3UMHA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with cadmium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
180
structure length
180
Chain Sequence
HAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein
total genus 80
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umhA00
3UMIA 3UMKA 3NYJA 3Q7GA 4RD9A 3K66A 5BUOA 3K6BA 3QMKA 3PMRA 4RDAA 4YN0B 3UMHA 3NYLA 1TKNA 3Q7LA
chains in the Genus database with same CATH superfamily
1ZW2A 1BR1A 1FMVA 1RCPA 1SZIA 3AGTA 4NCQA 4E0HA 3GEIA 4BJ6A 4A2NB 2VCBA 3ECSA 5E33A 3LESA 3RVYA 4DOZA 4J7TA 1YJGA 1NU7D 4NQFA 3RQGA 3SXZA 2IXNA 3KH2A 3SYNA 4C7OB 3C7JA 3MYFA 1RMVA 5JP7A 4IARA 3E70C 4CIPA 2R7XA 2OQMA 2J7PD 3U2LA 3U2MA 4MW3A 3FMSA 4MVQA 1HE9A 1TWGA 4ZLCA 1FNTc 4EHPA 1EKYA 4CSAA 1E86A 2WVNA 3EGDA 4MS2A 4MVZA 4W8KA 4PJNA 2CNWD 2XLEA 2J45A 3X1OA 4CDAA 4DBRA 1HY5A 1YAUO 2YLIA 4YN0B 2ZXRA 2J7PA 3KMIA 1D0XA 4CS9C 1Q0MA 2X0CA 4BEJA 3EPVA 2NUTB 1NFNA 3BEHA 2QNLA 3DAGA 3EZIA 3W4YA 2HSBA 2CNWA 2V26A 3F47A 4XPWA 5DS5A 1M56C 1LM3B 1NZEA 4X0RA 2E87A 5EHHA 3LS1A 3HLZA 5JUAA 5A6JA 1ZU5A 5FCLA 1LIHA 3DAFA 4OIOF 1XZPA 1TQGA 2WB7A 3NMJA 1OCCC 1CGME 3Q7LA 1WGWA 1TFKB 5CIVA 1M2OA 3RYLA 1Z6AA 3EG9B 3VAYA 2YQYA 1LI5A 3LLIA 4LLEA 1DOWA 2XLOA 3DWWA 3FHDA 3U0CA 5L0CA 3DD7A 1OQCA 2YL3A 3PHF2 3S90A 2NSFA 4U5DE 2A0BA 4EBBA 3AGUA 3S27A 2JX0A 3U8PA 4CJOA 1D0YA 2J8WA 4GEHA 2ZD9A 2QY9A 3O10A 2CGEA 3ZIBA 2PX3A 4U5CE 4JCZA 3M15A 4C3DA 4JTAB 4WGYA 2W45A 1XZQA 5BUOA 5D92A 1Q0GA 2NUPB 2P61A 4IWBA 4JW1A 5JVEA 4FAPB 2J0WA 3K66A 3S0XA 1OXBA 3AG1C 2Y3GA 4LERA 3GANA 2OKUA 2Y3HA 4XEFA 3UMHA 1MMNA 1O87A 4IAQA 1LVKA 3EGXB 2GDCA 5HV9A 2ZPAA 1J8YF 5JS5A 1V55C 1ST6A 5L0DA 4E7SA 2CCYA 4IB4A 2HMQA 3WHNA 3IEEA 4U5EE 5KYYA 5L0IA 1Y6DA 4G7ZF 3EFOA 4OD4A 1S05A 5JT4A 3LNRA 1WN0A 1UG7A 3ITFA 4J7YA 2GWWA 1AEPA 1RJ9A 5CI8A 4AE4A 3Q6MA 3NYMA 1I5NA 3U3FA 3V5ZA 4P9FA 3TULA 4NTAA 2Y39A 1SF8A 2R7OA 2Q4FA 3CZ6A 3OEOA 2WVOA 1LE4A 1PV3A 1GM5A 3A9CA 2BC5A 4CS8C 3EHMA 4ER9A 2KW3C 3K1HA 2XXAA 2L6HA 1T6IA 1TWAA 2YL1A 2YKZA 4U5GA 2L6FA 3H2UA 1T01A 1YA7O 4AX2A 1LKXA 3U9JA 2PFDA 4I1MA 1LE2A 4MVOA 2R7WA 2XL8A 2A68F 2YLDA 5FZTA 1AUEA 4DRIB 2IYLD 3ZC4A 3L8IA 2GA0A 1V54C 256BA 5DQTA 3NDBB 1YLMA 2EPNA 1EI7A 4O6MA 3QTHA 2GAQA 3POVA 1HMOA 3FOPA 1EQ1A 1FTSA 4JTDB 3B29A 3SXYA 2OEVA 1BBHA 1QSPA 1VMAA 1J8MF 1XWJA 1YVIA 5D91A 1Z7Qc 5L0HA 1VLSA 3ZQYA 1V74B 4ULWA 3V5YA 4PACA 4WABA 3R2PA 4E0IA 3JTLO 3K1IC 3FDQA 1HW1A 2ICWG 2LQGA 4NTBA 2HMZA 3QVZA 2YEVA 3DM5A 1V4AA 2YL0A 5L0FA 1L3PA 2XL6A 1RKEB 1ZZPA 2AWCA 1H6GA 3DE8A 1KNYA 3QW0A 4JEAA 4ONSA 2J46A 4XEVA 3ASNC 3V7OA 4HFKB 2H7BA 1E83A 2UUIA 2XL4A 4G78A 1GGQA 2NUPA 2HV7A 4K0DA 3RVZA 3T6JA 1HW2A 1A0BA 4PR9A 3UGPA 3JT1A 4JE9A 4YL3A 1N1CA 1OKKD 1ZHWA 1ZYRF 4AL0A 3UGOA 4OIQF 3HNLA 4YK5A 4A4AA 5BQGA 2XLHA 3HTKC 2O9XA 1AVOB 2IXPA 2R02A 3TD7A 5T3TA 2L7AA 3C63A 1W2WA 4I1OB 4QDLA 1L7CA 2LFDA 4DJ9A 3FAJA 3JYYA 5TJ5E 3T4RA 1JPNA 2QE9A 4O79A 3NMKA 3ASOC 1VYIA 3IQ5A 2IBFA 2LK4A 4RD9A 1G8XA 1WOLA 1O3UA 3FOOA 1G4WR 1Z63A 2EPLX 1G4US 3ABLC 5A6BA 2G3KA 1T9KA 1ZU4A 2AU5A 2Q9AA 2R9RB 4LLCA 4O7GA 1BR4A 3G50A 4EKWA 3E9VA 2Q7RA 3I4UA 4E7ZA 2MHRA 3ABMC 3M4CA 1JR8A 1OW7A 4EBKA 5A6BD 1M2VB 1JAFA 1QVXA 2LP4A 2WZGA 2J9UA 1JPJA 3AOUA 3GODA 4GQHA 3M1CB 1WWPA 1NU9C 4J32B 1Q0DA 1NBBA 3WG7C 1E85A 3CQZA 3HNKA 2H7VC 3IPMO 3HJCA 4JCHA 3HNJA 1OCRC 1HE1A 2VCAA 2HUJA 1OW6A 1RKCA 3RW0A 1U6HA 2FFHA 3ATPA 3KKBA 4AE4B 1WATA 4P9TA 2R7RA 4ZLDA 4BPMA 3N24A 5B3IA 1C03A 