3UMIA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with zinc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
ENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 78
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umiA00
3Q7LA 3NYLA 3PMRA 3K6BA 3QMKA 3Q7GA 3UMKA 3NYJA 5BUOA 4RD9A 4YN0B 3UMIA 3UMHA 1TKNA 4RDAA 3K66A
chains in the Genus database with same CATH superfamily
3SNHA 4I1MA 2XL4A 3JSEO 5DS6A 3W2VA 5L0FA 4H4KC 3RH3A 2G3KA 2Y39A 1LS1A 4QDLA 4XWJA 3U9MA 5KYNA 3EHNA 2ZXWC 1JR8A 2AP3A 2LIGA 1AUEA 1M57C 1OKKA 4G7OF 3G50A 3U5SA 4YT2A 5IY5C 5JSLA 4CSAC 1UG7A 4E17A 4HEAJ 4J7YA 4OIQF 3SXZA 2D4UA 4G0HA 5L3VA 3V5XA 3MYFA 3RIPA 3NMIA 1W2WA 1K40A 2WVQA 3U0CA 3C63A 2UUIA 2H7BA 1K05A 1T01A 2J9VA 2NSGA 1TFKB 2KC3A 1LE2A 2OG2A 5KYXA 2VH3A 1KU2A 2R05A 2Y69C 1OCOC 4I3MA 4H54A 3VF0A 4HFFB 4YT8A 1OW6A 5DQZA 5A69A 4A2NB 1E84A 3I4UA 1RXQA 4CS7A 3VRCA 3EGDB 1Z7Qc 1JPJA 3FHDA 2DB4A 3M4BA 5E3AA 3PHF2 3CSKA 3T9OA 1TKNA 1WN0A 3POVA 2KJGA 2EIJC 2ZD9A 3EJNA 2NUPA 4EBBA 1M56C 2QE9A 4O7GA 4YT5A 4YN0B 4MVQA 1T6UA 3T4RA 3E9VA 3M79A 2R7TA 3QTHA 4W8PA 3ABLC 1L3PA 1VOMA 3G4XA 2YLDA 4JEBA 1LE4A 1V54C 2Q00A 1G5ZA 1ORYA 5A6JA 1ORJA 1EKYA 3ZTZA 5COMA 1FR0A 1ZHYA 4XEKA 5JVEA 2QY9A 3C7JA 4FESA 4PR9A 1GM5A 5E2QA 1PD0A 2J45A 3SXYA 5FZTA 1YAUO 1KTMA 1D0ZA 4DBQA 1Q0MA 3EG9B 4JRZA 4QI2A 4BEMJ 4MTOA 3AGTA 5KYWB 2Y3GA 3A11A 2VC9A 1D1AA 1V74B 2J9WA 1VTMP 3B29A 3EGXA 1Q0DA 1ZU4A 3OWTA 4JKVA 1PD1A 3S28A 3MLGA 3JRMO 1M2VB 3JRTA 1I4YA 3DI5A 3JYHA 4CBEA 1MQVA 5COFA 1MMNA 3GANA 4RBNA 2XLVA 4LACB 4ER9A 4IARA 4BJTA 1GGQA 2WVNA 3MFNA 1BZ4A 1VK5A 2QNLA 3F47A 2HS5A 4AE4B 5A6KA 3C8GD 3AG2C 5DS5A 3NKDA 3WHNA 1H7IA 3Q7GA 4JTAB 3UR3C 3PDMP 4U9DA 3J06A 4O6MA 2OEXA 2M4EA 1R4TA 2OOCA 3PMRA 3ZVRA 2MHRA 4U5FE 2J0XA 4JZAA 2IM8A 3NDBB 4IWBA 2P7VA 2IBFA 4OD4A 4A4AA 4GQHA 2TMVP 1JRAA 1NU7D 3X2QC 3SEOA 4C3EA 4C7OB 3DZAA 1YDIA 2WVOA 3C8GB 3EH2A 1S05A 2CNWA 3GWNA 1OXBA 1WGWA 3I5PA 3V5ZA 2HMQA 3ZTMA 3TK0A 4IJJA 4U5GA 3LEVA 4EIYA 4LDQA 3RQEA 1HE9A 3DXJF 3FXHA 4G78A 1N1CA 4CSAA 2HSQA 1G4US 2VB6A 4K1OA 5GPGB 2W9YA 2E87A 3RQFA 3SZRA 3S84A 2YLIA 1TWCA 3K33A 3Q6MA 3UGPA 2JD3A 1H6GA 2M64A 4YWQA 1A7DA 2XLOA 3HLZA 1T5OA 4LDRA 5KYYA 2YL7A 3O6XA 4JIOA 2J7PD 1CPQA 1JPNA 1RKEB 1S7ZA 2DYSC 2YZSA 4HFKB 4P9TA 1RJ9A 1Z3IX 2EPOA 2ZXRA 3AG3C 2YRFA 3FVYA 4C3DA 2AVKA 2MWQA 1ZZPA 3IQ5A 4Z9IA 3VM6A 4D4XA 3LS0A 5AC5A 1LI7A 5KYUA 2LK4A 2VASA 2WZFA 2HJ3A 1ZHZA 5HV9A 2CGEA 3SP1A 4EHPA 1J8MF 3SYNA 3N2ZB 2XXAB 3ABMC 3IEEA 1SF8A 2A0BA 1LS4A 2C03A 2VCCA 2H8AA 1M2OA 1OQCA 3AQCA 3EPVA 3NKEA 4NY3A 4XTKA 5DLJA 4YT4A 4KI2A 5F28E 1JAFA 1L7CA 4NCQA 1BR4A 1MMGA 1T6QA 4MW8A 3RYLA 5L0HA 3EFOB 3RQGA 2L6HA 3Q6NA 4O6NA 4CIHA 2EIMC 3TOLA 1TWGA 2F22A 2EPNA 2Y3HA 3MX3A 3QVZA 3CQZA 3V7OA 5B3IA 2HKVA 1YYXA 1Z23A 4N6HA 3HKKA 2IXNA 4N6CA 3GEIA 1WWPA 3WODF 2QUPA 2XRHA 3U3BA 1YVIA 3GWLA 2RD9A 3UGOA 2GDCA 4NQFA 3MBGA 5COGA 2G62A 3G4ZA 3KMIA 2J0WA 1APCA 3QW0A 3T6GB 1E85A 2D5RB 256BA 2R7UA 2Z15A 1NU9C 2Q9BA 1OW8A 1MMAA 4E0HA 4CDAA 3RVYA 4BEJA 1B68A 2W45A 3HJCA 3ZQVA 3NYMA 1YJGA 4MS2A 3U8PA 5L0JA 3KKBA 5AGFA 4DVYP 3B0PA 3JT1A 3PCVA 2I15A 4J32B 4D4NA 4IAQA 1OR3A 2BC5A 2W4MA 2Q9AA 4KC9A 4P6IC 4CJGA 3DM9B 4N4WA 5A6BD 4EWCA 2PP4A 3UMHA 3FAPB 2IOQA 3HNJA 3TULA 3JZ0A 1U0BB 4MTGA 5DS4A 4UDVA 3L0IA 4MNDA 5B3SC 2KYHA 3NRHA 3FDQA 4JJFA 4MVUA 1HMOA 2Y3BA 1TFOB 4CX9A 4Z9HA 2ZXPA 1MMDA 4MTFA 2PX0A 5A6AA 3LNRA 3LESA 2H7VC 5BQGA 4DOZA 3CEXA 1VYKA 5EK0A 