3UMHA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with cadmium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
180
structure length
180
Chain Sequence
HAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 80
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umhA00
3K66A 3NYLA 3Q7LA 4RDAA 3QMKA 3NYJA 3UMKA 3UMIA 1TKNA 3Q7GA 3PMRA 3UMHA 4RD9A 5BUOA 4YN0B 3K6BA
chains in the Genus database with same CATH superfamily
2R02A 3KYJA 1Z6AA 3PCVA 1RKEA 1LS4A 3K1HA 1Q0MA 2A0UA 2KQ9A 4Q4ZF 3G50A 3MX3A 2YL3A 4GYTA 3C7JA 4DVZA 4U5HA 2Y69C 4CIHA 4EBJA 3C63A 4OD5A 3M4CA 4JCHA 4NY3A 4UDVA 3DAGA 4CDYA 1A0BA 4LDQA 3RW0A 2C04A 2LSEA 2QE9A 1LM3B 3F46A 2JX0A 5KYYA 3C8GA 3UGOA 3U8PA 1M6TA 1JPNA 5HV9A 5JSLA 5K0IA 2WVOA 4JC7A 4HE8D 4P6IC 2J9VA 1WASA 1CPRA 2J9BA 3O39A 1M2VB 5L0FA 1APCA 1F1MA 4P9FA 5B1BC 5CI8A 1FMWA 5JLIA 2NUTB 5T1DB 4U5CE 4EHPA 2O9XA 2Y3BA 4Q7CA 3RF3A 3FOOA 3K1IA 3M1CB 4JTDB 3NYMA 2DYRC 1T9KA 4OIPF 1O5HA 2XLEA 2E87A 2X51A 3C8GD 3JT1A 3O6XA 3I5QA 3FMSA 2FFHA 4PK4A 3LNRA 4AL1A 1D0ZA 2M64A 2M4EA 3GEIA 2NG1A 4G78A 4I1OB 5EHHA 2OQMA 3CAXA 2Q7RA 3DMDA 3POVA 4CDAA 2LP4A 2XLWA 3DZAA 2J46A 3AJMA 3B9QA 4JEBA 1TFKB 1A41A 2OEXA 2G3KA 1HMDA 1PV3A 2OEVA 3HLZA 4IB4A 4JCZA 2J0XA 1I5NA 1IZMA 1YA7O 2NUPA 3SP1A 4YN0B 3RVYA 3ZDLA 3EH1A 2H7OA 2B0HA 4DBQA 3CSKA 1MMAA 4MS2A 1AUEA 1V55C 1S7ZA 2LD6A 2WVQA 3V5XA 3TJ5A 4OINF 1FR0A 4RD9A 3HKKA 1T5OA 2YL0A 1L7CA 3TOMA 5F5HA 1MNDA 4N6HA 1ZZPA 2G62A 3SXMA 4CX9A 3Q6NA 1KNYA 3DD7A 5COFA 1V4AA 3SZRA 3W8IA 4YT2A 2QLAA 2CCYA 1CGOA 4HFKB 1Q0GA 3G4XA 3L1MA 3U3BA 1BR4A 4G7ZF 1Y4CA 5DS5A 4LERA 2IXPA 1ZU4A 4U9EA 4WGZA 3UNGC 4QI0A 1Z63A 4H4KC 3S29A 2R7TA 2OKUA 4AE4A 3EG9B 5L0CA 1VMAA 3DXJF 3VM6A 3RIPA 1ZYRF 5BUOA 3PHF2 5A6BA 1R4TA 4JTAB 4U9DA 4CJOA 1FFHA 3K33A 4D4XA 1M2VA 4PFOA 4JVSA 3M79A 2NUTA 4E0HA 4HEAJ 256BA 2XLHA 2YLDA 3NYLA 4JURI 1V74B 2CNWA 2RD9A 4J7YA 4XEVA 1V54C 4E17A 4JJFA 2R7WA 1E83A 1QLEC 3JYYA 1PCXA 3L34A 4XLNF 4ONSA 3GANA 2XLVA 1ZVZA 4XTKA 1ZHWA 2G3VA 2KGOA 1YZAA 2VC9A 2YL7A 2XL6A 5E3AA 2QY9A 4Z9IA 1MQVA 3W2VA 4IWBA 4MW8A 4U5BE 3A9CA 4MQ9F 1VK5A 3IQ5A 3RQEA 3FOPA 5CI9A 3ZG1A 2CNWD 3RFYA 4JW1A 2AWYA 4NTAA 5HSWA 2NSGA 1EQ1A 4A2NB 2QTVA 1HW2A 2KK1A 1LI5A 5JUAA 4DJ9A 2AU5A 1OW8A 2LQGA 3B29A 3SXYA 3TJ6A 1LVKA 3SNHA 1R5ID 2W4MA 4DXWA 1QPUA 1ZHTA 2CDQA 1L3PA 1K40A 2ZXRA 3CZ6A 2YEVA 3MBGA 1QVXA 3ABKC 2XXAB 2R7SA 1G8XA 4Q5SF 1YARO 3LUTB 1SZIA 4H54A 5E33A 4DVYP 1T01A 4EBBA 3WODF 2KJGA 3DJNB 4PJLA 4PACA 3SYNA 2L6HA 2HMZA 2P61A 2WB7A 1HY5A 2Y3DA 3C62A 1EA8A 2L9JA 3UGPA 3LEOA 1ORYA 2EPKX 1YLMA 4AK9A 5B3IA 1SMYF 5KYXB 2XM4A 1FFTC 3HNKA 1TFOB 3EG9A 2WZLA 2V26A 4U5GA 4XPWA 3T6JA 3V5ZA 1E85A 2I15A 2R7XA 3S28A 3QMKA 5FZTA 1ORJA 2IYLD 3T9OA 2YZSA 1D0YA 3GM3A 4LDKA 5KYWA 3LAYA 3JSZA 1B68A 4XPYA 2EPLX 2R7UA 3LNMB 3FHDA 3FXHA 1ZHYA 2JPUA 3K7DA 3Q7LA 2PX3A 4G0HA 3S27A 2ZXPA 1H9GA 1OQCA 4K0DA 1GS9A 2HSQA 1XZPA 3DKAA 3E9VA 1ZW3A 4K1OA 3R2PA 3B0PA 2IXOA 2VASA 2DB4A 1HW1A 2LIGA 3DAFA 4DRHB 3U8VA 3ASNC 3GODA 4XLPF 2A1DD 3N24A 4JEAA 5BQHA 1MMDA 3WAQA 4EBKA 5A6AA 1CPQA 2PF4E 4RBNA 3A11A 2XS8A 3ASOC 3U3FA 3X1OA 4CS8C 1VYIA 2ZXWC 1AVOB 2LFDA 3QW1A 5BQIA 3B0VC 5AC5A 2GAQA 4JJGA 3ZWIA 3FVYA 1KTMA 2X0CA 2UUHA 2XL4A 3ABLC 1J8YF 2HJMA 3S9OA 4OIQF 1YDIA 4CDVA 4XEFA 3DM9B 4GEHA 5DVWA 3QZCA 4MVSA 2NSFA 4MVUA 4P9TA 3M4BA 3NMKA 2XXAA 2VH3A 2GWWA 2XSEA 2DI3A 4IGGA 3VAYA 3M15A 2OU6A 1WATA 2XLDA 2R05A 3LJBA 1HE1A 2ZD9A 1NU7D 3ZTMA 1TKNA 5L0DA 2EPNA 