3UMIA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with zinc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
ENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein
total genus 78
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umiA00
4RD9A 4RDAA 3K6BA 4YN0B 3QMKA 3UMIA 3K66A 3NYJA 3PMRA 1TKNA 3UMHA 5BUOA 3UMKA 3NYLA 3Q7LA 3Q7GA
chains in the Genus database with same CATH superfamily
3EQLF 3MX3A 4CIPA 4YL3A 3KYJA 1JOGA 2A6EF 1JRAA 4YJWA 3WG7C 1BDJB 2J7PA 3K33A 3GANA 1OKKA 3J06A 1LVKA 3DJUB 1BR2A 2DYSC 1SMYF 3LS0A 2Q9BA 3QW1A 4JTCB 2YLGA 3NMIA 4JTDB 1YZAA 1KNYA 3VM6A 2NUPB 1MMGA 3MLGA 2XLWA 5KYUA 3S28A 4DRHB 3ABMC 3L34A 4LLCA 3TULA 3Q7GA 2O9XA 4IWBA 4LLEA 1E85A 1W2WA 2XXAA 1LIHA 4MTFA 2J46A 2AVKA 3DAGA 4IGGA 4H54A 1D0ZA 2OEXA 2QNLA 3B0PA 1NFNA 2IBFA 3LEVA 3NKDA 3PCVA 3LS1A 3IQ6A 1XZPA 2WVQA 3G4XA 1ZW3A 4DBRA 4KC9A 3PMRA 1Y6DA 3E70C 1NU9C 1LPEA 1AVOB 1Q0KA 2J9WA 3ITFA 3KKBA 4JCZA 4HE8D 2HJMA 1TFKB 2IOQA 1M6TA 3K1IA 4EIYA 3MYIA 3JRTA 3AQCA 3IHUA 1F1MA 5GPGB 4CJOA 3EGDA 2VCCA 3N2ZB 4J7YA 4MVZA 4N6CA 4P6IC 4CJGA 2EPLX 5L0IA 1MQVA 2ZXWC 3HNLA 1Z23A 4BJTA 5CIVA 2R7SA 2HFIA 1APCA 1MNEA 4IJJA 4P9TA 1GGQA 3DAFA 2L6GA 4EBBA 3GODA 4PFPA 4E0HA 4MS2A 3K66A 2C03A 1YA7O 2G3VA 1O5HA 4D4NA 2MWQA 3NMJA 3Q7LA 5L3VA 2P6VA 5DVWA 4XPXA 3ZVRA 4XTKA 4BJ5C 1S7ZA 1H7IA 5HSWA 3C8ZA 1RJ9A 4FESA 3DI5A 1IZMA 1ST6A 3FXHA 4QI0A 2WZLA 2VCAA 3U8PA 5L0CA 1K40A 3BEHA 1T9KA 2J45A 1FTSA 3JSEO 2J9UA 1ZU5A 3A9CA 1EI7A 1ZHTA 2C04A 2XL4A 2Y3DA 4C3EA 4E18A 2R7UA 3GM2A 3EFOA 2Y39A 4OIRF 5D92A 1Q0DA 3JRMO 1LKXA 2JD3A 2E87A 3ECSA 1OW6A 4JTAB 3SXMA 4G78A 3IQTA 4I1OB 4Q4ZF 1VTMP 4XEKA 1NG1A 2YL3A 1MMDA 1YVIA 4K0DA 3POVA 1N1CA 4NTFA 3PDMP 1V4AA 3U5SA 2A0UA 4IRUA 4BJ6C 3BRJA 3FDQA 1D0YA 3IEEA 2R7OA 4IAQA 1HW2A 5JVEA 2EINC 3IPMO 5DS6A 1RKEB 3AOUA 3UMKA 2PF4E 3U2LA 1E2XA 4JCHA 2W45A 4KNWA 3C8GA 4DJ9A 1OKKD 1Q0MA 2VCBA 3JTLO 5DQZA 1WASA 2H8AA 3AJMA 5COGA 2X0CA 4BEJA 1HE9A 4N06A 5DS5A 1WTYA 5B3IA 2UUHA 2OEVA 4EHPA 2YVKA 3EHMA 1CGOA 1L3PA 1SF8A 1ZHYA 4JRZA 5FCLA 4U9DA 4XLPF 1LI7A 2YWAA 4LERA 4MVOA 1H9GA 3C7JA 4RDAA 5KYXB 3S0XA 3I5QA 1QKRA 2EIMC 2EPKX 1IW7F 3RFYA 1CGME 2J0XA 3SXKA 4AK9A 2IXNA 3V7OA 1OW7A 2D4UA 3U8VA 4CSAA 2CNWD 1GQAA 2PX3A 3HNJA 4O6YA 4RBNA 2UUIA 2HS5A 4N6HA 4D4XA 3FMSA 1D1CA 4OD4A 5KYUB 3DM9B 1V55C 2GDCA 1M2VA 4RD9A 1ZW2A 1G4US 3HKKA 3JT1A 1RXQA 1WN0A 2WL8A 2WVOA 3KPHA 1AEPA 2L6HA 4X0RA 1OQCA 3K7DA 4BEMJ 2FAPB 1NU7D 1VYKA 1VK5A 2D5RB 2Z15A 2PNOA 1M2OA 3EHNA 2HMQA 2KSFA 2VB6A 2OG2A 2CCYA 2OJQA 3S90A 5D91A 4PK4A 3T4RA 4NQFA 5EHHA 3VF0A 2GWWA 2XLVA 1FMVA 2A6HF 2JPUA 1L7CA 2M64A 2P0NA 3OWTA 3VRCA 3EGDB 2NUPA 4MVSA 5DLJA 4DVYP 4XPYA 5KYWB 4QDLA 3RF3A 4MVRA 5JUAA 2HJ3A 5FZTA 3SXZA 1ZU4A 4MVUA 3ZDLA 2DI3A 4PJLA 3ZWIA 3LAYA 2IXMA 3AG1C 4Z9IA 4U5FE 3RH3A 4YT4A 2AWYA 3DM5A 1C03A 1E84A 1M56C 3S27A 4EBJA 3QVYA 2L6FA 4JJGA 2AWCA 1Y4CA 3AG4C 2GAQA 2I15A 2OU6A 1JAFA 3QMKA 2HMZA 3RVZA 4I44A 3CZ6A 1JPJA 3LJBA 2Y3BA 4U5GA 4OINF 3S84A 1KU2A 1H6GA 5F5FA 3PHF2 3SP1A 3EG9B 2IM8A 2YHSA 1HMOA 3RQGA 2G62A 4I1MA 1JPNA 3AG2C 3SZRA 1OCRC 3TJ6A 2XLEA 2XLHA 2QTVA 3GEEA 4C3BA 1U0BB 4O6NA 2YL1A 3U3BA 1LE4A 1D1AA 2DB4A 3K6BA 4JZAA 1AUEA 3C62A 2W4MA 1PD0A 4XPWA 2HV6A 2XXAB 3UGOA 3ZG1A 4ER9A 4LACB 1YAUO 2FGYA 2XLDA 3QVZA 2YLDA 1TWAA 4I3MA 5DS4A 2WZFA 1ZVZA 4GEHA 1U89A 3GEIA 2EIJC 5E2QA 1TFOB 3RW0A 2MHRA 4FWVA 2HKVA 2R03A 2Q00A 1O3UA 1PD1A 2FFHA 3JYYA 3M79A 3O6XA 2J8WA 4XLNF 3HNKA 3RYLA 