3UMHA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with cadmium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
180
structure length
180
Chain Sequence
b'HAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 80
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umhA00
3UMHA 1TKNA 3UMIA 3NYJA 3QMKA 3Q7LA 3PMRA 3UMKA 3NYLA 5BUOA 3K6BA 4RDAA 4YN0B 3K66A 4RD9A 3Q7GA
chains in the Genus database with same CATH superfamily
4D4XA 1NBBA 1O87A 2I15A 5JRAA 4O6MA 1KTMA 1U6HA 3I5QA 1DOVA 3T6JA 3GM2A 5T3TA 1WWPA 3LNMB 4YN0B 2ZXOA 3SXYA 3FDQA 1G5ZA 3TD7A 5COGA 3LS1A 3ZTZA 2IXOA 1W2WA 1I4ZA 2AWYA 2XRHA 5JSLA 1O3UA 4J30B 1F1MA 1VOMA 3NG1A 4JCZA 4MTFA 5L3QA 4JCHA 3CQZA 4X0RA 4OIPF 1SZIA 1SMYF 3WODF 2I8BA 2YL0A 2VASA 1G4WR 4CDYA 1VYKA 1LS4A 2A68F 4XEKA 4P6IC 4U5BE 3ITFA 3M79A 5DQZA 1ZHWA 2NUTA 4B6IA 4YK5A 3IQCA 1YYXA 1L3PA 2ASRA 5KYYB 3DAFA 4JTAB 2G62A 3SZRA 4AE4A 2ZPAA 5F28E 5KYUB 3C8ZA 3EGDB 4OIOF 3ASOC 2L6GA 4JW1A 2HJ3A 3DZAA 4HFFB 1XWJA 1TKNA 3ZC4A 4DBRA 4OIQF 1VYIA 4W8KA 2Y3DA 3T4RA 5L0FA 1WTYA 3HNKA 1M2OA 3AG4C 1Z6AA 1FFTC 3EH2A 3C63A 2G3KA 3GORA 2EIMC 4XQ1A 1H6GA 1M6TA 3S90A 3R7CA 2R02A 3KPHA 3C62A 2EILC 2M4EA 5D91A 3NRHA 3U9MA 3AG2C 1TQGA 3NYLA 1HMDA 1U89A 3ZWIA 5JLIA 3H65A 4J7TA 2H7OA 3G4ZA 1A7DA 2YL7A 1ZHYA 1Y6DA 3KMIA 4NC3A 5E3CA 4CJGA 4E0HA 3ABLC 4C3EA 1Z5ZA 4GYTA 3TOLA 4DVZA 1QPUA 4E18A 2L81A 1C03A 4LDQA 1OXKA 4K7BA 4MTOA 3HNLA 1DOWA 4Q5SF 3WHNA 3F47A 4IB4A 5T1DB 2IM8A 2YLIA 3RW0A 2WZFA 3ZIBA 3IHUA 3ZQVA 3MYIA 1TWCA 2A6EF 4I1MA 3PCVA 1R5ID 3N24A 4U9EA 3MLGA 2KK1A 3OA1A 1I5NA 1ZHZA 4MTGA 3DXJF 1NG1A 4XLNF 2WZLA 2O9XA 1OCCC 5A69A 4DJ9A 4PK4A 1E84A 1VLSA 3IQ5A 1VMAA 3HLZA 4JTCB 3MX3A 3S9OA 1IW7F 3R2PA 4BEMJ 4MVSA 5A6BA 2R7XA 3N2ZB 1ORJA 4I44A 4MVOA 3UGPA 1MQVA 2XS1A 1Z3IX 3EG9A 1YZCA 2Q9BA 3RQFA 3JRTA 3X1OA 3O39A 2J9UA 4K1OA 4EIYA 3B9QA 2L6HA 3H2VA 2X0CA 4MW3A 3NKDA 4U5DE 4EKWA 4U9DA 3S84A 1TWAA 3FXHA 3S27A 3H2UA 1MNEA 5L0JA 3CEXA 5DS5A 2DYRC 4ZLDA 2J9VA 1QQ3A 2LP4A 3JYHA 4BJ5A 3U9JA 1H9TA 1QVXA 2PX0A 1YA9A 4LDKA 3X2QC 2BL2A 4U5FE 3TQOA 4AL0A 1FNTc 1EQ1A 2PFDA 2W9YA 4YT2A 2PNOA 1RCPA 5B3SC 2A1DD 3S28A 2WVOA 5KYXB 4OD5A 2PBEA 2QLAA 2R7VA 3DD7A 4ZLCA 4LLCA 1A0BA 1ST6A 2DI3A 1S7ZA 3QVZA 1XZQA 2YQYA 3EHNA 4YL1A 4QI0A 3QVYA 5A6KA 4CS9A 4BJTA 3POVA 1D0ZA 1XZPA 3V5YA 1AUEA 2IBFA 2WVNA 5KYWB 2LIGA 4QDLA 1EKYA 3AQBA 1LIHA 2OCCC 3L8IA 4XWJA 1OW7A 1ZW2A 3JZ0A 1CPRA 5E3AA 4IGGA 3I4UA 1V55C 1T6QA 2B0JA 3LAYA 4MQ9F 1QSPA 2PX3A 4CBEA 2XS8A 3O55A 4MW8A 1RKEB 4U5GA 2JX0A 3W4YA 2XL6A 1ZHXA 4J32B 4JEAA 3OEOA 4PJJA 2OEVA 2CW0F 2P6VA 4U5HA 3UMKA 3WAQA 4XEVA 5AGFA 2R05A 2P0NA 3VF0A 2CYDA 1EA8A 1JOGA 3LESA 4NQFA 3SXKA 2CNWD 2R03A 1EI7A 2UUIA 4JE9A 4WGYA 4G78A 3GEHA 3HNIA 2YHSA 1QKRA 1SR2A 5KYUA 2EPKX 4PFPA 4DXWA 5L3VA 4XPYA 5TJ5E 1YYJA 2HSBA 3US6A 2WB7A 2ZD9A 3JSEO 5FCLA 3PDMP 4H54A 4RD9A 3ZSUA 2BE5F 1V54C 3QMKA 4M63A 4EHPA 1SF8A 5JUAA 1NFNA 3WG7C 4OIRF 3NMIA 3U8PA 2HS5A 4DBQA 2YLDA 4F4BA 3W2WA 4NTAA 5F5HA 4RDAA 2KSFA 2R7RA 4JVSA 2IXMA 3GWLA 5KYNA 2FGYA 2OQMA 3DAGA 5T3WA 2YL1A 4JURI 1M56C 2J45A 2G3VA 1LS1A 2IOQA 3SYNA 2XL8A 4CDVA 1Z63A 1OW6A 3QW0A 4CS8A 4JZAA 2W4MA 3SEOA 4HFKB 4DRIB 4IAQA 3PHF2 1A7VA 5E33A 4I1OB 1MMDA 3FVYA 4JC7A 3UMHA 4CIHA 5EHHA 2D5RB 3KH2A 1HW1A 3AJMA 4LACB 1G8XA 3EZHA 2OG2A 5D92A 2R7QA 2EIJC 1R4TA 2EINC 2PF4E 2GA0A 2H8AA 1V74B 2AP3A 1JRAA 2PP4A 3IPMO 1NU9C 3N0TA 5JT4A 5K0IA 5FZTA 5E2QA 4NY3A 4KI2A 3ZDLA 4JTDB 3C18A 1VLTA 3K1IC 3J06A 