5KYXA 4C3EA 4CJGA 3QVYA 1TQGA 2YHSA 3EHMA 4BJTA 2Q9BA 4BJ5C 5COMA 4PFPA 4ZLCA 1U0BB 2L6GA 3UMHA 1FTSA 2HSBA 3CQZA 4JRZA 4BEMJ 2R25A 2WZGA 1YVIA 3K66A 1G4US 2EPMX 4Z9HA 3FAJA 3HNLA 4N6CA 4W8PA 5T3WA 4NCQA 3RQGA 2ZPAA 3HJCA 3WG7C 4CBEA 3RYLA 1Q0DA 3G4ZA 1M2OA 1OCRC 3KMIA 2FAPB 2J7PD 2Y3GA 2WL8A 2AWCA 4LLEA 3RVZA 3AG2C 2J8WA 3E70C 5AGFA 2PX0A 1S05A 2MWQA 2Q4FA 3AQCA 3NMIA 2MYSA 1ST6A 2HJ3A 3NG1A 1RXQA 4NC3A 4CS8A 2QNLA 4RDAA 1YYXA 1LKXA 2KYHA 2LFFA 2EINC 2YLGA 4MVRA 1FMVA 4CIPA 2AP3A 3QTHA 4XEKA 2EIJC 2MHRA 3L0IA 1YAUO 3FAPB 2VCCA 3W8HA 5F5FA 5A69A 4C7OB 1H9TA 2IXMA 1QZXA 2CYDA 4KI2A 1U6HA 3S0XA 3NKEA 5KYUB 1MMNA 4HFFB 5E2QA 3V7OA 3J06A 2R03A 4N06A 1A7DA 1Q0KA 4YT5A 3U9JA 1OW6A 2H8AA 1EKYA 1OXBA 1NG1A 1TR2A 5B3SC 3Q6MA 2OJQA 4MTFA 2A0BA 2RSEB 2HFIA 1Z7Qc 4YL0A 1CGNA 5DQTA 1UFBA 4WGYA 2GA0A 2OJED 4XWJA 1WN0A 3TK0A 4MNDA 4KNWA 3LS1A 1ORSC 3JYHA 1OCZC 4W8KA 4BJ5A 4F4BA 2YKZA 4DBRA 2KSFA 3BRJA 4NTBA 2IM8A 3ITFA 4N4WA 4CSAC 2VCBA 1JAFA 2P6VA 2ZXOA 2I8BA 4JIOA 2Q00A 4O6MA 4E7ZA 3EZHA 3KYIA 2WZFA 3AGTA 4E0IA 3L8IA 3ATPA 2W45A 5B1AC 2XS1A 4K7BA 2OG2A 3IHUA 4EUKB 2A69F 2VCAA 1C17M 2D5RB 4PJNA 3TULA 3EZIA 1NFOA 1E2XA 3JCUQ 3S84A 2V3CC 1D1BA 4FESA 4O79A 2HKVA 2BC5A 3EGXB 4NTFA 5DS6A 2B0JA 4O7GA 1NBBA 1K04A 1NU9C 3LS0A 3OA1A 4MTGA 2R9RB 2H7VC 5EK0A 3ZC4A 2J9UA 2Q9CA 3DE8A 3X2QC 2IBFA 4C3BA 3IQ6A 4ULWA 3N0TA 4EIYA 1WGWA 1BDJB 1OR3A 1SYQA 3DM5A 3SXZA 2ICWG 3OEOA 2P0NA 3EGDB 2EIKC 4YWQA 2A68F 4FX5A 4C7OA 5TJ5E 1JRAA 2BL2A 2XL8A 3T6GB 4WABA 3IPMO 2VB6A 4EKWA 2Q3TA 1BBHA 1U89A 4I44A 1NFNA 4O6NA 2AVKA 1Z23A 4MTOA 3JRTA 3TOLA 1H6GA 1JPJA 3US6A 1FNTc 3JZ0A 4MVZA 2UUIA 4IARA 3DWWA 4PJJA 1UG7A 1A7EA 1OXKA 2FGYA 2P7VA 3ZQYA 3NDBB 3H2VA 1ZU5A 4MVQA 3LLIA 4LDRA 1ZHZA 1FAPB 2XLOA 4KC9A 4JZAA 4ULVA 5L0HA 2D4UA 4CS9C 4YL3A 1G4WR 1TWHA 3JRMO 3ZQVA 3C8ZA 4E18A 4PJMA 4IAQA 4DRJB 1RMVA 5GPGB 4CSAA 4KNVA 4U5FE 1YYJA 5L0JA 3EHNA 1IW7F 1JMWA 1VLTA 2EIMC 5AC4A 5L3QA 4ZLDA 1D1CA 1HE9A 3PMRA 3U9MA 1OKKD 2IXNA 4JE9A 3B71A 4BJ1A 5JT4A 1LE4A 2J0WA 1LI7A 2L81A 1YZCA 1NSGB 4AE4B 1SF8A 4OIOF 4M63A 4BEJA 1AEPA 1PD1A 3AG3C 5COGA 1WOLA 3IQTA 4B6IA 1ZW2A 4X0RA 2OCCC 2J9WA 3EGXA 3EH2A 3DJUB 1C03A 3HNIA 2A6EF 3O55A 4AX2A 2YVKA 2JD3A 3CEXA 3VYWA 5A6KA 4Z9JA 3TD7A 2J7PA 1EI7A 1SR2A 1O3UA 3NRHA 3U5SA 1E84A 3F47A 4MW3A 2EPOA 1XZQA 3VF0A 4BJ6C 3KL4A 1TWGA 2YRFA 1MNEA 2NPUA 3EGDA 3R7CA 5JRAA 1YA9A 1OCCC 4IRUA 4D4NA 1TWCA 1TWAA 2HUJA 1CGME 3GORA 1ZHXA 5D91A 4E7SA 1OCOC 2WVNA 3Q7GA 3AG4C 1Q0FA 4AL0A 4FAPB 3LEVA 4J7TA 2GDCA 3GWLA 3KPHA 4QDLA 2IOQA 3MLGA 3SEOA 3AG1C 1VYKA 2XLMA 1DOWA 1LE2A 3NYJA 3DI5A 3UMKA 1O87A 1T6UA 3I5PA 1LIHA 2HZ8A 4O6YA 5JP7A 2GFHA 5DLJA 5EGYA 3U2LA 2KNHA 2PBEA 2L7AA 2DYSC 3IEEA 3KH2A 4CS9A 3H2UA 4R32A 4C3DA 4YL1A 5DQZA 4J30B 4KBLA 1GGQA 3T6BA 2J45A 3MFNA 3GM2A 4YJWA 5L0GA 1VB5A 3DE9A 2R7RA 1LS1A 3I4UA 4YT8A 1VLSA 3RKOF 1D0XA 1PD0A 3QVZA 4YK5A 3U2MA 4A4AA 3ZTZA 1MMGA 2TMVP 1C02A 1RJ9B 3EFOB 3NKDA 5CIVA 2L6FA 3EQLF 2R7QA 2XRHA 4LLCA 5L3VA 1I4YA 3HNJA 4WJ0A 4EWCA 5F28E 2Q9AA 4PR9A 3SXKA 3QW0A 2EILC 2W9YA 2ASRA 4BPMA 3OWTA 1VOMA 5DS4A 4OD4A 3C18A 5KYWB 3HTKC 3ECSA 2H7BA 1LPEA 3TQOA 3V5YA 3BEHA 3ZIBA 5JVEA 4I3MA 3U0CA 2YQYA 4OIRF 3GWNA 2OOCA 1D1AA 3GM1A 3N2ZB 4BG0A 4YT4A 5JS5A 1RKEB 3K6BA 3W2WA 2PFDA 4GQHA 3UR3C 5T3TA 2C03A 4BJ6A 1K05A 3AGUA 3EJNA 4LACB 2YLIA 3AQBA 3VRCA 1NLXA 1NZEA 4ER9A 1WWPA 3AOUA 5A6BD 1BZ4A 2HV7A 3GEEA 4I1MA 1RKCA 2PNOA 3GEHA 2CGEA 4JTCB 4QI2A 5KYYB 2XM0A 3C8GB 