4PACA 3KL4A 5E33A 5L0CA 5JP7A 1BR1A 3FMSA 3T6JA 3EG9A 1T9KA 2PF4E 2R02A 2L6FA 4OIPF 4C3BA 3OEOA 2PFDA 2V26A 1M6TA 2QLAA 1SYQA 3IPMO 5KYWA 2EILC 2YL3A 1E86A 1MNEA 1T6IA 1VLSA 1M2VA 2H7OA 5T3WA 1ZYRF 1NBBA 3DD7A 4NTFA 3GODA 1QSPA 2ZXOA 4P9FA 2R7RA 3R2PA 1CPRA 3L34A 2DI3A 2OKUA 5JRAA 3ZWIA 3W8IA 2YKZA 3DE9A 1RMVA 3O39A 2J8WA 3I5QA 4PJLA 4PFPA 1GQAA 3B0VC 2L81A 1NFNA 3HNLA 1D1BA 1EQ1A 4OIOF 2XLMA 1AEPA 1Z63A 3C18A 3ITFA 1NZEA 4ZLDA 5CI8A 4Q5SF 3GM1A 5EGYA 2Q7RA 4F4BA 3U8VA 5BQHA 1V55C 3K1HA 4AL1A 2XL6A 3GEHA 3N24A 1D0XA 1I4ZA 2NUTB 3F46A 2IYLD 3IHUA 1FAPB 3VYWA 1HE1A 1OXKA 2ICWG 4LERA 1NSGB 2IXPA 1FMWA 3HNKA 3O10A 4C7OA 3E70C 2IXOA 3T6BA 3C8GA 4MW3A 5FCLA 4EKWA 2CDQA 4K7BA 1LM3B 1U6HA 1Q0GA 3EZIA 1FFHA 1A7VA 3DMDA 2EINC 2HSBA 3TJ6A 2A6HF 3GEEA 2YQYA 4LDKA 3UNGC 2Q4FA 2A0UA 3H65A 4CDYA 4AK9A 2P61A 2HJMA 4JW1A 4YL3A 4LLCA 1RKEA 2AU5A 3NYJA 4JTDB 4RD9A 2B0HA 2FFHA 3HTKC 3KYJA 3RVZA 1HW1A 2J9UA 4RDAA 1YLMA 4KNVA 1BR2A 4E7SA 2ASRA 4FWVA 4E7ZA 1E83A 2DYRC 4JJGA 5JUAA 3L8JA 2BE5F 3LJBA 4Q7CA 3ZIBA 4N06A 4YJWA 2R7WA 4GEHA 1LVKA 3H2UA 2R7OA 5L0GA 2LD6A 2XXAA 3DWWA 1OW7A 2KGOA 2A68F 4ZLCA 1D0YA 1ZHWA 2AWYA 4I1OB 2R7VA 3ZG1A 3WG7C 4AX2A 3FOOA 3JTLO 5F5HA 2J7PA 4ONSA 4X0RA 4U5HA 5JS5A 3B0UX 4FX5A 4XPXA 2PX3A 1QQ3A 5HSWA 3EFOA 4IAOA 1I5NA 3TJ5A 1TR2A 2XS1A 3AQBA 1YYJA 3DM5A 1O87A 3W2WA 2GWWA 4XEFA 2PNOA 4DXWA 1V4AA 3GORA 3KPHA 4PJJA 1PV3A 1VLTA 3ASNC 3NMKA 1LIHA 2XLHA 5L0DA 4CS8A 2FAPB 2P0NA 1QPUA 1PCXA 4YL1A 2NPUA 2JX0A 1D1CA 1CGME 4WGZA 3U2MA 1ZW3A 3LLIA 2LFDA 3S27A 3WAQA 2MYSA 4JEAA 4CJOA 4IRUA 4J7TA 3TOMA 1FMVA 2HV7A 1XZQA 3M1CB 4MVRA 4OIRF 1DOVA 4M63A 1G4WR 3VAYA 3MYIA 4MVMA 2L6GA 1OCZC 3R7CA 3K1IA 3JSZA 2Y3DA 4OINF 3EHMA 1OKKD 4PK4A 4W8KA 4R32A 1CGOA 3H2VA 4MVZA 1JOGA 5CI9A 3DKAA 4B6IA 3CZ6A 3AGUA 2HZ8A 3EGDA 2LQGA 2NSFA 3QW1A 2I8BA 3AJMA 3LAYA 2EIKC 2KSFA 2YWAA 4JE9A 3UMKA 4G7HF 4IGGA 1TWHA 1O3UA 4YK5A 2XM0A 5B1BC 5JLIA 3IQ6A 2HFIA 4J30B 1LKXA 3LLKA 4IB4A 4XPYA 1IW7F 3AG1C 2X0CA 3ZDLA 5L3QA 3S0XA 4AL0A 4EBJA 2Q9CA 2R25A 2WB7A 5T1DB 4CS9C 1F1MA 4CDVA 1ZVZA 4NTAA 3RFYA 4U5CE 3TQOA 4BJ5C 3RF3A 3DE8A 1Y6DA 4L6RA 1OCRC 1KNYA 5A6BA 2CYDA 4PJNA 4ULWA 2FGYA 4CS8C 1O5HA 4MVSA 3U2LA 4FAPB 5E3CA 2LFFA 1R5ID 4JURI 1NLXA 2OCCC 4EBKA 2WZGA 2R7XA 2EPMX 3DJNB 3S90A 1YZAA 5KYXB 1Y4CA 3DAFA 3W8HA 2R7SA 2EPKX 3AOUA 2J9BA 4HE8D 2LCHA 4U9EA 3BEHA 1G8XA 2ZPAA 4BPMA 5L0IA 1VMAA 3K1IC 3O55A 2W4BA 2L9JA 2OU6A 1WATA 3JYYA 2BL2A 4ULVA 1FTSA 1EI7A 2RSEB 2YL1A 1ORSC 4PFOA 4WJ0A 3LS1A 3TD7A 4KBLA 3UMIA 3X1OA 3U3FA 4U5DE 4PJMA 1YA9A 4AE4A 1NFOA 1U89A 2NUPB 2XLDA 1Z5ZA 3C8ZA 3GM2A 4NTBA 3S9OA 2DGJA 1QZXA 2X51A 1A7EA 4U5EE 5D92A 2OQMA 3DJUB 5K0IA 1WASA 1VYIA 1DOWA 1WOLA 2A1DD 2NUTA 2CW0F 3LEOA 3QZCA 4JCHA 1ZHXA 3QMKA 4XPWA 5DQTA 2LSEA 5AC4A 1ZU5A 1ZHTA 1OR2A 1YZCA 3EZHA 2YL0A 4XLNF 4DJ9A 1MNDA 2VCBA 5B1AC 3ZC4A 3HNIA 4QI0A 3QVYA 2YVKA 2LP4A 3M4CA 4GYTA 1A41A 4Z9JA 3SXMA 2HUJA 2XM4A 2P6VA 3L1MA 3OA1A 2YEVA 3C62A 2R9RB 3LNMB 2UUHA 4LLEA 1TQGA 1YA7O 1QKRA 4BJ6A 3GM3A 4JCZA 1RKCA 2J46A 2WZLA 3K6BA 3KH2A 3M15A 1RCPA 2VCAA 1HMDA 4BJ1A 2KK1A 3FOPA 5TJ5E 3ZSUA 2A6EF 4MVOA 2O9XA 3IQCA 3EGXB 1HW2A 4JVSA 3RKOF 1VB5A 5BUOA 3LUTB 3JCUQ 2XS8A 3V5YA 1OCCC 4XLPF 3EQLF 3ZQYA 1H9TA 1FNTc 3AG4C 1FFTC 3ECSA 1SMYF 2JPUA 2QTVA 2A69F 4KNWA 2CCYA 4BG0A 2XLEA 2OEVA 2CNWD 1WTYA 1SZIA 2GAQA 2R7QA 2YLGA 4O6YA 4O79A 3KYIA 4EUKB 2C04A 1C02A 1LI5A 1UFBA 4WGYA 2XLWA 4U5BE 1BBHA 4XEVA 4DBRA 2WL8A 1EA8A 1XWJA 