3RQEA 4XPXA 4PFOA 3FOOA 4Q4ZF 1FMWA 2A0BA 2FFHA 4MS2A 3NYJA 2EPOA 2Y69C 1ZU4A 3U8VA 4N6CA 3AG3C 1AVOB 1JPJA 2NPUA 1U0BB 1OW8A 2KJGA 4YT5A 3CAXA 1JMWA 2Y3BA 3LUTB 4Z9HA 3ZTMA 1RXQA 2V3CC 4JJFA 4W8PA 3IEEA 4MVRA 3JT1A 4P9TA 1OCOC 4FESA 3KL4A 4E17A 3KKBA 4KBLA 4RBNA 2H7VC 1YVIA 1BZ4A 1AEPA 4XTKA 4MVMA 2BC5A 4AL1A 2X51A 3BRJA 5L0HA 4AX2A 1OCZC 2GFHA 1G4US 3LLIA 5JP7A 5DS4A 3I5PA 2UUHA 2J7PD 1D1BA 4C3DA 4DOZA 2J46A 1BR4A 2IYLD 3DM9B 1T6IA 3HKKA 4CS8C 3U2LA 1RKCA 2GAQA 3KYIA 4FAPB 1NZEA 3U5SA 3Q6MA 2EPLX 2Y3HA 2XXAB 5HV9A 2VCAA 3RYLA 3F46A 4ULWA 2EPNA 1CGOA 5KYXA 2DGJA 2DB4A 2MWQA 4DRJB 1YDIA 1NLXA 4C7OB 5L0CA 5F5FA 2ETSA 3L1MA 4PACA 5CI9A 2CDQA 2QY9A 3CSKA 4O6YA 3EH1A 4J7YA 2J0WA 1RJ9B 1K05A 3DE8A 3FAPB 2P7VA 1NU7D 1MMAA 1TWHA 1QZXA 1PV3A 3AG1C 1M2VB 3HJCA 3L34A 5GPGB 4YL0A 5KYWA 4XLPF 1FFHA 2HMZA 1FMVA 1LI5A 3UNGC 5B1BC 4EBBA 4FX5A 4MVQA 4GQHA 3ZQYA 4N6HA 1TWGA 3U3FA 1LKXA 3AQCA 4KNVA 4O6NA 2Q7RA 3Q7GA 3B0VC 1YA7O 2HUJA 4YJWA 2LD6A 5A6AA 1IZMA 2QTVA 1TFOB 2XLDA 3MBGA 3GEEA 4R32A 2L6FA 1RKEA 3G4XA 1D0XA 3U3BA 2J8WA 2OJQA 3QW1A 1T9KA 4IWBA 5COFA 4C3BA 2LCHA 3A9CA 4IRUA 4FWVA 1YJGA 3W8IA 1ZVZA 4EWCA 4WJ0A 3EZIA 2NUPB 3AGUA 2VC9A 5JS5A 3GM3A 4YT8A 2EPMX 4EBKA 2VCBA 1YARO 2M64A 4OINF 3CZ6A 3B0PA 3FHDA 4O79A 1LPEA 2L7AA 1NFOA 2ZXWC 1NSGB 2E87A 3TJ5A 2EIKC 1CPQA 2R25A 1OCRC 1WASA 4YT4A 2KGOA 1J8YF 4LDRA 4P9FA 4PJNA 5JVEA 3B0UX 1A41A 4WGZA 1S05A 2GWWA 4HEAJ 2MHRA 2KC3A 1ZU5A 3EG9B 3MYFA 4EBJA 3B29A 4G7OF 2LK4A 3U0CA 5IY5C 1SYQA 2R7UA 1JR8A 1HE1A 3FAJA 4KNWA 2XLHA 3LS0A 1D1CA 3EGXB 3K6BA 4Z9IA 3OWTA 3SXZA 4ANJA 2R9RB 5KYYA 2R7SA 1GM5A 2XSEA 4L6RA 3GWNA 3FMSA 3EGDA 4BJ5C 1APCA 3VYWA 5L0IA 2XLMA 1HE9A 2VH3A 2OJED 1D1AA 2R7OA 5BQIA 4K0DA 2TMVP 4U5CE 1K04A 2XL4A 3JSZA 2GDCA 3A11A 1Z7Qc 1ZYRF 2WZGA 4UDVA 3C8GB 1ORYA 2NSGA 2KNHA 3DWWA 2J7PA 1GS9A 3QTHA 3RVZA 1HW2A 3ECSA 4CS9C 4Z9JA 3K7DA 3KYJA 4BJ1A 3LLKA 2YZSA 3LEOA 5L0GA 3UR3C 5HSWA 3AOUA 3B71A 4BG0A 1I4YA 2R7WA 2VCCA 4G7ZF 2Q4FA 1BR1A 2WVQA 1TR2A 3SXMA 2DYSC 4MVZA 1T5OA 1GGQA 3M15A 2HV6A 3TK0A 4E7SA 2W45A 3G50A 3LEVA 4AK9A 1BBHA 1OR2A 4BPMA 4CSAA 4PJLA 1QLEC 1UG7A 1D0YA 1BDJB 1WGWA 2XLWA 4A2NB 2AWCA 2YVKA 1T01A 3DE9A 3M4BA 3RVYA 2H7BA 3VRCA 1BR2A 3EHMA 3NKEA 2KQ9A 1MMGA 4EUKB 1A7EA 256BA 2IXPA 2P1AA 3EFOB 4LERA 1OKKD 1PD1A 3C8GD 2C03A 3RH3A 3QZCA 4D4NA 1WOLA 4DVYP 1OXBA 1ZHTA 4BJ6A 5L0DA 3GODA 2YKZA 2KW3C 2A0UA 2WL8A 3V5XA 3HNJA 1ZW3A 2VB6A 1Q0MA 3JCUQ 3UMIA 5BQHA 2QE9A 3RF3A 2XLVA 4YWQA 2J9WA 2XXAA 2RSEB 2YRFA 2A69F 3DKAA 4GEHA 4OD4A 2Y39A 4ONSA 3W8HA 4DRHB 4C7OA 3TJ6A 1Q0KA 1LE2A 3V5ZA 1CGNA 3ATPA 1WN0A 1LVKA 5BUOA 1C02A 3EJNA 4G0HA 4HE8D 1RJ9A 4CIPA 3C7JA 3VM6A 1JPNA 1TFKB 2XM4A 2Z15A 4NCQA 2NUTB 4E7ZA 1KNYA 2J9BA 3DM5A 1Q0DA 1M2VA 2JPUA 4MNDA 4JIOA 1GQAA 2XM0A 3BEHA 3AGTA 4AE4B 2L9JA 4ULVA 2QNLA 3NMJA 2YWAA 2YLGA 3ZG1A 2XLOA 1M57C 3RIPA 3IQTA 1H7IA 3IQ6A 3LNRA 4YL3A 2OU6A 1LI7A 2C04A 4CSAC 3NMKA 3E9VA 3ASNC 4LLEA 2LFFA 3U2MA 3L0IA 4JRZA 3T6GB 3Q6NA 3O10A 2AU5A 2AVKA 4IARA 1Q0GA 2HFIA 2CNWA 3O6XA 3RQGA 1VB5A 2XLEA 3VAYA 2QUPA 1YZAA 1VTMP 1V4AA 3ABMC 4JJGA 4IAOA 2JD3A 3NDBB 2NUPA 1ZZPA 4I3MA 2OKUA 2HJMA 2CGEA 4N06A 5CI8A 3RKOF 4A4AA 3ZVRA 2HSQA 3S0XA 1T6UA 2KYHA 1HMOA 4NTFA 4CS7A 4BJ6C 5AC5A 3UGOA 2W4BA 4XEFA 2NSFA 2Q00A 5COMA 4KC9A 3M1CB 4NTBA 3GANA 3PMRA 3SNHA 1PCXA 3FOPA 4O7GA 3K66A 4JEBA 3LJBA 3V7OA 3T6BA 1MNDA 2ZXRA 1LE4A 4N4WA 3L8JA 5DQTA 1J8MF 2OEXA 4PJMA 1KU2A 1ORSC 1Z23A 2F22A 3EPVA 4U5EE 5CIVA 