3JTLO 1T6QA 1OR2A 1GQAA 3H65A 4L6RA 4U5DE 5KYNA 5L0IA 3W4YA 4DOZA 3FDQA 1Z3IX 4JKVA 4CS7A 5FCLA 1GM5A 5IY5C 3EPVA 1Y6DA 2PP4A 1J8MF 1XWJA 1RCPA 3ABMC 4U5EE 1VTMP 3K1IC 2KC3A 4MVOA 3ZVRA 1DOVA 1E86A 3B0UX 2BE5F 4XQ1A 2A6HF 3ZSUA 4ANJA 3PDMP 2R7OA 1QQ3A 3LESA 1KU2A 2CW0F 3T4RA 4G7HF 1WTYA 2F22A 5KYUA 2YWAA 4FWVA 2R7VA 3LLKA 2Z15A 1A7VA 1RJ9A 4IAOA 4IJJA 1JR8A 4NQFA 3EFOA 5D92A 5BQGA 1H7IA 1N1CA 2HMQA 2Y39A 3IQCA 1T6IA 3L8JA 3O10A 4J32B 1BR2A 1BR1A 2DGJA 2HV6A 4XPXA 1QSPA 3MYFA 1Z5ZA 5E3CA 1JOGA 2ETSA 2NUPB 2LK4A 3JSEO 1OKKA 1M57C 2W4BA 2HS5A 2KW3C 2Y3HA 1HMOA 5A6JA 3NMJA 3RQFA 3MYIA 1OW7A 3RH3A 4G7OF 2LCHA 2QUPA 3KKBA 3UMIA 1QKRA 4MVMA 1G5ZA 3S90A 2P1AA 3WHNA 1M56C 2YL1A 1I4ZA 4DRIB 1YJGA 1W2WA
chains in the Genus database with same CATH topology
1Z6AA 4Q4ZF 3K1HA 2KQ9A 3MX3A 4GYTA 4DVZA 4U5HA 2Y69C 4CIHA 4OD5A 4JCHA 4NY3A 3DAGA 2C04A 2LSEA 3F46A 5KYYA 3UGOA 1JPNA 2WVOA 4HE8D 4P6IC 2J9VA 3O39A 1M2VB 5B1BC 5CI8A 1FMWA 2NUTB 5T1DB 4U5CE 2O9XA 2Y3BA 4Q7CA 3M1CB 3NYMA 2DYRC 4OIPF 1O5HA 2E87A 2X51A 3JT1A 3O6XA 3I5QA 4PK4A 2FFHA 3LNRA 1D0ZA 2M4EA 2NG1A 4I1OB 3DMDA 3POVA 3DZAA 2J46A 3B9QA 2G3KA 3HLZA 2J0XA 1IZMA 2NUPA 3SP1A 4YN0B 3EH1A 2H7OA 4DBQA 3CSKA 1MMAA 1V55C 1S7ZA 2WVQA 4OINF 4RD9A 5F5HA 1MNDA 2G62A 3Q6NA 3DD7A 3SZRA 4YT2A 3W8IA 4HFKB 1BR4A 4G7ZF 5DS5A 4LERA 2IXPA 1ZU4A 3UNGC 4QI0A 1Z63A 4H4KC 3S29A 2R7TA 4AE4A 3EG9B 1VMAA 3DXJF 3RIPA 1ZYRF 5BUOA 3PHF2 1FFHA 3K33A 1M2VA 4PFOA 4JVSA 2NUTA 4HEAJ 3NYLA 4JURI 2CNWA 1V54C 4JJFA 2R7WA 1QLEC 1PCXA 3L34A 4XLNF 3GANA 4XTKA 1ZHWA 2G3VA 2KGOA 5E3AA 2QY9A 3W2VA 4IWBA 4U5BE 4MQ9F 3ZG1A 1VK5A 5CI9A 2CNWD 3RFYA 4JW1A 5HSWA 4A2NB 2QTVA 1LVKA 3SNHA 2W4MA 1ZHTA 2CDQA 2ZXRA 3CZ6A 2YEVA 3ABKC 2XXAB 2R7SA 1G8XA 4Q5SF 5E33A 1SZIA 4DVYP 4EBBA 3WODF 2KJGA 3DJNB 4PJLA 3SYNA 2WB7A 2Y3DA 3UGPA 4AK9A 1SMYF 5KYXB 1FFTC 3EG9A 2WZLA 2V26A 4U5GA 3T6JA 2R7XA 3S28A 3QMKA 2IYLD 5KYWA 2YZSA 1D0YA 3LAYA 3JSZA 2R7UA 3FHDA 1ZHYA 3K7DA 3Q7LA 4G0HA 2PX3A 3S27A 2ZXPA 4K0DA 3E9VA 3B0PA 2IXOA 2VASA 3DAFA 3ASNC 3GODA 1W2WA 4XLPF 2A1DD 3N24A 1MMDA 2PF4E 3X1OA 4RBNA 3ASOC 4CS8C 1VYIA 2ZXWC 3B0VC 4JJGA 3FVYA 2XL4A 3ABLC 1J8YF 4OIQF 3DM9B 4GEHA 5DVWA 3QZCA 2XXAA 2VH3A 2XSEA 3VAYA 3LJBA 1NU7D 1TKNA 5KYXA 4C3EA 2YHSA 3EHMA 4BJTA 2Q9BA 4BJ5C 4PFPA 4ZLCA 3UMHA 1FTSA 3CQZA 2WZGA 3K66A 3FAJA 5T3WA 2ZPAA 3HJCA 3WG7C 4CBEA 3RYLA 1M2OA 1OCRC 3KMIA 2J7PD 2Y3GA 4LLEA 2WL8A 3AG2C 3E70C 2PX0A 2MWQA 3AQCA 2MYSA 1ST6A 1M56C 4CS8A 4RDAA 1LKXA 2EINC 1FMVA 2EIJC 3L0IA 3W8HA 5F5FA 4C7OB 2IXMA 1QZXA 4KI2A 3S0XA 3NKEA 5KYUB 1MMNA 4HFFB 5E2QA 3V7OA 4N06A 4YT5A 1NG1A 1TR2A 5B3SC 3Q6MA 5DQTA 4XWJA 4MNDA 4KNWA 3LS1A 3JYHA 4W8KA 1OCZC 4BJ5A 4F4BA 4DBRA 3ITFA 4CSAC 2P6VA 2ZXOA 2I8BA 4O6MA 4E7ZA 3EZHA 2WZFA 2W45A 5B1AC 4K7BA 2OG2A 2A69F 2D5RB 4PJNA 3EZIA 3JCUQ 2V3CC 1D1BA 4FESA 4O79A 3EGXB 5DS6A 2B0JA 4O7GA 1NU9C 3LS0A 3OA1A 2H7VC 3ZC4A 2J9UA 2Q9CA 3X2QC 4C3BA 4ULWA 3N0TA 1WGWA 3DM5A 3OEOA 3EGDB 2EIKC 4YWQA 2A68F 4FX5A 4C7OA 2VB6A 2Q3TA 4I44A 4O6NA 1Z23A 3JRTA 1JPJA 4PJJA 2FGYA 2P7VA 3NDBB 1ZU5A 3LLIA 1ZHZA 4KC9A 4JZAA 4CS9C 1TWHA 4PJMA 4CSAA 4KNVA 4U5FE 3EHNA 1IW7F 2EIMC 4ZLDA 5L3QA 1D1CA 3PMRA 1OKKD 2IXNA 4BJ1A 2J0WA 2L81A 4AE4B 1SF8A 4OIOF 4M63A 4BEJA 1PD1A 3AG3C 4B6IA 4X0RA 2OCCC 2J9WA 3EGXA 3DJUB 2A6EF 4AX2A 2JD3A 3VYWA 3TD7A 2J7PA 3NRHA 3F47A 4BJ6C 3KL4A 1TWGA 1MNEA 3EGDA 1OCCC 4IRUA 1TWCA 1TWAA 1ZHXA 5D91A 4E7SA 1OCOC 2WVNA 3Q7GA 3AG4C 3LEVA 4QDLA 2IOQA 3MLGA 