3N0TA 2G3VA 1BDJB 1J8YF 2KW3C 2YHSA 3EH1A 1ST6A 3K7DA 3B9QA 4XQ1A 4E0IA 4DRJB 1SR2A 2KNHA 3NYLA 3ASOC 4NC3A 2OJED 1QLEC 5JT4A 5F5FA 3ABKC 1QVXA 1HY5A 3CAXA 2GFHA 4YL0A 3RW0A 3US6A 1XZPA 2NG1A 3Q7LA 3FAJA 4CS9A 2AWCA 3U9JA 3IQTA 4Q4ZF 4BJ5A 4BJ6C 1NG1A 4JTCB 3A9CA 1IZMA 2IXMA 4DRHB 1C17M 2V3CC 5T3TA 4ANJA 3ATPA 2L7AA 4WABA 1YARO 2PBEA 5D91A 5KYYB 1GS9A 2GA0A 2ETSA 1K04A 3L8IA 3NMJA 1ZW2A 3K66A 1TWAA 2XL8A 5BQIA 1E2XA 2HMZA 4G7ZF 3SXKA 1LPEA 1RJ9B 4E18A 4K0DA 4CIPA 1CGNA 1Q0KA 3DAGA 3B71A 2HV6A 3W4YA 1Z6AA 2Q3TA 5EHHA 2P1AA 2EPLX 2KQ9A 4DVZA 4MQ9F 4DRIB 5KYUB 2XSEA 1JMWA 4OD5A 2R03A 1AVOB 5DVWA 2B0JA 3S29A 4I44A 1A0BA 1H9GA 4JC7A 3BRJA 5CIVA 2OJQA 1Q0FA 3NG1A 1C03A
chains in the Genus database with same CATH topology
3SNHA 4I1MA 2XL4A 5DS6A 3W2VA 4H4KC 3RH3A 2G3KA 2Y39A 1LS1A 4QDLA 4XWJA 5KYNA 3EHNA 2ZXWC 1M57C 1OKKA 4G7OF 4YT2A 5IY5C 4CSAC 4HEAJ 4OIQF 4G0HA 5L3VA 3RIPA 1W2WA 2WVQA 2H7BA 2J9VA 5KYXA 2OG2A 2VH3A 1KU2A 2Y69C 1OCOC 4I3MA 4HFFB 4YT8A 5DQZA 4A2NB 3I4UA 4CS7A 3EGDB 1JPJA 3FHDA 5E3AA 3PHF2 3CSKA 1TKNA 3POVA 2KJGA 2EIJC 3EJNA 4EBBA 2NUPA 1M56C 4O7GA 4YT5A 4YN0B 3T4RA 3E9VA 2R7TA 3ABLC 1VOMA 1V54C 1ZHYA 2QY9A 4FESA 5E2QA 1PD0A 2J45A 1D0ZA 4DBQA 3EG9B 4QI2A 2Y3GA 1D1AA 2J9WA 3OWTA 3EGXA 1ZU4A 3S28A 5KYWB 1PD1A 4CBEA 3MLGA 5B3SC 1M2VB 3JRTA 3JYHA 1MMNA 3GANA 4RBNA 4LACB 4BJTA 2WVNA 1VK5A 3F47A 4AE4B 3AG2C 5DS5A 3NKDA 3Q7GA 3UR3C 4O6MA 2M4EA 3PMRA 3ZVRA 4U5FE 2J0XA 4JZAA 3NDBB 4IWBA 2P7VA 4OD4A 1NU7D 3X2QC 3SEOA 4C3EA 4C7OB 3DZAA 2WVOA 3I5PA 3EH2A 2CNWA 1WGWA 4IJJA 4U5GA 3LEVA 3DXJF 4CSAA 1N1CA 2VB6A 3SZRA 2W9YA 2E87A 1TWCA 3K33A 3Q6MA 3UGPA 2JD3A 4YWQA 3HLZA 5KYYA 3O6XA 2J7PD 1JPNA 2DYSC 1S7ZA 4HFKB 2YZSA 1RJ9A 1Z3IX 2ZXRA 3AG3C 3FVYA 4C3DA 2MWQA 3LS0A 5KYUA 2VASA 2WZFA 1ZHZA 2CGEA 3SP1A 2XXAB 1J8MF 3SYNA 3N2ZB 3ABMC 3IEEA 1SF8A 2C03A 3EPVA 1M2OA 3AQCA 3NKEA 4NY3A 4YT4A 4XTKA 4KI2A 5DLJA 1MMGA 1BR4A 3RYLA 3EFOB 3Q6NA 4O6NA 4CIHA 2EIMC 1TWGA 3V7OA 2Y3HA 3MX3A 3CQZA 1Z23A 2IXNA 3WODF 2XRHA 3UGOA 2G62A 3KMIA 2R7UA 2J0WA 2D5RB 2Z15A 1NU9C 2Q9BA 1MMAA 4BEJA 2W45A 3HJCA 3NYMA 3KKBA 4DVYP 3B0PA 3JT1A 4J32B 2W4MA 4P6IC 2Q9AA 4KC9A 3DM9B 4EWCA 2PP4A 3UMHA 2IOQA 5DS4A 3L0IA 4MNDA 3NRHA 3FDQA 4JJFA 2Y3BA 2ZXPA 1MMDA 2PX0A 3LNRA 3LESA 2H7VC 4DOZA 1VYKA 5E33A 3KL4A 1BR1A 3T6JA 3EG9A 2PF4E 4OIPF 4C3BA 3OEOA 2PFDA 2V26A 5KYWA 2EILC 1MNEA 1M2VA 2H7OA 5T3WA 1ZYRF 3DD7A 3GODA 2ZXOA 2R7RA 3L34A 3W8IA 3O39A 3I5QA 4PJLA 4PFPA 3B0VC 2L81A 1D1BA 4OIOF 4ZLDA 1Z63A 3ITFA 1NZEA 5CI8A 4Q5SF 5EGYA 4F4BA 1V55C 3K1HA 3N24A 1D0XA 2NUTB 3F46A 2IYLD 3VYWA 4LERA 2IXPA 1FMWA 4C7OA 3E70C 2IXOA 3T6BA 5FCLA 2CDQA 4K7BA 3EZIA 1FFHA 3DMDA 2EINC 2A6HF 3UNGC 3H65A 4AK9A 4JW1A 4LLCA 3NYJA 4RD9A 2FFHA 3HTKC 2J9UA 4RDAA 4KNVA 1BR2A 4E7SA 4FWVA 4E7ZA 2DYRC 4JJGA 2BE5F 3LJBA 4Q7CA 3ZIBA 4N06A 4YJWA 2R7WA 4GEHA 1LVKA 2R7OA 2XXAA 2KGOA 2A68F 4ZLCA 1D0YA 1ZHWA 4I1OB 2R7VA 3ZG1A 3WG7C 4AX2A 5F5HA 2J7PA 3B0UX 4X0RA 4U5HA 4FX5A 2PX3A 5HSWA 3EFOA 4IAOA 1TR2A 3AQBA 3W2WA 3DM5A 1O87A 4PJJA 3ASNC 4CS8A 1PCXA 1D1CA 3LLIA 3S27A 2MYSA 4IRUA 1FMVA 2HV7A 3M1CB 4OIRF 4M63A 3VAYA 1OCZC 3JSZA 2Y3DA 4OINF 3EHMA 1OKKD 4PK4A 4W8KA 5CI9A 4B6IA 3CZ6A 3EGDA 2I8BA 3LAYA 2EIKC 3UMKA 4G7HF 1TWHA 5B1BC 4J30B 1LKXA 3LLKA 5L3QA 1IW7F 3AG1C 3S0XA 2Q9CA 2WB7A 5T1DB 4CS9C 3RFYA 4U5CE 4BJ5C 1OCRC 4PJNA 4ULWA 2FGYA 4CS8C 1O5HA 5E3CA 4JURI 2OCCC 2R7XA 2WZGA 3DJNB 5KYXB 3DAFA 3W8HA 2R7SA 4HE8D 1G8XA 2ZPAA 1VMAA 