1H9GA 3Q7LA 3TULA 1O5HA 2R7TA 2HV7A 2V26A 3DMDA 1OQCA 1RMVA 2RD9A 3E70C 5B1AC 3EGXA 2CCYA 3JYYA 2HMQA 2MYSA 1E83A 1LM3B 3M4CA 2YL3A 1PD0A 2YEVA 4QI2A 2Q9CA 1L7CA 1B68A 3NYMA 1E2XA 2B0HA 2LSEA 1JAFA 2Q3TA 1MMNA 1FTSA 2IXNA 5BQGA 4JKVA 3JRMO 3DI5A 4E0IA 1UFBA 2ZXPA 5A6JA 1OKKA 3GM1A 3C8GA 2HZ8A 3MFNA 4BEJA 1OR3A 3T9OA 4Q7CA 4MVUA 3JTLO 4CX9A 2D4UA 2A6HF 2LQGA 3W2VA 4CJOA 5AC4A 4PR9A 5B3IA 1VK5A 3TOMA 3K33A 4H4KC 3EQLF 4XPWA 5DS6A 3DJNB 2FAPB 2Y3GA 1HY5A 3DJUB 5EK0A 2ICWG 4ER9A 4WABA 5EGYA 1FR0A 4G7HF 3RFYA 2OOCA 1Y4CA 3S29A 1CGME 1N1CA 3K1HA 3SP1A 1Q0FA 1YAUO 3HTKC 1C17M 2Q9AA 1E85A 1E86A 1YLMA 3GEIA 5DLJA 2J0XA 5A6BD 4IJJA 3K1IA 1WATA 1FAPB 2HKVA 2NG1A 2LFDA 3ABKC 3EFOA 5DVWA 1K40A 4CDAA 2P61A
chains in the Genus database with same CATH topology
1O87A 4O6MA 3I5QA 3T6JA 5T3TA 4YN0B 2ZXOA 3FDQA 3TD7A 3LS1A 2IXOA 1W2WA 2XRHA 4J30B 1VOMA 3NG1A 5L3QA 4JCHA 3CQZA 4X0RA 4OIPF 1SZIA 1SMYF 3WODF 2I8BA 2VASA 1VYKA 2A68F 4P6IC 4U5BE 3ITFA 5DQZA 1ZHWA 2NUTA 4B6IA 5KYYB 3DAFA 3SZRA 2G62A 5KYUB 4AE4A 2ZPAA 3EGDB 4OIOF 3ASOC 4JW1A 3DZAA 4HFFB 4DBRA 1TKNA 3ZC4A 4OIQF 1VYIA 4W8KA 2Y3DA 3T4RA 1M2OA 3AG4C 1Z6AA 1FFTC 3EH2A 2G3KA 2EIMC 2EILC 2M4EA 5D91A 3NRHA 3AG2C 3NYLA 3H65A 2H7OA 3KMIA 1ZHYA 5E3CA 3ABLC 4C3EA 1Z5ZA 4GYTA 4DVZA 2L81A 4K7BA 4Q5SF 3F47A 5T1DB 2WZFA 3ZIBA 1TWCA 2A6EF 4I1MA 3N24A 3MLGA 3OA1A 1ZHZA 3DXJF 1NG1A 4XLNF 2WZLA 2O9XA 1OCCC 4PK4A 1VMAA 3HLZA 3MX3A 1IW7F 2R7XA 3N2ZB 4I44A 3UGPA 1Z3IX 3EG9A 2Q9BA 3JRTA 3X1OA 3O39A 2J9UA 3B9QA 4U5DE 3NKDA 1TWAA 3S27A 1MNEA 5DS5A 2DYRC 4ZLDA 2J9VA 3JYHA 4BJ5A 2PX0A 3X2QC 4U5FE 2PFDA 2W9YA 4YT2A 5B3SC 5KYXB 2A1DD 3S28A 2WVOA 4OD5A 2R7VA 3DD7A 4ZLCA 4LLCA 1ST6A 1S7ZA 3EHNA 4QI0A 4CS9A 4BJTA 1D0ZA 2WVNA 5KYWB 4QDLA 3AQBA 2OCCC 4XWJA 5E3AA 3I4UA 1V55C 2B0JA 3LAYA 4MQ9F 2PX3A 4CBEA 4U5GA 1ZHXA 4J32B 4PJJA 3OEOA 4U5HA 2CW0F 2P6VA 3UMKA 3LESA 2CNWD 2YHSA 5KYUA 4PFPA 5L3VA 2WB7A 5FCLA 4RD9A 3ZSUA 2BE5F 1V54C 3QMKA 4M63A 1SF8A 3WG7C 4OIRF 4DBQA 4F4BA 3W2WA 5F5HA 4RDAA 2R7RA 4JVSA 2IXMA 5KYNA 2FGYA 3DAGA 5T3WA 4JURI 1M56C 2J45A 2G3VA 1LS1A 2IOQA 3SYNA 1Z63A 4CS8A 4JZAA 2W4MA 3SEOA 4HFKB 3PHF2 4CIHA 5E33A 4I1OB 1MMDA 3FVYA 5EHHA 3UMHA 2D5RB 3KH2A 4LACB 1G8XA 3EZHA 2OG2A 5D92A 2R7QA 2EIJC 2EINC 2PF4E 2PP4A 3N0TA 1NU9C 5E2QA 4NY3A 4KI2A 3K1IC 4PFOA 1FMWA 2FFHA 3NYJA 2Y69C 1ZU4A 3AG3C 1JPJA 2KJGA 4YT5A 2V3CC 2Y3BA 4JJFA 3IEEA 3JT1A 1OCOC 4FESA 3KL4A 3KKBA 4KBLA 4RBNA 2H7VC 4XTKA 2X51A 4AX2A 1OCZC 2GFHA 3LLIA 5DS4A 3I5PA 4C3DA 2J7PD 1D1BA 4DOZA 2J46A 1BR4A 2IYLD 3DM9B 4CS8C 1NZEA 3Q6MA 2Y3HA 2XXAB 3RYLA 3F46A 4ULWA 4C7OB 5KYXA 2DGJA 2MWQA 5F5FA 5CI9A 2CDQA 2QY9A 3CSKA 4O6YA 3EH1A 2J0WA 1RJ9B 2P7VA 1NU7D 1MMAA 1TWHA 1QZXA 3AG1C 1M2VB 3HJCA 3L34A 5KYWA 4XLPF 1FFHA 1FMVA 3UNGC 5B1BC 4EBBA 4FX5A 1TWGA 3B0VC 1LKXA 3AQCA 4KNVA 4O6NA 3Q7GA 4YJWA 1IZMA 2QTVA 1D0XA 4IWBA 4C3BA 4IRUA 4FWVA 3POVA 3W8IA 4EWCA 4WJ0A 3EZIA 2NUPB 4YT8A 4OINF 3CZ6A 3B0PA 3FHDA 4O79A 2ZXWC 2E87A 2EIKC 1OCRC 4YT4A 2KGOA 1J8YF 4PJNA 3B0UX 4HEAJ 1ZU5A 3EG9B 4G7OF 5IY5C 2R7UA 3FAJA 4KNWA 3LS0A 1D1CA 3EGXB 3K6BA 3OWTA 4ANJA 5KYYA 2R7SA 2XSEA 4BJ5C 3EGDA 3VYWA 2VH3A 1D1AA 2R7OA 4K0DA 4U5CE 2XL4A 3JSZA 1ZYRF 2WZGA 2KNHA 2J7PA 3ECSA 4CS9C 3K7DA 4BJ1A 3LLKA 2YZSA 3UR3C 5HSWA 4BG0A 2R7WA 4G7ZF 1BR1A 2WVQA 1TR2A 2DYSC 2HV6A 4E7SA 2W45A 3LEVA 4AK9A 4CSAA 4PJLA 1QLEC 1WGWA 1D0YA 4A2NB 2H7BA 1BR2A 3EHMA 3NKEA 2KQ9A 1MMGA 2IXPA 3EFOB 4LERA 1OKKD 1PD1A 2C03A 3RH3A 3QZCA 