYB 4JPKH 3TNMB 4B7IA 3ARFA 3SKMB 1MIEH 2F19H 5C0EB 1FZKA 4GMSH 3D1MC 4L1HA 4L5FL 3O4OB 4KZEL 2FJFA 5JXED 2FX9H 2VMFA 35C8L 3QEQE 3U36A 1JHLH 5ACZA 4D0BB 4BKLA 5ANME 2FH6A 4F80A 1NMBH 1DQQB 3HHRB 1XGYL 3P9MA 1VFBA 1AO7E 1MJUL 2Z35A 3RZCB 5E1AB 5E9DB 1UH2A 3MV9D 2DQCH 5K9OB 4UIKH 1XH3B 3GK8L 5CZXC 4U1HA 5AD0B 3L9RA 3LQMA 5FCUL 4JFZH 1S3KH 2NY7L 2W60A 5C08A 3OGCA 2DJ4A 4M62L 3GM8A 2YA2A 5FCSH 4MAYC 5IB2B 5F1NA 5E8PB 4OLZH 1F2XK 2HJKB 4OGAC 4LLAA 5IBTH 3T3ME 3KXFE 1OQXA 1RV6X 3OX8A 5LCVH 2ZPKL 1ZT4A 1G1CA 4WFHE 1Q1JH 4AIZB 4I5BB 1SEBB 4MB5A 1FQ9C 3ZE1E 1AI1L 4XWGL 3BDYL 4HS3B 4LCCA 4FFZL 1V3KA 5INDB 1G6RL 4PGCA 3ZE2F 1QFPA 1BZ9B 2F8OA 3DSNA 4NKIL 4PTUB 4F7PB 5HHQA 3QNXB 5C6PB 4GH7B 4DN4H 3JTTA 5L7XL 5JW4N 4JO4L 2ENSA 5AAMA 1M6OA 3PV7A 4JO2H 2BY3A 2J8UF 3PWVA 4PV9B 3TO4D 2IBZY 5FHBL 3VGAC 1TPXB 2JE8A 5J13B 3NTCH 3U0TA 4KROC 5IVZA 1BX2B 3U0WH 1OD9A 1PLGL 3TYFA 4ZNEA 1HH9A 1ZMYA 2X4SA 3I3DA 4Q2ZA 1QFWL 1QRNA 4W6XB 2ZWLT 4ZD3L 2DI7A 5F1OB 4M3JA 4MJIB 3QNZB 2R1XB 4GRLA 3WIHA 5DFWH 1T83C 3BRDA 1JGDB 4N0YL 4WUKH 4XAWL 5FDWB 4XMLL 2W9DL 1A6VH 1R3JB 2Y7QB 1ZLVK 4FP8L 1K2DB 1F8TH 2AV7B 3F62A 3JWOL 3QAZB 2JJTC 4GRMB 5MEQA 2O5YH 3DHMA 4IMKC 4Z76B 2LE9A 4XP4H 1XIWA 1MQ8A 4KKBD 2LV4A 1EJOH 1I9EA 3BPNC 5BRZA 4PJBE 4U7SA 4E0RB 1BLNB 4QHMB 3IDGB 4UDTB 5KSBF 4KK6C 4J1UB 1RUPL 5CEXB 3H6JA 5FUZH 2CUMA 4TOYL 5FKPB 3C60C 2EIZA 2L7JA 1HKLH 5HHNA 1F4XH 2A6DB 5CAYB 3VFUA 5I1HH 1RHHA 3LH2H 2KZ1B 2K1MA 4EQ2A 1HEZB 5C0RH 3BKYH 2I25N 4X8JA 3BN9C 5E4EC 4NJ9H 4PJIF 2DD8H 3GI8H 4YHKH 4RRPG 2G5RA 1CFTA 4YX2H 3UZVB 4TSCH 3UTZB 5GGRY 3RWDB 1SBSL 1ZHBB 3L3KB 3OKOB 4JZNA 3RX8A 1QVOA 1YDPB 1T1YB 5J8OA 3FB7A 1DTUA 2Q7YA 2EKSB 4L8DA 4S1DC 2E9IA 4JM2A 2JK5A 3BKCH 3B9KD 4OCMC 5K33A 2P49B 3RHWK 1TCMA 1KYOK 1HZHL 2MMXA 2BXYA 1FAIH 3SY0A 3WJLC 1AJ7L 5FUOL 4YXKL 4PRDA 2JCCE 5JXEC 5CHNB 5DT1L 4ZXBB 5C0ND 5D2NE 2QL1A 4LMQI 3MRBB 2C4XA 3GB7A 3ZYIA 2ITCA 3U0PB 5BVJB 5DI8B 3SEPA 1JPTH 5BXFB 1EZVY 2P43B 1U92B 3QUXB 2ZCLL 3B9EA 3QXWA 4UNUA 1FBIH 3JV6A 2O5ZH 1GHFH 4U1LA 1U8HB 4P2OA 5DK2B 5HGGS 2D2OA 1P5VA 1FAKT 2J4WH 3NGBB 1YPZE 4FQ1H 2X1PA 4MA3A 1CD0A 2B0SH 3LQAL 1QP1A 2DDQH 1S8DB 3FRPA 4UOW1 4RAVA 3QG7H 4Y2DD 3MA9L 3FFCD 4NHCL 3L5XL 2M1KA 4ODHH 5INCB 3F6LA 1WWCA 3EFDH 1NAMB 2BOCA 3MOQA 4X0KA 3KWWA 3KJ4C 4L8CA 1AR1D 2HTLD 4AEIL 1QUNA 2QR0B 3BEWA 3CXHJ 2NTFB 5GHWL 1XGQA 3EHBD 1X5YA 4WUUB 2IANA 4GRWB 4QT5A 1K6QL 3O3EB 1C5DA 1YEHH 5LAXA 4ZTOL 2FB4H 1VFAB 4JFEA 1JBJA 2A6IA 4Q6IC 4EXPX 3QI9D 1A7NH 3KPSB 3TO4C 4G6FD 3VXPA 3WCYA 1KENH 3RX7A 5J6HA 4BSWB 3DO3A 3RY6C 2Q6WB 2QSCL 5GGTA 3PP4H 3L7EB 4HF5H 5DS8B 4IIQA 2DMCA 1D5MA 1R3KB 2Y5EA 2D31B 2VZ1A 4HAGA 4JFPA 1DBJH 3GJFK 4JO3L 4XPAL 4HHAA 3SDAB 1XF5A 5CP3A 5EU7C 3MLXH 4MQTB 4ONHA 4OKDA 4C56B 5J57B 5IK3A 1AXTH 3QXAA 1LP9B 3QA3B 4PJXF 3LMJH 3PHOA 4G8GE 1T2JA 1S9VB 1IGJB 4PREA 1BOGB 4KKBC 4TUOA 3P3YA 5F93C 4I4WB 3VWKA 4JFDA 2NW2A 4GSDL 1VA9A 5F7EH 4UQ3B 1SY6H 2OJEA 4RFOL 5IW1B 5DMIL 3ZKSD 