3SEOA 3AG1C 1VYKA 3NYJA 3UMKA 1O87A 3I5PA 4O6YA 5DLJA 5EGYA 2GFHA 2KNHA 3IEEA 3KH2A 2DYSC 4CS9A 4C3DA 5DQZA 4J30B 4KBLA 3T6BA 2J45A 4YJWA 2R7RA 1LS1A 3I4UA 3RKOF 1D0XA 1PD0A 1MMGA 1RJ9B 3EFOB 3NKDA 3EQLF 2R7QA 2XRHA 4LLCA 5L3VA 4WJ0A 4EWCA 2Q9AA 2EILC 2W9YA 3OWTA 1VOMA 5DS4A 4OD4A 5KYWB 3HTKC 3ECSA 2H7BA 3ZIBA 4I3MA 4OIRF 1D1AA 3N2ZB 4BG0A 4YT4A 3K6BA 3W2WA 2PFDA 3UR3C 5T3TA 2C03A 4BJ6A 3EJNA 4LACB 3AQBA 1NZEA 2HV7A 4I1MA 2CGEA 4QI2A 5KYYB 3H65A 4U5DE 5KYNA 4DOZA 3FDQA 1Z3IX 4CS7A 5FCLA 5IY5C 3EPVA 2PP4A 1J8MF 4U5EE 3ABMC 3K1IC 3ZVRA 3B0UX 2BE5F 2A6HF 3ZSUA 4ANJA 2R7OA 3LESA 1KU2A 2CW0F 3T4RA 4G7HF 5KYUA 4FWVA 2R7VA 3LLKA 2Z15A 5D92A 1RJ9A 4IAOA 4IJJA 5EHHA 3EFOA 2Y39A 1N1CA 4J32B 1BR2A 1BR1A 2DGJA 2HV6A 1Z5ZA 5E3CA 4YT8A 2NUPB 3NG1A 1OKKA 1M57C 2W4BA 2KW3C 2Y3HA 3RH3A 4G7OF 3KKBA 3UMIA 3EH2A 2L9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K66 A;  3NYL A;  3Q7L A;  4RDA A;  3QMK A;  3NYJ A;  3UMK A;  3UMI A;  1TKN A;  3Q7G A;  3PMR A;  3UMH A;  4RD9 A;  5BUO A;  4YN0 B;  3K6B A; 
#chains in the Genus database with same CATH topology
 2R02 A;  3KYJ A;  1Z6A A;  3PCV A;  1RKE A;  1LS4 A;  3K1H A;  1Q0M A;  2A0U A;  2KQ9 A;  4Q4Z F;  3G50 A;  3MX3 A;  2YL3 A;  4GYT A;  3C7J A;  4DVZ A;  4U5H A;  2Y69 C;  4CIH A;  4EBJ A;  3C63 A;  4OD5 A;  3M4C A;  4JCH A;  4NY3 A;  4UDV A;  3DAG A;  4CDY A;  1A0B A;  4LDQ A;  3RW0 A;  2C04 A;  2LSE A;  2QE9 A;  1LM3 B;  3F46 A;  2JX0 A;  5KYY A;  3C8G A;  3UGO A;  3U8P A;  1M6T A;  1JPN A;  5HV9 A;  5JSL A;  5K0I A;  2WVO A;  4JC7 A;  4HE8 D;  4P6I C;  2J9V A;  1WAS A;  1CPR A;  2J9B A;  3O39 A;  1M2V B;  5L0F A;  1APC A;  1F1M A;  4P9F A;  5B1B C;  5CI8 A;  1FMW A;  5JLI A;  2NUT B;  5T1D B;  4U5C E;  4EHP A;  2O9X A;  2Y3B A;  4Q7C A;  3RF3 A;  3FOO A;  3K1I A;  3M1C B;  4JTD B;  3NYM A;  2DYR C;  1T9K A;  4OIP F;  1O5H A;  2XLE A;  2E87 A;  2X51 A;  3C8G D;  3JT1 A;  3O6X A;  3I5Q A;  3FMS A;  2FFH A;  4PK4 A;  3LNR A;  4AL1 A;  1D0Z A;  2M64 A;  2M4E A;  3GEI A;  2NG1 A;  4G78 A;  4I1O B;  5EHH A;  2OQM A;  3CAX A;  2Q7R A;  3DMD A;  3POV A;  4CDA A;  2LP4 A;  2XLW A;  3DZA A;  2J46 A;  3AJM A;  3B9Q A;  4JEB A;  1TFK B;  1A41 A;  2OEX A;  2G3K A;  1HMD A;  1PV3 A;  2OEV A;  3HLZ A;  4IB4 A;  4JCZ A;  2J0X A;  1I5N A;  1IZM A;  1YA7 O;  2NUP A;  3SP1 A;  4YN0 B;  3RVY A;  3ZDL A;  3EH1 A;  2H7O A;  2B0H A;  4DBQ A;  3CSK A;  1MMA A;  4MS2 A;  1AUE A;  1V55 C;  1S7Z A;  2LD6 A;  2WVQ A;  3V5X A;  3TJ5 A;  4OIN F;  1FR0 A;  4RD9 A;  3HKK A;  1T5O A;  2YL0 A;  1L7C A;  3TOM A;  5F5H A;  1MND A;  4N6H A;  1ZZP A;  2G62 A;  3SXM A;  4CX9 A;  3Q6N A;  1KNY A;  3DD7 A;  5COF A;  1V4A A;  3SZR A;  3W8I A;  4YT2 A;  2QLA A;  2CCY A;  1CGO A;  4HFK B;  1Q0G A;  3G4X A;  3L1M A;  3U3B A;  1BR4 A;  4G7Z F;  1Y4C A;  5DS5 A;  4LER A;  2IXP A;  1ZU4 A;  4U9E A;  4WGZ A;  3UNG C;  4QI0 A;  1Z63 A;  4H4K C;  3S29 A;  2R7T A;  2OKU A;  4AE4 A;  3EG9 B;  5L0C A;  1VMA A;  3DXJ F;  3VM6 A;  3RIP A;  1ZYR F;  5BUO A;  3PHF 2;  5A6B A;  1R4T A;  4JTA B;  4U9D A;  4CJO A;  1FFH A;  3K33 A;  4D4X A;  1M2V A;  4PFO A;  4JVS A;  3M79 A;  2NUT A;  4E0H A;  4HEA J;  256B A;  2XLH A;  2YLD A;  3NYL A;  4JUR I;  1V74 B;  2CNW A;  2RD9 A;  4J7Y A;  4XEV A;  1V54 C;  4E17 A;  4JJF A;  2R7W A;  1E83 A;  1QLE C;  3JYY A;  1PCX A;  3L34 A;  4XLN F;  4ONS A;  3GAN A;  2XLV A;  1ZVZ A;  4XTK A;  1ZHW A;  2G3V A;  2KGO A;  1YZA