4P6IC 5A6AA 2PX0A 3JRMO 1VLTA 3QW1A 3CSKA 4EBJA 2G62A 2YVKA 4XPXA 1YYJA 5AGFA 3US6A 2G3VA 4BEMJ 4O6NA 3L34A 1SMYF 2P7VA 5E2QA 2AVKA 3VF0A 4D4NA 3DKAA 2LD6A 3EH1A 3K6BA 4XQ1A 1MMAA 5E3AA 3K7DA 3SXMA 2J9BA 3RH3A 1IW7F 1A7EA 2Q9CA 2QTVA 1CPRA 1WASA 2XS8A 3GWNA 5F28E 3VRCA 5KYUB 4DXWA 5JRAA 2L81A 4ULVA 4YWQA 5JLIA 4N6HA 4WJ0A 4BJTA 5L3VA 4YT4A 4OIRF 3DMDA 1BDJB 2BE5F 2R7TA 3DJNB 1YARO 3ABKC 3B71A 1OCOC 3NG1A 3QVYA 4JJGA 2C04A 3AG4C 4N4WA 3TJ5A 2BL2A 3C18A 4JZAA 4AL1A 5KYWB 1OW8A 3LEVA 3CEXA 2A6EF 3EH2A 1VYKA 4CSAC 4XLNF 4N6CA 2EINC 3S28A 3T6BA 1ZHXA 2KJGA 4IJJA 3W8IA 2Y3DA 4CS7A 2HKVA 1BR2A 5BQHA 3TOMA 5L3QA 4HFFB 2JPUA 3F46A 5KYNA 1B68A 1M6TA 3ZVRA 3LEOA 4MW8A 4BJ5A 4LDRA 1A7VA 2WZFA 3B0PA 1YZCA 3KYJA 3RQFA 2ZXOA 3C62A 3CAXA 3OA1A 2VASA 4MVRA 3NYLA 3L0IA 1QKRA 2HJMA 4J30B 2R7VA 1OXKA 3UMKA 4LDKA 1Z3IX 1HMDA 2I15A 2PNOA 5K0IA 4YT5A 2NG1A 4QI0A 2EPMX 3NKDA 4YT8A 2A1DD 4YL1A 3FVYA 4K7BA 4Z9JA 3RF3A 3TQOA 4RBNA 4DVYP 1JRAA 1I4YA 4IAOA 4RDAA 1T6UA 3QZCA 5F5HA 1D1BA 1FMWA 4G7OF 5A6KA 2ASRA 4KNVA 4KI2A 2EPOA 3KYIA 1SYQA 2J0XA 3IQCA 4HEAJ 4ANJA 1VTMP 2YL7A 3DZAA 4R32A 1H7IA 2OG2A 1H9TA 1FAPB 5DQZA 2M4EA 2EIJC 4CS9A 4EIYA 2IXOA 3I5PA 2B0JA 4XTKA 4IGGA 4CJGA 2CYDA 3FAPB 2XSEA 4FESA 2RSEB 4JEBA 3U9MA 3N0TA 4EUKB 2EIMC 2ZXPA 1K04A 3PMRA 3PDMP 3GEEA 5IY5C 4JJFA 1YYXA 3GWLA 1UFBA 4I44A 1A41A 4CBEA 2WZLA 3H65A 3EGDB 3H2VA 2QLAA 2VC9A 4U9EA 1LS4A 4C3EA 1YDIA 5KYYB 1U89A 1TKNA 3LS0A 3U3BA 1JOGA 3EZHA 4PFPA 4XWJA 4PK4A 2PBEA 1QPUA 2MWQA 2ZXWC 1LS1A 4MVUA 4NTFA 5B1BC 3RFYA 1ORJA 1LI7A 1Q0KA 4CDYA 4Q5SF 3EGXA 2UUHA 4Z9IA 3W2WA 1TR2A 1ORSC 2KQ9A 2XLWA 5E3CA 1APCA 3N2ZB 2XXAB 1FFHA 4IRUA 5B3SC 2FAPB 1VOMA 3JCUQ 2VH3A 1Z5ZA 3X2QC 1K05A 4PJMA 4W8PA 3Q7GA 5COFA 1PD0A 2L6GA 2F22A 3MBGA 3A11A 3ZDLA 4DRJB 1RXQA 1SR2A 3QMKA 1M57C 3L8JA 3T9OA 2IOQA 2KK1A 3G4XA 2R7UA 1MMDA 5KYXB 3GORA 3V5XA 1RJ9B 2LFFA 5B1AC 3AG3C 2Z15A 3IQTA 3LLKA 3OWTA 4JKVA 2IM8A 1S7ZA 1T5OA 4EWCA 2LIGA 3KPHA 2R7SA 3VM6A 1YZAA 2W4BA 2HFIA 5DVWA 3NRHA 1I4ZA 1FFTC 3DM9B 4NY3A 3O55A 5L0GA 4H54A 4MTGA 3B0VC 4UDVA 5COGA 1CGOA 1R4TA 2IXMA 2YLGA 3C8GD 1DOVA 4PFOA 3ZSUA 5L0JA 3M79A 3GM3A 3U8VA 2XRHA 3DXJF 1D1CA 1ORYA 2VB6A 1OCZC 4MTOA 4AK9A 1TWCA 3KL4A 2Q9BA 4HE8D 2PP4A 2EPKX 1QQ3A 1CGNA 3C8GA 2A0UA 4PJLA 3ZTMA 4MQ9F 2RD9A 3S29A 5GPGB 5AC4A 2Y3BA 5F5FA 4CX9A 4LACB 5T1DB 4G7HF 4JURI 5DS4A 3UNGC 1C17M 4YL0A 1MQVA 2XM4A 5T3WA 1R5ID 3AQCA 1H9GA 3B9QA 4U9DA 5JSLA 2H7OA 3SNHA 3TJ6A 2W4MA 2XM0A 4YT2A 1U0BB 2Q00A 1A7DA 2DGJA 4MVSA 2XLDA 3SXKA 2KNHA 4JTCB 3T6GB 3NKEA 3W2VA 1K40A 2P6VA 1OR2A 2OOCA 2YHSA 5DS6A 1YA9A 2OJQA 2NPUA 1LPEA 2AWYA 2JD3A 3PCVA 4Q7CA 3S84A 4CIHA 2R25A 1TFOB 1GQAA 3FXHA 5EGYA 3I5QA 3DI5A 1C02A 2HJ3A 3UMIA 2VCCA 3B0UX 1ZHZA 2D4UA 2P1AA 4U5FE 5KYUA 3TOLA 1E2XA 2OEXA 3R7CA 1EA8A 2HS5A 3K1IA 4DBQA 4JRZA 2OJED 3JYHA 2A69F 5KYXA 1NFOA 2DYSC 2QUPA 2GFHA 2Y69C 3M4BA 3JZ0A 3ZQVA 2YWAA 1VB5A 1F1MA 4BJ6C 4DRHB 2FGYA 2EILC 4FWVA 2YZSA 4OD5A 1NG1A 3W8HA 1ZHYA 2Q3TA 4E18A 2OCCC 3JRTA 4MNDA 2P0NA 1OKKA 3U5SA 3TK0A 3C8ZA 1Q0FA 3BRJA 3DE9A 4Q4ZF 1QLEC 2W9YA 3DJUB 3NMIA 2PF4E 2H8AA 4L6RA 4JVSA 3ZG1A 2C03A 3SEOA 3G4ZA 4MVMA 3ZTZA 4D4XA 3EFOB 3IQ6A 4XEKA 1NSGB 2LSEA 1KTMA 4G0HA 2L9JA 2YRFA 4N06A 3AQBA 5AC5A 4LDQA 3UR3C 3WAQA 4KC9A 4H4KC 2J9WA 3S9OA 2KGOA 4C7OA 3RKOF 2B0HA 2A6HF 3GM1A 4KNWA 2ETSA 4PJJA 1PD1A 3MFNA 4O6YA 1OR3A 1CPQA 2LCHA 4CDVA 1M2VA 4DVZA 2I8BA 5BQIA 3IHUA 4XLPF 3C8GB 1GS9A 2WL8A 3HKKA 2DYRC 2R03A 3MLGA 