3M1CB 2LP4A 4EWCA 5T3WA 1Z63A 2IXPA 3L8JA 3V5ZA 1G4WR 3CSKA 1E86A 1V74B 2R7QA 2XM0A 2WZGA 4YT8A 4CBEA 1WATA 2KK1A 2LQGA 1R5ID 1QSPA 1SYQA 2RSEB 3JYHA 3W8IA 3U2MA 3WHNA 2NUTA 2QY9A 5JS5A 3G50A 5JT4A 1HMDA 3C18A 1BZ4A 3M15A 2F22A 2H7VC 1VLSA 2HSQA 3B9QA 3UMIA 4JURI 4GQHA 1OXBA 2NG1A 2ETSA 2KNHA 3RVYA 1BR4A 4E0IA 1A7VA 2HV7A 1XZQA 2KQ9A 3ZIBA 5AC5A 2RD9A 2KC3A 3G4ZA 3EZHA 1EQ1A 4ZLCA 4MW8A 2R7XA 2VASA 5KYYA 1TWCA 1ORYA 3EZIA 1LS4A 5DQTA 1FR0A 2YRFA 1R4TA 2OQMA 1ORSC 2R05A 2J9BA 3MBGA 1M2VB 2R25A 4CX9A 1FFTC 1CGNA 3AGTA 1S05A 3ASOC 1SR2A 3FOPA 3O39A 3T6JA 4K1OA 3X1OA 4C3DA 4EBKA 3RKOF 3IQCA 1MMNA 2R02A 2Y3HA 3X2QC 2EPOA 1UG7A 4MTOA 5A6BA 4U5HA 2XS8A 3L1MA 1ZHZA 1Q0GA 4BJ5A 4E7ZA 3NYMA 4A2NB 3L0IA 2Q3TA 1VYIA 3EJNA 2A68F 5JP7A 3L8IA 1I5NA 1T01A 1Z6AA 4HEAJ 3ZSUA 4BG0A 2P61A 2V3CC 2LFDA 4CDVA 1LM3B 4JIOA 4MVQA 4OD5A 4JKVA 3JSZA 4PJJA 5A69A 2VC9A 1NZEA 3Q6NA 1WOLA 3B29A 5JLIA 3FVYA 2GFHA 3V5YA 2CDQA 3UGPA 3GEHA 2R7RA 2EPMX 2L81A 3F46A 4A4AA 3CEXA 1YYJA 2ZPAA 2R7VA 4J30B 5BQHA 3LESA 2P7VA 1G8XA 4UDVA 2L7AA 2OKUA 4J32B 1I4ZA 3K1HA 4NTAA 4O6MA 4XEVA 4XWJA 3UR3C 5B1AC 4AE4B 4AL0A 4CSAC 4KNVA 2YL7A 5L0HA 2J7PD 3DD7A 3TJ5A 4G7HF 4JVSA 4DRIB 2KGOA 3DE8A 2J0WA 4G0HA 4ONSA 3NMKA 4KI2A 2XL8A 3W4YA 2IYLD 5BQGA 4CDYA 3SXYA 1QQ3A 2TMVP 3FAPB 3AG3C 4PJMA 3T6GB 2NUTB 4HFFB 1YZCA 2QLAA 3T9OA 2NPUA 4U5CE 2KYHA 2BL2A 4DOZA 2R7WA 4XEFA 5CI8A 3B0VC 3NYLA 4C7OA 1VMAA 4JW1A 4PFOA 2DGJA 2LCHA 3DXJF 1NBBA 3HJCA 2EPNA 2AU5A 3ASNC 3C8GD 1T6UA 3VAYA 4FX5A 3O55A 1E83A 4JEAA 4M63A 1C17M 5T3TA 4YL1A 1J8MF 2BE5F 3R7CA 1Z5ZA 1OCOC 3KMIA 3TQOA 4E17A 4EKWA 3WODF 4JE9A 1UFBA 3SYNA 4WGZA 1QVXA 2OJED 3KL4A 1A0BA 2R9RB 3NRHA 4H4KC 4YT5A 2LK4A 3I4UA 5JSLA 1NLXA 3C63A 1NSGB 1ORJA 1WWPA 3IQ5A 1OXKA 3K1IC 3JZ0A 3U3FA 2XM4A 4NY3A 2LFFA 3A11A 2QE9A 2CGEA 3ZQYA 1LI5A 3B71A 4R32A 4W8PA 4YK5A 4G7ZF 3AQBA 1YA9A 4OIQF 2HZ8A 4PJNA 3TD7A 4NC3A 3KYIA 4YWQA 4LDRA 2WVNA 3CAXA 3W2WA 5A6BD 1GS9A 1CPRA 2YZSA 2J9VA 3QW0A 1YLMA 2H7OA 2YLIA 1TWGA 3HNIA 3ZQVA 1A41A 3FAJA 4IB4A 3R2PA 1LS1A 1NFOA 2XL6A 4IARA 1YDIA 2R7TA 5AC4A 1J8YF 1HE1A 3EG9A 5F28E 3FOOA 5T1DB 3EFOB 2YKZA 1QPUA 3MFNA 3UNGC 3RIPA 3E9VA 2Y3GA 2VH3A 5E33A 2AP3A 3NDBB 2KJGA 5TJ5E 3V5XA 1HW1A 2A0BA 3LLKA 1DOVA 1H9TA 1K04A 2CW0F 5COMA 5A6AA 3VYWA 1OCZC 1RKCA 4MVMA 3ZTZA 3HTKC 4CDAA 2V26A 3N24A 4DVZA 5BUOA 2G3KA 3DKAA 3DZAA 4K7BA 4HFKB 2ZXRA 4LDKA 5L0DA 4KBLA 4U5EE 3W2VA 3ZTMA 5E3CA 4YT2A 3NKEA 3HLZA 5L0JA 3U0CA 5EK0A 3AGUA 3LEOA 2IXOA 1JR8A 4OIOF 3U9JA 4DBQA 5KYWA 4BJ1A 3TOMA 4DRJB 1EKYA 5L0GA 1B68A 2HSBA 4PACA 3NYJA 4U5BE 4WJ0A 3S9OA 4CS9C 1RCPA 1D0XA 3T6BA 3WAQA 1T6QA 1FMWA 3US6A 2HUJA 2Q9CA 4U9EA 2X51A 5JRAA 4PR9A 1TWHA 2Q4FA 4MQ9F 2PP4A 2YEVA 4EUKB 3CQZA 5KYXA 2EIKC 3H2UA 4XQ1A 3EGXA 3RQEA 3LNRA 4C7OB 1ZHWA 5B1BC 1JMWA 4IAOA 2A1DD 2MYSA 2CYDA 2Q9AA 3TK0A 1QZXA 1TR2A 2CNWA 2ASRA 2XSEA 3GWLA 3F47A 1MMAA 4O7GA 1YJGA 3LNMB 4BJ6A 1OW8A 2XRHA 4ULWA 3GWNA 4YL0A 2I8BA 2L9JA 5BQIA 2ZXPA 4QI2A 1O87A 1EA8A 2B0JA 2KW3C 4GYTA 2LSEA 3LUTB 4N4WA 3KH2A 1ZZPA 3H2VA 2YQYA 1RKEA 4CS8C 3RQFA 1ZHXA 1SZIA 4JEBA 1PV3A 3ATPA 2ZD9A 2XS1A 3ABLC 1U6HA 2XLOA 4P9FA 2GA0A 2JX0A 3U9MA 2PX0A 3UMHA 1T5OA 2OOCA 5IY5C 5A6JA 3QZCA 3LLIA 3W8HA 1GM5A 3SNHA 4YN0B 1MNDA 2ZXOA 5E3AA 1Q0FA 5EGYA 4MNDA 3FHDA 2NSGA 4MTGA 3EH2A 1BBHA 2BC5A 4ANJA 5L3QA 1YARO 3I5PA 3MYFA 3N0TA 1YYXA 4U5DE 4F4BA 3C8GB 3NG1A 4CIHA 2WB7A 3DMDA 1CPQA 2W9YA 3EPVA 4WGYA 1KTMA 1WGWA 2B0HA 2OCCC 2H7BA 2ICWG 