3UMHA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with cadmium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
180
structure length
180
Chain Sequence
b'HAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 80
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umhA00
3NYJA 3K66A 4RDAA 1TKNA 3UMKA 3Q7LA 3NYLA 3PMRA 3Q7GA 3QMKA 3UMHA 3UMIA 5BUOA 4RD9A 3K6BA 4YN0B
chains in the Genus database with same CATH superfamily
1D1AA 3Q7LA 2YL0A 2ASRA 3ITFA 1CGME 2R03A 2OJQA 1O87A 4Z9IA 3NKEA 2EINC 1T6QA 3S27A 4EUKB 1MMAA 4JW1A 1RKEA 1NBBA 2YLDA 3B71A 3OA1A 2R25A 3NMJA 2NUTA 3U3FA 5EGYA 1WTYA 3K1HA 4MVUA 3ZG1A 4DBQA 2WZGA 1T01A 1F1MA 1OCRC 3DWWA 1PV3A 2KW3C 2IXNA 3EFOA 3H2UA 4J7TA 4RDAA 4LLCA 4U5GA 2KNHA 4AX2A 4EKWA 4YT8A 1BR4A 1Y6DA 4IAOA 1EI7A 4MNDA 4CJGA 3EPVA 4E7SA 4FAPB 1H9TA 2J0XA 1TFOB 4MVZA 2R05A 4ONSA 2QLAA 4U5EE 1VTMP 2KJGA 1ZHWA 1Z3IX 3GM1A 4NTFA 2XLOA 1LIHA 2AU5A 5IY5C 4MQ9F 3U8PA 3KYJA 1OXBA 3ZTZA 4XLPF 5L0FA 1BZ4A 3JTLO 5BUOA 3TJ5A 2RSEB 3WHNA 4JTAB 2HZ8A 1LE4A 1DOVA 2YRFA 1XZPA 1R5ID 1W2WA 1ZHTA 3C8GD 3DJNB 2DI3A 2EPOA 2OCCC 3FHDA 5TJ5E 4U5CE 3UMHA 4C3DA 4CBEA 1K04A 1OW6A 1PCXA 1RCPA 1VYIA 3CEXA 4LLEA 4ULWA 2CYDA 4YL0A 2YWAA 4L6RA 2W4MA 4NY3A 4XLNF 3ATPA 3C8GA 4CX9A 1NSGB 5A6KA 5A69A 3EG9A 3SXKA 2WL8A 4AK9A 4KNVA 1OKKD 3KYIA 5AGFA 3EG9B 3HNIA 3GODA 1CPRA 1HMOA 4LACB 2L81A 1I5NA 3J06A 4EIYA 2J0WA 1N1CA 1YYXA 1HY5A 3S0XA 5B1AC 1OKKA 5HSWA 4AL0A 3C7JA 1HMDA 1GQAA 3C63A 1KTMA 2GWWA 5COGA 1V4AA 1L3PA 3H2VA 1GM5A 1EQ1A 2LK4A 3CQZA 3RFYA 5AC4A 5HV9A 5JUAA 2OOCA 5F28E 2Q9CA 4O7GA 1IZMA 1YDIA 2RD9A 2WVOA 3TK0A 4DRHB 2R02A 1Q0KA 1JR8A 2EPMX 4CS8C 1FTSA 2I8BA 3FXHA 4JC7A 3ZWIA 4DVYP 4PJMA 1S7ZA 2PP4A 3QW1A 4IARA 1EKYA 1FR0A 2XLDA 2DYRC 4BJ6A 3U0CA 1V55C 4BJ5A 3K6BA 5BQIA 4Q7CA 3ABMC 4I1MA 1K40A 3SYNA 5JT4A 2OQMA 5KYNA 1CGOA 4JEAA 1Z5ZA 5BQGA 3WODF 3TQOA 3LNRA 3LS1A 5JLIA 1QLEC 4YK5A 2LCHA 3X1OA 2X51A 3EGXA 4DBRA 5DS6A 2KGOA 2R9RB 1OQCA 2UUHA 3GM3A 3X2QC 5KYWB 2Y3GA 4HEAJ 4RBNA 4OIPF 4EWCA 3T6JA 3EGDB 4ANJA 3PMRA 2KC3A 3IHUA 2C03A 4OINF 4UDVA 3ABKC 5E33A 1A7VA 3A11A 3AGTA 3O6XA 3GEHA 1BBHA 1U6HA 2FFHA 3N0TA 4CIHA 2R7OA 3QVYA 1OCZC 4F4BA 4MVRA 1M2OA 1H6GA 2CW0F 4N06A 2ZXRA 3A9CA 1GS9A 3FAPB 4WJ0A 3ZQVA 2R7RA 1V54C 3LLIA 4O6MA 3KMIA 4QDLA 2A68F 2YEVA 4H4KC 4J7YA 3QTHA 1AUEA 2L6GA 3GEIA 3TOMA 2P0NA 1TFKB 2XL8A 3C8ZA 3SXMA 4A2NB 3AG2C 2HSBA 2QNLA 1QSPA 4XEVA 3E70C 2MWQA 4MVSA 1TKNA 1XZQA 4JZAA 2TMVP 3JRMO 2XLHA 4MW8A 3LESA 4YL1A 3DD7A 3BEHA 1O3UA 3JSZA 4IB4A 2YZSA 2ZXOA 4LDQA 1JMWA 3NYMA 2VB6A 4N6CA 5DQZA 2H7BA 4AE4B 1G5ZA 1ZVZA 2Q3TA 2A6HF 5BQHA 4C3EA 3SXZA 1UFBA 3SP1A 1Q0FA 5KYUA 4C7OB 4YT2A 5JRAA 5EHHA 1ST6A 1PD1A 3DM5A 4CS7A 1Z7Qc 2JD3A 1KU2A 3RKOF 1RJ9A 3MYFA 4BEMJ 1T6IA 5CI8A 3F47A 2DGJA 4GYTA 3SXYA 2CCYA 3QMKA 5T1DB 1NU7D 1RJ9B 2QTVA 2LQGA 3FOPA 3HLZA 4BG0A 2AWCA 2IXOA 4OD5A 1C03A 2J9VA 5B1BC 4IJJA 5E3CA 3SEOA 5KYYB 3ZIBA 4PK4A 5D92A 4BPMA 1J8YF 1LI5A 3JT1A 4FESA 3MFNA 4NCQA 2YLIA 2KSFA 3NMKA 3V5YA 2VCBA 2NSGA 3KH2A 3C18A 1D1BA 3E9VA 1WN0A 2E87A 3M1CB 4JJGA 2IXPA 4YJWA 5F5HA 3W2WA 3ZSUA 1C02A 1VOMA 4YWQA 4G7ZF 2R7UA 1HE9A 3ZTMA 2Q9BA 4DVZA 3DMDA 3JYYA 2YLGA 5JSLA 2XL6A 4GEHA 1TWCA 3ABLC 4ULVA 3IQCA 1ZZPA 3JCUQ 3T4RA 5L0JA 3AG3C 3L8JA 2OEVA 2XL4A 3CAXA 4U9EA 4XQ1A 4J30B 3L34A 2WZLA 3T6GB 2YKZA 4H54A 3W4YA 2L6FA 1AVOB 4LERA 2YVKA 3B0PA 3VF0A 5KYUB 3TD7A 2HV7A 1E85A 1LPEA 2HUJA 1FFHA 1TQGA 4U5BE 5JP7A 2LSEA 3Q7GA 3ZVRA 1Z6AA 3UNGC 