4OZFG 1K4CA 4LLVB 3VFSB 4DKAA 3KYNB 4G6JH 3G6DL 3SGEH 5FGCE 2V5TA 3N0PB 4JM2F 3DX6B 3UC0H 4G7YH 5C3LD 1A4JB 1ONQB 1KGCD 3NZ8B 5EC2A 4WEBH 1MCQA 3CLFL 5GGSB 3MRHB 4X6DE 5HHOA 3GBMH 43C9B 3FQWA 2OTPA 1QPPA 3GO1H 3B2VH 4XPTH 2HVJA 2BVUA 4TNVF 4UTBL 4ZPTA 3G6JB 5BV7B 4IM8A 1DBAH 3KPPA 3VXOB 2EE6A 4D9QD 5JO5A 3U6RA 2YPKB 5EUKB 4F7CA 3SQOL 2HTKC 1HK6A 3SE8L 3B9KC 3BEVA 5C09A 4R6UA 4HG4J 1NGPH 5JPNB 1IT9H 4ZUTB 2HLAA 5ICXA 3OKEA 4JO1H 5EZJB 1GGBL 1FVEB 3RL2B 4K3EL 4CNIB 4HEME 1YQVH 5D7SL 1NKRA 1A1NA 4G6AD 4Y16B 3DROB 4C59B 4WV1C 5IROA 4BK4A 4GXVH 3N9GH 4X6BB 1JTPA 1WZMA 5CEZL 5JOPE 4S2SB 1C08A 43CAB 1OWRM 3FT3B 1CLOH 4AEFA 2VLKE 1KIPA 2ATPB 5FEBA 4POZD 2HRPH 2YPVH 1E28B 3WNKA 2V5SA 2E7MA 1X5GA 4Z0BH 3MACH 4YHLL 3NFPB 3RDTD 1DQJA 3HZMB 3DXAB 1OGAB 2XXMB 3MV7E 1HKFA 2OK0H 4Y2DC 2WP3O 1A9BA 2GJZB 1T4KB 1EAJA 4QTIL 2OI9C 5I15L 3OQ3B 4NQCE 2JIXA 1IVLA 5C3TA 1TZHA 5D6CB 1YY8A 2CIIA 5DZOA 4UQ2A 3ROOA 3TVMA 5C9KA 5IR1B 1PSKH 5HYEA 3VRLE 8FABB 2XN9B 5KANG 3F7QA 1IZJA 3MJ8A 3PABB 2H6PB 4JPIA 5A2IH 2H2PD 3BSZL 4LPXA 3CSYA 1N5AA 2HTLC 3PWJA 3S5LB 3OV6A 4YHPB 1F4YL 1MRFH 3MRNA 4DZ8A 3B6SA 3QPXL 3EHBC 4XCYB 2P5WD 5L2KA 1I3RA 3RVWD 3ARUA 2V7HA 4OLYL 3DGGA 3EGSA 1NCDH 3QI9C 1U8PB 5HYJD 5E6ID 1VADB 4L8BB 3BJLA 1NMAH 2O93L 2X4OA 4YHIA 5DFTA 4I9WE 3VRIA 3LSOB 2J8HA 5DFVD 4GG6E 2D0HA 2F54E 4I2XB 1UENA 3PWUB 3PNWB 4K3GA 1UKTA 1DEEB 3AB0C 1FDLL 1RD6A 5I9QC 5J9PB 3DMMD 5AWNH 4Y5VC 3P9WB 2YEZB 5ISZB 5D1XA 5HJ3B 3S36L 1YYLH 4PRHD 2UVEA 4HWBL 4KTEH 1H5BA 3MRPB 3SDXE 3TCLA 1JF5A 2OJZH 4ZUWA 4NWUH 2GSIA 3BWAA 4XP6H 4HGKC 5FF6B 1HH6B 4HWNA 5JUEL 2FX7H 2FHBA 2BY0A 1YYMH 3W9DB 3TBTB 4OAWA 5HDBF 4M1DH 5DQJA 5I8OL 1TCRB 4Y1AB 2IG2H 4HKXA 3C6SB 2EH7L 3FAXA 4XMKH 2J3SA 1FL3A 3RUGE 5T33H 1YEDA 2XZQH 3VXSE 2J7LA 2Z31B 1HOCA 3GSNL 2XTLA 1LVEA 1ZE3C 1TQCC 4PLNC 3FB5B 4YDKL 3C5SB 4M02A 5KJRL 4DAGL 4JFOB 4PJGF 1BQHA 5JDSB 1KG0A 2AW2A 3RRQA 1ZLSH 4AEHH 1G7HB 5FYLE 1WITA 2QTEA 4CADB 2BRRL 4M4RA 4N1HB 5C7XH 1FRGH 1FO0H 1C5BH 3ZO0A 2X4PA 1XCQB 3IFNL 1T3FA 3ALWA 3LKRA 4LGSB 2GFBA 3T77A 3ILPB 3OKNA 3E1F1 4OCLC 4O5LH 2PYEB 4WI3A 4G6AC 2R2HA 5ESQA 3QDGE 4JKWA 4ZFZA 4JFFE 3RZCD 3O0RH 2Q8AH 1TZIB 5E9DD 3WNNA 2NCMA 4B53A 3MJ7B 5DJZA 3SGDI 2NX5A 3FT4A 3HB3C 1QSFB 3MLYH 4POZC 1YUHB 1IQWH 4NKDA 3DBXB 4LLMA 3C87A 1KOAA 3MGAA 4LCYA 5DD1H 5F97E 1NFDB 4MA8H 3TO2B 3RDTC 3TA3B 1OT1A 4CJ0A 4NFDA 1ZT1B 5FGBA 3I3BA 3QUML 3U9UB 4ZPVB 4DGYL 4QY8B 1U8OB 5BZDB 2J12B 3GGWA 1NLBH 4YC2C 4RDQF 4NRXA 1RJZB 2GUOB 3O3BB 3TP4A 2OL3B 4LU5H 5J1SC 2VWEC 1VHPA 3BH8B 2EDNA 3RWJB 1PZ5B 3QZWB 4G8EA 5FO7A 4CN4A 1D6VH 2H8PB 3VXMB 4PJFB 1KCLA 3I3EA 3KLDA 3BQUB 4F9PC 1J8HB 1MNUH 1IL1B 2ZJSH 5B38B 3RVWC 1TETH 1AGEA 5I1GH 2GJ6B 4V1DE 4CU6A 3A0OA 3W82A 3CMGA 3FCTA 4NUJB 1OAQH 1P6FA 3RA7H 5E6IC 1G7LB 1JUFB 4I0PB 3QHFH 4PJ8A 4OZHE 3PHQB 4JHZA 1FCCA 3MRFB 1MRDL 2J5LC 3UZEA 1RUML 4CVXB 2WBWB 4MJID 4A6YL 4QLRA 3P2TA 1CBVH 5FYLH 1WQVT 4F7EA 4UZGA 2F5BH 3DMMC 5FO8B 1R5VA 5AUMA 