3K1IC 2W4BA 2L9JA 1FTSA 4WJ0A 4PFOA 3TD7A 3LS1A 4KBLA 3UMIA 3X1OA 4U5DE 4PJMA 4AE4A 2NUPB 1Z5ZA 2DGJA 1QZXA 2X51A 4U5EE 5D92A 3DJUB 2NUTA 1VYIA 2A1DD 2CW0F 3QZCA 4JCHA 1ZHXA 3QMKA 5DQTA 2LSEA 1ZU5A 1ZHTA 3EZHA 4XLNF 1MNDA 5B1AC 3ZC4A 4QI0A 4GYTA 3OA1A 2P6VA 2YEVA 4LLEA 4BJ6A 3K6BA 2J46A 2WZLA 3KH2A 4BJ1A 3ZSUA 2A6EF 2O9XA 3EGXB 4JVSA 3RKOF 5BUOA 3JCUQ 1OCCC 4XLPF 3EQLF 3AG4C 1FFTC 3ECSA 1SMYF 2QTVA 2A69F 4KNWA 4BG0A 2CNWD 1SZIA 2R7QA 4O79A 4O6YA 2C04A 4U5BE 4DBRA 2WL8A 3N0TA 2G3VA 1J8YF 3K7DA 2KW3C 2YHSA 3EH1A 1ST6A 3B9QA 2KNHA 3NYLA 3ASOC 1QLEC 5F5FA 3ABKC 2GFHA 2NG1A 3Q7LA 4CS9A 3FAJA 4Q4ZF 4BJ5A 4BJ6C 1NG1A 1IZMA 2IXMA 2V3CC 5T3TA 4ANJA 5D91A 5KYYB 3K66A 1TWAA 4G7ZF 1RJ9B 4K0DA 3DAGA 2HV6A 1Z6AA 2Q3TA 5EHHA 2KQ9A 4DVZA 4MQ9F 5KYUB 2XSEA 4OD5A 5DVWA 2B0JA 3S29A 4I44A 3NG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7L A;  3NYL A;  3PMR A;  3K6B A;  3QMK A;  3Q7G A;  3UMK A;  3NYJ A;  5BUO A;  4RD9 A;  4YN0 B;  3UMI A;  3UMH A;  1TKN A;  4RDA A;  3K66 A; 
#chains in the Genus database with same CATH topology
 3SNH A;  4I1M A;  2XL4 A;  3JSE O;  5DS6 A;  3W2V A;  5L0F A;  4H4K C;  3RH3 A;  2G3K A;  2Y39 A;  1LS1 A;  4QDL A;  4XWJ A;  3U9M A;  5KYN A;  3EHN A;  2ZXW C;  1JR8 A;  2AP3 A;  2LIG A;  1AUE A;  1M57 C;  1OKK A;  4G7O F;  3G50 A;  3U5S A;  4YT2 A;  5IY5 C;  5JSL A;  4CSA C;  1UG7 A;  4E17 A;  4HEA J;  4J7Y A;  4OIQ F;  3SXZ A;  2D4U A;  4G0H A;  5L3V A;  3V5X A;  3MYF A;  3RIP A;  3NMI A;  1W2W A;  1K40 A;  2WVQ A;  3U0C A;  3C63 A;  2UUI A;  2H7B A;  1K05 A;  1T01 A;  2J9V A;  2NSG A;  1TFK B;  2KC3 A;  1LE2 A;  2OG2 A;  5KYX A;  2VH3 A;  1KU2 A;  2R05 A;  2Y69 C;  1OCO C;  4I3M A;  4H54 A;  3VF0 A;  4HFF B;  4YT8 A;  1OW6 A;  5DQZ A;  5A69 A;  4A2N B;  1E84 A;  3I4U A;  1RXQ A;  4CS7 A;  3VRC A;  3EGD B;  1Z7Q c;  1JPJ A;  3FHD A;  2DB4 A;  3M4B A;  5E3A A;  3PHF 2;  3CSK A;  3T9O A;  1TKN A;  1WN0 A;  3POV A;  2KJG A;  2EIJ C;  2ZD9 A;  3EJN A;  2NUP A;  4EBB A;  1M56 C;  2QE9 A;  4O7G A;  4YT5 A;  4YN0 B;  4MVQ A;  1T6U A;  3T4R A;  3E9V A;  3M79 A;  2R7T A;  3QTH A;  4W8P A;  3ABL C;  1L3P A;  1VOM A;  3G4X A;  2YLD A;  4JEB A;  1LE4 A;  1V54 C;  2Q00 A;  1G5Z A;  1ORY A;  5A6J A;  1ORJ A;  1EKY A;  3ZTZ A;  5COM A;  1FR0 A;  1ZHY A;  4XEK A;  5JVE A;  2QY9 A;  3C7J A;  4FES A;  4PR9 A;  1GM5 A;  5E2Q A;  1PD0 A;  2J45 A;  3SXY A;  5FZT A;  1YAU O;  1KTM A;  1D0Z A;  4DBQ A;  1Q0M A;  3EG9 B;  4JRZ A;  4QI2 A;  4BEM J;  4MTO A;  3AGT A;  5KYW B;  2Y3G A;  3A11 A;  2VC9 A;  1D1A A;  1V74 B;  2J9W A;  1VTM P;  3B29 A;  3EGX A;  1Q0D A;  1ZU4 A;  3OWT A;  4JKV A;  1PD1 A;  3S28 A;  3MLG A;  3JRM O;  1M2V B;  3JRT A;  1I4Y A;  3DI5 A;  3JYH A;  4CBE A;  1MQV A;  5COF A;  1MMN A;  3GAN A;  4RBN A;  2XLV A;  4LAC B;  4ER9 A;  4IAR A;  4BJT A;  1GGQ A;  2WVN A;  3MFN A;  1BZ4 A;  1VK5 A;  2QNL A;  3F47 A;  2HS5 A;  4AE4 B;  5A6K A;  3C8G D;  3AG2 C;  5DS5 A;  3NKD A;  3WHN A;  1H7I A;  3Q7G A;  4JTA B;  3UR3 C;  3PDM P;  4U9D A;  3J06 A;  4O6M A;  2OEX A;  2M4E A;  1R4T A;  2OOC A;  3PMR A;  3ZVR A;  2MHR A;  4U5F E;  2J0X A;  4JZA A;  2IM8 A;  3NDB B;  4IWB A;  2P7V A;  2IBF A;  4OD4 A;  4A4A A;  4GQH A;  2TMV P;  1JRA A;  1NU7 D;  3X2Q C;  3SEO A;  4C3E A;  4C7O B;  3DZA A;  1YDI A;  2WVO A;  3C8G B;  3EH2 A;  1S05 A;  2CNW A;  3GWN A;  1OXB A;  1WGW A;  3I5P A;  3V5Z A;  2HMQ A;  3ZTM A;  3TK0 A;  4IJJ A;  4U5G A;  