2W9YA 2BC5A 5T3WA 3W8IA 5D91A 4Q5SF 2YL7A 4G78A 5K0IA 1FMVA 4OIQF 3EJNA 1RKCA 3KPHA 3S29A 1YZAA 2A6EF 3M15A 1QKRA 2Y3HA 2PNOA 3QW0A 3S84A 3VYWA 2P6VA 4JKVA 2YL3A 1D0YA 1LM3B 2G62A 3DAGA 1M56C 1WATA 2IYLD 2IM8A 2JX0A 4OIRF 3W8HA 3L1MA 1FMWA 3R2PA 4P9TA 4PR9A 1YA7O 4BJ6C 2VCCA 2LFDA 3EHNA 3NMIA 3U9MA 3LEVA 3MX3A 4BJ5C 1MQVA 2JPUA 4CJOA 2J45A 3HKKA 3NDBB 4JJFA 2L6HA 1ZHXA 1MNEA 1ORJA 2IBFA 1MMGA 4NTBA 4Z9JA 2J46A 1S05A 4DJ9A 4EBBA 5EK0A 3C62A 3UMIA 2O9XA 5E2QA 1WOLA 1YARO 2GFHA 3L8IA 4O6NA 3T9OA 4FWVA 5DS5A 3N2ZB 2BE5F 1YA9A 4MW3A 1YJGA 2OJED 2P61A 1E84A 3PCVA 1Y4CA 3L0IA 4JTCB 2IOQA 5L3VA 3RQEA 4CDVA 2XLWA 3JZ0A 1CPQA 1SYQA 4I44A 3B29A 4IWBA 5KYWA 1D1CA 2G3KA 3W2VA 4DRIB 2XLMA 3DJUB 1M2VB 4BEJA 3EGDA 4P9FA 2XLVA 1A0BA 4KBLA 4D4XA 2W45A 2NUPB 3K1IC 3NYLA 3IEEA 4MS2A 4E17A 3M79A 2IXMA 3AOUA 2HFIA 1ZW3A 2AP3A 4NC3A 3VAYA 3CZ6A 4R32A 1ORYA 3S90A 1RMVA 4GQHA 3SNHA 2R7SA 2XM0A 4MTGA 3ZC4A 4YT4A 1Q0MA 3AGUA 1YLMA 4X0RA 4YT5A 1E2XA 2A0UA 4PJJA 4IAQA 4KC9A 4PJNA 4DOZA 2EIKC 4I1OB 2NG1A 5B3SC 5L0GA 1U0BB 3BRJA 3UR3C 3MBGA 1SZIA 1BR2A 1JPJA 4CDYA 4Q4ZF 2LIGA 1QPUA 3DXJF 3I4UA 4JIOA 1OCOC 5CI9A 1B68A 2XS8A 4D4NA 1H9GA 1JRAA 2L7AA 3RVZA 1NFOA 3US6A 3FOOA 1LKXA 1U89A 2HV6A 1T9KA 3KL4A 3KKBA 2XXAB 3IQTA 2QE9A 5DS4A 2J9WA 1ZHZA 3V7OA 3DE8A 3WAQA 4CS9C 5COFA 1VYKA 3EQLF 3RQGA 2Q9AA 1HW1A 2NPUA 2J7PA 3MYIA 3NYJA 4MTFA 4AE4A 2WVQA 3LAYA 3ZDLA 4KNWA 3PDMP 2R7XA 2G3VA 1NG1A 2HMZA 3G50A 5DQTA 1ZHYA 4QI0A 2Y69C 1OW8A 4C7OA 4E7ZA 4K0DA 2LFFA 3Q6NA 2YHSA 1SR2A 4K1OA 1GGQA 1UG7A 1A7DA 1Z23A 3U2LA 2F22A 1RXQA 3FAJA 2ZD9A 1PD0A 3VRCA 3DAFA 3EZIA 1YYJA 4CS9A 5KYXB 3LS0A 1OCCC 4WGYA 5JS5A 4NTAA 1BDJB 4JRZA 5KYYA 2P1AA 2W4BA 2R7QA 5FCLA 4ER9A 4U5DE 3FVYA 2A1DD 2WZFA 1A7EA 4BJ1A 3QVZA 2Y3BA 3AG4C 3GWLA 5AC5A 5A6BD 2XSEA 5COMA 3UMKA 4EBKA 2UUIA 3JRTA 3S28A 2XRHA 2KQ9A 4E0HA 4KI2A 4ZLDA 2J8WA 2AVKA 4JCHA 3M4CA 5A6BA 3H65A 3HJCA 2HJ3A 3ASNC 3RW0A 1OW7A 1ZW2A 3ECSA 2VASA 2H7OA 1JPNA 1OR3A 1HW2A 2KYHA 2Q00A 4YL3A 3I5PA 2XS1A 2D4UA 5GPGB 2QUPA 3M4BA 1VB5A 1NFNA 2GAQA 3O55A 2DB4A 1DOWA 1TWHA 1SMYF 2J9UA 2LP4A 2OEXA 2Y39A 2ZXPA 3U3BA 5A6AA 3NG1A 1JOGA 1RKEB 1T5OA 2ICWG 4G7OF 5F5FA 2NUTB 2WVNA 3LEOA 3RVYA 1HE1A 1NZEA 4RD9A 1LS4A 4U5HA 4U9DA 1FAPB 3AQCA 2ZPAA 3EFOB 1IW7F 1XWJA 1MMNA 3LUTB 4HFKB 2A69F 2EPNA 4WABA 4JTDB 1M57C 2MHRA 1SF8A 4NQFA 4EHPA 3JYHA 3FMSA 4G0HA 4CIPA 4HFFB 4XEKA 1YVIA 2B0HA 1R4TA 1ORSC 3LNMB 1VMAA 5JVEA 3S9OA 1M6TA 4JCZA 1LI7A 3V5XA 2VCAA 1G4US 2H8AA 3JSEO 2X0CA 4A4AA 256BA 2HMQA 1J8MF 4LDRA 2R7VA 3CSKA 2MYSA 4B6IA 2BL2A 3GANA 3MLGA 2H7VC 5DVWA 4JVSA 3U8VA 2OU6A 2FAPB 1AEPA 2GA0A 2WB7A 3C8GB 1Q0GA 4PFPA 2R7WA 4E0IA 1NLXA 4HE8D 3DM9B 4MVOA 1I4YA 4ZLCA 2VH3A 5L0HA 4XWJA 1D0ZA 1YAUO 2KK1A 1CGNA 3K1IA 3LJBA 3HNLA 1ZYRF 5A6JA 2NSFA 3IQ5A 3RYLA 2A0BA 3DE9A 1T6UA 2ZXWC 1VLTA 2XLEA 3ZQYA 3WG7C 1VK5A 2EILC 2J9BA 4DXWA 1D0XA 1FFTC 3O10A 1APCA 2OG2A 4W8PA 4EBJA 2CGEA 3G4ZA 1M2VA 3EH1A 4XEFA 4PFOA 1TR2A 5L0CA 1LVKA 3GORA 4IGGA 1WGWA 2NUPA 4O6YA 1MMDA 1QVXA 4FX5A 4I3MA 3DKAA 4WGZA 3RIPA 1ZU4A 3AJMA 4N6HA 2Q4FA 4JEBA 3GEEA 4OIOF 3AQBA 2R7TA 3UGOA 2EIMC 3IPMO 1L7CA 4MVQA 4P6IC 3O39A 3TJ6A 1G8XA 4IRUA 2Q7RA 1E83A 4PJLA 4CSAC 1KNYA 4XPWA 3U9JA 1ZU5A 4XPXA 2OKUA 4J32B 4E18A 2EPLX 4W8KA 5L0DA 3HTKC 2CDQA 2HSQA 2HS5A 3NRHA 2V3CC 2GDCA 2HJMA 3HNKA 3OEOA 3QZCA 4M63A 4YN0B 3R7CA 3RF3A 3U2MA 3FDQA 3B0UX 3I5QA 1EA8A 1V74B 1TWAA 3U5SA 2D5RB 4PACA 4CS8A 2XXAA 3EGXB 3GM2A 3DI5A 4CSAA 2J7PD 