1TWHA 2M64A 4OIPF 1MNDA 4BJ1A 2AP3A 2DI3A 4MTFA 5DLJA 1D0ZA 1KU2A 1JMWA 3GEHA 1D1AA 2KYHA 3EHNA 4K1OA 5CI9A 3GM2A 2J9VA 2R05A 3VYWA 4F4BA 3SZRA 1MNEA 3O6XA 5EK0A 4JIOA 2V3CC 2WVQA 3LAYA 5KYWA 3ZWIA 3RQEA 2TMVP 3L1MA 1IZMA 1T6QA 1NLXA 4KBLA 2HZ8A 4XPYA 2XLMA 3AJMA 4BG0A 4JC7A 1Y4CA 2HV6A 1QZXA 1VK5A 3AG2C 3K33A 1ZW3A 2CDQA 4QI2A 3O39A 3LJBA 3RIPA 5A69A 5HSWA 4YJWA 3LNMB 1WTYA 3JSZA 3SP1A 1ZVZA 4M63A 4NC3A 4B6IA 3J06A 3EG9A 3WODF 4Z9HA 1FR0A 3JSEO 4E17A 4FX5A 3EJNA 2HSQA 2KC3A 3NYJA 4U5HA 2KSFA 1RKEA 2R7QA 4WGZA 1E84A 3MYIA 3HNIA 2X51A 2EIKC 1O5HA 3MX3A 2DB4A 3Q6NA 1PCXA 4U5BE 4I3MA 2NUTA 4CS8A 1G5ZA 2XLVA 2XS1A 3LUTB 4C3BA 1BZ4A 5COMA 4BJ5C 4OINF 1MMGA 1ZHTA 2NSGA 4GYTA 1Z23A 2OU6A 2CW0F 2D5RB 2MYSA 3EQLF
chains in the Genus database with same CATH topology
1BR1A 1FMVA 1SZIA 4BJ6A 4A2NB 3ECSA 5E33A 3LESA 4DOZA 3SYNA 4C7OB 1NU7D 2IXNA 3KH2A 3E70C 2R7XA 2J7PD 4ZLCA 1TWGA 4CSAA 2WVNA 3EGDA 4W8KA 4PJNA 2CNWD 2J45A 3X1OA 4YN0B 2ZXRA 2J7PA 3KMIA 1D0XA 4CS9C 4BEJA 3EPVA 2NUTB 3DAGA 3EZIA 2CNWA 3F47A 2V26A 5DS5A 1M56C 1NZEA 4X0RA 5EHHA 2E87A 3LS1A 3HLZA 1ZU5A 5FCLA 4OIOF 3DAFA 2WB7A 1OCCC 3Q7LA 1WGWA 1M2OA 3RYLA 1Z6AA 3EG9B 3VAYA 3LLIA 4LLEA 3FHDA 3DD7A 3PHF2 4U5DE 4EBBA 3S27A 1D0YA 4GEHA 2QY9A 3ZIBA 2CGEA 2PX3A 4U5CE 4C3DA 2W45A 5BUOA 5D92A 2NUPB 4IWBA 4JW1A 2J0WA 3K66A 3S0XA 3AG1C 2Y3GA 4LERA 3GANA 2Y3HA 3UMHA 1MMNA 1O87A 1LVKA 3EGXB 2ZPAA 1J8YF 1V55C 1ST6A 4E7SA 3IEEA 4U5EE 5KYYA 4G7ZF 3EFOA 4OD4A 3LNRA 3ITFA 4AE4A 5CI8A 1RJ9A 3Q6MA 3NYMA 2Y39A 1SF8A 3OEOA 2R7OA 3CZ6A 2WVOA 4CS8C 3EHMA 2KW3C 3K1HA 2XXAA 1TWAA 4U5GA 4AX2A 1LKXA 2PFDA 4I1MA 2R7WA 2A68F 2IYLD 3ZC4A 5DQTA 1V54C 3NDBB 4O6MA 3POVA 1FTSA 1VMAA 5D91A 1J8MF 4ULWA 3K1IC 3FDQA 2YEVA 3DM5A 2J46A 3ASNC 3V7OA 4HFKB 2H7BA 2XL4A 2NUPA 4K0DA 2HV7A 3T6JA 3UGPA 3JT1A 1N1CA 1OKKD 1ZHWA 1ZYRF 3UGOA 4OIQF 3HTKC 2O9XA 2IXPA 3TD7A 5T3TA 1W2WA 4I1OB 4QDLA 3FAJA 3T4RA 1JPNA 4O79A 3ASOC 1VYIA 4RD9A 1G8XA 3ABLC 2G3KA 1ZU4A 4O7GA 2Q9AA 4LLCA 1BR4A 3E9VA 4E7ZA 3I4UA 3ABMC 1M2VB 2WZGA 1JPJA 2J9UA 3GODA 3M1CB 1NU9C 4J32B 3WG7C 3CQZA 2H7VC 3HJCA 4JCHA 1OCRC 2FFHA 3KKBA 2R7RA 4ZLDA 3N24A 4P6IC 2PX0A 3CSKA 2G62A 2G3VA 4O6NA 3L34A 1SMYF 2P7VA 3EH1A 5E3AA 3K6BA 1MMAA 3K7DA 3RH3A 1IW7F 2Q9CA 4BJ6C 2QTVA 5KYUB 2L81A 4YWQA 4WJ0A 4BJTA 5L3VA 4YT4A 4OIRF 3DMDA 2BE5F 2R7TA 3DJNB 5E2QA 3ABKC 3NG1A 1OCOC 4AE4B 4JJGA 4DBRA 2C04A 3AG4C 5KYWB 4JZAA 3LEVA 3EH2A 2A6EF 1VYKA 4CSAC 4XLNF 2EINC 3S28A 3T6BA 1ZHXA 2KJGA 4IJJA 3W8IA 2Y3DA 4CS7A 1BR2A 5L3QA 4HFFB 3F46A 5KYNA 3ZVRA 4BJ5A 2WZFA 3B0PA 2ZXOA 3OA1A 2VASA 3NYLA 3L0IA 4J30B 2R7VA 3UMKA 1Z3IX 4YT5A 2NG1A 4QI0A 3NKDA 4YT8A 2A1DD 3FVYA 4K7BA 4RBNA 4DVYP 4IAOA 4RDAA 3QZCA 5F5HA 1D1BA 1FMWA 4G7OF 4KNVA 4KI2A 2J0XA 4HEAJ 4ANJA 3DZAA 2OG2A 5DQZA 2M4EA 2EIJC 4CS9A 2IXOA 3I5PA 2B0JA 4XTKA 4FESA 2XSEA 3N0TA 2EIMC 2ZXPA 3PMRA 5IY5C 4JJFA 4I44A 4CBEA 2WZLA 3H65A 3EGDB 4C3EA 5KYYB 1TKNA 3LS0A 4XWJA 3EZHA 4PFPA 4PK4A 2MWQA 2ZXWC 1LS1A 5B1BC 3RFYA 4Q5SF 3EGXA 3W2WA 1TR2A 2KQ9A 5E3CA 3N2ZB 2XXAB 1FFHA 4IRUA 5B3SC 1VOMA 3JCUQ 2VH3A 1Z5ZA 3X2QC 4PJMA 3Q7GA 1PD0A 3QMKA 1M57C 2IOQA 2R7UA 1MMDA 5KYXB 1RJ9B 5B1AC 3AG3C 2Z15A 3LLKA 3OWTA 1S7ZA 4EWCA 2R7SA 2W4BA 5DVWA 3NRHA 1FFTC 3DM9B 4NY3A 3B0VC 2IXMA 3ZSUA 4PFOA 2XRHA 3DXJF 1D1CA 2VB6A 1OCZC 4AK9A 1TWCA 3KL4A 2Q9BA 4HE8D 2PP4A 4PJLA 4MQ9F 3S29A 2Y3BA 5F5FA 4LACB 5T1DB 4G7HF 4JURI 5DS4A 3UNGC 5T3WA 3AQCA 3SNHA 3B9QA 4YT2A 1Z63A 2H7OA 2W4MA 2DGJA 