3LEV A;  4EIY A;  4LDQ A;  3RQE A;  1HE9 A;  3DXJ F;  3FXH A;  4G78 A;  1N1C A;  4CSA A;  2HSQ A;  1G4U S;  2VB6 A;  4K1O A;  5GPG B;  2W9Y A;  2E87 A;  3RQF A;  3SZR A;  3S84 A;  2YLI A;  1TWC A;  3K33 A;  3Q6M A;  3UGP A;  2JD3 A;  1H6G A;  2M64 A;  4YWQ A;  1A7D A;  2XLO A;  3HLZ A;  1T5O A;  4LDR A;  5KYY A;  2YL7 A;  3O6X A;  4JIO A;  2J7P D;  1CPQ A;  1JPN A;  1RKE B;  1S7Z A;  2DYS C;  2YZS A;  4HFK B;  4P9T A;  1RJ9 A;  1Z3I X;  2EPO A;  2ZXR A;  3AG3 C;  2YRF A;  3FVY A;  4C3D A;  2AVK A;  2MWQ A;  1ZZP A;  3IQ5 A;  4Z9I A;  3VM6 A;  4D4X A;  3LS0 A;  5AC5 A;  1LI7 A;  5KYU A;  2LK4 A;  2VAS A;  2WZF A;  2HJ3 A;  1ZHZ A;  5HV9 A;  2CGE A;  3SP1 A;  4EHP A;  1J8M F;  3SYN A;  3N2Z B;  2XXA B;  3ABM C;  3IEE A;  1SF8 A;  2A0B A;  1LS4 A;  2C03 A;  2VCC A;  2H8A A;  1M2O A;  1OQC A;  3AQC A;  3EPV A;  3NKE A;  4NY3 A;  4XTK A;  5DLJ A;  4YT4 A;  4KI2 A;  5F28 E;  1JAF A;  1L7C A;  4NCQ A;  1BR4 A;  1MMG A;  1T6Q A;  4MW8 A;  3RYL A;  5L0H A;  3EFO B;  3RQG A;  2L6H A;  3Q6N A;  4O6N A;  4CIH A;  2EIM C;  3TOL A;  1TWG A;  2F22 A;  2EPN A;  2Y3H A;  3MX3 A;  3QVZ A;  3CQZ A;  3V7O A;  5B3I A;  2HKV A;  1YYX A;  1Z23 A;  4N6H A;  3HKK A;  2IXN A;  4N6C A;  3GEI A;  1WWP A;  3WOD F;  2QUP A;  2XRH A;  3U3B A;  1YVI A;  3GWL A;  2RD9 A;  3UGO A;  2GDC A;  4NQF A;  3MBG A;  5COG A;  2G62 A;  3G4Z A;  3KMI A;  2J0W A;  1APC A;  3QW0 A;  3T6G B;  1E85 A;  2D5R B;  256B A;  2R7U A;  2Z15 A;  1NU9 C;  2Q9B A;  1OW8 A;  1MMA A;  4E0H A;  4CDA A;  3RVY A;  4BEJ A;  1B68 A;  2W45 A;  3HJC A;  3ZQV A;  3NYM A;  1YJG A;  4MS2 A;  3U8P A;  5L0J A;  3KKB A;  5AGF A;  4DVY P;  3B0P A;  3JT1 A;  3PCV A;  2I15 A;  4J32 B;  4D4N A;  4IAQ A;  1OR3 A;  2BC5 A;  2W4M A;  2Q9A A;  4KC9 A;  4P6I C;  4CJG A;  3DM9 B;  4N4W A;  5A6B D;  4EWC A;  2PP4 A;  3UMH A;  3FAP B;  2IOQ A;  3HNJ A;  3TUL A;  3JZ0 A;  1U0B B;  4MTG A;  5DS4 A;  4UDV A;  3L0I A;  4MND A;  5B3S C;  2KYH A;  3NRH A;  3FDQ A;  4JJF A;  4MVU A;  1HMO A;  2Y3B A;  1TFO B;  4CX9 A;  4Z9H A;  2ZXP A;  1MMD A;  4MTF A;  2PX0 A;  5A6A A;  3LNR A;  3LES A;  2H7V C;  5BQG A;  4DOZ A;  3CEX A;  1VYK A;  5EK0 A;  4PAC A;  3KL4 A;  5E33 A;  5L0C A;  5JP7 A;  1BR1 A;  3FMS A;  3T6J A;  3EG9 A;  1T9K A;  2PF4 E;  2R02 A;  2L6F A;  4OIP F;  4C3B A;  3OEO A;  2PFD A;  2V26 A;  1M6T A;  2QLA A;  1SYQ A;  3IPM O;  5KYW A;  2EIL C;  2YL3 A;  1E86 A;  1MNE A;  1T6I A;  1VLS A;  1M2V A;  2H7O A;  5T3W A;  1ZYR F;  1NBB A;  3DD7 A;  4NTF A;  3GOD A;  1QSP A;  2ZXO A;  4P9F A;  2R7R A;  3R2P A;  1CPR A;  3L34 A;  2DI3 A;  2OKU A;  5JRA A;  3ZWI A;  3W8I A;  2YKZ A;  3DE9 A;  1RMV A;  3O39 A;  2J8W A;  3I5Q A;  4PJL A;  4PFP A;  1GQA A;  3B0V C;  2L81 A;  1NFN A;  3HNL A;  1D1B A;  1EQ1 A;  4OIO F;  2XLM A;  1AEP A;  1Z63 A;  3C18 A;  3ITF A;  1NZE A;  4ZLD A;  5CI8 A;  4Q5S F;  3GM1 A;  5EGY A;  2Q7R A;  4F4B A;  3U8V A;  5BQH A;  1V55 C;  3K1H A;  4AL1 A;  2XL6 A;  3GEH A;  3N24 A;  1D0X A;  1I4Z A;  2NUT B;  3F46 A;  2IYL D;  3IHU A;  1FAP B;  3VYW A;  1HE1 A;  1OXK A;  2ICW G;  4LER A;  1NSG B;  2IXP A;  1FMW A;  3HNK A;  3O10 A;  4C7O A;  3E70 C;  2IXO A;  3T6B A;  3C8G A;  4MW3 A;  5FCL A;  4EKW A;  2CDQ A;  4K7B A;  1LM3 B;  1U6H A;  1Q0G A;  3EZI A;  1FFH A;  1A7V A;  3DMD A;  2EIN C;  2HSB A;  3TJ6 A;  2A6H F;  3GEE A;  2YQY A;  4LDK A;  3UNG C;  2Q4F A;  2A0U A;  3H65 A;  4CDY A;  4AK9 A;  2P61 A;  