1YZCA 2ETSA 2EPKX 2YQYA 1H7IA 2EIJC 2M4EA 3EH2A 3T6BA 4G7HF 1E86A 4XTKA 2LD6A 3EHMA 4MVMA 5FZTA 4C3BA 2V26A 5L0IA 2XM4A 1LS1A 2PF4E 3GWNA 4AL1A 3UGPA 2M64A 4DRJB 3K66A 1TWGA 2B0JA 3F46A 2QY9A 2PBEA 2CNWD 1K05A 2AWYA 2P7VA 2FGYA 1NU9C 4K7BA 3B0VC 1Z63A 5KYXA 1VLSA 3LLKA 1A41A 1JAFA 3TOLA 3RH3A 1FNTc 1MNDA 2PX0A 1I4ZA 2CNWA 3ASOC 5DLJA 4Z9HA 1C17M 3DZAA 3K7DA 3N24A 4O79A 1G4WR 4N4WA 4QI2A 2VC9A 1QZXA 2PFDA 3G4XA 3B9QA 1Q0DA 2I15A 4JURI 1WWPA 5CIVA 4U5FE 3POVA 4OD4A 1O5HA 2C04A 4LDKA 5T3TA 5B3IA 2HKVA 3TULA 1WASA 3OWTA 3HNJA 4XPYA 1OXKA 2L9JA 2DYSC 1OR2A 1LE2A 1QQ3A 2Z15A 3PHF2 3EZHA 5L3QA 3AG1C 4MTOA 2Y3DA 4CDAA 4JE9A 3SZRA 3K33A 2YL1A 3V5ZA 3Q6MA 3VM6A 5E3AA 4BJTA 3RQFA 3NKDA 2PX3A 3IQ6A 1BR1A
chains in the Genus database with same CATH topology
1D1AA 3Q7LA 3ITFA 1O87A 3NKEA 2EINC 3S27A 1MMAA 4JW1A 3OA1A 2NUTA 5EGYA 3ZG1A 3K1HA 4DBQA 2WZGA 3EFOA 1OCRC 2KW3C 2IXNA 4YT8A 4U5GA 4RDAA 4LLCA 4AX2A 2KNHA 1BR4A 4IAOA 4MNDA 3EPVA 4E7SA 2J0XA 4U5EE 2KJGA 1ZHWA 1Z3IX 5IY5C 4MQ9F 4XLPF 5BUOA 3K1IC 1ZHTA 1W2WA 1Z63A 3DJNB 3FHDA 2OCCC 4C3DA 4U5CE 3UMHA 4CBEA 1PCXA 1VYIA 4LLEA 4ULWA 4NY3A 2W4MA 4XLNF 3EG9A 2WL8A 4AK9A 4KNVA 1OKKD 3EG9B 3GODA 4LACB 2L81A 2J0WA 1N1CA 3S0XA 5B1AC 1OKKA 5HSWA 3RFYA 3CQZA 2Q9CA 4O7GA 1IZMA 2WVOA 4CS8C 1FTSA 2I8BA 4DVYP 4PJMA 1S7ZA 2PP4A 2DYRC 4BJ6A 1V55C 4BJ5A 3K6BA 4Q7CA 3ABMC 4I1MA 3SYNA 5KYNA 1Z5ZA 3WODF 3LNRA 3LS1A 1QLEC 3X1OA 4DBRA 5DS6A 2X51A 3EGXA 5KYWB 2KGOA 3X2QC 2Y3GA 4HEAJ 4RBNA 4OIPF 4EWCA 3T6JA 3EGDB 4ANJA 3PMRA 2C03A 4OINF 3ABKC 5E33A 3O6XA 2FFHA 3N0TA 4CIHA 2R7OA 1OCZC 4F4BA 4N06A 1M2OA 2CW0F 2ZXRA 4WJ0A 2R7RA 1V54C 3LLIA 4O6MA 3KMIA 4QDLA 2A68F 2YEVA 4H4KC 4A2NB 3AG2C 3E70C 2MWQA 1TKNA 4JZAA 3LESA 3DD7A 3JSZA 2YZSA 2ZXOA 3NYMA 2VB6A 5DQZA 2H7BA 4AE4B 2Q3TA 2A6HF 4C3EA 3SP1A 5KYUA 4C7OB 4YT2A 5EHHA 1ST6A 1PD1A 3DM5A 4CS7A 2JD3A 1KU2A 3RKOF 1RJ9A 5CI8A 3F47A 2DGJA 4GYTA 3QMKA 5T1DB 1NU7D 1RJ9B 2QTVA 3HLZA 4BG0A 2IXOA 4OD5A 2J9VA 5B1BC 4IJJA 5E3CA 3SEOA 5KYYB 3ZIBA 4PK4A 5D92A 1J8YF 3JT1A 4FESA 3KH2A 1D1BA 3E9VA 4JJGA 2E87A 3M1CB 4YJWA 2IXPA 5F5HA 3W2WA 3ZSUA 4YWQA 1VOMA 4G7ZF 2R7UA 2Q9BA 4DVZA 3DMDA 4GEHA 1TWCA 3ABLC 3T4RA 3JCUQ 3AG3C 2XL4A 4J30B 3L34A 2WZLA 4LERA 5KYUB 3B0PA 3TD7A 2HV7A 1FFHA 4U5BE 3ZVRA 2LSEA 3Q7GA 1Z6AA 3UNGC 2W9YA 5T3WA 3W8IA 5D91A 4Q5SF 1FMVA 4OIQF 3EJNA 3S29A 2A6EF 2Y3HA 3VYWA 2P6VA 1D0YA 2G62A 3DAGA 1M56C 2IYLD 4OIRF 3W8HA 1FMWA 4BJ6C 3EHNA 4BJ5C 3LEVA 3MX3A 3NDBB 2J45A 4JJFA 1ZHXA 1MNEA 1MMGA 2J46A 4EBBA 3UMIA 2O9XA 5E2QA 2GFHA 4O6NA 4FWVA 5DS5A 3N2ZB 2BE5F 3L0IA 2IOQA 5L3VA 4IWBA 4I44A 5KYWA 1D1CA 2G3KA 3W2VA 3DJUB 4BEJA 1M2VB 3EGDA 4KBLA 2W45A 2NUPB 3NYLA 3IEEA 2IXMA 3VAYA 3CZ6A 3SNHA 2R7SA 3ZC4A 4YT4A 4X0RA 4YT5A 4PJJA 4DOZA 4KC9A 4PJNA 2EIKC 4I1OB 2NG1A 5B3SC 3UR3C 1SZIA 1BR2A 1JPJA 4Q4ZF 3I4UA 3DXJF 1OCOC 5CI9A 1LKXA 2HV6A 3KL4A 3KKBA 2XXAB 5DS4A 2J9WA 1ZHZA 3V7OA 4CS9C 1VYKA 3EQLF 2Q9AA 3NYJA 2J7PA 4AE4A 2WVQA 3LAYA 4KNWA 2R7XA 2G3VA 1NG1A 5DQTA 1ZHYA 4QI0A 2Y69C 4C7OA 4E7ZA 4K0DA 3Q6NA 2YHSA 1Z23A 3FAJA 1PD0A 3DAFA 3EZIA 4CS9A 5KYXB 3LS0A 1OCCC 5KYYA 2R7QA 2W4BA 5FCLA 4U5DE 3FVYA 2A1DD 2WZFA 4BJ1A 2Y3BA 3AG4C 2XSEA 3UMKA 3JRTA 3S28A 2XRHA 2KQ9A 4KI2A 4ZLDA 4JCHA 3H65A 3HJCA 3ASNC 3ECSA 2VASA 2H7OA 1JPNA 3I5PA 1TWHA 1SMYF 2J9UA 2Y39A 2ZXPA 3NG1A 4G7OF 5F5FA 2NUTB 2WVNA 1NZEA 4RD9A 4U5HA 3AQCA 2ZPAA 3EFOB 1IW7F 1MMNA 4HFKB 2A69F 1M57C 1SF8A 3JYHA 4G0HA 4HFFB 1VMAA 1J8MF 2R7VA 