2KNHA 3W2VA 3NKEA 2P6VA 2YHSA 5DS6A 2JD3A 4Q7CA 4CIHA 5EGYA 3I5QA 3UMIA 3B0UX 1ZHZA 4U5FE 5KYUA 4DBQA 3JYHA 2A69F 5KYXA 2DYSC 2GFHA 2Y69C 2FGYA 2EILC 4FWVA 2YZSA 4OD5A 1NG1A 3W8HA 1ZHYA 2Q3TA 2OCCC 3JRTA 4MNDA 1OKKA 4Q4ZF 1QLEC 2W9YA 3DJUB 2PF4E 4JVSA 3ZG1A 2C03A 3SEOA 3EFOB 2LSEA 4G0HA 2L9JA 4N06A 3AQBA 3UR3C 4KC9A 4H4KC 2J9WA 4C7OA 2KGOA 3RKOF 2A6HF 4KNWA 4PJJA 1PD1A 4O6YA 1M2VA 4DVZA 2I8BA 4XLPF 3MLGA 2WL8A 2DYRC 1TWHA 4OIPF 1MNDA 4BJ1A 5DLJA 1D0ZA 1KU2A 1D1AA 5CI9A 3EHNA 2J9VA 3VYWA 4F4BA 3SZRA 1MNEA 3O6XA 2V3CC 2WVQA 3LAYA 5KYWA 1IZMA 4KBLA 2HV6A 1QZXA 1VK5A 3AG2C 3K33A 2CDQA 4QI2A 3O39A 3LJBA 3RIPA 5HSWA 4YJWA 3JSZA 3SP1A 4M63A 4B6IA 3EG9A 3WODF 4FX5A 3EJNA 3NYJA 4U5HA 2R7QA 4BG0A 2X51A 2EIKC 1O5HA 3MX3A 3Q6NA 4U5BE 1PCXA 2NUTA 4I3MA 4CS8A 4C3BA 4BJ5C 4OINF 1MMGA 1ZHTA 4GYTA 1Z23A 2CW0F 2D5RB 2MYSA 3EQLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMI A;  3UMK A;  3NYJ A;  3Q7G A;  4RD9 A;  3K66 A;  5BUO A;  3K6B A;  3QMK A;  3PMR A;  4RDA A;  4YN0 B;  3UMH A;  3NYL A;  1TKN A;  3Q7L A; 
#chains in the Genus database with same CATH topology
 1ZW2 A;  1BR1 A;  1FMV A;  1RCP A;  1SZI A;  3AGT A;  4NCQ A;  4E0H A;  3GEI A;  4BJ6 A;  4A2N B;  2VCB A;  3ECS A;  5E33 A;  3LES A;  3RVY A;  4DOZ A;  4J7T A;  1YJG A;  1NU7 D;  4NQF A;  3RQG A;  3SXZ A;  2IXN A;  3KH2 A;  3SYN A;  4C7O B;  3C7J A;  3MYF A;  1RMV A;  5JP7 A;  4IAR A;  3E70 C;  4CIP A;  2R7X A;  2OQM A;  2J7P D;  3U2L A;  3U2M A;  4MW3 A;  3FMS A;  4MVQ A;  1HE9 A;  1TWG A;  4ZLC A;  1FNT c;  4EHP A;  1EKY A;  4CSA A;  1E86 A;  2WVN A;  3EGD A;  4MS2 A;  4MVZ A;  4W8K A;  4PJN A;  2CNW D;  2XLE A;  2J45 A;  3X1O A;  4CDA A;  4DBR A;  1HY5 A;  1YAU O;  2YLI A;  4YN0 B;  2ZXR A;  2J7P A;  3KMI A;  1D0X A;  4CS9 C;  1Q0M A;  2X0C A;  4BEJ A;  3EPV A;  2NUT B;  1NFN A;  3BEH A;  2QNL A;  3DAG A;  3EZI A;  3W4Y A;  2HSB A;  2CNW A;  2V26 A;  3F47 A;  4XPW A;  5DS5 A;  1M56 C;  1LM3 B;  1NZE A;  4X0R A;  2E87 A;  5EHH A;  3LS1 A;  3HLZ A;  5JUA A;  5A6J A;  1ZU5 A;  5FCL A;  1LIH A;  3DAF A;  4OIO F;  1XZP A;  1TQG A;  2WB7 A;  3NMJ A;  1OCC C;  1CGM E;  3Q7L A;  1WGW A;  1TFK B;  5CIV A;  1M2O A;  3RYL A;  1Z6A A;  3EG9 B;  3VAY A;  2YQY A;  1LI5 A;  3LLI A;  4LLE A;  1DOW A;  2XLO A;  3DWW A;  3FHD A;  3U0C A;  5L0C A;  3DD7 A;  1OQC A;  2YL3 A;  3PHF 2;  3S90 A;  2NSF A;  4U5D E;  2A0B A;  4EBB A;  3AGU A;  3S27 A;  2JX0 A;  3U8P A;  4CJO A;  1D0Y A;  2J8W A;  4GEH A;  2ZD9 A;  2QY9 A;  3O10 A;  2CGE A;  3ZIB A;  2PX3 A;  4U5C E;  4JCZ A;  3M15 A;  4C3D A;  4JTA B;  4WGY A;  2W45 A;  1XZQ A;  5BUO A;  5D92 A;  1Q0G A;  2NUP B;  2P61 A;  4IWB A;  4JW1 A;  5JVE A;  4FAP B;  2J0W A;  3K66 A;  3S0X A;  1OXB A;  3AG1 C;  2Y3G A;  4LER A;  3GAN A;  2OKU A;  2Y3H A;  4XEF A;  3UMH A;  1MMN A;  1O87 A;  4IAQ A;  1LVK A;  3EGX B;  2GDC A;  5HV9 A;  2ZPA A;  1J8Y F;  5JS5 A;  1V55 C;  1ST6 A;  5L0D A;  4E7S A;  2CCY A;  4IB4 A;  2HMQ A;  3WHN A;  3IEE A;  4U5E E;  5KYY A;  5L0I A;  1Y6D A;  4G7Z F;  3EFO A;  4OD4 A;  1S05 A;  5JT4 A;  3LNR A;  1WN0 A;  1UG7 A;  3ITF A;  4J7Y A;  2GWW A;  1AEP A;  1RJ9 A;  5CI8 A;  4AE4 A;  3Q6M A;  3NYM A;  1I5N A;  3U3F A;  3V5Z A;  4P9F A;  3TUL A;  4NTA A;  2Y39 A;  1SF8 A;  2R7O A;  2Q4F A;  3CZ6 A;  3OEO A;  2WVO A;  1LE4 A;  1PV3 A;  1GM5 A;  3A9C A;  2BC5 A;  4CS8 C;  3EHM A;  4ER9 A;  2KW3 C;  3K1H A;  2XXA A;  2L6H A;  1T6I A;  1TWA A;  2YL1 A;  