A;  2VC9 A;  2YL7 A;  2XL6 A;  5E3A A;  2QY9 A;  4Z9I A;  1MQV A;  3W2V A;  4IWB A;  4MW8 A;  4U5B E;  3A9C A;  4MQ9 F;  1VK5 A;  3IQ5 A;  3RQE A;  3FOP A;  5CI9 A;  3ZG1 A;  2CNW D;  3RFY A;  4JW1 A;  2AWY A;  4NTA A;  5HSW A;  2NSG A;  1EQ1 A;  4A2N B;  2QTV A;  1HW2 A;  2KK1 A;  1LI5 A;  5JUA A;  4DJ9 A;  2AU5 A;  1OW8 A;  2LQG A;  3B29 A;  3SXY A;  3TJ6 A;  1LVK A;  3SNH A;  1R5I D;  2W4M A;  4DXW A;  1QPU A;  1ZHT A;  2CDQ A;  1L3P A;  1K40 A;  2ZXR A;  3CZ6 A;  2YEV A;  3MBG A;  1QVX A;  3ABK C;  2XXA B;  2R7S A;  1G8X A;  4Q5S F;  1YAR O;  3LUT B;  1SZI A;  4H54 A;  5E33 A;  4DVY P;  1T01 A;  4EBB A;  3WOD F;  2KJG A;  3DJN B;  4PJL A;  4PAC A;  3SYN A;  2L6H A;  2HMZ A;  2P61 A;  2WB7 A;  1HY5 A;  2Y3D A;  3C62 A;  1EA8 A;  2L9J A;  3UGP A;  3LEO A;  1ORY A;  2EPK X;  1YLM A;  4AK9 A;  5B3I A;  1SMY F;  5KYX B;  2XM4 A;  1FFT C;  3HNK A;  1TFO B;  3EG9 A;  2WZL A;  2V26 A;  4U5G A;  4XPW A;  3T6J A;  3V5Z A;  1E85 A;  2I15 A;  2R7X A;  3S28 A;  3QMK A;  5FZT A;  1ORJ A;  2IYL D;  3T9O A;  2YZS A;  1D0Y A;  3GM3 A;  4LDK A;  5KYW A;  3LAY A;  3JSZ A;  1B68 A;  4XPY A;  2EPL X;  2R7U A;  3LNM B;  3FHD A;  3FXH A;  1ZHY A;  2JPU A;  3K7D A;  3Q7L A;  2PX3 A;  4G0H A;  3S27 A;  2ZXP A;  1H9G A;  1OQC A;  4K0D A;  1GS9 A;  2HSQ A;  1XZP A;  3DKA A;  3E9V A;  1ZW3 A;  4K1O A;  3R2P A;  3B0P A;  2IXO A;  2VAS A;  2DB4 A;  1HW1 A;  2LIG A;  3DAF A;  4DRH B;  3U8V A;  3ASN C;  3GOD A;  4XLP F;  2A1D D;  3N24 A;  4JEA A;  5BQH A;  1MMD A;  3WAQ A;  4EBK A;  5A6A A;  1CPQ A;  2PF4 E;  4RBN A;  3A11 A;  2XS8 A;  3ASO C;  3U3F A;  3X1O A;  4CS8 C;  1VYI A;  2ZXW C;  1AVO B;  2LFD A;  3QW1 A;  5BQI A;  3B0V C;  5AC5 A;  2GAQ A;  4JJG A;  3ZWI A;  3FVY A;  1KTM A;  2X0C A;  2UUH A;  2XL4 A;  3ABL C;  1J8Y F;  2HJM A;  3S9O A;  4OIQ F;  1YDI A;  4CDV A;  4XEF A;  3DM9 B;  4GEH A;  5DVW A;  3QZC A;  4MVS A;  2NSF A;  4MVU A;  4P9T A;  3M4B A;  3NMK A;  2XXA A;  2VH3 A;  2GWW A;  2XSE A;  2DI3 A;  4IGG A;  3VAY A;  3M15 A;  2OU6 A;  1WAT A;  2XLD A;  2R05 A;  3LJB A;  1HE1 A;  2ZD9 A;  1NU7 D;  3ZTM A;  1TKN A;  5L0D A;  2EPN A;  5KYX A;  4C3E A;  4CJG A;  3QVY A;  1TQG A;  2YHS A;  3EHM A;  4BJT A;  2Q9B A;  4BJ5 C;  5COM A;  4PFP A;  4ZLC A;  1U0B B;  2L6G A;  3UMH A;  1FTS A;  2HSB A;  3CQZ A;  4JRZ A;  4BEM J;  2R25 A;  2WZG A;  1YVI A;  3K66 A;  1G4U S;  2EPM X;  4Z9H A;  3FAJ A;  3HNL A;  4N6C A;  4W8P A;  5T3W A;  4NCQ A;  3RQG A;  2ZPA A;  3HJC A;  3WG7 C;  4CBE A;  3RYL A;  1Q0D A;  3G4Z A;  1M2O A;  1OCR C;  3KMI A;  2FAP B;  2J7P D;  2Y3G A;  2WL8 A;  2AWC A;  4LLE A;  3RVZ A;  3AG2 C;  2J8W A;  3E70 C;  5AGF A;  2PX0 A;  1S05 A;  2MWQ A;  2Q4F A;  3AQC A;  3NMI A;  2MYS A;  1ST6 A;  2HJ3 A;  3NG1 A;  1RXQ A;  4NC3 A;  4CS8 A;  2QNL A;  4RDA A;  1YYX A;  1LKX A;  2KYH A;  2LFF A;  2EIN C;  2YLG A;  4MVR A;  1FMV A;  4CIP A;  2AP3 A;  3QTH A;  4XEK A;  2EIJ C;  2MHR A;  3L0I A;  1YAU O;  3FAP B;  2VCC A;  3W8H A;  5F5F A;  5A69 A;  4C7O B;  1H9T A;  2IXM A;  1QZX A;  2CYD A;  4KI2 A;  1U6H A;  3S0X A;  3NKE A;  5KYU B;  1MMN A;  4HFF B;  5E2Q A;  3V7O A;  3J06 A;  2R03 A;  4N06 A;  1A7D A;  1Q0K A;  4YT5 A;  3U9J A;  1OW6 A;  2H8A A;  1EKY A;  1OXB A;  1NG1 A;  1TR2 A;  5B3S C;  3Q6M A;  2OJQ A;  4MTF A;  2A0B A;  2RSE B;  2HFI A;  1Z7Q c;  4YL0 A;  1CGN A;  5DQT A;  1UFB A;  4WGY A;  2GA0 A;  2OJE D;  4XWJ A;  1WN0 A;  3TK0 A;  4MND A;  