3CSKA 2MYSA 4B6IA 3MLGA 3GANA 2H7VC 5DVWA 4JVSA 2WB7A 4PFPA 2R7WA 4HE8D 3DM9B 4ZLCA 2VH3A 4XWJA 1D0ZA 3LJBA 1ZYRF 3RYLA 2ZXWC 3WG7C 1VK5A 2EILC 1D0XA 1FFTC 2OG2A 2CGEA 1M2VA 3EH1A 4PFOA 1TR2A 1LVKA 1WGWA 2NUPA 4O6YA 1MMDA 4I3MA 4FX5A 3RIPA 1ZU4A 4OIOF 3AQBA 2R7TA 3UGOA 2EIMC 4P6IC 3O39A 1G8XA 4IRUA 4PJLA 4CSAC 1ZU5A 4J32B 4W8KA 3HTKC 2CDQA 3NRHA 2V3CC 3OEOA 3QZCA 4YN0B 4M63A 3FDQA 3B0UX 3I5QA 1TWAA 2D5RB 4CS8A 2XXAA 3EGXB 4CSAA 2J7PD 2EIJC 2M4EA 3EH2A 3T6BA 4G7HF 4XTKA 3EHMA 4C3BA 2V26A 1LS1A 2PF4E 3UGPA 3K66A 1TWGA 2B0JA 3F46A 2QY9A 2CNWD 2P7VA 4K7BA 2FGYA 1NU9C 3B0VC 5KYXA 3LLKA 3RH3A 1MNDA 2PX0A 2CNWA 3ASOC 5DLJA 3DZAA 3K7DA 3N24A 4O79A 4QI2A 1QZXA 2PFDA 3B9QA 4JURI 3POVA 4U5FE 4OD4A 1O5HA 2C04A 5T3TA 3OWTA 2L9JA 2DYSC 2Z15A 3PHF2 3EZHA 5L3QA 3AG1C 2Y3DA 3SZRA 3K33A 3Q6MA 5E3AA 4BJTA 3NKDA 2PX3A 1BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYJ A;  3K66 A;  4RDA A;  1TKN A;  3UMK A;  3Q7L A;  3NYL A;  3PMR A;  3Q7G A;  3QMK A;  3UMH A;  3UMI A;  5BUO A;  4RD9 A;  3K6B A;  4YN0 B; 
#chains in the Genus database with same CATH topology
 1D1A A;  3Q7L A;  2YL0 A;  2ASR A;  3ITF A;  1CGM E;  2R03 A;  2OJQ A;  1O87 A;  4Z9I A;  3NKE A;  2EIN C;  1T6Q A;  3S27 A;  4EUK B;  1MMA A;  4JW1 A;  1RKE A;  1NBB A;  2YLD A;  3B71 A;  3OA1 A;  2R25 A;  3NMJ A;  2NUT A;  3U3F A;  5EGY A;  1WTY A;  3K1H A;  4MVU A;  3ZG1 A;  4DBQ A;  2WZG A;  1T01 A;  1F1M A;  1OCR C;  3DWW A;  1PV3 A;  2KW3 C;  2IXN A;  3EFO A;  3H2U A;  4J7T A;  4RDA A;  4LLC A;  4U5G A;  2KNH A;  4AX2 A;  4EKW A;  4YT8 A;  1BR4 A;  1Y6D A;  4IAO A;  1EI7 A;  4MND A;  4CJG A;  3EPV A;  4E7S A;  4FAP B;  1H9T A;  2J0X A;  1TFO B;  4MVZ A;  2R05 A;  4ONS A;  2QLA A;  4U5E E;  1VTM P;  2KJG A;  1ZHW A;  1Z3I X;  3GM1 A;  4NTF A;  2XLO A;  1LIH A;  2AU5 A;  5IY5 C;  4MQ9 F;  3U8P A;  3KYJ A;  1OXB A;  3ZTZ A;  4XLP F;  5L0F A;  1BZ4 A;  3JTL O;  5BUO A;  3TJ5 A;  2RSE B;  3WHN A;  4JTA B;  2HZ8 A;  1LE4 A;  1DOV A;  2YRF A;  1XZP A;  1R5I D;  1W2W A;  1ZHT A;  3C8G D;  3DJN B;  2DI3 A;  2EPO A;  2OCC C;  3FHD A;  5TJ5 E;  4U5C E;  3UMH A;  4C3D A;  4CBE A;  1K04 A;  1OW6 A;  1PCX A;  1RCP A;  1VYI A;  3CEX A;  4LLE A;  4ULW A;  2CYD A;  4YL0 A;  2YWA A;  4L6R A;  2W4M A;  4NY3 A;  4XLN F;  3ATP A;  3C8G A;  4CX9 A;  1NSG B;  5A6K A;  5A69 A;  3EG9 A;  3SXK A;  2WL8 A;  4AK9 A;  4KNV A;  1OKK D;  3KYI A;  5AGF A;  3EG9 B;  3HNI A;  3GOD A;  1CPR A;  1HMO A;  4LAC B;  2L81 A;  1I5N A;  3J06 A;  4EIY A;  2J0W A;  1N1C A;  1YYX A;  1HY5 A;  3S0X A;  5B1A C;  1OKK A;  5HSW A;  4AL0 A;  3C7J A;  1HMD A;  1GQA A;  3C63 A;  1KTM A;  2GWW A;  5COG A;  1V4A A;  1L3P A;  3H2V A;  1GM5 A;  1EQ1 A;  2LK4 A;  3CQZ A;  3RFY A;  5AC4 A;  5HV9 A;  5JUA A;  2OOC A;  5F28 E;  2Q9C A;  4O7G A;  1IZM A;  1YDI A;  2RD9 A;  2WVO A;  3TK0 A;  4DRH B;  2R02 A;  1Q0K A;  1JR8 A;  2EPM X;  4CS8 C;  1FTS A;  2I8B A;  3FXH A;  4JC7 A;  3ZWI A;  4DVY P;  4PJM A;  1S7Z A;  2PP4 A;  3QW1 A;  4IAR A;  1EKY A;  1FR0 A;  2XLD A;  2DYR C;  4BJ6 A;  3U0C A;  1V55 C;  4BJ5 A;  3K6B A;  5BQI A;  4Q7C A;  3ABM C;  4I1M A;  1K40 A;  3SYN A;  5JT4 A;  2OQM A;  5KYN A;  1CGO A;  4JEA A;  1Z5Z A;  5BQG A;  3WOD F;  3TQO A;  3LNR A;  3LS1 A;  5JLI A;  1QLE C;  4YK5 A;  2LCH A;  3X1O A;  2X51 A;  3EGX A;  4DBR A;  5DS6 A;  2KGO A;  2R9R B;  1OQC A;  2UUH A;  3GM3 A;  3X2Q C;  5KYW B;  2Y3G A;  4HEA J;  4RBN A;  4OIP F;  4EWC