2YKZ A;  4U5G A;  2L6F A;  3H2U A;  1T01 A;  1YA7 O;  4AX2 A;  1LKX A;  3U9J A;  2PFD A;  4I1M A;  1LE2 A;  4MVO A;  2R7W A;  2XL8 A;  2A68 F;  2YLD A;  5FZT A;  1AUE A;  4DRI B;  2IYL D;  3ZC4 A;  3L8I A;  2GA0 A;  1V54 C;  256B A;  5DQT A;  3NDB B;  1YLM A;  2EPN A;  1EI7 A;  4O6M A;  3QTH A;  2GAQ A;  3POV A;  1HMO A;  3FOP A;  1EQ1 A;  1FTS A;  4JTD B;  3B29 A;  3SXY A;  2OEV A;  1BBH A;  1QSP A;  1VMA A;  1J8M F;  1XWJ A;  1YVI A;  5D91 A;  1Z7Q c;  5L0H A;  1VLS A;  3ZQY A;  1V74 B;  4ULW A;  3V5Y A;  4PAC A;  4WAB A;  3R2P A;  4E0I A;  3JTL O;  3K1I C;  3FDQ A;  1HW1 A;  2ICW G;  2LQG A;  4NTB A;  2HMZ A;  3QVZ A;  2YEV A;  3DM5 A;  1V4A A;  2YL0 A;  5L0F A;  1L3P A;  2XL6 A;  1RKE B;  1ZZP A;  2AWC A;  1H6G A;  3DE8 A;  1KNY A;  3QW0 A;  4JEA A;  4ONS A;  2J46 A;  4XEV A;  3ASN C;  3V7O A;  4HFK B;  2H7B A;  1E83 A;  2UUI A;  2XL4 A;  4G78 A;  1GGQ A;  2NUP A;  2HV7 A;  4K0D A;  3RVZ A;  3T6J A;  1HW2 A;  1A0B A;  4PR9 A;  3UGP A;  3JT1 A;  4JE9 A;  4YL3 A;  1N1C A;  1OKK D;  1ZHW A;  1ZYR F;  4AL0 A;  3UGO A;  4OIQ F;  3HNL A;  4YK5 A;  4A4A A;  5BQG A;  2XLH A;  3HTK C;  2O9X A;  1AVO B;  2IXP A;  2R02 A;  3TD7 A;  5T3T A;  2L7A A;  3C63 A;  1W2W A;  4I1O B;  4QDL A;  1L7C A;  2LFD A;  4DJ9 A;  3FAJ A;  3JYY A;  5TJ5 E;  3T4R A;  1JPN A;  2QE9 A;  4O79 A;  3NMK A;  3ASO C;  1VYI A;  3IQ5 A;  2IBF A;  2LK4 A;  4RD9 A;  1G8X A;  1WOL A;  1O3U A;  3FOO A;  1G4W R;  1Z63 A;  2EPL X;  1G4U S;  3ABL C;  5A6B A;  2G3K A;  1T9K A;  1ZU4 A;  2AU5 A;  2Q9A A;  2R9R B;  4LLC A;  4O7G A;  1BR4 A;  3G50 A;  4EKW A;  3E9V A;  2Q7R A;  3I4U A;  4E7Z A;  2MHR A;  3ABM C;  3M4C A;  1JR8 A;  1OW7 A;  4EBK A;  5A6B D;  1M2V B;  1JAF A;  1QVX A;  2LP4 A;  2WZG A;  2J9U A;  1JPJ A;  3AOU A;  3GOD A;  4GQH A;  3M1C B;  1WWP A;  1NU9 C;  4J32 B;  1Q0D A;  1NBB A;  3WG7 C;  1E85 A;  3CQZ A;  3HNK A;  2H7V C;  3IPM O;  3HJC A;  4JCH A;  3HNJ A;  1OCR C;  1HE1 A;  2VCA A;  2HUJ A;  1OW6 A;  1RKC A;  3RW0 A;  1U6H A;  2FFH A;  3ATP A;  3KKB A;  4AE4 B;  1WAT A;  4P9T A;  2R7R A;  4ZLD A;  4BPM A;  3N24 A;  5B3I A;  1C03 A;  4P6I C;  5A6A A;  2PX0 A;  3JRM O;  1VLT A;  3QW1 A;  3CSK A;  4EBJ A;  2G62 A;  2YVK A;  4XPX A;  1YYJ A;  5AGF A;  3US6 A;  2G3V A;  4BEM J;  4O6N A;  3L34 A;  1SMY F;  2P7V A;  5E2Q A;  2AVK A;  3VF0 A;  4D4N A;  3DKA A;  2LD6 A;  3EH1 A;  3K6B A;  4XQ1 A;  1MMA A;  5E3A A;  3K7D A;  3SXM A;  2J9B A;  3RH3 A;  1IW7 F;  1A7E A;  2Q9C A;  2QTV A;  1CPR A;  1WAS A;  2XS8 A;  3GWN A;  5F28 E;  3VRC A;  5KYU B;  4DXW A;  5JRA A;  2L81 A;  4ULV A;  4YWQ A;  5JLI A;  4N6H A;  4WJ0 A;  4BJT A;  5L3V A;  4YT4 A;  4OIR F;  3DMD A;  1BDJ B;  2BE5 F;  2R7T A;  3DJN B;  1YAR O;  3ABK C;  3B71 A;  1OCO C;  3NG1 A;  3QVY A;  4JJG A;  2C04 A;  3AG4 C;  4N4W A;  3TJ5 A;  2BL2 A;  3C18 A;  4JZA A;  4AL1 A;  5KYW B;  1OW8 A;  3LEV A;  3CEX A;  2A6E F;  3EH2 A;  1VYK A;  4CSA C;  4XLN F;  4N6C A;  2EIN C;  3S28 A;  3T6B A;  1ZHX A;  2KJG A;  4IJJ A;  3W8I A;  2Y3D A;  4CS7 A;  2HKV A;  1BR2 A;  5BQH A;  3TOM A;  5L3Q A;  4HFF B;  2JPU A;  3F46 A;  5KYN A;  1B68 A;  1M6T A;  3ZVR A;  3LEO A;  4MW8 A;  4BJ5 A;  4LDR A;  1A7V A;  2WZF A;  3B0P A;  1YZC A;  3KYJ A;  3RQF A;  2ZXO A;  3C62 A;  3CAX A;  3OA1 A;  2VAS A;  4MVR A;  3NYL A;  3L0I A;  1QKR A;  2HJM A;  4J30 B;  2R7V A;  1OXK A;  3UMK A;  4LDK A;  1Z3I X;  1HMD A;  2I15 A;  2PNO A;  5K0I A;  4YT5 