3TF7C 5K59F 3ULVF 1GGTA 4OTXL 4NT6A 3P4OA 1N8ZB 3QIUB 5E6YA 2ESVA 4BSVA 1G9EA 4OSUL 3KDMA 4KXZI 1JF1B 1IC4L 2OTWB 3S37L 5F9JA 5DA4A 3V5DB 3RIAF 3T1FA 1TIUA 1QBBA 2CK0L 5LG1A 1I7RB 3SE3C 3LOWA 4ONGL 2IMNA 4PGBA 1ZWIA 3ECBB 1T7VA 5C0FB 2WAHA 2XA8H 4JRYB 1XF4A 4IHOB 1GC1H 4KKLD 5HHXH 1U6AL 3CX2A 4ZAKA 1HYSC 2DAVA 2O5XL 3VFMB 3KVQA 4NQUA 1CTOA 4KK9C 2VDKL 3T2PA 3U7YH 4KK5D 1FZJB 2GSGB 4F57H 1TTGA 4P59L 1BJ1J 2PCPA 3NFNB 3U4EA 3KLAB 4HV8B 1QFOA 3IU4H 4P2RB 3BP5A 1OTTD 5IF0A 1UXSB 3U46A 3NIFF 1A3LL 1FH5L 3DHJA 2HLFD 3Q48A 4KQ3H 1QO3A 3NFSL 2V17L 4K3DL 3C5ZA 5DD5L 4KI5D 3H3BC 4M00A 3IDMA 2MPAL 4YO0B 1VCAA 1FNHA 5GRUL 5E2VH 2BNQB 1LO0H 3G5YA 2CGRH 3O4OC 1C5CL 4ZXBD 2NR6C 2ZUYA 8CGTA 3HUJE 1GPOL 2ZSVB 4LAJH 5ETUB 3WD5L 3NH7L 1NANI 5CBEB 3FQNA 4J6RH 3VXNB 3WFHB 3RZCC 4PJHF 4ZS6D 4FTVA 1I8KA 3F7VB 3HG1A 1YECL 1FG9C 2JJWA 4NO2B 3WNOA 1B0RB 5SWSA 1Q9WA 3IXTB 4DOHB 1U8MA 4OLUH 2MFNA 2PF6A 3JV4B 1RJLA 3BXNA 3T0VA 2C7UB 2H3NA 3LDBB 3L5IA 5FCUH 2BVOB 2OM5A 2A6KB 2YC1B 1V3MA 4Z7WB 5M95B 4O51B 3KPNA 4MNQD 5D9SB 4LCWB 3S4SB 1G0XA 5E7FA 2C3VA 3UDWC 4OFYA 1UYWL 4Q6YA 2CIKA 1D5BA 2ZKHL 1UH3A 2YD6A 5D1ZB 3EJZD 4M7KL 4WUUD 1JZ4A 3WKML 1HSBA 1PDKA 5DJ2B 2WUBL 1U93A 4RDQG 4WW2C 1AI1H 3HPJB 3QH3A 4NQDB 3BDYH 3DYOA 3KPSD 4KHTL 1U95B 5CZVH 5IG7A 1MEXL 1SJEA 2QQQA 1TPXC 1JYWA 5IFJA 1MF2H 2C3GA 3U1SH 3VGGA 2XT1B 2OX5A 1QLFB 1T5XB 4Z5RB 1NGXA 2J8OA 1BF2A 3EJYD 3O4LA 5DUML 1OHQA 3CX5J 3S34L 2XG4A 2AJXL 4Y5YA 4LHQB 1YZZA 2B1AL 3SDCB 3SDAD 2I9TA 4QNPE 5HDOA 3H9HA 3LEXB 5C07B 3QAZC 1QFWH 5BOPA 3W11D 2PN5A 5BW7C 5MHSE 3QNYB 3SDYH 2DM4A 2CSPA 4JVUA 4N0YH 1JMXA 1EO7A 3OKDB 2IWGA 4U1NA 5EO9A 2MCPL 2ARJA 3MC0A 4FP8H 3JWOH 5IJVB 3K1KC 1BFSA 3EDDA 3AFLA 1OAKL 1X6LA 1CR9H 4RFEA 5JOFB 2ID5A 2X7LA 5ECJE 3KYKH 4KKLC 4PJDB 3W9EA 3F58L 3BW9B 2PTUA 1ES0B 4KK5C 1NBYB 3MCLL 1NGQL 2X5PA 4G9FE 3OR7B 1RUPH 4IMLA 2A9NL 4DW2L 1JNLL 1ZHLB 4PJAE 5BS0E 1P4BL 4NQEB 2F9BT 3QXDB 4NNXA 4P3CH 5H94B 1OTTC 5ID0A 5DJCA 3VE0B 3TLRA 3QDJE 2P5EA 3O6MH 4QHKI 4PTTA 2HLFC 3G5XA 4WFFE 4C58B 2JJSC 4KI5C 3GKZA 1RURL 1A8JH 3AS0A 4G8IA 4XC1H 2G2RB 3UJJH 3DX9B 1LO5B 3MA7A 5DHXB 5HGBB 1FN4A 2M8XA 1IFHH 5DEGB 5DD0L 3X11B 2L7UA 3HZVA 3SGKC 3SJVA 4ODSL 4ZXBC 1F6FB 5J6GB 4KKAD 4RMUA 3D5OF 1W72H 1AGCA 2H26B 1AGBB 1G9NH 1X5KA 5TDPA 3PF2A 3GZKA 4X4XA 1UH4A 4ZS6C 1YNLL 4V2BA 3IDUA 4P48A 4L9LA 4YXKH 4F37K 3VD3A 5HYSG 5DT1H 4OZGE 5JZ7D 1B3JA 2P4AB 3QDMA 5IB3A 1N6UA 1XGTA 3CDYA 4OQTL 2XACC 5K9KA 4EZMA 1IGML 3DXAD 1AGDB 4RQQA 1OGAD 2BERA 3TN0C 4B7LA 5DGRA 4XNQB 2R0KL 5I17B 2A77L 4ZFFB 4NKOA 5IIEA 4XB8A 5IBLD 3OJ2C 1ZTXL 2R0ZL 1IGYB 4E42A 4ELMF 3MBXH 3GMRA 4HXAL 4CVUA 5D7LE 3LQAH 3D2UA 2NY5H 5F9OH 1YEIL 1ETZB 3FQRB 2GCYB 2VXTL 3VXUE 5FOBB 2QQKL 1JGVL 1U8QB 2A73A 2VXUL 3EJZC 1K4DB 3RZWA 3TIDA 3T04D 2R39A 3NCFB 3O6FB 4PY7B 5DWUL 2P7TA 4HAFA 2IQAB 3UYOD 5AYUL 3O3UN 2CKBB 1KT2A 5IT2L 4PG2A 1CXEA 2IMMA 3BUYA 2HFGH 1ED3B 4OZ4A 2FDBP 3REVA 3UTTE 3CCHA 2G9HB 4QRPA 4FXKA 1P69B 