4KNW A;  3LS1 A;  1ORS C;  3JYH A;  1OCZ C;  4W8K A;  4BJ5 A;  4F4B A;  2YKZ A;  4DBR A;  2KSF A;  3BRJ A;  4NTB A;  2IM8 A;  3ITF A;  4N4W A;  4CSA C;  2VCB A;  1JAF A;  2P6V A;  2ZXO A;  2I8B A;  4JIO A;  2Q00 A;  4O6M A;  4E7Z A;  3EZH A;  3KYI A;  2WZF A;  3AGT A;  4E0I A;  3L8I A;  3ATP A;  2W45 A;  5B1A C;  2XS1 A;  4K7B A;  2OG2 A;  3IHU A;  4EUK B;  2A69 F;  2VCA A;  1C17 M;  2D5R B;  4PJN A;  3TUL A;  3EZI A;  1NFO A;  1E2X A;  3JCU Q;  3S84 A;  2V3C C;  1D1B A;  4FES A;  4O79 A;  2HKV A;  2BC5 A;  3EGX B;  4NTF A;  5DS6 A;  2B0J A;  4O7G A;  1NBB A;  1K04 A;  1NU9 C;  3LS0 A;  3OA1 A;  4MTG A;  2R9R B;  2H7V C;  5EK0 A;  3ZC4 A;  2J9U A;  2Q9C A;  3DE8 A;  3X2Q C;  2IBF A;  4C3B A;  3IQ6 A;  4ULW A;  3N0T A;  4EIY A;  1WGW A;  1BDJ B;  1OR3 A;  1SYQ A;  3DM5 A;  3SXZ A;  2ICW G;  3OEO A;  2P0N A;  3EGD B;  2EIK C;  4YWQ A;  2A68 F;  4FX5 A;  4C7O A;  5TJ5 E;  1JRA A;  2BL2 A;  2XL8 A;  3T6G B;  4WAB A;  3IPM O;  2VB6 A;  4EKW A;  2Q3T A;  1BBH A;  1U89 A;  4I44 A;  1NFN A;  4O6N A;  2AVK A;  1Z23 A;  4MTO A;  3JRT A;  3TOL A;  1H6G A;  1JPJ A;  3US6 A;  1FNT c;  3JZ0 A;  4MVZ A;  2UUI A;  4IAR A;  3DWW A;  4PJJ A;  1UG7 A;  1A7E A;  1OXK A;  2FGY A;  2P7V A;  3ZQY A;  3NDB B;  3H2V A;  1ZU5 A;  4MVQ A;  3LLI A;  4LDR A;  1ZHZ A;  1FAP B;  2XLO A;  4KC9 A;  4JZA A;  4ULV A;  5L0H A;  2D4U A;  4CS9 C;  4YL3 A;  1G4W R;  1TWH A;  3JRM O;  3ZQV A;  3C8Z A;  4E18 A;  4PJM A;  4IAQ A;  4DRJ B;  1RMV A;  5GPG B;  4CSA A;  4KNV A;  4U5F E;  1YYJ A;  5L0J A;  3EHN A;  1IW7 F;  1JMW A;  1VLT A;  2EIM C;  5AC4 A;  5L3Q A;  4ZLD A;  1D1C A;  1HE9 A;  3PMR A;  3U9M A;  1OKK D;  2IXN A;  4JE9 A;  3B71 A;  4BJ1 A;  5JT4 A;  1LE4 A;  2J0W A;  1LI7 A;  2L81 A;  1YZC A;  1NSG B;  4AE4 B;  1SF8 A;  4OIO F;  4M63 A;  4BEJ A;  1AEP A;  1PD1 A;  3AG3 C;  5COG A;  1WOL A;  3IQT A;  4B6I A;  1ZW2 A;  4X0R A;  2OCC C;  2J9W A;  3EGX A;  3EH2 A;  3DJU B;  1C03 A;  3HNI A;  2A6E F;  3O55 A;  4AX2 A;  2YVK A;  2JD3 A;  3CEX A;  3VYW A;  5A6K A;  4Z9J A;  3TD7 A;  2J7P A;  1EI7 A;  1SR2 A;  1O3U A;  3NRH A;  3U5S A;  1E84 A;  3F47 A;  4MW3 A;  2EPO A;  1XZQ A;  3VF0 A;  4BJ6 C;  3KL4 A;  1TWG A;  2YRF A;  1MNE A;  2NPU A;  3EGD A;  3R7C A;  5JRA A;  1YA9 A;  1OCC C;  4IRU A;  4D4N A;  1TWC A;  1TWA A;  2HUJ A;  1CGM E;  3GOR A;  1ZHX A;  5D91 A;  4E7S A;  1OCO C;  2WVN A;  3Q7G A;  3AG4 C;  1Q0F A;  4AL0 A;  4FAP B;  3LEV A;  4J7T A;  2GDC A;  3GWL A;  3KPH A;  4QDL A;  2IOQ A;  3MLG A;  3SEO A;  3AG1 C;  1VYK A;  2XLM A;  1DOW A;  1LE2 A;  3NYJ A;  3DI5 A;  3UMK A;  1O87 A;  1T6U A;  3I5P A;  1LIH A;  2HZ8 A;  4O6Y A;  5JP7 A;  2GFH A;  5DLJ A;  5EGY A;  3U2L A;  2KNH A;  2PBE A;  2L7A A;  2DYS C;  3IEE A;  3KH2 A;  4CS9 A;  3H2U A;  4R32 A;  4C3D A;  4YL1 A;  5DQZ A;  4J30 B;  4KBL A;  1GGQ A;  3T6B A;  2J45 A;  3MFN A;  3GM2 A;  4YJW A;  5L0G A;  1VB5 A;  3DE9 A;  2R7R A;  1LS1 A;  3I4U A;  4YT8 A;  1VLS A;  3RKO F;  1D0X A;  1PD0 A;  3QVZ A;  4YK5 A;  3U2M A;  4A4A A;  3ZTZ A;  1MMG A;  2TMV P;  1C02 A;  1RJ9 B;  3EFO B;  3NKD A;  5CIV A;  2L6F A;  3EQL F;  2R7Q A;  2XRH A;  4LLC A;  5L3V A;  1I4Y A;  3HNJ A;  4WJ0 A;  4EWC A;  5F28 E;  2Q9A A;  4PR9 A;  3SXK A;  3QW0 A;  2EIL C;  2W9Y A;  2ASR A;  4BPM A;  3OWT A;  1VOM A;  5DS4 A;  4OD4 A;  3C18 A;  5KYW B;  3HTK C;  3ECS A;  2H7B A;  1LPE A;  3TQO A;  3V5Y A;  3BEH A;  3ZIB A;  5JVE A;  4I3M A;  3U0C