2HJM A;  4JW1 A;  4YL3 A;  4LLC A;  1RKE A;  2AU5 A;  3NYJ A;  4JTD B;  4RD9 A;  2B0H A;  2FFH A;  3HTK C;  3KYJ A;  3RVZ A;  1HW1 A;  2J9U A;  4RDA A;  1YLM A;  4KNV A;  1BR2 A;  4E7S A;  2ASR A;  4FWV A;  4E7Z A;  1E83 A;  2DYR C;  4JJG A;  5JUA A;  3L8J A;  2BE5 F;  3LJB A;  4Q7C A;  3ZIB A;  4N06 A;  4YJW A;  2R7W A;  4GEH A;  1LVK A;  3H2U A;  2R7O A;  5L0G A;  2LD6 A;  2XXA A;  3DWW A;  1OW7 A;  2KGO A;  2A68 F;  4ZLC A;  1D0Y A;  1ZHW A;  2AWY A;  4I1O B;  2R7V A;  3ZG1 A;  3WG7 C;  4AX2 A;  3FOO A;  3JTL O;  5F5H A;  2J7P A;  4ONS A;  4X0R A;  4U5H A;  5JS5 A;  3B0U X;  4FX5 A;  4XPX A;  2PX3 A;  1QQ3 A;  5HSW A;  3EFO A;  4IAO A;  1I5N A;  3TJ5 A;  1TR2 A;  2XS1 A;  3AQB A;  1YYJ A;  3DM5 A;  1O87 A;  3W2W A;  2GWW A;  4XEF A;  2PNO A;  4DXW A;  1V4A A;  3GOR A;  3KPH A;  4PJJ A;  1PV3 A;  1VLT A;  3ASN C;  3NMK A;  1LIH A;  2XLH A;  5L0D A;  4CS8 A;  2FAP B;  2P0N A;  1QPU A;  1PCX A;  4YL1 A;  2NPU A;  2JX0 A;  1D1C A;  1CGM E;  4WGZ A;  3U2M A;  1ZW3 A;  3LLI A;  2LFD A;  3S27 A;  3WAQ A;  2MYS A;  4JEA A;  4CJO A;  4IRU A;  4J7T A;  3TOM A;  1FMV A;  2HV7 A;  1XZQ A;  3M1C B;  4MVR A;  4OIR F;  1DOV A;  4M63 A;  1G4W R;  3VAY A;  3MYI A;  4MVM A;  2L6G A;  1OCZ C;  3R7C A;  3K1I A;  3JSZ A;  2Y3D A;  4OIN F;  3EHM A;  1OKK D;  4PK4 A;  4W8K A;  4R32 A;  1CGO A;  3H2V A;  4MVZ A;  1JOG A;  5CI9 A;  3DKA A;  4B6I A;  3CZ6 A;  3AGU A;  2HZ8 A;  3EGD A;  2LQG A;  2NSF A;  3QW1 A;  2I8B A;  3AJM A;  3LAY A;  2EIK C;  2KSF A;  2YWA A;  4JE9 A;  3UMK A;  4G7H F;  4IGG A;  1TWH A;  1O3U A;  4YK5 A;  2XM0 A;  5B1B C;  5JLI A;  3IQ6 A;  2HFI A;  4J30 B;  1LKX A;  3LLK A;  4IB4 A;  4XPY A;  1IW7 F;  3AG1 C;  2X0C A;  3ZDL A;  5L3Q A;  3S0X A;  4AL0 A;  4EBJ A;  2Q9C A;  2R25 A;  2WB7 A;  5T1D B;  4CS9 C;  1F1M A;  4CDV A;  1ZVZ A;  4NTA A;  3RFY A;  4U5C E;  3TQO A;  4BJ5 C;  3RF3 A;  3DE8 A;  1Y6D A;  4L6R A;  1OCR C;  1KNY A;  5A6B A;  2CYD A;  4PJN A;  4ULW A;  2FGY A;  4CS8 C;  1O5H A;  4MVS A;  3U2L A;  4FAP B;  5E3C A;  2LFF A;  1R5I D;  4JUR I;  1NLX A;  2OCC C;  4EBK A;  2WZG A;  2R7X A;  2EPM X;  3DJN B;  3S90 A;  1YZA A;  5KYX B;  1Y4C A;  3DAF A;  3W8H A;  2R7S A;  2EPK X;  3AOU A;  2J9B A;  4HE8 D;  2LCH A;  4U9E A;  3BEH A;  1G8X A;  2ZPA A;  4BPM A;  5L0I A;  1VMA A;  3K1I C;  3O55 A;  2W4B A;  2L9J A;  2OU6 A;  1WAT A;  3JYY A;  2BL2 A;  4ULV A;  1FTS A;  1EI7 A;  2RSE B;  2YL1 A;  1ORS C;  4PFO A;  4WJ0 A;  3LS1 A;  3TD7 A;  4KBL A;  3UMI A;  3X1O A;  3U3F A;  4U5D E;  4PJM A;  1YA9 A;  4AE4 A;  1NFO A;  1U89 A;  2NUP B;  2XLD A;  1Z5Z A;  3C8Z A;  3GM2 A;  4NTB A;  3S9O A;  2DGJ A;  1QZX A;  2X51 A;  1A7E A;  4U5E E;  5D92 A;  2OQM A;  3DJU B;  5K0I A;  1WAS A;  1VYI A;  1DOW A;  1WOL A;  2A1D D;  2NUT A;  2CW0 F;  3LEO A;  3QZC A;  4JCH A;  1ZHX A;  3QMK A;  4XPW A;  5DQT A;  2LSE A;  5AC4 A;  1ZU5 A;  1ZHT A;  1OR2 A;  1YZC A;  3EZH A;  2YL0 A;  4XLN F;  4DJ9 A;  1MND A;  2VCB A;  5B1A C;  3ZC4 A;  3HNI A;  4QI0 A;  3QVY A;  2YVK A;  2LP4 A;  3M4C A;  4GYT A;  1A41 A;  4Z9J A;  3SXM A;  2HUJ A;  2XM4 A;  2P6V A;  3L1M A;  3OA1 A;  2YEV A;  3C62 A;  2R9R B;  3LNM B;  2UUH A;  4LLE A;  1TQG A;  1YA7 O;  1QKR A;  4BJ6 A;  3GM3 A;  4JCZ A;  1RKC A;  2J46 A;  2WZL A;  3K6B A;  3KH2 A;  3M15 A;  1RCP A;  2VCA A;  1HMD A;  4BJ1 A;  2KK1 A;  3FOP A;  5TJ5 E;  3ZSU A;  2A6E F;  4MVO A;  2O9X A;  3IQC A;  3EGX B;  1HW2 A;  