A;  2NG1 A;  4QI0 A;  2EPM X;  3NKD A;  4YT8 A;  2A1D D;  4YL1 A;  3FVY A;  4K7B A;  4Z9J A;  3RF3 A;  3TQO A;  4RBN A;  4DVY P;  1JRA A;  1I4Y A;  4IAO A;  4RDA A;  1T6U A;  3QZC A;  5F5H A;  1D1B A;  1FMW A;  4G7O F;  5A6K A;  2ASR A;  4KNV A;  4KI2 A;  2EPO A;  3KYI A;  1SYQ A;  2J0X A;  3IQC A;  4HEA J;  4ANJ A;  1VTM P;  2YL7 A;  3DZA A;  4R32 A;  1H7I A;  2OG2 A;  1H9T A;  1FAP B;  5DQZ A;  2M4E A;  2EIJ C;  4CS9 A;  4EIY A;  2IXO A;  3I5P A;  2B0J A;  4XTK A;  4IGG A;  4CJG A;  2CYD A;  3FAP B;  2XSE A;  4FES A;  2RSE B;  4JEB A;  3U9M A;  3N0T A;  4EUK B;  2EIM C;  2ZXP A;  1K04 A;  3PMR A;  3PDM P;  3GEE A;  5IY5 C;  4JJF A;  1YYX A;  3GWL A;  1UFB A;  4I44 A;  1A41 A;  4CBE A;  2WZL A;  3H65 A;  3EGD B;  3H2V A;  2QLA A;  2VC9 A;  4U9E A;  1LS4 A;  4C3E A;  1YDI A;  5KYY B;  1U89 A;  1TKN A;  3LS0 A;  3U3B A;  1JOG A;  3EZH A;  4PFP A;  4XWJ A;  4PK4 A;  2PBE A;  1QPU A;  2MWQ A;  2ZXW C;  1LS1 A;  4MVU A;  4NTF A;  5B1B C;  3RFY A;  1ORJ A;  1LI7 A;  1Q0K A;  4CDY A;  4Q5S F;  3EGX A;  2UUH A;  4Z9I A;  3W2W A;  1TR2 A;  1ORS C;  2KQ9 A;  2XLW A;  5E3C A;  1APC A;  3N2Z B;  2XXA B;  1FFH A;  4IRU A;  5B3S C;  2FAP B;  1VOM A;  3JCU Q;  2VH3 A;  1Z5Z A;  3X2Q C;  1K05 A;  4PJM A;  4W8P A;  3Q7G A;  5COF A;  1PD0 A;  2L6G A;  2F22 A;  3MBG A;  3A11 A;  3ZDL A;  4DRJ B;  1RXQ A;  1SR2 A;  3QMK A;  1M57 C;  3L8J A;  3T9O A;  2IOQ A;  2KK1 A;  3G4X A;  2R7U A;  1MMD A;  5KYX B;  3GOR A;  3V5X A;  1RJ9 B;  2LFF A;  5B1A C;  3AG3 C;  2Z15 A;  3IQT A;  3LLK A;  3OWT A;  4JKV A;  2IM8 A;  1S7Z A;  1T5O A;  4EWC A;  2LIG A;  3KPH A;  2R7S A;  3VM6 A;  1YZA A;  2W4B A;  2HFI A;  5DVW A;  3NRH A;  1I4Z A;  1FFT C;  3DM9 B;  4NY3 A;  3O55 A;  5L0G A;  4H54 A;  4MTG A;  3B0V C;  4UDV A;  5COG A;  1CGO A;  1R4T A;  2IXM A;  2YLG A;  3C8G D;  1DOV A;  4PFO A;  3ZSU A;  5L0J A;  3M79 A;  3GM3 A;  3U8V A;  2XRH A;  3DXJ F;  1D1C A;  1ORY A;  2VB6 A;  1OCZ C;  4MTO A;  4AK9 A;  1TWC A;  3KL4 A;  2Q9B A;  4HE8 D;  2PP4 A;  2EPK X;  1QQ3 A;  1CGN A;  3C8G A;  2A0U A;  4PJL A;  3ZTM A;  4MQ9 F;  2RD9 A;  3S29 A;  5GPG B;  5AC4 A;  2Y3B A;  5F5F A;  4CX9 A;  4LAC B;  5T1D B;  4G7H F;  4JUR I;  5DS4 A;  3UNG C;  1C17 M;  4YL0 A;  1MQV A;  2XM4 A;  5T3W A;  1R5I D;  3AQC A;  1H9G A;  3B9Q A;  4U9D A;  5JSL A;  2H7O A;  3SNH A;  3TJ6 A;  2W4M A;  2XM0 A;  4YT2 A;  1U0B B;  2Q00 A;  1A7D A;  2DGJ A;  4MVS A;  2XLD A;  3SXK A;  2KNH A;  4JTC B;  3T6G B;  3NKE A;  3W2V A;  1K40 A;  2P6V A;  1OR2 A;  2OOC A;  2YHS A;  5DS6 A;  1YA9 A;  2OJQ A;  2NPU A;  1LPE A;  2AWY A;  2JD3 A;  3PCV A;  4Q7C A;  3S84 A;  4CIH A;  2R25 A;  1TFO B;  1GQA A;  3FXH A;  5EGY A;  3I5Q A;  3DI5 A;  1C02 A;  2HJ3 A;  3UMI A;  2VCC A;  3B0U X;  1ZHZ A;  2D4U A;  2P1A A;  4U5F E;  5KYU A;  3TOL A;  1E2X A;  2OEX A;  3R7C A;  1EA8 A;  2HS5 A;  3K1I A;  4DBQ A;  4JRZ A;  2OJE D;  3JYH A;  2A69 F;  5KYX A;  1NFO A;  2DYS C;  2QUP A;  2GFH A;  2Y69 C;  3M4B A;  3JZ0 A;  3ZQV A;  2YWA A;  1VB5 A;  1F1M A;  4BJ6 C;  4DRH B;  2FGY A;  2EIL C;  4FWV A;  2YZS A;  4OD5 A;  1NG1 A;  3W8H A;  1ZHY A;  2Q3T A;  4E18 A;  2OCC C;  3JRT A;  4MND A;  2P0N A;  1OKK A;  3U5S A;  3TK0 A;  3C8Z A;  1Q0F A;  3BRJ A;  3DE9 A;  4Q4Z F;  1QLE C;  2W9Y A;  3DJU B;  3NMI A;  2PF4 E;  2H8A A;  4L6R A;  4JVS A;  3ZG1 A;  2C03 A;  3SEO A;  3G4Z A;  4MVM A;  3ZTZ A;  4D4X A;  3EFO B;  3IQ6 A;  4XEK A;  1NSG B;  2LSE