3UN1A

Crystal structure of an oxidoreductase from sinorhizobium meliloti 1021
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
241
Chain Sequence
FQSMMRNQQKVVVITGASQGIGAGLVRAYRDRNYRVVATSRSIKPSADPDIHTVAGDISKPETADRIVREGIERFGRIDSLVNNAGVFLAKPFVEMTQEDYDHNLGVNVAGFFHITQRAAAEMLKQGSGHIVSITTSLVDQPMVGMPSALASLTKGGLNAVTRSLAMEFSRSGVRVNAVSPGVIKTPMHPAETHSTLAGLHPVGRMGEIRDVVDAVLYLEHAGFITGEILHVDGGQNAGRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an oxidoreductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Probable oxidoreductase
total genus 80
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3un1A00
3GH3A 3VPGA 1M75A 4RPGA 1JVSA 3QIVA 2Q1UA 4FN4A 2ZYAA 2NACA 3SLKA 1T2FA 4R16A 5DP2A 4A0SA 4CMEA 1ZO8A 3CIFA 4CLEA 4CM8B 3GEGA 2B83A 2WE7A 4MO2A 4MVJM 3N7UA 1H94A 2RAFA 2DFVA 2BH9A 3TL2A 1ZH8A 5JYDA 3AUAA 3GR6A 3UW3A 1B0AA 3DONA 4AJNA 3V1YA 3WJAA 5JS6A 3L4SO 1QKIA 1R0KA 5K0ZA 4C4OA 1VKNA 1DOHA 3H4VA 1LLUA 4XYBA 3T4XA 1LDEA 3IAHA 1F8GA 5FI3A 4WLVA 2PKQO 2BKAA 2EXXA 1PJ2A 4DIFA 2Q1WA 2Q4BA 1U4SA 4W9NC 4N5NA 2RH4A 4MVJI 1VE9A 1MG5A 3JQ8A 3ZV3A 4DPLA 3F4LA 2NTJA 1NPTO 2HCTA 3ZU5A 1PIWA 4Q9NA 4TROA 1SBYA 4TZKA 3VPSA 3E9NA 3B6ZA 5L4SA 2WJPA 3G1TA 4MP6A 1J6UA 2O2YA 3N58A 2P91A 4U6QA 1E6EA 1LEHA 2DTEA 5F1OA 5IJZA 3DOOA 3F3SA 1LC3A 3SBOA 3ZZNA 1GEEA 1WNTA 3GVCA 3ICPA 4XYEA 5DBGA 1X1EA 1LRKA 3JQ8B 4FDAA 4GPD1 3D4OA 1U3WA 4IJWA 3JQAD 1E77A 4PFJA 4CMGA 1ONNA 4UUMA 1TXGA 3IUSA 2GN9A 2PD4A 2XXJA 3HWRA 3W4KA 4OYRA 1I8TA 2YY7A 3OFSA 4J91A 4BQRA 4XZ3A 1M76A 1EVJA 3OETA 1P31A 4EEXA 2C2XA 2VTDA 3BMNA 1T4DA 2HRBA 3HFSA 1NQOA 5L95A 3M2PA 1B3BA 4DA9A 4YAIA 5JPIA 3C3XA 4XRGA 2Y1CA 2NLOA 2A94A 3K96A 4OKNA 2DPHA 3FR8A 3UF0A 1VSUA 3C7DB 1RYDA 2PK3A 5T57A 4YT4A 5IFLA 3VKUA 1H6CA 2CUKA 5B12A 1WW8A 3GNSA 2D2IA 4IPTA 2GCGA 2C5EA 1WDKA 4DRYA 4K26A 1Y1PA 5L9AA 1U2GA 3PXXA 4ALMA 3E18A 4BS9A 1UH5A 3AM5A 3GF4A 3FSRA 4R9RA 5F5NA 3ETDA 5GMOA 1J49A 3O8QA 4OIMA 4XQGA 4YPOA 3BHMA 4CLRA 2NQTA 4J90A 5U1PA 3PHHA 4YRAA 1ISIA 2FY8A 5B4UA 4IJVA 3W8FA 3ENKA 1E7MA 4CLDA 4Z0HO 4HNHA 5LDHA 2HMSA 3WNQA 1UZMA 2IYPA 3A06A 3JV7A 3AOEC 1KVUA 4IIVA 3GZ4A 