4JVS A;  3RKO F;  1VB5 A;  5BUO A;  3LUT B;  3JCU Q;  2XS8 A;  3V5Y A;  1OCC C;  4XLP F;  3EQL F;  3ZQY A;  1H9T A;  1FNT c;  3AG4 C;  1FFT C;  3ECS A;  1SMY F;  2JPU A;  2QTV A;  2A69 F;  4KNW A;  2CCY A;  4BG0 A;  2XLE A;  2OEV A;  2CNW D;  1WTY A;  1SZI A;  2GAQ A;  2R7Q A;  2YLG A;  4O6Y A;  4O79 A;  3KYI A;  4EUK B;  2C04 A;  1C02 A;  1LI5 A;  1UFB A;  4WGY A;  2XLW A;  4U5B E;  1BBH A;  4XEV A;  4DBR A;  2WL8 A;  1EA8 A;  1XWJ A;  3N0T A;  2G3V A;  1BDJ B;  1J8Y F;  2KW3 C;  2YHS A;  3EH1 A;  1ST6 A;  3K7D A;  3B9Q A;  4XQ1 A;  4E0I A;  4DRJ B;  1SR2 A;  2KNH A;  3NYL A;  3ASO C;  4NC3 A;  2OJE D;  1QLE C;  5JT4 A;  5F5F A;  3ABK C;  1QVX A;  1HY5 A;  3CAX A;  2GFH A;  4YL0 A;  3RW0 A;  3US6 A;  1XZP A;  2NG1 A;  3Q7L A;  3FAJ A;  4CS9 A;  2AWC A;  3U9J A;  3IQT A;  4Q4Z F;  4BJ5 A;  4BJ6 C;  1NG1 A;  4JTC B;  3A9C A;  1IZM A;  2IXM A;  4DRH B;  1C17 M;  2V3C C;  5T3T A;  4ANJ A;  3ATP A;  2L7A A;  4WAB A;  1YAR O;  2PBE A;  5D91 A;  5KYY B;  1GS9 A;  2GA0 A;  2ETS A;  1K04 A;  3L8I A;  3NMJ A;  1ZW2 A;  3K66 A;  1TWA A;  2XL8 A;  5BQI A;  1E2X A;  2HMZ A;  4G7Z F;  3SXK A;  1LPE A;  1RJ9 B;  4E18 A;  4K0D A;  4CIP A;  1CGN A;  1Q0K A;  3DAG A;  3B71 A;  2HV6 A;  3W4Y A;  1Z6A A;  2Q3T A;  5EHH A;  2P1A A;  2EPL X;  2KQ9 A;  4DVZ A;  4MQ9 F;  4DRI B;  5KYU B;  2XSE A;  1JMW A;  4OD5 A;  2R03 A;  1AVO B;  5DVW A;  2B0J A;  3S29 A;  4I44 A;  1A0B A;  1H9G A;  4JC7 A;  3BRJ A;  5CIV A;  2OJQ A;  1Q0F A;  3NG1 A;  1C03 A; 
#chains in the Genus database with same CATH homology
 3SNH A;  4I1M A;  2XL4 A;  5DS6 A;  3W2V A;  4H4K C;  3RH3 A;  2G3K A;  2Y39 A;  1LS1 A;  4QDL A;  4XWJ A;  5KYN A;  3EHN A;  2ZXW C;  1M57 C;  1OKK A;  4G7O F;  4YT2 A;  5IY5 C;  4CSA C;  4HEA J;  4OIQ F;  4G0H A;  5L3V A;  3RIP A;  1W2W A;  2WVQ A;  2H7B A;  2J9V A;  5KYX A;  2OG2 A;  2VH3 A;  1KU2 A;  2Y69 C;  1OCO C;  4I3M A;  4HFF B;  4YT8 A;  5DQZ A;  4A2N B;  3I4U A;  4CS7 A;  3EGD B;  1JPJ A;  3FHD A;  5E3A A;  3PHF 2;  3CSK A;  1TKN A;  3POV A;  2KJG A;  2EIJ C;  3EJN A;  4EBB A;  2NUP A;  1M56 C;  4O7G A;  4YT5 A;  4YN0 B;  3T4R A;  3E9V A;  2R7T A;  3ABL C;  1VOM A;  1V54 C;  1ZHY A;  2QY9 A;  4FES A;  5E2Q A;  1PD0 A;  2J45 A;  1D0Z A;  4DBQ A;  3EG9 B;  4QI2 A;  2Y3G A;  1D1A A;  2J9W A;  3OWT A;  3EGX A;  1ZU4 A;  3S28 A;  5KYW B;  1PD1 A;  4CBE A;  3MLG A;  5B3S C;  1M2V B;  3JRT A;  3JYH A;  1MMN A;  3GAN A;  4RBN A;  4LAC B;  4BJT A;  2WVN A;  1VK5 A;  3F47 A;  4AE4 B;  3AG2 C;  5DS5 A;  3NKD A;  3Q7G A;  3UR3 C;  4O6M A;  2M4E A;  3PMR A;  3ZVR A;  4U5F E;  2J0X A;  4JZA A;  3NDB B;  4IWB A;  2P7V A;  4OD4 A;  1NU7 D;  3X2Q C;  3SEO A;  4C3E A;  4C7O B;  3DZA A;  2WVO A;  3I5P A;  3EH2 A;  2CNW A;  1WGW A;  4IJJ A;  4U5G A;  3LEV A;  3DXJ F;  4CSA A;  1N1C A;  2VB6 A;  3SZR A;  2W9Y A;  2E87 A;  1TWC A;  3K33 A;  3Q6M A;  3UGP A;  2JD3 A;  4YWQ A;  3HLZ A;  5KYY A;  3O6X A;  2J7P D;  1JPN A;  2DYS C;  1S7Z A;  4HFK B;  2YZS A;  1RJ9 A;  1Z3I X;  2ZXR A;  3AG3 C;  3FVY A;  4C3D A;  2MWQ A;  3LS0 A;  5KYU A;  2VAS A;  2WZF A;  1ZHZ A;  2CGE A;  3SP1 A;  2XXA B;  1J8M F;  3SYN A;  3N2Z B;  3ABM C;  3IEE A;  1SF8 A;  2C03 A;  3EPV A;  1M2O A;  3AQC A;  3NKE A;  4NY3 A;  4YT4 A;  4XTK A;  4KI2 A;  5DLJ A;  1MMG A;  1BR4 A;  3RYL A;  3EFO B;  3Q6N A;  4O6N A;  4CIH A;  2EIM C;  1TWG A;  3V7O A;  2Y3H A;  3MX3 A;  3CQZ A;  1Z23 A;  2IXN A;  3WOD