A;  3T6J A;  3EGD B;  4ANJ A;  3PMR A;  2KC3 A;  3IHU A;  2C03 A;  4OIN F;  4UDV A;  3ABK C;  5E33 A;  1A7V A;  3A11 A;  3AGT A;  3O6X A;  3GEH A;  1BBH A;  1U6H A;  2FFH A;  3N0T A;  4CIH A;  2R7O A;  3QVY A;  1OCZ C;  4F4B A;  4MVR A;  1M2O A;  1H6G A;  2CW0 F;  4N06 A;  2ZXR A;  3A9C A;  1GS9 A;  3FAP B;  4WJ0 A;  3ZQV A;  2R7R A;  1V54 C;  3LLI A;  4O6M A;  3KMI A;  4QDL A;  2A68 F;  2YEV A;  4H4K C;  4J7Y A;  3QTH A;  1AUE A;  2L6G A;  3GEI A;  3TOM A;  2P0N A;  1TFK B;  2XL8 A;  3C8Z A;  3SXM A;  4A2N B;  3AG2 C;  2HSB A;  2QNL A;  1QSP A;  4XEV A;  3E70 C;  2MWQ A;  4MVS A;  1TKN A;  1XZQ A;  4JZA A;  2TMV P;  3JRM O;  2XLH A;  4MW8 A;  3LES A;  4YL1 A;  3DD7 A;  3BEH A;  1O3U A;  3JSZ A;  4IB4 A;  2YZS A;  2ZXO A;  4LDQ A;  1JMW A;  3NYM A;  2VB6 A;  4N6C A;  5DQZ A;  2H7B A;  4AE4 B;  1G5Z A;  1ZVZ A;  2Q3T A;  2A6H F;  5BQH A;  4C3E A;  3SXZ A;  1UFB A;  3SP1 A;  1Q0F A;  5KYU A;  4C7O B;  4YT2 A;  5JRA A;  5EHH A;  1ST6 A;  1PD1 A;  3DM5 A;  4CS7 A;  1Z7Q c;  2JD3 A;  1KU2 A;  3RKO F;  1RJ9 A;  3MYF A;  4BEM J;  1T6I A;  5CI8 A;  3F47 A;  2DGJ A;  4GYT A;  3SXY A;  2CCY A;  3QMK A;  5T1D B;  1NU7 D;  1RJ9 B;  2QTV A;  2LQG A;  3FOP A;  3HLZ A;  4BG0 A;  2AWC A;  2IXO A;  4OD5 A;  1C03 A;  2J9V A;  5B1B C;  4IJJ A;  5E3C A;  3SEO A;  5KYY B;  3ZIB A;  4PK4 A;  5D92 A;  4BPM A;  1J8Y F;  1LI5 A;  3JT1 A;  4FES A;  3MFN A;  4NCQ A;  2YLI A;  2KSF A;  3NMK A;  3V5Y A;  2VCB A;  2NSG A;  3KH2 A;  3C18 A;  1D1B A;  3E9V A;  1WN0 A;  2E87 A;  3M1C B;  4JJG A;  2IXP A;  4YJW A;  5F5H A;  3W2W A;  3ZSU A;  1C02 A;  1VOM A;  4YWQ A;  4G7Z F;  2R7U A;  1HE9 A;  3ZTM A;  2Q9B A;  4DVZ A;  3DMD A;  3JYY A;  2YLG A;  5JSL A;  2XL6 A;  4GEH A;  1TWC A;  3ABL C;  4ULV A;  3IQC A;  1ZZP A;  3JCU Q;  3T4R A;  5L0J A;  3AG3 C;  3L8J A;  2OEV A;  2XL4 A;  3CAX A;  4U9E A;  4XQ1 A;  4J30 B;  3L34 A;  2WZL A;  3T6G B;  2YKZ A;  4H54 A;  3W4Y A;  2L6F A;  1AVO B;  4LER A;  2YVK A;  3B0P A;  3VF0 A;  5KYU B;  3TD7 A;  2HV7 A;  1E85 A;  1LPE A;  2HUJ A;  1FFH A;  1TQG A;  4U5B E;  5JP7 A;  2LSE A;  3Q7G A;  3ZVR A;  1Z6A A;  3UNG C;  2W9Y A;  2BC5 A;  5T3W A;  3W8I A;  5D91 A;  4Q5S F;  2YL7 A;  4G78 A;  5K0I A;  1FMV A;  4OIQ F;  3EJN A;  1RKC A;  3KPH A;  3S29 A;  1YZA A;  2A6E F;  3M15 A;  1QKR A;  2Y3H A;  2PNO A;  3QW0 A;  3S84 A;  3VYW A;  2P6V A;  4JKV A;  2YL3 A;  1D0Y A;  1LM3 B;  2G62 A;  3DAG A;  1M56 C;  1WAT A;  2IYL D;  2IM8 A;  2JX0 A;  4OIR F;  3W8H A;  3L1M A;  1FMW A;  3R2P A;  4P9T A;  4PR9 A;  1YA7 O;  4BJ6 C;  2VCC A;  2LFD A;  3EHN A;  3NMI A;  3U9M A;  3LEV A;  3MX3 A;  4BJ5 C;  1MQV A;  2JPU A;  4CJO A;  2J45 A;  3HKK A;  3NDB B;  4JJF A;  2L6H A;  1ZHX A;  1MNE A;  1ORJ A;  2IBF A;  1MMG A;  4NTB A;  4Z9J A;  2J46 A;  1S05 A;  4DJ9 A;  4EBB A;  5EK0 A;  3C62 A;  3UMI A;  2O9X A;  5E2Q A;  1WOL A;  1YAR O;  2GFH A;  3L8I A;  4O6N A;  3T9O A;  4FWV A;  5DS5 A;  3N2Z B;  2BE5 F;  1YA9 A;  4MW3 A;  1YJG A;  2OJE D;  2P61 A;  1E84 A;  3PCV A;  1Y4C A;  3L0I A;  4JTC B;  2IOQ A;  5L3V A;  3RQE A;  4CDV A;  2XLW A;  3JZ0 A;  1CPQ A;  1SYQ A;  4I44 A;  3B29 A;  4IWB A;  5KYW A;  1D1C A;  2G3K A;  3W2V A;  4DRI B;  2XLM A;  3DJU B;  1M2V B;  4BEJ A;  3EGD A;  4P9F A;  2XLV A;  1A0B A;  4KBL A;  4D4X A;  2W45 A;  2NUP B;  3K1I C;  3NYL A;  3IEE A;  4MS2 A;  4E17 A;  3M79 A;  2IXM A;  3AOU A;  2HFI A;  1ZW3 A;  2AP3 A;  4NC3 A;  3VAY A;  