A;  2YQY A;  4OIR F;  3GWN A;  2OOC A;  1D1A A;  3GM1 A;  3N2Z B;  4BG0 A;  4YT4 A;  5JS5 A;  1RKE B;  3K6B A;  3W2W A;  2PFD A;  4GQH A;  3UR3 C;  5T3T A;  2C03 A;  4BJ6 A;  1K05 A;  3AGU A;  3EJN A;  4LAC B;  2YLI A;  3AQB A;  3VRC A;  1NLX A;  1NZE A;  4ER9 A;  1WWP A;  3AOU A;  5A6B D;  1BZ4 A;  2HV7 A;  3GEE A;  4I1M A;  1RKC A;  2PNO A;  3GEH A;  2CGE A;  4JTC B;  4QI2 A;  5KYY B;  2XM0 A;  3C8G B;  3JTL O;  1T6Q A;  1OR2 A;  1GQA A;  3H65 A;  4L6R A;  4U5D E;  5KYN A;  5L0I A;  3W4Y A;  4DOZ A;  3FDQ A;  1Z3I X;  4JKV A;  4CS7 A;  5FCL A;  1GM5 A;  5IY5 C;  3EPV A;  1Y6D A;  2PP4 A;  1J8M F;  1XWJ A;  1RCP A;  3ABM C;  4U5E E;  1VTM P;  3K1I C;  2KC3 A;  4MVO A;  3ZVR A;  1DOV A;  1E86 A;  3B0U X;  2BE5 F;  4XQ1 A;  2A6H F;  3ZSU A;  4ANJ A;  3PDM P;  2R7O A;  1QQ3 A;  3LES A;  1KU2 A;  2CW0 F;  3T4R A;  4G7H F;  1WTY A;  2F22 A;  5KYU A;  2YWA A;  4FWV A;  2R7V A;  3LLK A;  2Z15 A;  1A7V A;  1RJ9 A;  4IAO A;  4IJJ A;  1JR8 A;  4NQF A;  3EFO A;  5D92 A;  5BQG A;  1H7I A;  1N1C A;  2HMQ A;  2Y39 A;  3IQC A;  1T6I A;  3L8J A;  3O10 A;  4J32 B;  1BR2 A;  1BR1 A;  2DGJ A;  2HV6 A;  4XPX A;  1QSP A;  3MYF A;  1Z5Z A;  5E3C A;  1JOG A;  2ETS A;  2NUP B;  2LK4 A;  3JSE O;  1OKK A;  1M57 C;  2W4B A;  2HS5 A;  2KW3 C;  2Y3H A;  1HMO A;  5A6J A;  3NMJ A;  3RQF A;  3MYI A;  1OW7 A;  3RH3 A;  4G7O F;  2LCH A;  2QUP A;  3KKB A;  3UMI A;  1QKR A;  4MVM A;  1G5Z A;  3S90 A;  2P1A A;  3WHN A;  1M56 C;  2YL1 A;  1I4Z A;  4DRI B;  1YJG A;  1W2W A; 
#chains in the Genus database with same CATH homology
 1Z6A A;  4Q4Z F;  3K1H A;  2KQ9 A;  3MX3 A;  4GYT A;  4DVZ A;  4U5H A;  2Y69 C;  4CIH A;  4OD5 A;  4JCH A;  4NY3 A;  3DAG A;  2C04 A;  2LSE A;  3F46 A;  5KYY A;  3UGO A;  1JPN A;  2WVO A;  4HE8 D;  4P6I C;  2J9V A;  3O39 A;  1M2V B;  5B1B C;  5CI8 A;  1FMW A;  2NUT B;  5T1D B;  4U5C E;  2O9X A;  2Y3B A;  4Q7C A;  3M1C B;  3NYM A;  2DYR C;  4OIP F;  1O5H A;  2E87 A;  2X51 A;  3JT1 A;  3O6X A;  3I5Q A;  4PK4 A;  2FFH A;  3LNR A;  1D0Z A;  2M4E A;  2NG1 A;  4I1O B;  3DMD A;  3POV A;  3DZA A;  2J46 A;  3B9Q A;  2G3K A;  3HLZ A;  2J0X A;  1IZM A;  2NUP A;  3SP1 A;  4YN0 B;  3EH1 A;  2H7O A;  4DBQ A;  3CSK A;  1MMA A;  1V55 C;  1S7Z A;  2WVQ A;  4OIN F;  4RD9 A;  5F5H A;  1MND A;  2G62 A;  3Q6N A;  3DD7 A;  3SZR A;  4YT2 A;  3W8I A;  4HFK B;  1BR4 A;  4G7Z F;  5DS5 A;  4LER A;  2IXP A;  1ZU4 A;  3UNG C;  4QI0 A;  1Z63 A;  4H4K C;  3S29 A;  2R7T A;  4AE4 A;  3EG9 B;  1VMA A;  3DXJ F;  3RIP A;  1ZYR F;  5BUO A;  3PHF 2;  1FFH A;  3K33 A;  1M2V A;  4PFO A;  4JVS A;  2NUT A;  4HEA J;  3NYL A;  4JUR I;  2CNW A;  1V54 C;  4JJF A;  2R7W A;  1QLE C;  1PCX A;  3L34 A;  4XLN F;  3GAN A;  4XTK A;  1ZHW A;  2G3V A;  2KGO A;  5E3A A;  2QY9 A;  3W2V A;  4IWB A;  4U5B E;  4MQ9 F;  3ZG1 A;  1VK5 A;  5CI9 A;  2CNW D;  3RFY A;  4JW1 A;  5HSW A;  4A2N B;  2QTV A;  1LVK A;  3SNH A;  2W4M A;  1ZHT A;  2CDQ A;  2ZXR A;  3CZ6 A;  2YEV A;  3ABK C;  2XXA B;  2R7S A;  1G8X A;  4Q5S F;  5E33 A;  1SZI A;  4DVY P;  4EBB A;  3WOD F;  2KJG A;  3DJN B;  4PJL A;  3SYN A;  2WB7 A;  2Y3D A;  3UGP A;  4AK9 A;  1SMY F;  5KYX B;  1FFT C;  3EG9 A;  2WZL A;  2V26 A;  4U5G A;  3T6J A;  2R7X A;  3S28 A;  3QMK A;  2IYL D;  5KYW A;  2YZS A;  1D0Y A;  3LAY A;  3JSZ A;  2R7U A;  3FHD A;  1ZHY A;  3K7D A;  3Q7L A;  4G0H A;  2PX3 A;  3S27 A;  2ZXP A;  4K0D A;  3E9V A;  3B0P A;  2IXO A;  2VAS A;  3DAF A;  