4DVYP 1ZHTA 4BJ6A 3GODA 2KW3C 2WL8A 3UMIA 2VB6A 3JCUQ 4YWQA 2J9WA 2XXAA 2A69F 4GEHA 3W8HA 4OD4A 2Y39A 4C7OA 1LVKA 5BUOA 3EJNA 4G0HA 4HE8D 1RJ9A 1JPNA 2Z15A 4E7ZA 2NUTB 3DM5A 1M2VA 4MNDA 4AE4B 2L9JA 3ZG1A 1M57C 3RIPA 3LNRA 2C04A 4CSAC 3E9VA 3ASNC 4LLEA 3L0IA 3Q6NA 2CNWA 3O6XA 3VAYA 3ABMC 4JJGA 4IAOA 2JD3A 3NDBB 2NUPA 4I3MA 4N06A 5CI8A 2CGEA 3RKOF 3ZVRA 3S0XA 3UGOA 4CS7A 4BJ6C 2W4BA 4KC9A 3M1CB 3GANA 3PMRA 3SNHA 1PCXA 4O7GA 3K66A 3LJBA 3V7OA 3T6BA 1MNDA 2ZXRA 5DQTA 1J8MF 4PJMA 4Q4ZF 1KU2A 1Z23A 3EPVA 4U5EE 3Q7LA 1O5HA 2R7TA 2HV7A 2V26A 3DMDA 3E70C 5B1AC 3EGXA 2MYSA 1PD0A 2YEVA 4QI2A 2Q9CA 3NYMA 2LSEA 2Q3TA 1MMNA 1FTSA 2IXNA 2ZXPA 1OKKA 4BEJA 4Q7CA 2A6HF 3W2VA 1VK5A 3K33A 4H4KC 3EQLF 5DS6A 3DJNB 2Y3GA 3DJUB 5EGYA 4G7HF 3RFYA 3S29A 3K1HA 1N1CA 3SP1A 3HTKC 2Q9AA 5DLJA 2J0XA 4IJJA 2NG1A 3EFOA 3ABKC 5DVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMH A;  1TKN A;  3UMI A;  3NYJ A;  3QMK A;  3Q7L A;  3PMR A;  3UMK A;  3NYL A;  5BUO A;  3K6B A;  4RDA A;  4YN0 B;  3K66 A;  4RD9 A;  3Q7G A; 
#chains in the Genus database with same CATH topology
 4D4X A;  1NBB A;  1O87 A;  2I15 A;  5JRA A;  4O6M A;  1KTM A;  1U6H A;  3I5Q A;  1DOV A;  3T6J A;  3GM2 A;  5T3T A;  1WWP A;  3LNM B;  4YN0 B;  2ZXO A;  3SXY A;  3FDQ A;  1G5Z A;  3TD7 A;  5COG A;  3LS1 A;  3ZTZ A;  2IXO A;  1W2W A;  1I4Z A;  2AWY A;  2XRH A;  5JSL A;  1O3U A;  4J30 B;  1F1M A;  1VOM A;  3NG1 A;  4JCZ A;  4MTF A;  5L3Q A;  4JCH A;  3CQZ A;  4X0R A;  4OIP F;  1SZI A;  1SMY F;  3WOD F;  2I8B A;  2YL0 A;  2VAS A;  1G4W R;  4CDY A;  1VYK A;  1LS4 A;  2A68 F;  4XEK A;  4P6I C;  4U5B E;  3ITF A;  3M79 A;  5DQZ A;  1ZHW A;  2NUT A;  4B6I A;  4YK5 A;  3IQC A;  1YYX A;  1L3P A;  2ASR A;  5KYY B;  3DAF A;  4JTA B;  2G62 A;  3SZR A;  4AE4 A;  2ZPA A;  5F28 E;  5KYU B;  3C8Z A;  3EGD B;  4OIO F;  3ASO C;  2L6G A;  4JW1 A;  2HJ3 A;  3DZA A;  4HFF B;  1XWJ A;  1TKN A;  3ZC4 A;  4DBR A;  4OIQ F;  1VYI A;  4W8K A;  2Y3D A;  3T4R A;  5L0F A;  1WTY A;  3HNK A;  1M2O A;  3AG4 C;  1Z6A A;  1FFT C;  3EH2 A;  3C63 A;  2G3K A;  3GOR A;  2EIM C;  4XQ1 A;  1H6G A;  1M6T A;  3S90 A;  3R7C A;  2R02 A;  3KPH A;  3C62 A;  2EIL C;  2M4E A;  5D91 A;  3NRH A;  3U9M A;  3AG2 C;  1TQG A;  3NYL A;  1HMD A;  1U89 A;  3ZWI A;  5JLI A;  3H65 A;  4J7T A;  2H7O A;  3G4Z A;  1A7D A;  2YL7 A;  1ZHY A;  1Y6D A;  3KMI A;  4NC3 A;  5E3C A;  4CJG A;  4E0H A;  3ABL C;  4C3E A;  1Z5Z A;  4GYT A;  3TOL A;  4DVZ A;  1QPU A;  4E18 A;  2L81 A;  1C03 A;  4LDQ A;  1OXK A;  4K7B A;  4MTO A;  3HNL A;  1DOW A;  4Q5S F;  3WHN A;  3F47 A;  4IB4 A;  5T1D B;  2IM8 A;  2YLI A;  3RW0 A;  2WZF A;  3ZIB A;  3IHU A;  3ZQV A;  3MYI A;  1TWC A;  2A6E F;  4I1M A;  3PCV A;  1R5I D;  3N24 A;  4U9E A;  3MLG A;  2KK1 A;  3OA1 A;  1I5N A;  1ZHZ A;  4MTG A;  3DXJ F;  1NG1 A;  4XLN F;  2WZL A;  2O9X A;  1OCC C;  5A69 A;  4DJ9 A;  4PK4 A;  1E84 A;  1VLS A;  3IQ5 A;  1VMA A;  3HLZ A;  4JTC B;  3MX3 A;  3S9O A;  1IW7 F;  3R2P A;  4BEM J;  4MVS A;  5A6B A;  2R7X A;  3N2Z B;  1ORJ A;  4I44 A;  4MVO A;  3UGP A;  1MQV A;  2XS1 A;  1Z3I X;  3EG9 A;  1YZC A;  2Q9B A;  3RQF A;  3JRT A;  3X1O A;  3O39 A;  2J9U A;  4K1O A;  4EIY A;  3B9Q A;  2L6H A;  3H2V A;  2X0C A;  4MW3 A;  3NKD A;  4U5D E;  4EKW A;  4U9D A;  3S84 A;  1TWA A;  3FXH A;  3S27 A;  3H2U A;  1MNE A;  5L0J A;  3CEX A;  5DS5 A;  2DYR C;  4ZLD A;  2J9V A;  1QQ3 A;  2LP4 A;  3JYH A;  4BJ5 A;  3U9J A;  1H9T