3CZ6 A;  4R32 A;  1ORY A;  3S90 A;  1RMV A;  4GQH A;  3SNH A;  2R7S A;  2XM0 A;  4MTG A;  3ZC4 A;  4YT4 A;  1Q0M A;  3AGU A;  1YLM A;  4X0R A;  4YT5 A;  1E2X A;  2A0U A;  4PJJ A;  4IAQ A;  4KC9 A;  4PJN A;  4DOZ A;  2EIK C;  4I1O B;  2NG1 A;  5B3S C;  5L0G A;  1U0B B;  3BRJ A;  3UR3 C;  3MBG A;  1SZI A;  1BR2 A;  1JPJ A;  4CDY A;  4Q4Z F;  2LIG A;  1QPU A;  3DXJ F;  3I4U A;  4JIO A;  1OCO C;  5CI9 A;  1B68 A;  2XS8 A;  4D4N A;  1H9G A;  1JRA A;  2L7A A;  3RVZ A;  1NFO A;  3US6 A;  3FOO A;  1LKX A;  1U89 A;  2HV6 A;  1T9K A;  3KL4 A;  3KKB A;  2XXA B;  3IQT A;  2QE9 A;  5DS4 A;  2J9W A;  1ZHZ A;  3V7O A;  3DE8 A;  3WAQ A;  4CS9 C;  5COF A;  1VYK A;  3EQL F;  3RQG A;  2Q9A A;  1HW1 A;  2NPU A;  2J7P A;  3MYI A;  3NYJ A;  4MTF A;  4AE4 A;  2WVQ A;  3LAY A;  3ZDL A;  4KNW A;  3PDM P;  2R7X A;  2G3V A;  1NG1 A;  2HMZ A;  3G50 A;  5DQT A;  1ZHY A;  4QI0 A;  2Y69 C;  1OW8 A;  4C7O A;  4E7Z A;  4K0D A;  2LFF A;  3Q6N A;  2YHS A;  1SR2 A;  4K1O A;  1GGQ A;  1UG7 A;  1A7D A;  1Z23 A;  3U2L A;  2F22 A;  1RXQ A;  3FAJ A;  2ZD9 A;  1PD0 A;  3VRC A;  3DAF A;  3EZI A;  1YYJ A;  4CS9 A;  5KYX B;  3LS0 A;  1OCC C;  4WGY A;  5JS5 A;  4NTA A;  1BDJ B;  4JRZ A;  5KYY A;  2P1A A;  2W4B A;  2R7Q A;  5FCL A;  4ER9 A;  4U5D E;  3FVY A;  2A1D D;  2WZF A;  1A7E A;  4BJ1 A;  3QVZ A;  2Y3B A;  3AG4 C;  3GWL A;  5AC5 A;  5A6B D;  2XSE A;  5COM A;  3UMK A;  4EBK A;  2UUI A;  3JRT A;  3S28 A;  2XRH A;  2KQ9 A;  4E0H A;  4KI2 A;  4ZLD A;  2J8W A;  2AVK A;  4JCH A;  3M4C A;  5A6B A;  3H65 A;  3HJC A;  2HJ3 A;  3ASN C;  3RW0 A;  1OW7 A;  1ZW2 A;  3ECS A;  2VAS A;  2H7O A;  1JPN A;  1OR3 A;  1HW2 A;  2KYH A;  2Q00 A;  4YL3 A;  3I5P A;  2XS1 A;  2D4U A;  5GPG B;  2QUP A;  3M4B A;  1VB5 A;  1NFN A;  2GAQ A;  3O55 A;  2DB4 A;  1DOW A;  1TWH A;  1SMY F;  2J9U A;  2LP4 A;  2OEX A;  2Y39 A;  2ZXP A;  3U3B A;  5A6A A;  3NG1 A;  1JOG A;  1RKE B;  1T5O A;  2ICW G;  4G7O F;  5F5F A;  2NUT B;  2WVN A;  3LEO A;  3RVY A;  1HE1 A;  1NZE A;  4RD9 A;  1LS4 A;  4U5H A;  4U9D A;  1FAP B;  3AQC A;  2ZPA A;  3EFO B;  1IW7 F;  1XWJ A;  1MMN A;  3LUT B;  4HFK B;  2A69 F;  2EPN A;  4WAB A;  4JTD B;  1M57 C;  2MHR A;  1SF8 A;  4NQF A;  4EHP A;  3JYH A;  3FMS A;  4G0H A;  4CIP A;  4HFF B;  4XEK A;  1YVI A;  2B0H A;  1R4T A;  1ORS C;  3LNM B;  1VMA A;  5JVE A;  3S9O A;  1M6T A;  4JCZ A;  1LI7 A;  3V5X A;  2VCA A;  1G4U S;  2H8A A;  3JSE O;  2X0C A;  4A4A A;  256B A;  2HMQ A;  1J8M F;  4LDR A;  2R7V A;  3CSK A;  2MYS A;  4B6I A;  2BL2 A;  3GAN A;  3MLG A;  2H7V C;  5DVW A;  4JVS A;  3U8V A;  2OU6 A;  2FAP B;  1AEP A;  2GA0 A;  2WB7 A;  3C8G B;  1Q0G A;  4PFP A;  2R7W A;  4E0I A;  1NLX A;  4HE8 D;  3DM9 B;  4MVO A;  1I4Y A;  4ZLC A;  2VH3 A;  5L0H A;  4XWJ A;  1D0Z A;  1YAU O;  2KK1 A;  1CGN A;  3K1I A;  3LJB A;  3HNL A;  1ZYR F;  5A6J A;  2NSF A;  3IQ5 A;  3RYL A;  2A0B A;  3DE9 A;  1T6U A;  2ZXW C;  1VLT A;  2XLE A;  3ZQY A;  3WG7 C;  1VK5 A;  2EIL C;  2J9B A;  4DXW A;  1D0X A;  1FFT C;  3O10 A;  1APC A;  2OG2 A;  4W8P A;  4EBJ A;  2CGE A;  3G4Z A;  1M2V A;  3EH1 A;  4XEF A;  4PFO A;  1TR2 A;  5L0C A;  1LVK A;  3GOR A;  4IGG A;  1WGW A;  2NUP A;  4O6Y A;  1MMD A;  1QVX A;  4FX5 A;  4I3M A;  3DKA A;  4WGZ A;  3RIP A;  1ZU4 A;  3AJM A;  4N6H A;  2Q4F A;  4JEB A;  3GEE A;  4OIO F;  3AQB A;  2R7T A;  3UGO A;  2EIM C;  3IPM O;  1L7C A;  4MVQ A;  4P6I C;  3O39 A;  3TJ6 A;  1G8X A;  4IRU A;  2Q7R A;  1E83 