F;  2XRH A;  3UGO A;  2G62 A;  3KMI A;  2R7U A;  2J0W A;  2D5R B;  2Z15 A;  1NU9 C;  2Q9B A;  1MMA A;  4BEJ A;  2W45 A;  3HJC A;  3NYM A;  3KKB A;  4DVY P;  3B0P A;  3JT1 A;  4J32 B;  2W4M A;  4P6I C;  2Q9A A;  4KC9 A;  3DM9 B;  4EWC A;  2PP4 A;  3UMH A;  2IOQ A;  5DS4 A;  3L0I A;  4MND A;  3NRH A;  3FDQ A;  4JJF A;  2Y3B A;  2ZXP A;  1MMD A;  2PX0 A;  3LNR A;  3LES A;  2H7V C;  4DOZ A;  1VYK A;  5E33 A;  3KL4 A;  1BR1 A;  3T6J A;  3EG9 A;  2PF4 E;  4OIP F;  4C3B A;  3OEO A;  2PFD A;  2V26 A;  5KYW A;  2EIL C;  1MNE A;  1M2V A;  2H7O A;  5T3W A;  1ZYR F;  3DD7 A;  3GOD A;  2ZXO A;  2R7R A;  3L34 A;  3W8I A;  3O39 A;  3I5Q A;  4PJL A;  4PFP A;  3B0V C;  2L81 A;  1D1B A;  4OIO F;  4ZLD A;  1Z63 A;  3ITF A;  1NZE A;  5CI8 A;  4Q5S F;  5EGY A;  4F4B A;  1V55 C;  3K1H A;  3N24 A;  1D0X A;  2NUT B;  3F46 A;  2IYL D;  3VYW A;  4LER A;  2IXP A;  1FMW A;  4C7O A;  3E70 C;  2IXO A;  3T6B A;  5FCL A;  2CDQ A;  4K7B A;  3EZI A;  1FFH A;  3DMD A;  2EIN C;  2A6H F;  3UNG C;  3H65 A;  4AK9 A;  4JW1 A;  4LLC A;  3NYJ A;  4RD9 A;  2FFH A;  3HTK C;  2J9U A;  4RDA A;  4KNV A;  1BR2 A;  4E7S A;  4FWV A;  4E7Z A;  2DYR C;  4JJG A;  2BE5 F;  3LJB A;  4Q7C A;  3ZIB A;  4N06 A;  4YJW A;  2R7W A;  4GEH A;  1LVK A;  2R7O A;  2XXA A;  2KGO A;  2A68 F;  4ZLC A;  1D0Y A;  1ZHW A;  4I1O B;  2R7V A;  3ZG1 A;  3WG7 C;  4AX2 A;  5F5H A;  2J7P A;  3B0U X;  4X0R A;  4U5H A;  4FX5 A;  2PX3 A;  5HSW A;  3EFO A;  4IAO A;  1TR2 A;  3AQB A;  3W2W A;  3DM5 A;  1O87 A;  4PJJ A;  3ASN C;  4CS8 A;  1PCX A;  1D1C A;  3LLI A;  3S27 A;  2MYS A;  4IRU A;  1FMV A;  2HV7 A;  3M1C B;  4OIR F;  4M63 A;  3VAY A;  1OCZ C;  3JSZ A;  2Y3D A;  4OIN F;  3EHM A;  1OKK D;  4PK4 A;  4W8K A;  5CI9 A;  4B6I A;  3CZ6 A;  3EGD A;  2I8B A;  3LAY A;  2EIK C;  3UMK A;  4G7H F;  1TWH A;  5B1B C;  4J30 B;  1LKX A;  3LLK A;  5L3Q A;  1IW7 F;  3AG1 C;  3S0X A;  2Q9C A;  2WB7 A;  5T1D B;  4CS9 C;  3RFY A;  4U5C E;  4BJ5 C;  1OCR C;  4PJN A;  4ULW A;  2FGY A;  4CS8 C;  1O5H A;  5E3C A;  4JUR I;  2OCC C;  2R7X A;  2WZG A;  3DJN B;  5KYX B;  3DAF A;  3W8H A;  2R7S A;  4HE8 D;  1G8X A;  2ZPA A;  1VMA A;  3K1I C;  2W4B A;  2L9J A;  1FTS A;  4WJ0 A;  4PFO A;  3TD7 A;  3LS1 A;  4KBL A;  3UMI A;  3X1O A;  4U5D E;  4PJM A;  4AE4 A;  2NUP B;  1Z5Z A;  2DGJ A;  1QZX A;  2X51 A;  4U5E E;  5D92 A;  3DJU B;  2NUT A;  1VYI A;  2A1D D;  2CW0 F;  3QZC A;  4JCH A;  1ZHX A;  3QMK A;  5DQT A;  2LSE A;  1ZU5 A;  1ZHT A;  3EZH A;  4XLN F;  1MND A;  5B1A C;  3ZC4 A;  4QI0 A;  4GYT A;  3OA1 A;  2P6V A;  2YEV A;  4LLE A;  4BJ6 A;  3K6B A;  2J46 A;  2WZL A;  3KH2 A;  4BJ1 A;  3ZSU A;  2A6E F;  2O9X A;  3EGX B;  4JVS A;  3RKO F;  5BUO A;  3JCU Q;  1OCC C;  4XLP F;  3EQL F;  3AG4 C;  1FFT C;  3ECS A;  1SMY F;  2QTV A;  2A69 F;  4KNW A;  4BG0 A;  2CNW D;  1SZI A;  2R7Q A;  4O79 A;  4O6Y A;  2C04 A;  4U5B E;  4DBR A;  2WL8 A;  3N0T A;  2G3V A;  1J8Y F;  3K7D A;  2KW3 C;  2YHS A;  3EH1 A;  1ST6 A;  3B9Q A;  2KNH A;  3NYL A;  3ASO C;  1QLE C;  5F5F A;  3ABK C;  2GFH A;  2NG1 A;  3Q7L A;  4CS9 A;  3FAJ A;  4Q4Z F;  4BJ5 A;  4BJ6 C;  1NG1 A;  1IZM A;  2IXM A;  2V3C C;  5T3T A;  4ANJ A;  5D91 A;  5KYY B;  3K66 A;  1TWA A;  4G7Z F;  1RJ9 B;  4K0D A;  3DAG A;  2HV6 A;  1Z6A A;  2Q3T A;  5EHH A;  2KQ9 A;  4DVZ A;  4MQ9 F;  5KYU B;  2XSE A;  4OD5 A;  5DVW A;  2B0J A;  3S29 A;  4I44 A;  3NG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...