A;  1QVX A;  2PX0 A;  1YA9 A;  4LDK A;  3X2Q C;  2BL2 A;  4U5F E;  3TQO A;  4AL0 A;  1FNT c;  1EQ1 A;  2PFD A;  2W9Y A;  4YT2 A;  2PNO A;  1RCP A;  5B3S C;  2A1D D;  3S28 A;  2WVO A;  5KYX B;  4OD5 A;  2PBE A;  2QLA A;  2R7V A;  3DD7 A;  4ZLC A;  4LLC A;  1A0B A;  1ST6 A;  2DI3 A;  1S7Z A;  3QVZ A;  1XZQ A;  2YQY A;  3EHN A;  4YL1 A;  4QI0 A;  3QVY A;  5A6K A;  4CS9 A;  4BJT A;  3POV A;  1D0Z A;  1XZP A;  3V5Y A;  1AUE A;  2IBF A;  2WVN A;  5KYW B;  2LIG A;  4QDL A;  1EKY A;  3AQB A;  1LIH A;  2OCC C;  3L8I A;  4XWJ A;  1OW7 A;  1ZW2 A;  3JZ0 A;  1CPR A;  5E3A A;  4IGG A;  3I4U A;  1V55 C;  1T6Q A;  2B0J A;  3LAY A;  4MQ9 F;  1QSP A;  2PX3 A;  4CBE A;  2XS8 A;  3O55 A;  4MW8 A;  1RKE B;  4U5G A;  2JX0 A;  3W4Y A;  2XL6 A;  1ZHX A;  4J32 B;  4JEA A;  3OEO A;  4PJJ A;  2OEV A;  2CW0 F;  2P6V A;  4U5H A;  3UMK A;  3WAQ A;  4XEV A;  5AGF A;  2R05 A;  2P0N A;  3VF0 A;  2CYD A;  1EA8 A;  1JOG A;  3LES A;  4NQF A;  3SXK A;  2CNW D;  2R03 A;  1EI7 A;  2UUI A;  4JE9 A;  4WGY A;  4G78 A;  3GEH A;  3HNI A;  2YHS A;  1QKR A;  1SR2 A;  5KYU A;  2EPK X;  4PFP A;  4DXW A;  5L3V A;  4XPY A;  5TJ5 E;  1YYJ A;  2HSB A;  3US6 A;  2WB7 A;  2ZD9 A;  3JSE O;  5FCL A;  3PDM P;  4H54 A;  4RD9 A;  3ZSU A;  2BE5 F;  1V54 C;  3QMK A;  4M63 A;  4EHP A;  1SF8 A;  5JUA A;  1NFN A;  3WG7 C;  4OIR F;  3NMI A;  3U8P A;  2HS5 A;  4DBQ A;  2YLD A;  4F4B A;  3W2W A;  4NTA A;  5F5H A;  4RDA A;  2KSF A;  2R7R A;  4JVS A;  2IXM A;  3GWL A;  5KYN A;  2FGY A;  2OQM A;  3DAG A;  5T3W A;  2YL1 A;  4JUR I;  1M56 C;  2J45 A;  2G3V A;  1LS1 A;  2IOQ A;  3SYN A;  2XL8 A;  4CDV A;  1Z63 A;  1OW6 A;  3QW0 A;  4CS8 A;  4JZA A;  2W4M A;  3SEO A;  4HFK B;  4DRI B;  4IAQ A;  3PHF 2;  1A7V A;  5E33 A;  4I1O B;  1MMD A;  3FVY A;  4JC7 A;  3UMH A;  4CIH A;  5EHH A;  2D5R B;  3KH2 A;  1HW1 A;  3AJM A;  4LAC B;  1G8X A;  3EZH A;  2OG2 A;  5D92 A;  2R7Q A;  2EIJ C;  1R4T A;  2EIN C;  2PF4 E;  2GA0 A;  2H8A A;  1V74 B;  2AP3 A;  1JRA A;  2PP4 A;  3IPM O;  1NU9 C;  3N0T A;  5JT4 A;  5K0I A;  5FZT A;  5E2Q A;  4NY3 A;  4KI2 A;  3ZDL A;  4JTD B;  3C18 A;  1VLT A;  3K1I C;  3J06 A;  3RQE A;  4XPX A;  4PFO A;  3FOO A;  4Q4Z F;  1FMW A;  2A0B A;  2FFH A;  4MS2 A;  3NYJ A;  2EPO A;  2Y69 C;  1ZU4 A;  3U8V A;  4N6C A;  3AG3 C;  1AVO B;  1JPJ A;  2NPU A;  1U0B B;  1OW8 A;  2KJG A;  4YT5 A;  3CAX A;  1JMW A;  2Y3B A;  3LUT B;  4Z9H A;  3ZTM A;  1RXQ A;  2V3C C;  4JJF A;  4W8P A;  3IEE A;  4MVR A;  3JT1 A;  4P9T A;  1OCO C;  4FES A;  3KL4 A;  4E17 A;  3KKB A;  4KBL A;  4RBN A;  2H7V C;  1YVI A;  1BZ4 A;  1AEP A;  4XTK A;  4MVM A;  2BC5 A;  4AL1 A;  2X51 A;  3BRJ A;  5L0H A;  4AX2 A;  1OCZ C;  2GFH A;  1G4U S;  3LLI A;  5JP7 A;  5DS4 A;  3I5P A;  2UUH A;  2J7P D;  1D1B A;  4C3D A;  4DOZ A;  2J46 A;  1BR4 A;  2IYL D;  3DM9 B;  1T6I A;  3HKK A;  4CS8 C;  3U2L A;  1RKC A;  2GAQ A;  3KYI A;  4FAP B;  1NZE A;  3U5S A;  3Q6M A;  2EPL X;  2Y3H A;  2XXA B;  5HV9 A;  2VCA A;  3RYL A;  3F46 A;  4ULW A;  2EPN A;  1CGO A;  5KYX A;  2DGJ A;  2DB4 A;  2MWQ A;  4DRJ B;  1YDI A;  1NLX A;  4C7O B;  5L0C A;  5F5F A;  2ETS A;  3L1M A;  4PAC A;  5CI9 A;  2CDQ A;  2QY9 A;  3CSK A;  4O6Y A;  3EH1 A;  4J7Y A;  2J0W A;  1RJ9 B;  1K05 A;  3DE8 A;  3FAP B;  2P7V A;  1NU7 D;  1MMA A;  1TWH A;  1QZX A;  1PV3 A;  3AG1 C;  1M2V B;  3HJC A;  3L34 A;  5GPG B;  4YL0 A;  5KYW A;  4XLP F;  1FFH A;  2HMZ A;  1FMV A;  1LI5 A;  3UNG C;  5B1B C;  