A;  4PJL A;  4CSA C;  1KNY A;  4XPW A;  3U9J A;  1ZU5 A;  4XPX A;  2OKU A;  4J32 B;  4E18 A;  2EPL X;  4W8K A;  5L0D A;  3HTK C;  2CDQ A;  2HSQ A;  2HS5 A;  3NRH A;  2V3C C;  2GDC A;  2HJM A;  3HNK A;  3OEO A;  3QZC A;  4M63 A;  4YN0 B;  3R7C A;  3RF3 A;  3U2M A;  3FDQ A;  3B0U X;  3I5Q A;  1EA8 A;  1V74 B;  1TWA A;  3U5S A;  2D5R B;  4PAC A;  4CS8 A;  2XXA A;  3EGX B;  3GM2 A;  3DI5 A;  4CSA A;  2J7P D;  1YZC A;  2ETS A;  2EPK X;  2YQY A;  1H7I A;  2EIJ C;  2M4E A;  3EH2 A;  3T6B A;  4G7H F;  1E86 A;  4XTK A;  2LD6 A;  3EHM A;  4MVM A;  5FZT A;  4C3B A;  2V26 A;  5L0I A;  2XM4 A;  1LS1 A;  2PF4 E;  3GWN A;  4AL1 A;  3UGP A;  2M64 A;  4DRJ B;  3K66 A;  1TWG A;  2B0J A;  3F46 A;  2QY9 A;  2PBE A;  2CNW D;  1K05 A;  2AWY A;  2P7V A;  2FGY A;  1NU9 C;  4K7B A;  3B0V C;  1Z63 A;  5KYX A;  1VLS A;  3LLK A;  1A41 A;  1JAF A;  3TOL A;  3RH3 A;  1FNT c;  1MND A;  2PX0 A;  1I4Z A;  2CNW A;  3ASO C;  5DLJ A;  4Z9H A;  1C17 M;  3DZA A;  3K7D A;  3N24 A;  4O79 A;  1G4W R;  4N4W A;  4QI2 A;  2VC9 A;  1QZX A;  2PFD A;  3G4X A;  3B9Q A;  1Q0D A;  2I15 A;  4JUR I;  1WWP A;  5CIV A;  4U5F E;  3POV A;  4OD4 A;  1O5H A;  2C04 A;  4LDK A;  5T3T A;  5B3I A;  2HKV A;  3TUL A;  1WAS A;  3OWT A;  3HNJ A;  4XPY A;  1OXK A;  2L9J A;  2DYS C;  1OR2 A;  1LE2 A;  1QQ3 A;  2Z15 A;  3PHF 2;  3EZH A;  5L3Q A;  3AG1 C;  4MTO A;  2Y3D A;  4CDA A;  4JE9 A;  3SZR A;  3K33 A;  2YL1 A;  3V5Z A;  3Q6M A;  3VM6 A;  5E3A A;  4BJT A;  3RQF A;  3NKD A;  2PX3 A;  3IQ6 A;  1BR1 A; 
#chains in the Genus database with same CATH homology
 1D1A A;  3Q7L A;  3ITF A;  1O87 A;  3NKE A;  2EIN C;  3S27 A;  1MMA A;  4JW1 A;  3OA1 A;  2NUT A;  5EGY A;  3ZG1 A;  3K1H A;  4DBQ A;  2WZG A;  3EFO A;  1OCR C;  2KW3 C;  2IXN A;  4YT8 A;  4U5G A;  4RDA A;  4LLC A;  4AX2 A;  2KNH A;  1BR4 A;  4IAO A;  4MND A;  3EPV A;  4E7S A;  2J0X A;  4U5E E;  2KJG A;  1ZHW A;  1Z3I X;  5IY5 C;  4MQ9 F;  4XLP F;  5BUO A;  3K1I C;  1ZHT A;  1W2W A;  1Z63 A;  3DJN B;  3FHD A;  2OCC C;  4C3D A;  4U5C E;  3UMH A;  4CBE A;  1PCX A;  1VYI A;  4LLE A;  4ULW A;  4NY3 A;  2W4M A;  4XLN F;  3EG9 A;  2WL8 A;  4AK9 A;  4KNV A;  1OKK D;  3EG9 B;  3GOD A;  4LAC B;  2L81 A;  2J0W A;  1N1C A;  3S0X A;  5B1A C;  1OKK A;  5HSW A;  3RFY A;  3CQZ A;  2Q9C A;  4O7G A;  1IZM A;  2WVO A;  4CS8 C;  1FTS A;  2I8B A;  4DVY P;  4PJM A;  1S7Z A;  2PP4 A;  2DYR C;  4BJ6 A;  1V55 C;  4BJ5 A;  3K6B A;  4Q7C A;  3ABM C;  4I1M A;  3SYN A;  5KYN A;  1Z5Z A;  3WOD F;  3LNR A;  3LS1 A;  1QLE C;  3X1O A;  4DBR A;  5DS6 A;  2X51 A;  3EGX A;  5KYW B;  2KGO A;  3X2Q C;  2Y3G A;  4HEA J;  4RBN A;  4OIP F;  4EWC A;  3T6J A;  3EGD B;  4ANJ A;  3PMR A;  2C03 A;  4OIN F;  3ABK C;  5E33 A;  3O6X A;  2FFH A;  3N0T A;  4CIH A;  2R7O A;  1OCZ C;  4F4B A;  4N06 A;  1M2O A;  2CW0 F;  2ZXR A;  4WJ0 A;  2R7R A;  1V54 C;  3LLI A;  4O6M A;  3KMI A;  4QDL A;  2A68 F;  2YEV A;  4H4K C;  4A2N B;  3AG2 C;  3E70 C;  2MWQ A;  1TKN A;  4JZA A;  3LES A;  3DD7 A;  3JSZ A;  2YZS A;  2ZXO A;  3NYM A;  2VB6 A;  5DQZ A;  2H7B A;  4AE4 B;  2Q3T A;  2A6H F;  4C3E A;  3SP1 A;  5KYU A;  4C7O B;  4YT2 A;  5EHH A;  1ST6 A;  1PD1 A;  3DM5 A;  4CS7 A;  2JD3 A;  1KU2 A;  3RKO F;  1RJ9 A;  5CI8 A;  3F47 A;  2DGJ A;  4GYT A;  3QMK A;  5T1D B;  1NU7 D;  1RJ9 B;  2QTV A;  3HLZ A;  4BG0 A;  2IXO A;  4OD5 A;  2J9V A;  5B1B C;  4IJJ A;  5E3C A;  3SEO A;  5KYY B;  3ZIB A;  4PK4 A;  5D92 A;  1J8Y F;  