3TOLA 4B6IA 4L6RA 4DXWA 1M57C 1RJ9B 4Q7CA 1PCXA 3GORA 5A6KA 2DYRC 4Z9HA 1TKNA 2QUPA 2Q7RA 4BPMA 5K0IA 1T6IA 3O10A 4ZLDA 1TQGA 1ZYRF 4CS7A 4NCQA 2LD6A 2XLMA 3EH1A 4AE4A 4O79A 3OA1A 4OIPF 1DOWA 3EGXB 1OR2A 3GM1A 4JC7A 1OCCC 3H65A 1I4YA 1HY5A 1XWJA 5F5HA 3QTHA 5KYNA 2W4BA 3DE9A 1RMVA 1C02A 4NTBA 3B0UX 4MW3A 2EILC 2YL0A 4LDQA 1VB5A 5CI9A 4AX2A 4CS8A 1FNTc 2A69F 3DJNB 1D1BA 256BA 4ULVA 4G7OF 1VOMA 5KYYB 1BR1A 4CS9A 3ZC4A 4E7SA 1V54C 2PBEA 3OEOA 3JCUQ 2P1AA 1LE2A 4J7TA 4W8KA 5L0FA 1QLEC 1K05A 1Z7Qc 1VLTA 3Q6MA 3ABKC 5COFA 2M4EA 4WABA 4Z9JA 1FFHA 2Y69C 5HV9A 3S29A 4Q5SF 1FAPB 1G5ZA 2PFDA 4JJFA 3DWWA 5AGFA 2NSFA 1OR3A 4FAPB 1A7EA 5B3SC 3GM3A 1A7DA 1Z3IX 2LIGA 3M4BA 3SEOA 4AL1A 3M4CA
chains in the Genus database with same CATH topology
3EQLF 3MX3A 2A6EF 4YJWA 2J7PA 3K33A 3GANA 1OKKA 1LVKA 3DJUB 1BR2A 2DYSC 1SMYF 3LS0A 2Q9BA 2NUPB 1MMGA 3MLGA 5KYUA 3S28A 3ABMC 3L34A 4LLCA 3Q7GA 2O9XA 4IWBA 4LLEA 1W2WA 2XXAA 2J46A 3DAGA 1D0ZA 3B0PA 3LEVA 3NKDA 3LS1A 2WVQA 4DBRA 4KC9A 3PMRA 3E70C 1NU9C 2J9WA 3ITFA 3KKBA 4HE8D 2IOQA 3JRTA 3AQCA 3EGDA 3N2ZB 4P6IC 2ZXWC 1Z23A 4BJTA 2R7SA 4IJJA 1MNEA 3DAFA 4EBBA 3GODA 4PFPA 3K66A 2C03A 2G3VA 1O5HA 2MWQA 3Q7LA 5L3VA 2P6VA 5DVWA 3ZVRA 4XTKA 4BJ5C 1S7ZA 5HSWA 1RJ9A 4FESA 1IZMA 1ST6A 4QI0A 2WZLA 2J45A 1FTSA 1ZU5A 2J9UA 1ZHTA 2C04A 2XL4A 4C3EA 2Y3DA 2R7UA 3EFOA 2Y39A 4OIRF 5D92A 1LKXA 2JD3A 2E87A 3ECSA 4Q4ZF 4I1OB 1NG1A 1MMDA 4K0DA 3POVA 1N1CA 4IRUA 4BJ6C 3FDQA 1D0YA 3IEEA 2R7OA 2EINC 5DS6A 3UMKA 2PF4E 4JCHA 2W45A 4KNWA 1OKKD 5DQZA 4BEJA 4N06A 5DS5A 3EHMA 1SF8A 1ZHYA 5FCLA 4XLPF 4LERA 4RDAA 3S0XA 5KYXB 3I5QA 2EIMC 1IW7F 3RFYA 2J0XA 4AK9A 2IXNA 3V7OA 4CSAA 2CNWD 2PX3A 4O6YA 4RBNA 1D1CA 4OD4A 5KYUB 3DM9B 1V55C 1M2VA 4RD9A 3JT1A 2WL8A 2WVOA 4X0RA 3K7DA 1NU7D 1VYKA 1VK5A 2D5RB 2Z15A 1M2OA 3EHNA 2VB6A 2OG2A 5D91A 4PK4A 3T4RA 5EHHA 1FMVA 2A6HF 3OWTA 3EGDB 2NUPA 5DLJA 4DVYP 5KYWB 4QDLA 1ZU4A 4PJLA 3LAYA 2IXMA 3AG1C 4U5FE 3RH3A 4YT4A 3DM5A 1M56C 3S27A 4JJGA 3AG4C 3QMKA 4I44A 3CZ6A 1JPJA 3LJBA 2Y3BA 4U5GA 4OINF 1KU2A 5F5FA 3PHF2 3SP1A 3EG9B 2YHSA 3SZRA 2G62A 4I1MA 1JPNA 3AG2C 1OCRC 2QTVA 4C3BA 4O6NA 1D1AA 4JZAA 3K6BA 2XXAB 2W4MA 1PD0A 2HV6A 3UGOA 3ZG1A 4LACB 2FGYA 1TWAA 4I3MA 5DS4A 2WZFA 4GEHA 2EIJC 5E2QA 4FWVA 2FFHA 1PD1A 3O6XA 4XLNF 3WG7C 2R7WA 4EWCA 3RYLA 3M1CB 5T3WA 1Z63A 2IXPA 3CSKA 2R7QA 2WZGA 4YT8A 4CBEA 3W8IA 3JYHA 2NUTA 2QY9A 2H7VC 3B9QA 3UMIA 4JURI 2NG1A 2KNHA 1BR4A 2HV7A 2KQ9A 3ZIBA 3EZHA 4ZLCA 2R7XA 2VASA 5KYYA 1TWCA 3EZIA 5DQTA 1M2VB 1FFTC 3ASOC 3O39A 3T6JA 3X1OA 4C3DA 3RKOF 1MMNA 2Y3HA 3X2QC 4U5HA 1ZHZA 4BJ5A 4E7ZA 3NYMA 4A2NB 3L0IA 2Q3TA 1VYIA 3EJNA 2A68F 1Z6AA 4HEAJ 3ZSUA 4BG0A 2V3CC 4OD5A 4PJJA 3JSZA 1NZEA 3Q6NA 3FVYA 2GFHA 2CDQA 3UGPA 2R7RA 2L81A 3F46A 2ZPAA 2R7VA 4J30B 3LESA 2P7VA 1G8XA 4O6MA 4J32B 4OIOF 3K1HA 4XWJA 3UR3C 5B1AC 4AE4B 4CSAC 4KNVA 2J7PD 3DD7A 4G7HF 4JVSA 2KGOA 4G0HA 2J0WA 4KI2A 2IYLD 4PJMA 3AG3C 2NUTB 4HFFB 4U5CE 4DOZA 5CI8A 3B0VC 4C7OA 3NYLA 1VMAA 4JW1A 4PFOA 2DGJA 3DXJF 3HJCA 3ASNC 3VAYA 4FX5A 4M63A 5T3TA 1J8MF 2BE5F 1Z5ZA 1OCOC 3KMIA 3WODF 3SYNA 3KL4A 3NRHA 4H4KC 4YT5A 3I4UA 3K1IC 4NY3A 2CGEA 4G7ZF 3AQBA 4OIQF 4PJNA 3TD7A 4YWQA 2WVNA 3W2WA 2YZSA 2J9VA 2H7OA 1TWGA 3FAJA 1LS1A 2R7TA 1J8YF 3EG9A 5T1DB 3EFOB 3UNGC 3RIPA 3E9VA 2Y3GA 2VH3A 5E33A 3NDBB 2KJGA 3LLKA 2CW0F 3VYWA 1OCZC 4DVZA 5BUOA 3HTKC 3N24A 2V26A 2G3KA 3DZAA 4K7BA 4HFKB 2ZXRA 4KBLA 4U5EE 3W2VA 5E3CA 4YT2A 3NKEA 3HLZA 2IXOA 4DBQA 5KYWA 4BJ1A 