4EBB A;  4FX5 A;  4MVQ A;  4GQH A;  3ZQY A;  4N6H A;  1TWG A;  3U3F A;  1LKX A;  3AQC A;  4KNV A;  4O6N A;  2Q7R A;  3Q7G A;  3B0V C;  1YA7 O;  2HUJ A;  4YJW A;  2LD6 A;  5A6A A;  1IZM A;  2QTV A;  1TFO B;  2XLD A;  3MBG A;  3GEE A;  4R32 A;  2L6F A;  1RKE A;  3G4X A;  1D0X A;  3U3B A;  2J8W A;  2OJQ A;  3QW1 A;  1T9K A;  4IWB A;  5COF A;  4C3B A;  2LCH A;  3A9C A;  4IRU A;  4FWV A;  1YJG A;  3W8I A;  1ZVZ A;  4EWC A;  4WJ0 A;  3EZI A;  2NUP B;  3AGU A;  2VC9 A;  5JS5 A;  3GM3 A;  4YT8 A;  2EPM X;  4EBK A;  2VCB A;  1YAR O;  2M64 A;  4OIN F;  3CZ6 A;  3B0P A;  3FHD A;  4O79 A;  1LPE A;  2L7A A;  1NFO A;  2ZXW C;  1NSG B;  2E87 A;  3TJ5 A;  2EIK C;  1CPQ A;  2R25 A;  1OCR C;  1WAS A;  4YT4 A;  2KGO A;  1J8Y F;  4LDR A;  4P9F A;  4PJN A;  5JVE A;  3B0U X;  1A41 A;  4WGZ A;  1S05 A;  2GWW A;  4HEA J;  2MHR A;  2KC3 A;  1ZU5 A;  3EG9 B;  3MYF A;  4EBJ A;  3B29 A;  4G7O F;  2LK4 A;  3U0C A;  5IY5 C;  1SYQ A;  2R7U A;  1JR8 A;  1HE1 A;  3FAJ A;  4KNW A;  2XLH A;  3LS0 A;  1D1C A;  3EGX B;  3K6B A;  4Z9I A;  3OWT A;  3SXZ A;  4ANJ A;  2R9R B;  5KYY A;  2R7S A;  1GM5 A;  2XSE A;  4L6R A;  3GWN A;  3FMS A;  3EGD A;  4BJ5 C;  1APC A;  3VYW A;  5L0I A;  2XLM A;  1HE9 A;  2VH3 A;  2OJE D;  1D1A A;  2R7O A;  5BQI A;  4K0D A;  2TMV P;  4U5C E;  1K04 A;  2XL4 A;  3JSZ A;  2GDC A;  3A11 A;  1Z7Q c;  1ZYR F;  2WZG A;  4UDV A;  3C8G B;  1ORY A;  2NSG A;  2KNH A;  3DWW A;  2J7P A;  1GS9 A;  3QTH A;  3RVZ A;  1HW2 A;  3ECS A;  4CS9 C;  4Z9J A;  3K7D A;  3KYJ A;  4BJ1 A;  3LLK A;  2YZS A;  3LEO A;  5L0G A;  3UR3 C;  5HSW A;  3AOU A;  3B71 A;  4BG0 A;  1I4Y A;  2R7W A;  2VCC A;  4G7Z F;  2Q4F A;  1BR1 A;  2WVQ A;  1TR2 A;  3SXM A;  2DYS C;  4MVZ A;  1T5O A;  1GGQ A;  3M15 A;  2HV6 A;  3TK0 A;  4E7S A;  2W45 A;  3G50 A;  3LEV A;  4AK9 A;  1BBH A;  1OR2 A;  4BPM A;  4CSA A;  4PJL A;  1QLE C;  1UG7 A;  1D0Y A;  1BDJ B;  1WGW A;  2XLW A;  4A2N B;  2AWC A;  2YVK A;  1T01 A;  3DE9 A;  3M4B A;  3RVY A;  2H7B A;  3VRC A;  1BR2 A;  3EHM A;  3NKE A;  2KQ9 A;  1MMG A;  4EUK B;  1A7E A;  256B A;  2IXP A;  2P1A A;  3EFO B;  4LER A;  1OKK D;  1PD1 A;  3C8G D;  2C03 A;  3RH3 A;  3QZC A;  4D4N A;  1WOL A;  4DVY P;  1OXB A;  1ZHT A;  4BJ6 A;  5L0D A;  3GOD A;  2YKZ A;  2KW3 C;  2A0U A;  2WL8 A;  3V5X A;  3HNJ A;  1ZW3 A;  2VB6 A;  1Q0M A;  3JCU Q;  3UMI A;  5BQH A;  2QE9 A;  3RF3 A;  2XLV A;  4YWQ A;  2J9W A;  2XXA A;  2RSE B;  2YRF A;  2A69 F;  3DKA A;  4GEH A;  4OD4 A;  2Y39 A;  4ONS A;  3W8H A;  4DRH B;  4C7O A;  3TJ6 A;  1Q0K A;  1LE2 A;  3V5Z A;  1CGN A;  3ATP A;  1WN0 A;  1LVK A;  5BUO A;  1C02 A;  3EJN A;  4G0H A;  4HE8 D;  1RJ9 A;  4CIP A;  3C7J A;  3VM6 A;  1JPN A;  1TFK B;  2XM4 A;  2Z15 A;  4NCQ A;  2NUT B;  4E7Z A;  1KNY A;  2J9B A;  3DM5 A;  1Q0D A;  1M2V A;  2JPU A;  4MND A;  4JIO A;  1GQA A;  2XM0 A;  3BEH A;  3AGT A;  4AE4 B;  2L9J A;  4ULV A;  2QNL A;  3NMJ A;  2YWA A;  2YLG A;  3ZG1 A;  2XLO A;  1M57 C;  3RIP A;  3IQT A;  1H7I A;  3IQ6 A;  3LNR A;  4YL3 A;  2OU6 A;  1LI7 A;  2C04 A;  4CSA C;  3NMK A;  3E9V A;  3ASN C;  4LLE A;  2LFF A;  3U2M A;  3L0I A;  4JRZ A;  3T6G B;  3Q6N A;  3O10 A;  2AU5 A;  2AVK A;  4IAR A;  1Q0G A;  2HFI A;  2CNW A;  3O6X A;  3RQG A;  1VB5 A;  2XLE A;  3VAY A;  2QUP A;  1YZA A;  1VTM P;  1V4A A;  3ABM C;  4JJG A;  4IAO A;  2JD3 A;  3NDB B;  2NUP A;  1ZZP A;  4I3M A;  2OKU A;  2HJM A;  2CGE A;  4N06 A;  5CI8 A;  3RKO F;  4A4A A;  3ZVR