3JT1 A;  4FES A;  3KH2 A;  1D1B A;  3E9V A;  4JJG A;  2E87 A;  3M1C B;  4YJW A;  2IXP A;  5F5H A;  3W2W A;  3ZSU A;  4YWQ A;  1VOM A;  4G7Z F;  2R7U A;  2Q9B A;  4DVZ A;  3DMD A;  4GEH A;  1TWC A;  3ABL C;  3T4R A;  3JCU Q;  3AG3 C;  2XL4 A;  4J30 B;  3L34 A;  2WZL A;  4LER A;  5KYU B;  3B0P A;  3TD7 A;  2HV7 A;  1FFH A;  4U5B E;  3ZVR A;  2LSE A;  3Q7G A;  1Z6A A;  3UNG C;  2W9Y A;  5T3W A;  3W8I A;  5D91 A;  4Q5S F;  1FMV A;  4OIQ F;  3EJN A;  3S29 A;  2A6E F;  2Y3H A;  3VYW A;  2P6V A;  1D0Y A;  2G62 A;  3DAG A;  1M56 C;  2IYL D;  4OIR F;  3W8H A;  1FMW A;  4BJ6 C;  3EHN A;  4BJ5 C;  3LEV A;  3MX3 A;  3NDB B;  2J45 A;  4JJF A;  1ZHX A;  1MNE A;  1MMG A;  2J46 A;  4EBB A;  3UMI A;  2O9X A;  5E2Q A;  2GFH A;  4O6N A;  4FWV A;  5DS5 A;  3N2Z B;  2BE5 F;  3L0I A;  2IOQ A;  5L3V A;  4IWB A;  4I44 A;  5KYW A;  1D1C A;  2G3K A;  3W2V A;  3DJU B;  4BEJ A;  1M2V B;  3EGD A;  4KBL A;  2W45 A;  2NUP B;  3NYL A;  3IEE A;  2IXM A;  3VAY A;  3CZ6 A;  3SNH A;  2R7S A;  3ZC4 A;  4YT4 A;  4X0R A;  4YT5 A;  4PJJ A;  4DOZ A;  4KC9 A;  4PJN A;  2EIK C;  4I1O B;  2NG1 A;  5B3S C;  3UR3 C;  1SZI A;  1BR2 A;  1JPJ A;  4Q4Z F;  3I4U A;  3DXJ F;  1OCO C;  5CI9 A;  1LKX A;  2HV6 A;  3KL4 A;  3KKB A;  2XXA B;  5DS4 A;  2J9W A;  1ZHZ A;  3V7O A;  4CS9 C;  1VYK A;  3EQL F;  2Q9A A;  3NYJ A;  2J7P A;  4AE4 A;  2WVQ A;  3LAY A;  4KNW A;  2R7X A;  2G3V A;  1NG1 A;  5DQT A;  1ZHY A;  4QI0 A;  2Y69 C;  4C7O A;  4E7Z A;  4K0D A;  3Q6N A;  2YHS A;  1Z23 A;  3FAJ A;  1PD0 A;  3DAF A;  3EZI A;  4CS9 A;  5KYX B;  3LS0 A;  1OCC C;  5KYY A;  2R7Q A;  2W4B A;  5FCL A;  4U5D E;  3FVY A;  2A1D D;  2WZF A;  4BJ1 A;  2Y3B A;  3AG4 C;  2XSE A;  3UMK A;  3JRT A;  3S28 A;  2XRH A;  2KQ9 A;  4KI2 A;  4ZLD A;  4JCH A;  3H65 A;  3HJC A;  3ASN C;  3ECS A;  2VAS A;  2H7O A;  1JPN A;  3I5P A;  1TWH A;  1SMY F;  2J9U A;  2Y39 A;  2ZXP A;  3NG1 A;  4G7O F;  5F5F A;  2NUT B;  2WVN A;  1NZE A;  4RD9 A;  4U5H A;  3AQC A;  2ZPA A;  3EFO B;  1IW7 F;  1MMN A;  4HFK B;  2A69 F;  1M57 C;  1SF8 A;  3JYH A;  4G0H A;  4HFF B;  1VMA A;  1J8M F;  2R7V A;  3CSK A;  2MYS A;  4B6I A;  3MLG A;  3GAN A;  2H7V C;  5DVW A;  4JVS A;  2WB7 A;  4PFP A;  2R7W A;  4HE8 D;  3DM9 B;  4ZLC A;  2VH3 A;  4XWJ A;  1D0Z A;  3LJB A;  1ZYR F;  3RYL A;  2ZXW C;  3WG7 C;  1VK5 A;  2EIL C;  1D0X A;  1FFT C;  2OG2 A;  2CGE A;  1M2V A;  3EH1 A;  4PFO A;  1TR2 A;  1LVK A;  1WGW A;  2NUP A;  4O6Y A;  1MMD A;  4I3M A;  4FX5 A;  3RIP A;  1ZU4 A;  4OIO F;  3AQB A;  2R7T A;  3UGO A;  2EIM C;  4P6I C;  3O39 A;  1G8X A;  4IRU A;  4PJL A;  4CSA C;  1ZU5 A;  4J32 B;  4W8K A;  3HTK C;  2CDQ A;  3NRH A;  2V3C C;  3OEO A;  3QZC A;  4YN0 B;  4M63 A;  3FDQ A;  3B0U X;  3I5Q A;  1TWA A;  2D5R B;  4CS8 A;  2XXA A;  3EGX B;  4CSA A;  2J7P D;  2EIJ C;  2M4E A;  3EH2 A;  3T6B A;  4G7H F;  4XTK A;  3EHM A;  4C3B A;  2V26 A;  1LS1 A;  2PF4 E;  3UGP A;  3K66 A;  1TWG A;  2B0J A;  3F46 A;  2QY9 A;  2CNW D;  2P7V A;  4K7B A;  2FGY A;  1NU9 C;  3B0V C;  5KYX A;  3LLK A;  3RH3 A;  1MND A;  2PX0 A;  2CNW A;  3ASO C;  5DLJ A;  3DZA A;  3K7D A;  3N24 A;  4O79 A;  4QI2 A;  1QZX A;  2PFD A;  3B9Q A;  4JUR I;  3POV A;  4U5F E;  4OD4 A;  1O5H A;  2C04 A;  5T3T A;  3OWT A;  2L9J A;  2DYS C;  2Z15 A;  3PHF 2;  3EZH A;  5L3Q A;  3AG1 C;  2Y3D A;  3SZR A;  3K33 A;  3Q6M A;  5E3A A;  4BJT A;  3NKD A;  2PX3 A;  1BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...