A;  1KTM A;  4G0H A;  2L9J A;  2YRF A;  4N06 A;  3AQB A;  5AC5 A;  4LDQ A;  3UR3 C;  3WAQ A;  4KC9 A;  4H4K C;  2J9W A;  3S9O A;  2KGO A;  4C7O A;  3RKO F;  2B0H A;  2A6H F;  3GM1 A;  4KNW A;  2ETS A;  4PJJ A;  1PD1 A;  3MFN A;  4O6Y A;  1OR3 A;  1CPQ A;  2LCH A;  4CDV A;  1M2V A;  4DVZ A;  2I8B A;  5BQI A;  3IHU A;  4XLP F;  3C8G B;  1GS9 A;  2WL8 A;  3HKK A;  2DYR C;  2R03 A;  3MLG A;  1TWH A;  2M64 A;  4OIP F;  1MND A;  4BJ1 A;  2AP3 A;  2DI3 A;  4MTF A;  5DLJ A;  1D0Z A;  1KU2 A;  1JMW A;  3GEH A;  1D1A A;  2KYH A;  3EHN A;  4K1O A;  5CI9 A;  3GM2 A;  2J9V A;  2R05 A;  3VYW A;  4F4B A;  3SZR A;  1MNE A;  3O6X A;  5EK0 A;  4JIO A;  2V3C C;  2WVQ A;  3LAY A;  5KYW A;  3ZWI A;  3RQE A;  2TMV P;  3L1M A;  1IZM A;  1T6Q A;  1NLX A;  4KBL A;  2HZ8 A;  4XPY A;  2XLM A;  3AJM A;  4BG0 A;  4JC7 A;  1Y4C A;  2HV6 A;  1QZX A;  1VK5 A;  3AG2 C;  3K33 A;  1ZW3 A;  2CDQ A;  4QI2 A;  3O39 A;  3LJB A;  3RIP A;  5A69 A;  5HSW A;  4YJW A;  3LNM B;  1WTY A;  3JSZ A;  3SP1 A;  1ZVZ A;  4M63 A;  4NC3 A;  4B6I A;  3J06 A;  3EG9 A;  3WOD F;  4Z9H A;  1FR0 A;  3JSE O;  4E17 A;  4FX5 A;  3EJN A;  2HSQ A;  2KC3 A;  3NYJ A;  4U5H A;  2KSF A;  1RKE A;  2R7Q A;  4WGZ A;  1E84 A;  3MYI A;  3HNI A;  2X51 A;  2EIK C;  1O5H A;  3MX3 A;  2DB4 A;  3Q6N A;  1PCX A;  4U5B E;  4I3M A;  2NUT A;  4CS8 A;  1G5Z A;  2XLV A;  2XS1 A;  3LUT B;  4C3B A;  1BZ4 A;  5COM A;  4BJ5 C;  4OIN F;  1MMG A;  1ZHT A;  2NSG A;  4GYT A;  1Z23 A;  2OU6 A;  2CW0 F;  2D5R B;  2MYS A;  3EQL F; 
#chains in the Genus database with same CATH homology
 1BR1 A;  1FMV A;  1SZI A;  4BJ6 A;  4A2N B;  3ECS A;  5E33 A;  3LES A;  4DOZ A;  3SYN A;  4C7O B;  1NU7 D;  2IXN A;  3KH2 A;  3E70 C;  2R7X A;  2J7P D;  4ZLC A;  1TWG A;  4CSA A;  2WVN A;  3EGD A;  4W8K A;  4PJN A;  2CNW D;  2J45 A;  3X1O A;  4YN0 B;  2ZXR A;  2J7P A;  3KMI A;  1D0X A;  4CS9 C;  4BEJ A;  3EPV A;  2NUT B;  3DAG A;  3EZI A;  2CNW A;  3F47 A;  2V26 A;  5DS5 A;  1M56 C;  1NZE A;  4X0R A;  5EHH A;  2E87 A;  3LS1 A;  3HLZ A;  1ZU5 A;  5FCL A;  4OIO F;  3DAF A;  2WB7 A;  1OCC C;  3Q7L A;  1WGW A;  1M2O A;  3RYL A;  1Z6A A;  3EG9 B;  3VAY A;  3LLI A;  4LLE A;  3FHD A;  3DD7 A;  3PHF 2;  4U5D E;  4EBB A;  3S27 A;  1D0Y A;  4GEH A;  2QY9 A;  3ZIB A;  2CGE A;  2PX3 A;  4U5C E;  4C3D A;  2W45 A;  5BUO A;  5D92 A;  2NUP B;  4IWB A;  4JW1 A;  2J0W A;  3K66 A;  3S0X A;  3AG1 C;  2Y3G A;  4LER A;  3GAN A;  2Y3H A;  3UMH A;  1MMN A;  1O87 A;  1LVK A;  3EGX B;  2ZPA A;  1J8Y F;  1V55 C;  1ST6 A;  4E7S A;  3IEE A;  4U5E E;  5KYY A;  4G7Z F;  3EFO A;  4OD4 A;  3LNR A;  3ITF A;  4AE4 A;  5CI8 A;  1RJ9 A;  3Q6M A;  3NYM A;  2Y39 A;  1SF8 A;  3OEO A;  2R7O A;  3CZ6 A;  2WVO A;  4CS8 C;  3EHM A;  2KW3 C;  3K1H A;  2XXA A;  1TWA A;  4U5G A;  4AX2 A;  1LKX A;  2PFD A;  4I1M A;  2R7W A;  2A68 F;  2IYL D;  3ZC4 A;  5DQT A;  1V54 C;  3NDB B;  4O6M A;  3POV A;  1FTS A;  1VMA A;  5D91 A;  1J8M F;  4ULW A;  3K1I C;  3FDQ A;  2YEV A;  3DM5 A;  2J46 A;  3ASN C;  3V7O A;  4HFK B;  2H7B A;  2XL4 A;  2NUP A;  4K0D A;  2HV7 A;  3T6J A;  3UGP A;  3JT1 A;  1N1C A;  1OKK D;  1ZHW A;  1ZYR F;  3UGO A;  4OIQ F;  3HTK C;  2O9X A;  2IXP A;  3TD7 A;  5T3T A;  1W2W A;  4I1O B;  4QDL A;  3FAJ A;  3T4R A;  1JPN A;  4O79 A;  3ASO C;  1VYI A;  4RD9 A;  1G8X A;  3ABL C;  2G3K A;  1ZU4 A;  4O7G A;  2Q9A A;  4LLC A;  1BR4 A;  3E9V A;  4E7Z A;  3I4U A;  3ABM C;  1M2V B;  2WZG A;  1JPJ A;  