4U5BE 3NYJA 4WJ0A 4CS9C 1D0XA 1FMWA 2Q9CA 2X51A 1TWHA 4MQ9F 2PP4A 2YEVA 3CQZA 5KYXA 2EIKC 3EGXA 3LNRA 4C7OB 1ZHWA 5B1BC 4IAOA 2A1DD 2MYSA 2Q9AA 1QZXA 1TR2A 2CNWA 2XSEA 4O7GA 3F47A 1MMAA 4BJ6A 2XRHA 4ULWA 2I8BA 2L9JA 2ZXPA 4QI2A 1O87A 2B0JA 2KW3C 4GYTA 2LSEA 3KH2A 4CS8C 1ZHXA 1SZIA 3ABLC 2PX0A 3UMHA 5IY5C 3QZCA 3LLIA 3W8HA 3SNHA 4YN0B 1MNDA 2ZXOA 5E3AA 5EGYA 4MNDA 3FHDA 3EH2A 4ANJA 5L3QA 4F4BA 3I5PA 3N0TA 4CIHA 4U5DE 3NG1A 2WB7A 3DMDA 3EPVA 2W9YA 1WGWA 2OCCC 2H7BA 4B6IA 1M57C 1RJ9B 4Q7CA 1PCXA 2DYRC 1TKNA 4ZLDA 1ZYRF 4CS7A 3EH1A 4AE4A 4O79A 3OA1A 4OIPF 3EGXB 1OCCC 3H65A 5F5HA 5KYNA 2W4BA 3B0UX 2EILC 5CI9A 4AX2A 4CS8A 2A69F 3DJNB 1D1BA 4G7OF 1VOMA 5KYYB 1BR1A 4CS9A 3ZC4A 4E7SA 1V54C 3OEOA 4W8KA 3JCUQ 1QLEC 3Q6MA 3ABKC 2M4EA 1FFHA 2Y69C 4Q5SF 3S29A 2PFDA 4JJFA 5B3SC 1Z3IX 3SEOA 3T6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RD9 A;  4RDA A;  3K6B A;  4YN0 B;  3QMK A;  3UMI A;  3K66 A;  3NYJ A;  3PMR A;  1TKN A;  3UMH A;  5BUO A;  3UMK A;  3NYL A;  3Q7L A;  3Q7G A; 
#chains in the Genus database with same CATH topology
 3EQL F;  3MX3 A;  4CIP A;  4YL3 A;  3KYJ A;  1JOG A;  2A6E F;  1JRA A;  4YJW A;  3WG7 C;  1BDJ B;  2J7P A;  3K33 A;  3GAN A;  1OKK A;  3J06 A;  1LVK A;  3DJU B;  1BR2 A;  2DYS C;  1SMY F;  3LS0 A;  2Q9B A;  3QW1 A;  4JTC B;  2YLG A;  3NMI A;  4JTD B;  1YZA A;  1KNY A;  3VM6 A;  2NUP B;  1MMG A;  3MLG A;  2XLW A;  5KYU A;  3S28 A;  4DRH B;  3ABM C;  3L34 A;  4LLC A;  3TUL A;  3Q7G A;  2O9X A;  4IWB A;  4LLE A;  1E85 A;  1W2W A;  2XXA A;  1LIH A;  4MTF A;  2J46 A;  2AVK A;  3DAG A;  4IGG A;  4H54 A;  1D0Z A;  2OEX A;  2QNL A;  3B0P A;  1NFN A;  2IBF A;  3LEV A;  3NKD A;  3PCV A;  3LS1 A;  3IQ6 A;  1XZP A;  2WVQ A;  3G4X A;  1ZW3 A;  4DBR A;  4KC9 A;  3PMR A;  1Y6D A;  3E70 C;  1NU9 C;  1LPE A;  1AVO B;  1Q0K A;  2J9W A;  3ITF A;  3KKB A;  4JCZ A;  4HE8 D;  2HJM A;  1TFK B;  2IOQ A;  1M6T A;  3K1I A;  4EIY A;  3MYI A;  3JRT A;  3AQC A;  3IHU A;  1F1M A;  5GPG B;  4CJO A;  3EGD A;  2VCC A;  3N2Z B;  4J7Y A;  4MVZ A;  4N6C A;  4P6I C;  4CJG A;  2EPL X;  5L0I A;  1MQV A;  2ZXW C;  3HNL A;  1Z23 A;  4BJT A;  5CIV A;  2R7S A;  2HFI A;  1APC A;  1MNE A;  4IJJ A;  4P9T A;  1GGQ A;  3DAF A;  2L6G A;  4EBB A;  3GOD A;  4PFP A;  4E0H A;  4MS2 A;  3K66 A;  2C03 A;  1YA7 O;  2G3V A;  1O5H A;  4D4N A;  2MWQ A;  3NMJ A;  3Q7L A;  5L3V A;  2P6V A;  5DVW A;  4XPX A;  3ZVR A;  4XTK A;  4BJ5 C;  1S7Z A;  1H7I A;  5HSW A;  3C8Z A;  1RJ9 A;  4FES A;  3DI5 A;  1IZM A;  1ST6 A;  3FXH A;  4QI0 A;  2WZL A;  2VCA A;  3U8P A;  5L0C A;  1K40 A;  3BEH A;  1T9K A;  2J45 A;  1FTS A;  3JSE O;  2J9U A;  1ZU5 A;  3A9C A;  1EI7 A;  1ZHT A;  2C04 A;  2XL4 A;  2Y3D A;  4C3E A;  4E18 A;  2R7U A;  3GM2 A;  3EFO A;  2Y39 A;  4OIR F;  5D92 A;  1Q0D A;  3JRM O;  1LKX A;  2JD3 A;  2E87 A;  3ECS A;  1OW6 A;  4JTA B;  3SXM A;  4G78 A;  3IQT A;  4I1O B;  4Q4Z F;  1VTM P;  4XEK A;  1NG1 A;  2YL3 A;  1MMD A;  1YVI A;  4K0D A;  3POV A;  1N1C A;  4NTF A;  3PDM P;  1V4A A;  3U5S A;  2A0U A;  4IRU A;  4BJ6 C;  3BRJ A;  3FDQ A;  1D0Y A;  3IEE A;  2R7O A;  4IAQ A;  1HW2 A;  5JVE A;  2EIN C;  3IPM O;  5DS6 A;  1RKE B;  3AOU A;  3UMK A;  2PF4 E;  3U2L A;  1E2X A;  4JCH A;  2W45 A;  4KNW A;  3C8G A;  4DJ9 A;  1OKK D;  1Q0M A;  2VCB A;  3JTL O;  5DQZ A;  1WAS A;  2H8A A;  3AJM A;  5COG A;  2X0C A;  4BEJ A;  1HE9 A;  4N06 A;  5DS5 A;  1WTY A;  5B3I A;  2UUH A;  2OEV A;  4EHP