2DQFB 3EFFA 3AGVA 3EJYC 4R7NA 1IAOA 3EYUL 4L4VA 1KCSH 2VIRA 4K2UH 4IRSA 1JYVA 4CVWA 3EZ8A 3KYAA 3NIGF 3WN5A 3MV11 5ISZD 3SDAC 2X9YA 2ZUQB 3MODL 3GMNA 1INQA 3GMMA 3K74B 3O3DA 4LSSH 5HHVL 5CJBA 4W6YB 2VJXA 3P73A 1YEKL 3W11C 4JDVA 3VD5A 4XBEL 3VFTA 3WFEL 2R69L 1S5IH 4OF3A 5T5FL 3UTSB 3P4MB 5HHME 4NBZB 5SV3A 3FOLB 2AK4B 4P4RA 2DYPB 1NJ9B 3O6LL 5DJDB 4Y1AD 4K94C 3D25B 3Q6GL 1A6AB 4NPYB 3MRJB 3F12B 1FJ1A 4QRUB 4NZTL 5C6TH 4LASH 4APQB 4ALAH 4JY5H 2ARWA 5DC4B 4YFEA 2X70A 4QHLB 4OZIA 2Z31D 1P7KA 2FHFA 4IS6B 1T0MA 3KPQA 2UY7A 5EIIB 4RFOH 1NGZA 4FQCL 2BY2A 4GKSB 5GGVH 5F7HA 4FHBD 1MCOH 2XPGB 1JK8A 2GTZB 3DV6B 3GKWL 5BV7C 2EDXA 4OZFB 5JORA 5H37H 1UJTA 3G6DH 1U58A 2DWDB 4H0HB 5CSBA 1MCHA 2DQIL 2G75A 4OM0L 3K2UH 3ZE2E 3P0VH 1CF8L 4R90L 4MHHG 2SEBB 5IW6B 5HYQB 4LARL 5CMAB 3ZL4H 1FL5A 1K8DB 3H3PH 3QEQB 1JCKA 4EDXB 1DVFA 4UTBH 4NOBA 1EK3A 1K3ZA 3WHE1 1YN6A 4U1KB 2PXYB 3QJHB 4DFIA 4DWHA 1AO7B 4FQLH 1MHPL 1U8NB 5I0DA 2PYED 5BVPH 4P4KB 2AEPL 3S7GA 3SQOH 4KKAC 3WUZA 4ZQKB 3CD4A 1I9JH 3SE8H 1JPST 4JG1L 5GS2D 1RQ5A 3WFBL 4MJ4A 4GW4B 3VFOB 1S9XB 3ZDXE 3O2WL 1S78D 3FTGB 4FABL 3TPUB 2WZPD 5DLMH 3MRMB 1L0YA 1QSFD 2VDQL 3GDBA 2HT4D 4GAFB 1CK0L 3C6LA 3HMXA 5JZ7C 2C1OB 3L1OL 3EDFA 3KXFB 4HUNB 3W0WA 1P6AB 2A2QT 2VSDA 5DDHA 3TA3D 1F11A 3V5KB 3F7YB 2IEPA 3VMPA 4CL7A 2FRGP 4JRXE 1DN0A 5KOVC 1KCVL 3HCVB 1AXIB 5CJ5A 5E08H 2K7PA 4UT7L 3CFJA 1MAJA 2YSSA 2R2EA 3VDAA 4YGVB 5LJYH 3VGFA 4LLYA 5GRVL 2UWEE 4H1LG 4YHOH 1QFWI 3B4NA 1FLRL 3EOTH 5ALBL 4NZUL 3VXMD 3IJSA 2BSTA 1DQDH 4HCRH 3BQUD 3D48R 5I15H 2NY1B 3D3VA 4NFCA 4YDJA 3JZ7A 5CBAB 5A2KH 2I9LA 1RZ7L 4S0TD 2GJ6D 3D6GA 4PGDB 4DVBA 3H9SB 5D6DC 4L3CB 4Z8FL 3VFNA 3MGOB 3FO2B 4LFHG 4O2FA 4I0PD 3TEUA 3VWJB 3GSXB 5F9DC 3RAJH 5E8DH 4EDWL 2RCSH 3PGCB 4FQ2L 4ODWA 2AEQH 4Y4HA 2MKLC 1E6JH 3CH1B 1I1CA 1FL6A 5D2LA 1I3UA 5HY9A 2H45A 2F74B 3BZ4A 2COQA 4KDTC 1GIGH 2FBJH 3RVUC 5FECB 5C08E 3LS4H 3QIUD 2VABA 1J0HA 3CZFB 4NZJA 1KJMB 1OF2B 2Y72A 3K81A 1JWSB 4KUZH 4RIRB 4YDLB 1KYOJ 4HUVA 1JWUA 3KPRB 1FDLH 3LKQB 4OZIF 4FQIL 5D5ME 3X17A 1X7QB 2YMXH 3MRIB 3OXSA 1HSAB 3G04B 5IJKA 4YZFE 1ZGLB 4JGUA 1SJXA 3IKCA 4MVBD 1GGIH 1PG7L 5EU4B 1KPRB 3S36H 2CUHA 1S7TB 3UJIH 4JRYD 3EO0B 4WHTA 2V9TA 5L2JA 1I1AA 1FNFA 4OFVA 1EFXB 4K23H 2Z31C 2YUWA 3I6KA 3QO0A 1P1ZA 1QSZA 5A2FA 4PBVC 2BOBA 1EHLL 3IXAB 2FZ3B 1F13A 1MAMH 4P2RD 3N06B 2HYMA 2Z8VC 3IGAB 4MD0A 3DVGB 4LNRB 3AUVA 3C2AL 4YHMH 2EH7H 4HH9A 4ZNEE 1XF3B 3K1DA 5TDOB 2DBJA 1QRNE 3N1QC 5IHZA 4G43A 3IETB 1RIUL 1PY4A 2EYSB 2JCCB 3QCVL 2BNQD 5D2NB 3Q2CA 1JJUA 4AK1A 3C9NA 5IMKA 3DUUB 1B4RA 3U4AA 1ITBB 5EPMB 1VACA 5KSAB 2PTTB 5DQDL 2EIEA 6FABL 2NY2B 4N0CD 4MMXC 1KIQB 1IAIL 5C0DB 1IE5A 3ULUD 1QFUH 1DZBA 1A1MB 5FO9A 1SYSB 3GSWB 3MNZA 2V2XA 4HUXA 5DD3L 5H37G 4UNTA 1T03H 5ID1B 1J12A 3LN5A 1S78C 4PGEB 1YNTB 4MD4A 2XWTA 2Q86A 1J18A 4YUEL 2HT4C 2NW3A 3E3QE 3ZE0F 1UVQB 4WTZG 1BAFL 4MNGA 2H32B 2BFVL 3TA3C 1JNNL 4XI5D 3SKOB 3IU3A 5E8OB 4I18B 1QSED 1KJ3H 1JHTA 3LV3B 4BFIB 5I1JL 4LLQB 1H0DB 1QRKA 5C8JA 3G08B 3ROLA 5GSVA 2BVEA 4NYLB 4UT6L 5D1ZD 5D7IE 4JE4B 4O2EB 5B4MD 4X7CC 1JZ2A 4E9LA 4NDMA 5T3XH 4JLRB 3IDIB 4HGMA 3WL9B 4NQDD 4U2YA 3FO9A 1UQSA 2IPKB 4X6FA 5HI4D 1UCBL 3RL1B 4HEPG 3CVIH 5I71B 1S7SA 1KJVB 5C9JB 1TLKA 1WF5A 4FFWD 5L8KB 4YEFA 4I0PC 4LEXL 4WW1B 2PR4L 4HWUA 4CBPA 1YJDH 4NC1C 3KYMA 1N2RA 4I48A 3WEXA 1MJJA 1CQYA 4RZCA 3B9DA 4JVWA 4IRJA 1KIRB 2DTML 2VQ1B 1MCBA 2VDLL 4M8QA 3SDCD 3HC3L 3CPLA 4PY8I 4DQOL 5C07D 5T3ZD 4M1GL 3B9KA 3QIUC 3MJ9L 1EAPA 2HJFA 1RUMH 3QUZD 2EE3A 2B4CC 4Q58C 3BKMH 1U8LA 3VXTA 4Z78B 3QCTL 1SEQL 5ELIA 3DUSA 5FGCB 1ROWA 5DEFA 4MVBC 1X4YA 3E6FB 5KN5B 4NO5A 4JAMA 4X6DB 2XXCB 1WT5A 1KN4H 3MRLA 3SDDA 4LLWB 1F02I 1AQDA 2HRLA 4CDHA 3RNKB 3G5ZA 2LU4A 3EBAA 4OF7A 3CH8A 1JGUL 2IANE 3PQYE 1AD9A 4X7SL 5HGAB 3SGJC 3L3OB 1A6PA 4O9HH 4E41E 1WIUA 4IOIB 4JFEE 1I3GH 3CUPB 4ONGH 1RZ8A 3ARBD 5C0AA 1GCFA 1RUAL 2EDTA 4DKFH 1C12B 2F53B 4D0DB 3HNSH 3WE6B 3H7BB 4DEPB 1ZAGA 4Y2DA 5DHYA 3FFCA 1R5WA 1RK0B 1OL0A 3QUYA 2O5XH 3EYFB 4UIMB 2DQJH 1CDYA 5ICYA 4Z77A 4ZUVB 4OF6A 4P59H 4R7DA 5MEOA 3JVGC 3ZTJH 3LIZL 3P0YH 4MMZC 3Q1SL 1YEJH 2IGFL 5I75B 4XNYH 2XICA 3NFSH 3KJ6L 2VLKB 4LBEB 2H9GA 4N0CC 3T2OA 3ULUC 2FJHB 3K2MC 3Q5TA 2X4UA 1WC7A 4HGWA 4YPGB 5DJ0A 5GRUH 5J1TC 4K94L 4JFDE 4Y0GA 3QI9A 3E2HB 2F8VA 1GVIA 3MLTA 4U2ZA 3VFRB 3MV7B 4R4FH 1HHHB 3RI5F 1GPOH 5D71H 2MCG1 2NY0B 1DUYA 3IKKA 2FEEI 4TQEH 1AQKL 4NQCB 5BV7L 2ITDA 4G6MH 1Z9LA 3WUWG 5HHOE 1O7SA 4XI5C 2DLTA 4Y5VA 4GW5A 1YECH 3D87B 3SCMD 4NZDA 1AD0B 3PJSA 4X5XA 5IW3A 4D94A 2APTA 4PJ7B 4KPHL 1CXIA 2P8LA 4IOFD 2D7QA 4OV5A 1JZ5A 5JIIA 1LE5A 1R3HB 1J9CT 4LVOB 5IMLB 1JZ8A 4PB0L 1MFAL 4TSAH 3CSGA 2FD6L 1EUUA 1J0YA 2E7LA 4MNHA 5D1ZC 3GBNL 5C09E 3WLBA 1EX0A 2HFEA 4FNLH 2CDEA 1WTGT 1HHJB 3MNWB 4IRZL 1KCRL 1ND0A 5B4MC 5DRXB 1MCWW 2ZP0T 3QEGL 2X9XA 3DTXB 3IFLL 1QBLL 3HE7B 3MRRB 5C0GA 1IM9B 3LKOB 3QJFB 4GG6B 1LGVA 2K7QA 5HI4C 1U41A 4N0FA 3PIQB 4EKXA 1UYWH 2DIBA 1Q94B 4QXTA 4OQ1A 1BZ7B 3H3KA 2ERJC 5F7DB 3S3PA 1OGTB 2W0FA 4ZSOE 4WEUD 4U49A 1IILE 5GGTH 1DQLL 2IQ9L 4XVJH 4R8WL 4R97B 2DM3A 3L3GB 3SDXB 1KV3A 3BGMA 5HHPB 3SDCC 3FT2B 2R4RH 1Q9KB 3MQIA 5B3NA 2B2XH 4TTDC 1IGIL 2NZ9C 3L5WB 5CP3H 5BOZG 1Q9OB 4UINL 2VNCA 3IDJB 5D1QB 5T1MB 2ZG2A 5DUMH 1G0YR 1NCAH 3QUZC 4F7MA 2YA1A 1JWMA 4MSWB 2IADA 4JKLA 3UTSD 4P9ML 4PJEA 1OB1A 1U2CA 2B1AH 5BQ7B 2AK4D 2DYPD 3DIFA 4NO0A 3C5JA 5LGKA 5DJAB 3RUGB 1QG3A 1FNAA 1CIUA 1JGLL 2FX8L 1KIUA 4ZO7A 5EO1A 3V4PL 3QEUA 3GIZH 4N90D 1P4LA 4APQD 2X89A 4M5YH 5IB1B 3OKMB 1CU4L 2XKNA 5L2KE 4AJ0A 4Z7UB 5D72L 5MEPB 4OJFH 1CGTA 1NDMB 5FYKL 1XEDA 4G9DA 2DWEA 1ZHNB 3ARBC 3HC0B 1HQ4B 4HK0B 1G7PB 3LB6D 5JNYB 4JPVH 4TNWF 4JJ5A 1BD2A 4X98B 3I75A 1WSST 3V5HB 3THML 4HIIA 5E56A 1UM4H 3UO1L 4OCXL 2NTSP 3MCLH 1NGQH 2X09A 4HJGA 4K7PL 1NDGB 1LEGB 5FB8B 4M6ML 1OAXL 2A9NH 2MTPA 3O8XD 1JNLH 3QEQD 4P5KA 3BP7A 4NC2B 5EH1A 5CWSA 3ULSB 5IUSA 2PXYD 3M8OH 1AO7D 5CD3A 1B90A 3DRTA 4P4KD 4QRQA 2R9HD 5MP6L 2QADB 5J56B 2HJLA 