A;  2HSQ A;  3S0X A;  1T6U A;  2KYH A;  1HMO A;  4NTF A;  4CS7 A;  4BJ6 C;  5AC5 A;  3UGO A;  2W4B A;  4XEF A;  2NSF A;  2Q00 A;  5COM A;  4KC9 A;  3M1C B;  4NTB A;  3GAN A;  3PMR A;  3SNH A;  1PCX A;  3FOP A;  4O7G A;  3K66 A;  4JEB A;  3LJB A;  3V7O A;  3T6B A;  1MND A;  2ZXR A;  1LE4 A;  4N4W A;  3L8J A;  5DQT A;  1J8M F;  2OEX A;  4PJM A;  1KU2 A;  1ORS C;  1Z23 A;  2F22 A;  3EPV A;  4U5E E;  5CIV A;  1H9G A;  3Q7L A;  3TUL A;  1O5H A;  2R7T A;  2HV7 A;  2V26 A;  3DMD A;  1OQC A;  1RMV A;  2RD9 A;  3E70 C;  5B1A C;  3EGX A;  2CCY A;  3JYY A;  2HMQ A;  2MYS A;  1E83 A;  1LM3 B;  3M4C A;  2YL3 A;  1PD0 A;  2YEV A;  4QI2 A;  2Q9C A;  1L7C A;  1B68 A;  3NYM A;  1E2X A;  2B0H A;  2LSE A;  1JAF A;  2Q3T A;  1MMN A;  1FTS A;  2IXN A;  5BQG A;  4JKV A;  3JRM O;  3DI5 A;  4E0I A;  1UFB A;  2ZXP A;  5A6J A;  1OKK A;  3GM1 A;  3C8G A;  2HZ8 A;  3MFN A;  4BEJ A;  1OR3 A;  3T9O A;  4Q7C A;  4MVU A;  3JTL O;  4CX9 A;  2D4U A;  2A6H F;  2LQG A;  3W2V A;  4CJO A;  5AC4 A;  4PR9 A;  5B3I A;  1VK5 A;  3TOM A;  3K33 A;  4H4K C;  3EQL F;  4XPW A;  5DS6 A;  3DJN B;  2FAP B;  2Y3G A;  1HY5 A;  3DJU B;  5EK0 A;  2ICW G;  4ER9 A;  4WAB A;  5EGY A;  1FR0 A;  4G7H F;  3RFY A;  2OOC A;  1Y4C A;  3S29 A;  1CGM E;  1N1C A;  3K1H A;  3SP1 A;  1Q0F A;  1YAU O;  3HTK C;  1C17 M;  2Q9A A;  1E85 A;  1E86 A;  1YLM A;  3GEI A;  5DLJ A;  2J0X A;  5A6B D;  4IJJ A;  3K1I A;  1WAT A;  1FAP B;  2HKV A;  2NG1 A;  2LFD A;  3ABK C;  3EFO A;  5DVW A;  1K40 A;  4CDA A;  2P61 A; 
#chains in the Genus database with same CATH homology
 1O87 A;  4O6M A;  3I5Q A;  3T6J A;  5T3T A;  4YN0 B;  2ZXO A;  3FDQ A;  3TD7 A;  3LS1 A;  2IXO A;  1W2W A;  2XRH A;  4J30 B;  1VOM A;  3NG1 A;  5L3Q A;  4JCH A;  3CQZ A;  4X0R A;  4OIP F;  1SZI A;  1SMY F;  3WOD F;  2I8B A;  2VAS A;  1VYK A;  2A68 F;  4P6I C;  4U5B E;  3ITF A;  5DQZ A;  1ZHW A;  2NUT A;  4B6I A;  5KYY B;  3DAF A;  3SZR A;  2G62 A;  5KYU B;  4AE4 A;  2ZPA A;  3EGD B;  4OIO F;  3ASO C;  4JW1 A;  3DZA A;  4HFF B;  4DBR A;  1TKN A;  3ZC4 A;  4OIQ F;  1VYI A;  4W8K A;  2Y3D A;  3T4R A;  1M2O A;  3AG4 C;  1Z6A A;  1FFT C;  3EH2 A;  2G3K A;  2EIM C;  2EIL C;  2M4E A;  5D91 A;  3NRH A;  3AG2 C;  3NYL A;  3H65 A;  2H7O A;  3KMI A;  1ZHY A;  5E3C A;  3ABL C;  4C3E A;  1Z5Z A;  4GYT A;  4DVZ A;  2L81 A;  4K7B A;  4Q5S F;  3F47 A;  5T1D B;  2WZF A;  3ZIB A;  1TWC A;  2A6E F;  4I1M A;  3N24 A;  3MLG A;  3OA1 A;  1ZHZ A;  3DXJ F;  1NG1 A;  4XLN F;  2WZL A;  2O9X A;  1OCC C;  4PK4 A;  1VMA A;  3HLZ A;  3MX3 A;  1IW7 F;  2R7X A;  3N2Z B;  4I44 A;  3UGP A;  1Z3I X;  3EG9 A;  2Q9B A;  3JRT A;  3X1O A;  3O39 A;  2J9U A;  3B9Q A;  4U5D E;  3NKD A;  1TWA A;  3S27 A;  1MNE A;  5DS5 A;  2DYR C;  4ZLD A;  2J9V A;  3JYH A;  4BJ5 A;  2PX0 A;  3X2Q C;  4U5F E;  2PFD A;  2W9Y A;  4YT2 A;  5B3S C;  5KYX B;  2A1D D;  3S28 A;  2WVO A;  4OD5 A;  2R7V A;  3DD7 A;  4ZLC A;  4LLC A;  1ST6 A;  1S7Z A;  3EHN A;  4QI0 A;  4CS9 A;  4BJT A;  1D0Z A;  2WVN A;  5KYW B;  4QDL A;  3AQB A;  2OCC C;  4XWJ A;  5E3A A;  3I4U A;  1V55 C;  2B0J A;  3LAY A;  4MQ9 F;  2PX3 A;  4CBE A;  4U5G A;  1ZHX A;  4J32 B;  4PJJ A;  3OEO A;  4U5H A;  2CW0 F;  2P6V A;  3UMK A;  3LES A;  2CNW D;  2YHS A;  5KYU A;  4PFP A;  5L3V A;  2WB7 A;  5FCL A;  4RD9 A;  3ZSU A;  2BE5 F;  1V54 C;  3QMK A;  4M63 A;  1SF8 A;  3WG7 C;  4OIR F;  4DBQ A;  4F4B A;  3W2W A;  5F5H A;  4RDA A;  2R7R A;  4JVS A;  2IXM A;  