A;  2YVK A;  3EHM A;  1CGO A;  1L3P A;  1SF8 A;  1ZHY A;  4JRZ A;  5FCL A;  4U9D A;  4XLP F;  1LI7 A;  2YWA A;  4LER A;  4MVO A;  1H9G A;  3C7J A;  4RDA A;  5KYX B;  3S0X A;  3I5Q A;  1QKR A;  2EIM C;  2EPK X;  1IW7 F;  3RFY A;  1CGM E;  2J0X A;  3SXK A;  4AK9 A;  2IXN A;  3V7O A;  1OW7 A;  2D4U A;  3U8V A;  4CSA A;  2CNW D;  1GQA A;  2PX3 A;  3HNJ A;  4O6Y A;  4RBN A;  2UUI A;  2HS5 A;  4N6H A;  4D4X A;  3FMS A;  1D1C A;  4OD4 A;  5KYU B;  3DM9 B;  1V55 C;  2GDC A;  1M2V A;  4RD9 A;  1ZW2 A;  1G4U S;  3HKK A;  3JT1 A;  1RXQ A;  1WN0 A;  2WL8 A;  2WVO A;  3KPH A;  1AEP A;  2L6H A;  4X0R A;  1OQC A;  3K7D A;  4BEM J;  2FAP B;  1NU7 D;  1VYK A;  1VK5 A;  2D5R B;  2Z15 A;  2PNO A;  1M2O A;  3EHN A;  2HMQ A;  2KSF A;  2VB6 A;  2OG2 A;  2CCY A;  2OJQ A;  3S90 A;  5D91 A;  4PK4 A;  3T4R A;  4NQF A;  5EHH A;  3VF0 A;  2GWW A;  2XLV A;  1FMV A;  2A6H F;  2JPU A;  1L7C A;  2M64 A;  2P0N A;  3OWT A;  3VRC A;  3EGD B;  2NUP A;  4MVS A;  5DLJ A;  4DVY P;  4XPY A;  5KYW B;  4QDL A;  3RF3 A;  4MVR A;  5JUA A;  2HJ3 A;  5FZT A;  3SXZ A;  1ZU4 A;  4MVU A;  3ZDL A;  2DI3 A;  4PJL A;  3ZWI A;  3LAY A;  2IXM A;  3AG1 C;  4Z9I A;  4U5F E;  3RH3 A;  4YT4 A;  2AWY A;  3DM5 A;  1C03 A;  1E84 A;  1M56 C;  3S27 A;  4EBJ A;  3QVY A;  2L6F A;  4JJG A;  2AWC A;  1Y4C A;  3AG4 C;  2GAQ A;  2I15 A;  2OU6 A;  1JAF A;  3QMK A;  2HMZ A;  3RVZ A;  4I44 A;  3CZ6 A;  1JPJ A;  3LJB A;  2Y3B A;  4U5G A;  4OIN F;  3S84 A;  1KU2 A;  1H6G A;  5F5F A;  3PHF 2;  3SP1 A;  3EG9 B;  2IM8 A;  2YHS A;  1HMO A;  3RQG A;  2G62 A;  4I1M A;  1JPN A;  3AG2 C;  3SZR A;  1OCR C;  3TJ6 A;  2XLE A;  2XLH A;  2QTV A;  3GEE A;  4C3B A;  1U0B B;  4O6N A;  2YL1 A;  3U3B A;  1LE4 A;  1D1A A;  2DB4 A;  3K6B A;  4JZA A;  1AUE A;  3C62 A;  2W4M A;  1PD0 A;  4XPW A;  2HV6 A;  2XXA B;  3UGO A;  3ZG1 A;  4ER9 A;  4LAC B;  1YAU O;  2FGY A;  2XLD A;  3QVZ A;  2YLD A;  1TWA A;  4I3M A;  5DS4 A;  2WZF A;  1ZVZ A;  4GEH A;  1U89 A;  3GEI A;  2EIJ C;  5E2Q A;  1TFO B;  3RW0 A;  2MHR A;  4FWV A;  2HKV A;  2R03 A;  2Q00 A;  1O3U A;  1PD1 A;  2FFH A;  3JYY A;  3M79 A;  3O6X A;  2J8W A;  4XLN F;  3HNK A;  3RYL A;  3M1C B;  2LP4 A;  4EWC A;  5T3W A;  1Z63 A;  2IXP A;  3L8J A;  3V5Z A;  1G4W R;  3CSK A;  1E86 A;  1V74 B;  2R7Q A;  2XM0 A;  2WZG A;  4YT8 A;  4CBE A;  1WAT A;  2KK1 A;  2LQG A;  1R5I D;  1QSP A;  1SYQ A;  2RSE B;  3JYH A;  3W8I A;  3U2M A;  3WHN A;  2NUT A;  2QY9 A;  5JS5 A;  3G50 A;  5JT4 A;  1HMD A;  3C18 A;  1BZ4 A;  3M15 A;  2F22 A;  2H7V C;  1VLS A;  2HSQ A;  3B9Q A;  3UMI A;  4JUR I;  4GQH A;  1OXB A;  2NG1 A;  2ETS A;  2KNH A;  3RVY A;  1BR4 A;  4E0I A;  1A7V A;  2HV7 A;  1XZQ A;  2KQ9 A;  3ZIB A;  5AC5 A;  2RD9 A;  2KC3 A;  3G4Z A;  3EZH A;  1EQ1 A;  4ZLC A;  4MW8 A;  2R7X A;  2VAS A;  5KYY A;  1TWC A;  1ORY A;  3EZI A;  1LS4 A;  5DQT A;  1FR0 A;  2YRF A;  1R4T A;  2OQM A;  1ORS C;  2R05 A;  2J9B A;  3MBG A;  1M2V B;  2R25 A;  4CX9 A;  1FFT C;  1CGN A;  3AGT A;  1S05 A;  3ASO C;  1SR2 A;  3FOP A;  3O39 A;  3T6J A;  4K1O A;  3X1O A;  4C3D A;  4EBK A;  3RKO F;  3IQC A;  1MMN A;  2R02 A;  2Y3H A;  3X2Q C;  2EPO A;  1UG7 A;  4MTO A;  5A6B A;  4U5H A;  2XS8 A;  3L1M A;  1ZHZ A;  1Q0G A;  4BJ5 A;  4E7Z A;  3NYM A;  4A2N B;  3L0I A;  2Q3T A;  1VYI A;  3EJN A;  2A68 F;  5JP7 A;  3L8I A;  1I5N A;  1T01 A;  1Z6A A;  4HEA J;  3ZSU A;  4BG0 A;  2P61 A;  2V3C C;  2LFD A;  4CDV A;  1LM3 B;  4JIO A;  4MVQ A;  4OD5 A;  4JKV A;  3JSZ A;  4PJJ A;  5A69 A;  2VC9 A;  1NZE A;  3Q6N A;  1WOL A;  3B29 A;  5JLI A;  3FVY A;  2GFH A;  3V5Y A;  2CDQ A;  3UGP A;  3GEH A;  2R7R A;  2EPM X;  2L81 A;  3F46 A;  4A4A A;  3CEX A;  1YYJ A;  2ZPA A;  2R7V A;  4J30 B;  5BQH A;  3LES A;  2P7V A;  1G8X A;  4UDV A;  2L7A A;  2OKU A;  4J32 B;  1I4Z A;  3K1H A;  4NTA A;  4O6M A;  4XEV A;  4XWJ A;  3UR3 C;  5B1A C;  4AE4 B;  4AL0 A;  4CSA C;  4KNV A;  2YL7 A;  5L0H A;  2J7P D;  3DD7 A;  3TJ5 A;  4G7H F;  4JVS A;  4DRI B;  2KGO A;  3DE8 A;  2J0W A;  4G0H A;  4ONS A;  3NMK A;  4KI2 A;  2XL8 A;  3W4Y A;  2IYL D;  5BQG A;  4CDY A;  3SXY A;  1QQ3 A;  2TMV P;  3FAP B;  3AG3 C;  4PJM A;  3T6G B;  2NUT B;  4HFF B;  1YZC A;  2QLA A;  3T9O A;  2NPU A;  4U5C E;  2KYH A;  2BL2 A;  4DOZ A;  2R7W A;  4XEF A;  5CI8 A;  3B0V C;  3NYL A;  4C7O A;  1VMA A;  4JW1 A;  4PFO A;  2DGJ A;  2LCH A;  3DXJ F;  1NBB A;  3HJC A;  2EPN A;  2AU5 A;  3ASN C;  3C8G D;  1T6U A;  3VAY A;  4FX5 A;  3O55 A;  1E83 A;  4JEA A;  4M63 A;  1C17 M;  5T3T A;  4YL1 A;  1J8M F;  2BE5 F;  3R7C A;  1Z5Z A;  1OCO C;  3KMI A;  3TQO A;  4E17 A;  4EKW A;  3WOD F;  4JE9 A;  1UFB A;  3SYN A;  4WGZ A;  1QVX A;  2OJE D;  3KL4 A;  1A0B A;  2R9R B;  3NRH A;  4H4K C;  4YT5 A;  2LK4 A;  3I4U A;  5JSL A;  1NLX A;  3C63 A;  1NSG B;  1ORJ A;  1WWP A;  3IQ5 A;  1OXK A;  3K1I C;  3JZ0 A;  3U3F A;  2XM4 A;  4NY3 A;  2LFF A;  3A11 A;  2QE9 A;  2CGE A;  3ZQY A;  1LI5 A;  3B71 A;  4R32 A;  4W8P A;  4YK5 A;  4G7Z F;  3AQB A;  1YA9 A;  4OIQ F;  2HZ8 A;  4PJN A;  3TD7 A;  4NC3 A;  3KYI A;  4YWQ A;  4LDR A;  2WVN A;  3CAX A;  3W2W A;  5A6B D;  1GS9 A;  1CPR A;  2YZS A;  2J9V A;  3QW0 A;  1YLM A;  2H7O A;  2YLI A;  1TWG A;  3HNI A;  3ZQV A;  1A41 A;  3FAJ A;  4IB4 A;  3R2P A;  1LS1 A;  1NFO A;  2XL6 A;  4IAR A;  1YDI A;  2R7T A;  5AC4 A;  1J8Y F;  1HE1 A;  3EG9 A;  5F28 E;  3FOO A;  5T1D B;  3EFO B;  2YKZ A;  1QPU A;  3MFN A;  3UNG C;  3RIP A;  3E9V A;  2Y3G A;  2VH3 A;  5E33 A;  2AP3 A;  3NDB B;  2KJG A;  5TJ5 E;  3V5X A;  1HW1 A;  2A0B A;  3LLK A;  1DOV A;  1H9T A;  1K04 A;  2CW0 F;  5COM A;  5A6A A;  3VYW A;  1OCZ C;  1RKC A;  4MVM A;  3ZTZ A;  3HTK C;  4CDA A;  2V26 A;  3N24 A;  4DVZ A;  5BUO A;  2G3K A;  3DKA A;  3DZA A;  4K7B A;  4HFK B;  2ZXR A;  4LDK A;  5L0D A;  4KBL A;  4U5E E;  3W2V A;  3ZTM A;  5E3C A;  4YT2 A;  3NKE A;  3HLZ A;  5L0J A;  3U0C A;  5EK0 A;  3AGU A;  3LEO A;  2IXO A;  1JR8 A;  4OIO F;  3U9J A;  4DBQ A;  5KYW A;  4BJ1 A;  3TOM A;  4DRJ B;  1EKY A;  5L0G A;  1B68 A;  2HSB A;  4PAC A;  3NYJ A;  4U5B E;  4WJ0 A;  3S9O A;  4CS9 C;  1RCP A;  1D0X A;  3T6B A;  3WAQ A;  1T6Q A;  1FMW A;  3US6 A;  2HUJ A;  2Q9C A;  4U9E A;  2X51 A;  5JRA A;  4PR9 A;  1TWH A;  2Q4F A;  4MQ9 F;  2PP4 A;  2YEV A;  4EUK B;  3CQZ A;  5KYX A;  2EIK C;  3H2U A;  4XQ1 A;  3EGX A;  3RQE A;  3LNR A;  4C7O B;  1ZHW A;  5B1B C;  1JMW A;  4IAO A;  2A1D D;  2MYS A;  2CYD A;  2Q9A A;  3TK0 A;  1QZX A;  1TR2 A;  2CNW A;  2ASR A;  2XSE A;  3GWL A;  3F47 A;  1MMA A;  4O7G A;  1YJG A;  3LNM B;  4BJ6 A;  1OW8 A;  2XRH A;  4ULW A;  3GWN A;  4YL0 A;  2I8B A;  2L9J A;  5BQI A;  2ZXP A;  4QI2 A;  1O87 A;  1EA8 A;  2B0J A;  2KW3 C;  4GYT A;  2LSE A;  3LUT B;  4N4W A;  3KH2 A;  1ZZP A;  3H2V A;  2YQY A;  1RKE A;  4CS8 C;  3RQF A;  1ZHX A;  1SZI A;  4JEB A;  1PV3 A;  3ATP A;  2ZD9 A;  2XS1 A;  3ABL C;  1U6H A;  2XLO A;  4P9F A;  2GA0 A;  2JX0 A;  3U9M A;  2PX0 