2J9U A;  3GOD A;  3M1C B;  1NU9 C;  4J32 B;  3WG7 C;  3CQZ A;  2H7V C;  3HJC A;  4JCH A;  1OCR C;  2FFH A;  3KKB A;  2R7R A;  4ZLD A;  3N24 A;  4P6I C;  2PX0 A;  3CSK A;  2G62 A;  2G3V A;  4O6N A;  3L34 A;  1SMY F;  2P7V A;  3EH1 A;  5E3A A;  3K6B A;  1MMA A;  3K7D A;  3RH3 A;  1IW7 F;  2Q9C A;  4BJ6 C;  2QTV A;  5KYU B;  2L81 A;  4YWQ A;  4WJ0 A;  4BJT A;  5L3V A;  4YT4 A;  4OIR F;  3DMD A;  2BE5 F;  2R7T A;  3DJN B;  5E2Q A;  3ABK C;  3NG1 A;  1OCO C;  4AE4 B;  4JJG A;  4DBR A;  2C04 A;  3AG4 C;  5KYW B;  4JZA A;  3LEV A;  3EH2 A;  2A6E F;  1VYK A;  4CSA C;  4XLN F;  2EIN C;  3S28 A;  3T6B A;  1ZHX A;  2KJG A;  4IJJ A;  3W8I A;  2Y3D A;  4CS7 A;  1BR2 A;  5L3Q A;  4HFF B;  3F46 A;  5KYN A;  3ZVR A;  4BJ5 A;  2WZF A;  3B0P A;  2ZXO A;  3OA1 A;  2VAS A;  3NYL A;  3L0I A;  4J30 B;  2R7V A;  3UMK A;  1Z3I X;  4YT5 A;  2NG1 A;  4QI0 A;  3NKD A;  4YT8 A;  2A1D D;  3FVY A;  4K7B A;  4RBN A;  4DVY P;  4IAO A;  4RDA A;  3QZC A;  5F5H A;  1D1B A;  1FMW A;  4G7O F;  4KNV A;  4KI2 A;  2J0X A;  4HEA J;  4ANJ A;  3DZA A;  2OG2 A;  5DQZ A;  2M4E A;  2EIJ C;  4CS9 A;  2IXO A;  3I5P A;  2B0J A;  4XTK A;  4FES A;  2XSE A;  3N0T A;  2EIM C;  2ZXP A;  3PMR A;  5IY5 C;  4JJF A;  4I44 A;  4CBE A;  2WZL A;  3H65 A;  3EGD B;  4C3E A;  5KYY B;  1TKN A;  3LS0 A;  4XWJ A;  3EZH A;  4PFP A;  4PK4 A;  2MWQ A;  2ZXW C;  1LS1 A;  5B1B C;  3RFY A;  4Q5S F;  3EGX A;  3W2W A;  1TR2 A;  2KQ9 A;  5E3C A;  3N2Z B;  2XXA B;  1FFH A;  4IRU A;  5B3S C;  1VOM A;  3JCU Q;  2VH3 A;  1Z5Z A;  3X2Q C;  4PJM A;  3Q7G A;  1PD0 A;  3QMK A;  1M57 C;  2IOQ A;  2R7U A;  1MMD A;  5KYX B;  1RJ9 B;  5B1A C;  3AG3 C;  2Z15 A;  3LLK A;  3OWT A;  1S7Z A;  4EWC A;  2R7S A;  2W4B A;  5DVW A;  3NRH A;  1FFT C;  3DM9 B;  4NY3 A;  3B0V C;  2IXM A;  3ZSU A;  4PFO A;  2XRH A;  3DXJ F;  1D1C A;  2VB6 A;  1OCZ C;  4AK9 A;  1TWC A;  3KL4 A;  2Q9B A;  4HE8 D;  2PP4 A;  4PJL A;  4MQ9 F;  3S29 A;  2Y3B A;  5F5F A;  4LAC B;  5T1D B;  4G7H F;  4JUR I;  5DS4 A;  3UNG C;  5T3W A;  3AQC A;  3SNH A;  3B9Q A;  4YT2 A;  1Z63 A;  2H7O A;  2W4M A;  2DGJ A;  2KNH A;  3W2V A;  3NKE A;  2P6V A;  2YHS A;  5DS6 A;  2JD3 A;  4Q7C A;  4CIH A;  5EGY A;  3I5Q A;  3UMI A;  3B0U X;  1ZHZ A;  4U5F E;  5KYU A;  4DBQ A;  3JYH A;  2A69 F;  5KYX A;  2DYS C;  2GFH A;  2Y69 C;  2FGY A;  2EIL C;  4FWV A;  2YZS A;  4OD5 A;  1NG1 A;  3W8H A;  1ZHY A;  2Q3T A;  2OCC C;  3JRT A;  4MND A;  1OKK A;  4Q4Z F;  1QLE C;  2W9Y A;  3DJU B;  2PF4 E;  4JVS A;  3ZG1 A;  2C03 A;  3SEO A;  3EFO B;  2LSE A;  4G0H A;  2L9J A;  4N06 A;  3AQB A;  3UR3 C;  4KC9 A;  4H4K C;  2J9W A;  4C7O A;  2KGO A;  3RKO F;  2A6H F;  4KNW A;  4PJJ A;  1PD1 A;  4O6Y A;  1M2V A;  4DVZ A;  2I8B A;  4XLP F;  3MLG A;  2WL8 A;  2DYR C;  1TWH A;  4OIP F;  1MND A;  4BJ1 A;  5DLJ A;  1D0Z A;  1KU2 A;  1D1A A;  5CI9 A;  3EHN A;  2J9V A;  3VYW A;  4F4B A;  3SZR A;  1MNE A;  3O6X A;  2V3C C;  2WVQ A;  3LAY A;  5KYW A;  1IZM A;  4KBL A;  2HV6 A;  1QZX A;  1VK5 A;  3AG2 C;  3K33 A;  2CDQ A;  4QI2 A;  3O39 A;  3LJB A;  3RIP A;  5HSW A;  4YJW A;  3JSZ A;  3SP1 A;  4M63 A;  4B6I A;  3EG9 A;  3WOD F;  4FX5 A;  3EJN A;  3NYJ A;  4U5H A;  2R7Q A;  4BG0 A;  2X51 A;  2EIK C;  1O5H A;  3MX3 A;  3Q6N A;  4U5B E;  1PCX A;  2NUT A;  4I3M A;  4CS8 A;  4C3B A;  4BJ5 C;  4OIN F;  1MMG A;  1ZHT A;  4GYT A;  1Z23 A;  2CW0 F;  2D5R B;  2MYS A;  3EQL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...