5KYN A;  2FGY A;  3DAG A;  5T3W A;  4JUR I;  1M56 C;  2J45 A;  2G3V A;  1LS1 A;  2IOQ A;  3SYN A;  1Z63 A;  4CS8 A;  4JZA A;  2W4M A;  3SEO A;  4HFK B;  3PHF 2;  4CIH A;  5E33 A;  4I1O B;  1MMD A;  3FVY A;  5EHH A;  3UMH A;  2D5R B;  3KH2 A;  4LAC B;  1G8X A;  3EZH A;  2OG2 A;  5D92 A;  2R7Q A;  2EIJ C;  2EIN C;  2PF4 E;  2PP4 A;  3N0T A;  1NU9 C;  5E2Q A;  4NY3 A;  4KI2 A;  3K1I C;  4PFO A;  1FMW A;  2FFH A;  3NYJ A;  2Y69 C;  1ZU4 A;  3AG3 C;  1JPJ A;  2KJG A;  4YT5 A;  2V3C C;  2Y3B A;  4JJF A;  3IEE A;  3JT1 A;  1OCO C;  4FES A;  3KL4 A;  3KKB A;  4KBL A;  4RBN A;  2H7V C;  4XTK A;  2X51 A;  4AX2 A;  1OCZ C;  2GFH A;  3LLI A;  5DS4 A;  3I5P A;  4C3D A;  2J7P D;  1D1B A;  4DOZ A;  2J46 A;  1BR4 A;  2IYL D;  3DM9 B;  4CS8 C;  1NZE A;  3Q6M A;  2Y3H A;  2XXA B;  3RYL A;  3F46 A;  4ULW A;  4C7O B;  5KYX A;  2DGJ A;  2MWQ A;  5F5F A;  5CI9 A;  2CDQ A;  2QY9 A;  3CSK A;  4O6Y A;  3EH1 A;  2J0W A;  1RJ9 B;  2P7V A;  1NU7 D;  1MMA A;  1TWH A;  1QZX A;  3AG1 C;  1M2V B;  3HJC A;  3L34 A;  5KYW A;  4XLP F;  1FFH A;  1FMV A;  3UNG C;  5B1B C;  4EBB A;  4FX5 A;  1TWG A;  3B0V C;  1LKX A;  3AQC A;  4KNV A;  4O6N A;  3Q7G A;  4YJW A;  1IZM A;  2QTV A;  1D0X A;  4IWB A;  4C3B A;  4IRU A;  4FWV A;  3POV A;  3W8I A;  4EWC A;  4WJ0 A;  3EZI A;  2NUP B;  4YT8 A;  4OIN F;  3CZ6 A;  3B0P A;  3FHD A;  4O79 A;  2ZXW C;  2E87 A;  2EIK C;  1OCR C;  4YT4 A;  2KGO A;  1J8Y F;  4PJN A;  3B0U X;  4HEA J;  1ZU5 A;  3EG9 B;  4G7O F;  5IY5 C;  2R7U A;  3FAJ A;  4KNW A;  3LS0 A;  1D1C A;  3EGX B;  3K6B A;  3OWT A;  4ANJ A;  5KYY A;  2R7S A;  2XSE A;  4BJ5 C;  3EGD A;  3VYW A;  2VH3 A;  1D1A A;  2R7O A;  4K0D A;  4U5C E;  2XL4 A;  3JSZ A;  1ZYR F;  2WZG A;  2KNH A;  2J7P A;  3ECS A;  4CS9 C;  3K7D A;  4BJ1 A;  3LLK A;  2YZS A;  3UR3 C;  5HSW A;  4BG0 A;  2R7W A;  4G7Z F;  1BR1 A;  2WVQ A;  1TR2 A;  2DYS C;  2HV6 A;  4E7S A;  2W45 A;  3LEV A;  4AK9 A;  4CSA A;  4PJL A;  1QLE C;  1WGW A;  1D0Y A;  4A2N B;  2H7B A;  1BR2 A;  3EHM A;  3NKE A;  2KQ9 A;  1MMG A;  2IXP A;  3EFO B;  4LER A;  1OKK D;  1PD1 A;  2C03 A;  3RH3 A;  3QZC A;  4DVY P;  1ZHT A;  4BJ6 A;  3GOD A;  2KW3 C;  2WL8 A;  3UMI A;  2VB6 A;  3JCU Q;  4YWQ A;  2J9W A;  2XXA A;  2A69 F;  4GEH A;  3W8H A;  4OD4 A;  2Y39 A;  4C7O A;  1LVK A;  5BUO A;  3EJN A;  4G0H A;  4HE8 D;  1RJ9 A;  1JPN A;  2Z15 A;  4E7Z A;  2NUT B;  3DM5 A;  1M2V A;  4MND A;  4AE4 B;  2L9J A;  3ZG1 A;  1M57 C;  3RIP A;  3LNR A;  2C04 A;  4CSA C;  3E9V A;  3ASN C;  4LLE A;  3L0I A;  3Q6N A;  2CNW A;  3O6X A;  3VAY A;  3ABM C;  4JJG A;  4IAO A;  2JD3 A;  3NDB B;  2NUP A;  4I3M A;  4N06 A;  5CI8 A;  2CGE A;  3RKO F;  3ZVR A;  3S0X A;  3UGO A;  4CS7 A;  4BJ6 C;  2W4B A;  4KC9 A;  3M1C B;  3GAN A;  3PMR A;  3SNH A;  1PCX A;  4O7G A;  3K66 A;  3LJB A;  3V7O A;  3T6B A;  1MND A;  2ZXR A;  5DQT A;  1J8M F;  4PJM A;  4Q4Z F;  1KU2 A;  1Z23 A;  3EPV A;  4U5E E;  3Q7L A;  1O5H A;  2R7T A;  2HV7 A;  2V26 A;  3DMD A;  3E70 C;  5B1A C;  3EGX A;  2MYS A;  1PD0 A;  2YEV A;  4QI2 A;  2Q9C A;  3NYM A;  2LSE A;  2Q3T A;  1MMN A;  1FTS A;  2IXN A;  2ZXP A;  1OKK A;  4BEJ A;  4Q7C A;  2A6H F;  3W2V A;  1VK5 A;  3K33 A;  4H4K C;  3EQL F;  5DS6 A;  3DJN B;  2Y3G A;  3DJU B;  5EGY A;  4G7H F;  3RFY A;  3S29 A;  3K1H A;  1N1C A;  3SP1 A;  3HTK C;  2Q9A A;  5DLJ A;  2J0X A;  4IJJ A;  2NG1 A;  3EFO A;  3ABK C;  5DVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...