3ASN C;  3GOD A;  1W2W A;  4XLP F;  2A1D D;  3N24 A;  1MMD A;  2PF4 E;  3X1O A;  4RBN A;  3ASO C;  4CS8 C;  1VYI A;  2ZXW C;  3B0V C;  4JJG A;  3FVY A;  2XL4 A;  3ABL C;  1J8Y F;  4OIQ F;  3DM9 B;  4GEH A;  5DVW A;  3QZC A;  2XXA A;  2VH3 A;  2XSE A;  3VAY A;  3LJB A;  1NU7 D;  1TKN A;  5KYX A;  4C3E A;  2YHS A;  3EHM A;  4BJT A;  2Q9B A;  4BJ5 C;  4PFP A;  4ZLC A;  3UMH A;  1FTS A;  3CQZ A;  2WZG A;  3K66 A;  3FAJ A;  5T3W A;  2ZPA A;  3HJC A;  3WG7 C;  4CBE A;  3RYL A;  1M2O A;  1OCR C;  3KMI A;  2J7P D;  2Y3G A;  4LLE A;  2WL8 A;  3AG2 C;  3E70 C;  2PX0 A;  2MWQ A;  3AQC A;  2MYS A;  1ST6 A;  1M56 C;  4CS8 A;  4RDA A;  1LKX A;  2EIN C;  1FMV A;  2EIJ C;  3L0I A;  3W8H A;  5F5F A;  4C7O B;  2IXM A;  1QZX A;  4KI2 A;  3S0X A;  3NKE A;  5KYU B;  1MMN A;  4HFF B;  5E2Q A;  3V7O A;  4N06 A;  4YT5 A;  1NG1 A;  1TR2 A;  5B3S C;  3Q6M A;  5DQT A;  4XWJ A;  4MND A;  4KNW A;  3LS1 A;  3JYH A;  4W8K A;  1OCZ C;  4BJ5 A;  4F4B A;  4DBR A;  3ITF A;  4CSA C;  2P6V A;  2ZXO A;  2I8B A;  4O6M A;  4E7Z A;  3EZH A;  2WZF A;  2W45 A;  5B1A C;  4K7B A;  2OG2 A;  2A69 F;  2D5R B;  4PJN A;  3EZI A;  3JCU Q;  2V3C C;  1D1B A;  4FES A;  4O79 A;  3EGX B;  5DS6 A;  2B0J A;  4O7G A;  1NU9 C;  3LS0 A;  3OA1 A;  2H7V C;  3ZC4 A;  2J9U A;  2Q9C A;  3X2Q C;  4C3B A;  4ULW A;  3N0T A;  1WGW A;  3DM5 A;  3OEO A;  3EGD B;  2EIK C;  4YWQ A;  2A68 F;  4FX5 A;  4C7O A;  2VB6 A;  2Q3T A;  4I44 A;  4O6N A;  1Z23 A;  3JRT A;  1JPJ A;  4PJJ A;  2FGY A;  2P7V A;  3NDB B;  1ZU5 A;  3LLI A;  1ZHZ A;  4KC9 A;  4JZA A;  4CS9 C;  1TWH A;  4PJM A;  4CSA A;  4KNV A;  4U5F E;  3EHN A;  1IW7 F;  2EIM C;  4ZLD A;  5L3Q A;  1D1C A;  3PMR A;  1OKK D;  2IXN A;  4BJ1 A;  2J0W A;  2L81 A;  4AE4 B;  1SF8 A;  4OIO F;  4M63 A;  4BEJ A;  1PD1 A;  3AG3 C;  4B6I A;  4X0R A;  2OCC C;  2J9W A;  3EGX A;  3DJU B;  2A6E F;  4AX2 A;  2JD3 A;  3VYW A;  3TD7 A;  2J7P A;  3NRH A;  3F47 A;  4BJ6 C;  3KL4 A;  1TWG A;  1MNE A;  3EGD A;  1OCC C;  4IRU A;  1TWC A;  1TWA A;  1ZHX A;  5D91 A;  4E7S A;  1OCO C;  2WVN A;  3Q7G A;  3AG4 C;  3LEV A;  4QDL A;  2IOQ A;  3MLG A;  3SEO A;  3AG1 C;  1VYK A;  3NYJ A;  3UMK A;  1O87 A;  3I5P A;  4O6Y A;  5DLJ A;  5EGY A;  2GFH A;  2KNH A;  3IEE A;  3KH2 A;  2DYS C;  4CS9 A;  4C3D A;  5DQZ A;  4J30 B;  4KBL A;  3T6B A;  2J45 A;  4YJW A;  2R7R A;  1LS1 A;  3I4U A;  3RKO F;  1D0X A;  1PD0 A;  1MMG A;  1RJ9 B;  3EFO B;  3NKD A;  3EQL F;  2R7Q A;  2XRH A;  4LLC A;  5L3V A;  4WJ0 A;  4EWC A;  2Q9A A;  2EIL C;  2W9Y A;  3OWT A;  1VOM A;  5DS4 A;  4OD4 A;  5KYW B;  3HTK C;  3ECS A;  2H7B A;  3ZIB A;  4I3M A;  4OIR F;  1D1A A;  3N2Z B;  4BG0 A;  4YT4 A;  3K6B A;  3W2W A;  2PFD A;  3UR3 C;  5T3T A;  2C03 A;  4BJ6 A;  3EJN A;  4LAC B;  3AQB A;  1NZE A;  2HV7 A;  4I1M A;  2CGE A;  4QI2 A;  5KYY B;  3H65 A;  4U5D E;  5KYN A;  4DOZ A;  3FDQ A;  1Z3I X;  4CS7 A;  5FCL A;  5IY5 C;  3EPV A;  2PP4 A;  1J8M F;  4U5E E;  3ABM C;  3K1I C;  3ZVR A;  3B0U X;  2BE5 F;  2A6H F;  3ZSU A;  4ANJ A;  2R7O A;  3LES A;  1KU2 A;  2CW0 F;  3T4R A;  4G7H F;  5KYU A;  4FWV A;  2R7V A;  3LLK A;  2Z15 A;  5D92 A;  1RJ9 A;  4IAO A;  4IJJ A;  5EHH A;  3EFO A;  2Y39 A;  1N1C A;  4J32 B;  1BR2 A;  1BR1 A;  2DGJ A;  2HV6 A;  1Z5Z A;  5E3C A;  4YT8 A;  2NUP B;  3NG1 A;  1OKK A;  1M57 C;  2W4B A;  2KW3 C;  2Y3H A;  3RH3 A;  4G7O F;  3KKB A;  3UMI A;  3EH2 A;  2L9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...