A;  3UMH A;  1T5O A;  2OOC A;  5IY5 C;  5A6J A;  3QZC A;  3LLI A;  3W8H A;  1GM5 A;  3SNH A;  4YN0 B;  1MND A;  2ZXO A;  5E3A A;  1Q0F A;  5EGY A;  4MND A;  3FHD A;  2NSG A;  4MTG A;  3EH2 A;  1BBH A;  2BC5 A;  4ANJ A;  5L3Q A;  1YAR O;  3I5P A;  3MYF A;  3N0T A;  1YYX A;  4U5D E;  4F4B A;  3C8G B;  3NG1 A;  4CIH A;  2WB7 A;  3DMD A;  1CPQ A;  2W9Y A;  3EPV A;  4WGY A;  1KTM A;  1WGW A;  2B0H A;  2OCC C;  2H7B A;  2ICW G;  3TOL A;  4B6I A;  4L6R A;  4DXW A;  1M57 C;  1RJ9 B;  4Q7C A;  1PCX A;  3GOR A;  5A6K A;  2DYR C;  4Z9H A;  1TKN A;  2QUP A;  2Q7R A;  4BPM A;  5K0I A;  1T6I A;  3O10 A;  4ZLD A;  1TQG A;  1ZYR F;  4CS7 A;  4NCQ A;  2LD6 A;  2XLM A;  3EH1 A;  4AE4 A;  4O79 A;  3OA1 A;  4OIP F;  1DOW A;  3EGX B;  1OR2 A;  3GM1 A;  4JC7 A;  1OCC C;  3H65 A;  1I4Y A;  1HY5 A;  1XWJ A;  5F5H A;  3QTH A;  5KYN A;  2W4B A;  3DE9 A;  1RMV A;  1C02 A;  4NTB A;  3B0U X;  4MW3 A;  2EIL C;  2YL0 A;  4LDQ A;  1VB5 A;  5CI9 A;  4AX2 A;  4CS8 A;  1FNT c;  2A69 F;  3DJN B;  1D1B A;  256B A;  4ULV A;  4G7O F;  1VOM A;  5KYY B;  1BR1 A;  4CS9 A;  3ZC4 A;  4E7S A;  1V54 C;  2PBE A;  3OEO A;  3JCU Q;  2P1A A;  1LE2 A;  4J7T A;  4W8K A;  5L0F A;  1QLE C;  1K05 A;  1Z7Q c;  1VLT A;  3Q6M A;  3ABK C;  5COF A;  2M4E A;  4WAB A;  4Z9J A;  1FFH A;  2Y69 C;  5HV9 A;  3S29 A;  4Q5S F;  1FAP B;  1G5Z A;  2PFD A;  4JJF A;  3DWW A;  5AGF A;  2NSF A;  1OR3 A;  4FAP B;  1A7E A;  5B3S C;  3GM3 A;  1A7D A;  1Z3I X;  2LIG A;  3M4B A;  3SEO A;  4AL1 A;  3M4C A; 
#chains in the Genus database with same CATH homology
 3EQL F;  3MX3 A;  2A6E F;  4YJW A;  2J7P A;  3K33 A;  3GAN A;  1OKK A;  1LVK A;  3DJU B;  1BR2 A;  2DYS C;  1SMY F;  3LS0 A;  2Q9B A;  2NUP B;  1MMG A;  3MLG A;  5KYU A;  3S28 A;  3ABM C;  3L34 A;  4LLC A;  3Q7G A;  2O9X A;  4IWB A;  4LLE A;  1W2W A;  2XXA A;  2J46 A;  3DAG A;  1D0Z A;  3B0P A;  3LEV A;  3NKD A;  3LS1 A;  2WVQ A;  4DBR A;  4KC9 A;  3PMR A;  3E70 C;  1NU9 C;  2J9W A;  3ITF A;  3KKB A;  4HE8 D;  2IOQ A;  3JRT A;  3AQC A;  3EGD A;  3N2Z B;  4P6I C;  2ZXW C;  1Z23 A;  4BJT A;  2R7S A;  4IJJ A;  1MNE A;  3DAF A;  4EBB A;  3GOD A;  4PFP A;  3K66 A;  2C03 A;  2G3V A;  1O5H A;  2MWQ A;  3Q7L A;  5L3V A;  2P6V A;  5DVW A;  3ZVR A;  4XTK A;  4BJ5 C;  1S7Z A;  5HSW A;  1RJ9 A;  4FES A;  1IZM A;  1ST6 A;  4QI0 A;  2WZL A;  2J45 A;  1FTS A;  1ZU5 A;  2J9U A;  1ZHT A;  2C04 A;  2XL4 A;  4C3E A;  2Y3D A;  2R7U A;  3EFO A;  2Y39 A;  4OIR F;  5D92 A;  1LKX A;  2JD3 A;  2E87 A;  3ECS A;  4Q4Z F;  4I1O B;  1NG1 A;  1MMD A;  4K0D A;  3POV A;  1N1C A;  4IRU A;  4BJ6 C;  3FDQ A;  1D0Y A;  3IEE A;  2R7O A;  2EIN C;  5DS6 A;  3UMK A;  2PF4 E;  4JCH A;  2W45 A;  4KNW A;  1OKK D;  5DQZ A;  4BEJ A;  4N06 A;  5DS5 A;  3EHM A;  1SF8 A;  1ZHY A;  5FCL A;  4XLP F;  4LER A;  4RDA A;  3S0X A;  5KYX B;  3I5Q A;  2EIM C;  1IW7 F;  3RFY A;  2J0X A;  4AK9 A;  2IXN A;  3V7O A;  4CSA A;  2CNW D;  2PX3 A;  4O6Y A;  4RBN A;  1D1C A;  4OD4 A;  5KYU B;  3DM9 B;  1V55 C;  1M2V A;  4RD9 A;  3JT1 A;  2WL8 A;  2WVO A;  4X0R A;  3K7D A;  1NU7 D;  1VYK A;  1VK5 A;  2D5R B;  2Z15 A;  1M2O A;  3EHN A;  2VB6 A;  2OG2 A;  5D91 A;  4PK4 A;  3T4R A;  5EHH A;  1FMV A;  2A6H F;  3OWT A;  3EGD B;  2NUP A;  5DLJ A;  4DVY P;  5KYW B;  4QDL A;  1ZU4 A;  4PJL A;  3LAY A;  2IXM A;  3AG1 C;  4U5F E;  3RH3 A;  4YT4 A;  3DM5 A;  1M56 C;  3S27 A;  4JJG A;  3AG4 C;  3QMK A;  4I44 A;  3CZ6 A;  1JPJ A;  3LJB