1GGUA 2P5WA 3H7LA 3PV6A 3U83A 1URLA 3JBG7 2BDNH 5JIHA 4M6OH 2APVA 2V7NB 1KPVB 3MREB 2D9CA 5E94A 2GAZB 2X4NA 4OCWH 3UTPE 4W4NA 3GSVA 4WJ5B 4G8FB 5HYJA 5TE4H 3TZVA 1FE8L 1QTYT 2AABL 1HXYB 3OB8A 5E2UL 5K59E 1E27A 4A2LA 2E27L 4ZDHA 4IEFB 4BZ2H 1A3RH 2BVPB 4WY7L 1HHGB 4OKVA 3KXFD 5A16B 3VFVA 1B2WL 4F7TA 4R26L 3S3JA 4GKZB 5I74B 4JREB 2XZAH 4WFHD 4BH8B 1CFBA 1H8SA 5EZIL 3TNNB 3SCMC 4JZOB 3V6FA 5CJXC 1MOEA 5HYSB 3R06A 1KNOA 3WFZA 2YD9A 1NUFA 1T04B 3T2NH 1HQRB 3SQBA 2WQ8A 4IOFC 4XBGA 2YZ1A 3L95B 2EZ0D 1Y0LA 2OSLB 4G6KH 3IT8D 3VRJA 4KKCD 4S1QH 1IGMH 1J86A 2VZOA 2AQ1A 4MAUL 1AR2A 1SJHA 2VISB 3GSQA 3G9VA 4V1DB 2VXQH 1MCIA 2YWZA 3BPOC 1CD9B 4U6TA 2R56L 4X7EC 1I8IB 4U6XB 1LILA 2NY1D 4J3VA 3L3DB 4PJCA 1ZTXH 4OZHB 5TF0A 4BH7B 4DUWA 1G1YA 1YEIH 2V2TA 4HULB 3UPRA 3NIFE 4D3CL 4X6CA 3VWJD 1JGVH 4JR9L 4I77L 5B8CA 5JIKA 1WBYA 4NKMB 1TVBA 4Y4KC 3LPFA 2VXUH 3QEHA 5TJWK 3ZTNL 4X9FA 4FMKA 3O6KL 2PO6B 1NFIB 4PJEF 2NX5E 3O41B 3QQNA 2D7MA 3T4AB 4QXUL 3V4UL 2ORBL 1S9YA 1EMTL 2ZUQC 1S7UB 4KJQC 3G5VB 3DRQA 2CRIA 4X99B 5I18L 1KELL 4ISVB 3RWCA 1OP3H 3TNMA 1CICA 3BP6B 1DQML 3M17B 3SKMA 2ZNWA 3HNVL 3KPRD 1F3JA 4CJ1A 4L1DA 1BFTA 3INUH 4MJ2A 3SBWC 3MYJB 3BOVA 4XTRD 1KULA 4D0BA 2OQJB 3MODH 4J2XA 2FLRT 3C2SA 1A7QL 4JFQB 4RWYL 3MGTB 1DQQA 4HJ0D 3NACH 4HIXH 3RZCA 1RIVH 2BRQA 4HKZA 5ILTL 4APQC 5K9OA 3U7WH 4PP2B 4LQ1A 2ED7A 5T5FH 2BK8A 2MOVA 1G6RB 3RY5A 1ADQL 1I3VA 4PJ9B 5LWYH 2VE6A 5JW3L 1MLCB 4HUWB 3NCBB 2L0DA 3I6LE 4Z7OF 2OTUB 1YN7B 4NWTH 3WFCL 1NCWH 2YBRB 3FMGL 5E8PA 5IFHL 3LB6C 1IGTA 2HJKA 4PUBL 1DL7H 5AZEL 4LRIC 2PETA 2KL6A 4AH2B 2A1WH 4AIZA 1VEMA 3TJEL 3CDGB 4NIKB 4MWFA 1ZS8A 1D6EA 3O8XC 3HUJB 4HS3A 5EUOF 2B4CL 3AY4A 4HH8A 5KSAD 2K9UA 4UV7L 1T6VN 5HVHB 4M48L 2NY2D 2DQIH 1BZ9A 4P4KC 3RVTD 2R9HC 4S1SL 2ESVE 2DRUA 4F7PA 3QNXA 5HI5D 4IDJL 1OARL 4HS8H 1Y18B 4PV9A 3MYZA 1P9MA 2EYTA 5ENWB 3QULA 5LXGL 4LLUB 2VC2L 2DF3A 3O9WB 3QNZA 2R1XA 4NCC2 1JGDA 4P9HH 2CH8A 2VO5A 1FC2D 3O2WH 3N1PC 4JFYA 2VLRB 4FABH 3SPVB 1R3JA 4TVSa 2VDQH 1UWGL 2AV7A 4LSVL 1E4WH 4CVZB 3DJ9A 5E2WL 1CK0H 1DBKL 5DJ6B 5I66B 5BW7A 1INEL 3PWNA 2EZ0C 2IFGA 5DJXB 4KKCC 1OVZA 1LEKB 4X6CF 1DANU 5F7FA 4QHMA 1X5XA 4NQXB 3C8KB 3FHQA 4KUCF 5J1AA 4J1UA 5CEXA 2Q76A 2NY1C 1W72B 1I1FB 4NRZB 4ZTPL 5FKPA 5LBSL 3ULUL 4AMKL 2DLFL 1MREL 2A6DA 4WU7A 4H1LB 4GAJL 2CR3A 2BC4B 2GI7A 3LKSB 4LEOB 3VWJC 1MCPH 4AM0B 5C0JB 3RWDA 2E5EA 1U42A 2AJZB 1OM3H 4FTVE 3UJTL 3L3KA 3HG1E 3OKOA 3GHEH 1K5NA 1YDPA 2VXVL 3ESUF 1ZK9A 1CFQA 4ZFOL 4X5LA 5KVGH 4Z8FH 3SKJH 4JFXB 2AQ2A 4U1IA 1XGRB 2CD0A 1S7XB 1DE4B 1QEWA 3FN0L 1UB5B 1WBXB 1XR8B 4YDLC 4N9GB 2I07B 2ZOKB 4JPWH 3QPQC 3BRFA 3TWCH 5CHNA 4ZXBA 4NBXB 5GRJL 2EXWD 4XTRC 3MRBA 1NCBL 5BVJA 3U0PA 5DI8A 1NCNA 3GHBL 5ICZA 3OAYH 4LK4A 4OD3L 5CJQL 2X1WL 4HJ0C 5BXFA 4EUPG 1ULVA 4KJYB 4ELKB 3HFMH 4XNUH 2EYRB 5L6YL 3QUXA 4PJAB 4FQIH 1KFAL 2F58L 5IOPB 3QDJB 4CUCA 1RMFH 4CKVX 1Q72L 1PG7H 4ORGB 3V4VL 3X14A 3WXVL 1N3NB 1S8DA 3ARGB 1UJ3B 3QP3A 4Y4FD 1EGJA 3WDIA 