A;  2Y3B A;  4U5G A;  4OIN F;  1KU2 A;  5F5F A;  3PHF 2;  3SP1 A;  3EG9 B;  2YHS A;  3SZR A;  2G62 A;  4I1M A;  1JPN A;  3AG2 C;  1OCR C;  2QTV A;  4C3B A;  4O6N A;  1D1A A;  4JZA A;  3K6B A;  2XXA B;  2W4M A;  1PD0 A;  2HV6 A;  3UGO A;  3ZG1 A;  4LAC B;  2FGY A;  1TWA A;  4I3M A;  5DS4 A;  2WZF A;  4GEH A;  2EIJ C;  5E2Q A;  4FWV A;  2FFH A;  1PD1 A;  3O6X A;  4XLN F;  3WG7 C;  2R7W A;  4EWC A;  3RYL A;  3M1C B;  5T3W A;  1Z63 A;  2IXP A;  3CSK A;  2R7Q A;  2WZG A;  4YT8 A;  4CBE A;  3W8I A;  3JYH A;  2NUT A;  2QY9 A;  2H7V C;  3B9Q A;  3UMI A;  4JUR I;  2NG1 A;  2KNH A;  1BR4 A;  2HV7 A;  2KQ9 A;  3ZIB A;  3EZH A;  4ZLC A;  2R7X A;  2VAS A;  5KYY A;  1TWC A;  3EZI A;  5DQT A;  1M2V B;  1FFT C;  3ASO C;  3O39 A;  3T6J A;  3X1O A;  4C3D A;  3RKO F;  1MMN A;  2Y3H A;  3X2Q C;  4U5H A;  1ZHZ A;  4BJ5 A;  4E7Z A;  3NYM A;  4A2N B;  3L0I A;  2Q3T A;  1VYI A;  3EJN A;  2A68 F;  1Z6A A;  4HEA J;  3ZSU A;  4BG0 A;  2V3C C;  4OD5 A;  4PJJ A;  3JSZ A;  1NZE A;  3Q6N A;  3FVY A;  2GFH A;  2CDQ A;  3UGP A;  2R7R A;  2L81 A;  3F46 A;  2ZPA A;  2R7V A;  4J30 B;  3LES A;  2P7V A;  1G8X A;  4O6M A;  4J32 B;  4OIO F;  3K1H A;  4XWJ A;  3UR3 C;  5B1A C;  4AE4 B;  4CSA C;  4KNV A;  2J7P D;  3DD7 A;  4G7H F;  4JVS A;  2KGO A;  4G0H A;  2J0W A;  4KI2 A;  2IYL D;  4PJM A;  3AG3 C;  2NUT B;  4HFF B;  4U5C E;  4DOZ A;  5CI8 A;  3B0V C;  4C7O A;  3NYL A;  1VMA A;  4JW1 A;  4PFO A;  2DGJ A;  3DXJ F;  3HJC A;  3ASN C;  3VAY A;  4FX5 A;  4M63 A;  5T3T A;  1J8M F;  2BE5 F;  1Z5Z A;  1OCO C;  3KMI A;  3WOD F;  3SYN A;  3KL4 A;  3NRH A;  4H4K C;  4YT5 A;  3I4U A;  3K1I C;  4NY3 A;  2CGE A;  4G7Z F;  3AQB A;  4OIQ F;  4PJN A;  3TD7 A;  4YWQ A;  2WVN A;  3W2W A;  2YZS A;  2J9V A;  2H7O A;  1TWG A;  3FAJ A;  1LS1 A;  2R7T A;  1J8Y F;  3EG9 A;  5T1D B;  3EFO B;  3UNG C;  3RIP A;  3E9V A;  2Y3G A;  2VH3 A;  5E33 A;  3NDB B;  2KJG A;  3LLK A;  2CW0 F;  3VYW A;  1OCZ C;  4DVZ A;  5BUO A;  3HTK C;  3N24 A;  2V26 A;  2G3K A;  3DZA A;  4K7B A;  4HFK B;  2ZXR A;  4KBL A;  4U5E E;  3W2V A;  5E3C A;  4YT2 A;  3NKE A;  3HLZ A;  2IXO A;  4DBQ A;  5KYW A;  4BJ1 A;  4U5B E;  3NYJ A;  4WJ0 A;  4CS9 C;  1D0X A;  1FMW A;  2Q9C A;  2X51 A;  1TWH A;  4MQ9 F;  2PP4 A;  2YEV A;  3CQZ A;  5KYX A;  2EIK C;  3EGX A;  3LNR A;  4C7O B;  1ZHW A;  5B1B C;  4IAO A;  2A1D D;  2MYS A;  2Q9A A;  1QZX A;  1TR2 A;  2CNW A;  2XSE A;  4O7G A;  3F47 A;  1MMA A;  4BJ6 A;  2XRH A;  4ULW A;  2I8B A;  2L9J A;  2ZXP A;  4QI2 A;  1O87 A;  2B0J A;  2KW3 C;  4GYT A;  2LSE A;  3KH2 A;  4CS8 C;  1ZHX A;  1SZI A;  3ABL C;  2PX0 A;  3UMH A;  5IY5 C;  3QZC A;  3LLI A;  3W8H A;  3SNH A;  4YN0 B;  1MND A;  2ZXO A;  5E3A A;  5EGY A;  4MND A;  3FHD A;  3EH2 A;  4ANJ A;  5L3Q A;  4F4B A;  3I5P A;  3N0T A;  4CIH A;  4U5D E;  3NG1 A;  2WB7 A;  3DMD A;  3EPV A;  2W9Y A;  1WGW A;  2OCC C;  2H7B A;  4B6I A;  1M57 C;  1RJ9 B;  4Q7C A;  1PCX A;  2DYR C;  1TKN A;  4ZLD A;  1ZYR F;  4CS7 A;  3EH1 A;  4AE4 A;  4O79 A;  3OA1 A;  4OIP F;  3EGX B;  1OCC C;  3H65 A;  5F5H A;  5KYN A;  2W4B A;  3B0U X;  2EIL C;  5CI9 A;  4AX2 A;  4CS8 A;  2A69 F;  3DJN B;  1D1B A;  4G7O F;  1VOM A;  5KYY B;  1BR1 A;  4CS9 A;  3ZC4 A;  4E7S A;  1V54 C;  3OEO A;  4W8K A;  3JCU Q;  1QLE C;  3Q6M A;  3ABK C;  2M4E A;  1FFH A;  2Y69 C;  4Q5S F;  3S29 A;  2PFD A;  4JJF A;  5B3S C;  1Z3I X;  3SEO A;  3T6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...