2A0LD 2MJWA 5INCA 4QXGL 1NAMA 1W0VA 3O4LE 1FGNL 2OR7A 2WWMD 3GFUA 3FB6A 4OFDA 3S8WA 1AGFB 1HHIB 5T3ZL 3O45B 4UBDD 3D9AL 2Q7NA 3KLHD 1DJSA 3REWA 1RU9L 1FGVH 5D2NC 3TBWA 1I7ZA 5GSRB 3PWPA 4U0RB 3UYRL 5JOPD 2DQHL 5KSAC 3W39A 2NTFA 4RGMB 5E5RB 2NY2C 4WUUA 2VLKD 1AY1L 4HUUA 4N9OB 1B4JH 1M1SA 5DQ9B 5FGRA 2W59A 3CK0H 1VFAA 1CFVL 4QOKA 1RZFL 4OZGB 4XP5L 3B2UC 3H2WA 3OR6B 4R4BB 4DVRL 5I1LB 3CGTA 3QXTA 5F7UA 4RWHA 4BSWA 3B83A 1GL4B 3MV7D 4HX1B 3UPCA 2NY0D 5E2JA 4F2MA 1CLZL 3KPMA 4NQCD 5DS8A 3MTRA 4OGXH 3OAUL 1R3KA 5F3BB 2D31A 5TGBA 4O4YL 1CFSB 2E6PA 1J05B 2X4RA 4TVPE 4WO4B 1TJGH 5D7LB 5DYOB 1NL0L 5GRYA 1IEHA 3WJJA 4C56A 4I18C 4YUEH 3V0VA 1IAKB 3VXUB 1LP9A 4KKNA 3JUZA 3OAZK 4JHWH 1BAFH 1S9VA 3RJQB 1BOGA 2P5EE 4WNQA 1KCUL 1BGXL 5KVEL 1JIBA 5IHUL 3RGHA 5I6XB 5BMFL 4UQ3A 4FG6D 3ZT6A 1QNZL 5IW1A 1PJ9A 3PWLA 3DX7B 4U3HA 1L9MA 1ZSDB 3D39E 3VFSA 3HE7D 3MXVL 5I1JH 3O2VH 1WK0A 3UTTB 3DX6A 5SWZA 1ONQA 2F54D 3NZ8A 3SJVE 4PV8A 5GGSA 5DURB 3MRHA 1GAFL 3GMOB 1WISA 1FFPA 5F9WC 3U9PL 2W9EL 1L6ZA 4U0QB 4U33A 1N64L 3G6JA 3MBEB 2MSPA 3VXOA 5DC9B 5H2BB 5IHBA 2YPKA 5EUKA 5F8QC 1NSNL 3IJHA 3BZEB 1FZMB 4LEXH 3NPZB 3DETD 4FQHA 5HHMB 5JPNA 5D1QD 4QYOB 4ZUTA 4UOJA 4KMTH 4LP4A 3D0VA 1J5OH 3S3SA 5EZJA 3RL2A 1MIEL 3QXVA 4YHZH 2F19L 3J7HA 4OI9A 3BZDA 4CNIA 1SM3H 3MLWH 3KPLB 2HVKA 3CJJA 4P23B 3HC3H 2FX9L 5FKAB 5DO2D 3T0WA 2EXWC 4Y16A 3DROA 1JHLL 1RZJL 3MRDB 3NBNA 2DQDH 4X6BA 4S2SA 43CAA 1NMBL 3GBLA 3I9GH 3WMSA 4LOUC 3FT3A 3GM0A 3TBYB 3T2QA 2DQCL 4J4PA 4JDZB 4UIKL 3QCTH 4FQXB 5LGJA 1I85C 1G7QB 1E28A 4MDJB 1BFOB 4JFZL 4TVPH 1S3KL 1CGYA 3NFPA 4QHKJ 3HZMA 3BMWA 5FYLD 1OGAA 1LD9B 3HMWH 2GHWB 3KYOA 2R1WB 4DEPC 4Y4FC 1ZANH 2GJZA 3T65B 4OLZL 1ZLWH 2A0LC 5IBTL 4QRPE 3U4BH 3RP1A 3D69B 2YPLA 3SN6N 5IR1A 3VXRA 4I3SH 4AT6A 2WWMC 4L4VE 5LCVL 4HLZH 8FABA 2XN9A 1JGEA 1Q1JL 3GJEA 4M6AA 3WHXB 3KLHC 3PABA 5E99H 1J1XH 3GNMH 1CDBA 2QLVB 5I75C 1NGWB 2GTWB 4YHPA 4MAYB 2Y23A 1EEYA 2DL9A 4WI5A 2QADD 3C8HA 4XCYA 3AU1B 4E5XB 1PD6A 4QHUB 3QXUA 1XR9A 3AREB 3FKUS 2LAGB 2FO4B 4DN4L 4P46D 1T0PB 3FL7A 2RR3A 3Q1SH 1AIFB 1VADA 3E2HC 1RZGB 3FONB 5ERWB 1LP9F 1RPQA 3NTCL 1JI2A 3U0WL 1A21A 3LSOA 5SWQB 2NY0C 4JRXB 4PB9H 4ZOCA 4I2XA 3PWUA 3PNWA 3RU8L 2R2BA 1E4KA 5KBNC 4N0UB 1AHWA 3OKKB 4OZIE 1JNJA 4WUKL 5ISZA 3CDCA 2UWEB 1A6VL 1KXQE 2HP4A 3GSNB 3RVVC 1W0WB 5TDNA 1AKJA 1F8TL 1FZOB 2XV6B 4H0GA 2OMBA 3VA6A 2XG5A 3MRPA 3SE4A 1A7BA 5F3HB 4GO6B 2BSED 1H3WM 2O5YL 3HAEA 3HR5B 4QGYA 4MDIB 4P3WA 4XP4L 5JXAH 2DMKA 1EJOL 5FF6A 4V1DD 4MB4A 2FHCA 1SMOA 3WUWB 5JW4R 1N6QH 4XP1H 5FYKE 1OW0A 2FJFB 3TBTA 4FG6C 3G6JF 1ZV5A 5JHDE 1UEMA 5FUZL 3U36B 1ZEAH 4KPHH 1U3YA 5KSUB 1TCRA 4Y1AA 1UXWA 3CSPA 1HKLL 3HE7C 3TT3H 3BISA 4YEEA 2ATKB 5I1HL 3LH2L 3HI6L 5C0RL 3BKYL 3VD4A 2X1XR 3GMQA 4NJ9L 4EN3A 2DD8L 4P3DA 4U1HB 4YHKL 4HD9A 3L9RB 3BX7C 4YX2L 5K9JH 4TSCL 1KCRH 12E8H 3D18B 3P4NB 3C60B 1WICA 5C08B 4X9BA 2PO6D 4Z95H 3C5SA 2J6EA 4JFOA 4R97C 3SKUD 5DMKB 4O00A 1WTLA 1OP3K 5FYJE 5E4EB 3QQ4A 4CADA 3W0WE 5D5MB 3BKCL 3OX8B 1XCQA 5D1QC 1ZT4B 3V8OA 2APFA 3F5WA 2VL4A 3WFDL 1FAIL 3BIKB 3QUMB 2YXFA 4LCCB 3L3JB 2MWCA 4OCSH 1V05A 1I1RA 4Z7QF 4PGCB 1IGIH 5I1DA 1BWMA 4UINH 5HHQB 1TZIA 3FRUA 5MERB 3JTTB 1U91B 2IALB 1M6OB 2XI9A 3MJ7A 1BBDH 2BNRB 1QSFA 1FBIL 2MKWA 3D3VE 1HDMA 1YUHA 4R2GD 4YQXL 4PJ9D 3DBXA 3U0TB 1MVUA 5GS0H 5IVZB 1NMCB 2J4WL 4XRCA 3TYFB 4GMTL 2P8PB 3ARDD 3TO2A 2X4SB 4FQ1L 1H8OA 1QRNB 5EOTB 2B0SL 3TA3A 1IAII 1LO4H 3L7FA 1ZT1A 4N1CA 5I1IL 5CS7A 1HINH 3LN9A 4ZPVA 2P1YA 4GRLB 3QG7L 3MV9B 1U8OA 5BZDA 4F9LA 4OBSA 5FYKU 4ODHL 2GUOA 3O3BA 3AXLB 3EFDL 2OL3A 2HMIC 2CPCA 5FYKH 2R4SH 3FO1A 4HKBA 5D2LE 3BH8A 3HI5H 3QZWA 4QHNB 1SHMA 2H8PA 3MV8E 3V79C 1XIWB 4PR5B 3BQUA 4HC1A 2QADC 1J8HA 4U1GB 1IL1A 3UO1H 5B38A 5KTEH 5GGUB 1JYXA 2EDDA 1U9KA 4KJPD 2GJ6A 1F4AA 1UKQA 2VH5H 1YEHL 4P46C 5J4MA 4TULH 1GC1C 4JZJA 4NUJA 2XKSA 1A4KB 3KJ4B 1JN6B 2EDYA 1RHHB 1HCFX 3LQZB 1H3XA 3NA4A 5EIQA 1G7LA 1JUFA 2VKWA 2HFFB 3QQ3A 1KENL 3MLZL 3PHQA 5FYJU 5MP6H 3WO4B 3MRFA 4M93B 4CVXA 3PP4L 4CDGC 1CFTB 3ALPA 3O9WD 3HMXH 5FYJH 4L9DA 4JREC 1MCEA 1RY7B 3E0GA 2VLRD 3MX0A 1DBJL 4JZNB 3RGVC 3TO4B 3FB7B 2Q7YB 3CVHA 1N8ZA 3ZSSA 5E2UH 3QIUA 1G7IA 2VZUA 3MLXL 5LGHH 5HTSA 4RA3A 2ZUWA 5D7IB 1JF1A 1AFVL 2OTWA 4ODXA 4ACPA 1TJHL 1CE6B 3BP4B 4FQQB 5HPOA 5HPMB 3PGFH 1SY6L 4EI6B 1CI5A 2AVGA 3ECBA 2Z93B 3GB7B 3EO1A 5F7WC 4I8DA 3VI3F 4G6JL 4NZRL 4OFKA 3VH8G 3UC0L 4G7YL 1EEQA 2VDNH 4WEBL 1UCTA 1RZIA 1FZJA 2GSGA 3JV6B 2R56H 5EBLA 4M1CD 4ETQB 3NFNA 2B20A 1ODAA 3GO1L 1KLGB 4XPTL 2GY7B 4HV8A 4AIOA 3JUYA 4W70A 2BVTA 4TRPH 2E9BA 4D9RE 1DBAL 2NY6B 4P2QE 5HD8D 3A6BL 3BKJH 5MHSD 1T89C 4RAVB 4D3CH 5GJTH 4F8QA 1RJCA 4I77H 3QRGH 4MNGE 1E6OH 4WFGD 5T1DH 2AEWA 3IYLW 1T80A 2BOCB 3ZTNH 1JRHH 1PX4A 5ITFB 1NPUA 1IT9L 2J2ZA 4YFLI 2WUCH 4JO1L 3EYSH 4L8CB 4Q9QH 5CINL 4QXUH 2ORBH 4HQQL 1NFDF 1U8JB 2ZSVA 3OAYK 1EMTH 1YQVL 4DGVL 5CBEA 1XGQB 2RQ8A 2IANB 3PQYB 4GXVL 3VXNA 3WFHA 3N9GL 1S9KC 1CG9B 4G9FD 3F7VA 4E41B 1CLOL 2R0LL 2UUDK 4S11A 2A6IB 5BS0D 1I7TB 2KKQA 4NO2A 4P5MA 1X6NA 1B0RA 4R2GC 4UDUA 2B1HH 4ENEC 2FWOB 3IXTA 3QDJD 2WINB 2YPVL 3ZMRA 2X9WA 3RHWF 3VMOA 3ARDC 3HZKB 4WV1B 1TVHB 3MACL 4Z0BL 4WFFD 1BQSA 4PJFF 3ARGD 1MJ8L 1OD7A 5ILTH 4PLKD 2OK0L 2HG5B 2C7UA 2FCBA 1ADQH 2YC1A 1XF5B 3NCYP 5JW3H 1PSKL 4Z7WA 4WHYH 4YIQB 5D9SA 1EH9A 4LCWA 2NQCA 3PHOB 3WFCH 2CDGA 4PREB 1IEAB 4JG0H 5HVHC 3S5LG 4HPOH 4J8RB 4LVNB 5AZEH 4JFDB 1MRFL 1J7VR 5E2TH 1HNFA 4YNYA 4MCYB 2JTDA 1I8MB 3TT1H 3JWOC 3SOBL 2OJEB 1NC2A 2CLRB 4KJPC 3RVXD 3V0WH 1MY7A 1JYNA 1U95A 3QCUH 5GJSH 5KS9E 4W4OC 1QLFA 4M48H 5D8JL 4O58H 5EC2B 4WWID 2WW8A 5HHOB 4S1SH 1YY9D 4Y19A 3FQWB 2VAAB 4BM7A 2E7HA 3GEWB 3O9WC 4IDJH 5DUPL 2XZZA 1X5FA 2Z4QA 1V8HA 4ZPTB 3HC4H 4WO4D 3IDXH 3SDCA 5D7LD 5AWNL 2E7CA 4FXGB 5JO5B 3T08A 3SE9H 3VXUD 3RBGA 4F7CB 5C0AE 4DK3A 3MOAH 1YYLL 2OYPA 4F33B 1NAKH 4PPTA 2CRYA 3ARVA 4MA1C 4KJWD 4KTEL 3OJVC 5C09B 1IGFL 3FFCE 2OJZL 3ELAT 3AB0B 3BWUC 4NWUL 3VMNA 3OKEB 5I9QB 1UEYA 3HA0A 3STZB