2NADA 2WM3A 4IDCA 3RD5A 3OQBA 2X9GA 1Z82A 2JHFA 1GPJA 3H3FA 4XB1A 3JQFC 1PZGA 2VZ9A 3S2FA 4E5PA 4ZHSA 5JDCA 4I5EA 3TL3A 3DZHA 4BNNA 1I2ZA 3RIHA 3LQFA 2NUAA 4GWKA 3QQPA 3KUXA 4RVDA 5TJHA 5KVQA 3NGXA 1P0FA 3ZW9A 5DCYA 2W4QA 4WUVA 1LA2A 4TRRA 3LLVA 2DQ4A 1NQ5A 4O1MA 1ZZEA 3HB4X 3NKLA 5IXYA 4NIMA 1Y6JA 3ANNA 4OQZA 3C7AA 1ZMTA 1Y8QA 4QX6A 1BXGA 5KKAA 4CMIA 1DC5A 4NK5A 2CZCA 4DXHA 4RORA 2WD7A 1JU9A 2GN6A 1D3AA 3G49A 4WLNA 4WPGA 5CEEA 2BI8A 4YBZA 3VZRA 2VYVA 4FB5A 3U0BA 4AL4A 3ICCA 3KSDO 2X1HA 1K89A 2UYYA 3AU8A 5HTOA 2X8LA 4J2HA 3IIEA 1F8FA 3QHAA 2NTVA 1Y8QB 4EJ6A 2O7QA 1KYQA 1V6AA 3ONEA 5HWSA 2DFDA 2G17A 2VN8A 1LLDA 2C59A 3L6OO 1GUZA 2I6TA 4ZQBA 2YV1A 4XGKA 2BELA 3TFOA 1C1DA 3UH1A 5A5FA 4LISA 4PVDA 3ASUA 4CM5A 1IYZA 1FMCA 3WQRA 4RGBA 3I4FA 4CLXA 1SB8A 1D8AA 1P77A 1UXKA 4KWHA 1GQYA 3DBVO 3L0DA 4R01A 4XCVA 4Y8VA 3DAPA 4I5FA 1T1SA 5I8WA 3LF2A 4W4TA 3E9QA 3TWOA 2AE1A 2NV6A 3KVOA 1PQWA 5CPFA 2NVBA 1PGOA 4R3WA 1OZAA 4IZHA 1M6WA 1IZ9A 2GERA 4AJ2A 1ORRA 4WGGA 1XR3A 2CNBA 2Y0DA 4HFNA 2IZ0A 2BHLA 1R4MB 4TMFA 4IMPA 4EEZA 1OMOA 3VDQA 1F17A 2DBQA 2WYUA 1UP4A 1X7DA 4PRLA 5AXBA 3OJLA 3U4IA 1ENYA 2EJWA 1YRLA 1BMDA 1DSSG 2GUGA 1AHHA 4GBJA 2X5JO 1CQJA 4E13A 3PPIA 4EI2A 4Q3EA 2FWMX 5EIOA 5KIAA 3ONFA 4RO0A 4EZBA 1DBVO 3WB9A 3GAZA 1GL3A 2ZTLA 2Q2VA 3PGJA 1PL8A 3OECA 1N7GA 3KM0A 3TZ6A 1DC4A 2PD3A 4BKOA 1NHWA 5ER6A 1EUDA 4IMRA 1D1TA 5EPOA 3K30A 2ZJ0A 3L9XA 2V7PA 5DOVA 5DBFA 3UHAA 2CDBA 2HK7A 3DL2A 1ISHA 3IJPA 5EL0A 1ISGA 1KEVA 2J3JA 4ZQHA 5EJ2A 1U4OA 4AVYA 3W8EA 3GMDA 4YWJA 3B1JA 1I5RA 4J43A 1F14A 4B8ZA 4BMVA 4EJ0A 4PLWA 3ZWPA 3UFXA 1I0ZA 1NWCA 1MC4A 1I3KA 3GVPA 1CQIA 2ZYGA 3H9JA 1Y9AA 5FF9A 3Q11A 1Q0QA 2AQ8A 2HAEA 4Q3NA 1LDYA 4JXKA 2AW5A 4CQMA 4CM6A 1R4NA 1WAMA 3FHLA 5KJ1A 1LRJA 5KOIA 5G0VA 3U62A 2VHYA 4FOSA 2W90A 4MVJH 4D3SA 3CZRA 1BW9B 3RKUA 3BMOA 4YAJA 5G4KB 3UN1A 2EEZA 5JC8A 3RSHA 3HDJA 4PLFA 1GR0A 4YJFA 1QSGA 2BFPA 5THQA 2HRZA 2GZ1A 1AUPA 5IAAA 4BO8A 3GDFA 4ZQFA 5FEUA 2X5OA 1LJ8A 1B15A 2GLXA 3E5RA 3KTDA 5DZSA 1LDMA 2VT3A 3AI2A 2O4CA 2NSDA 1IPEA 3DFUA 3NYWA 5JNLA 3D3WB 3LK7A 5JO9A 1DRVA 3K31A 3JYQA 1I36A 4ZVVA 3JD4A 2B4TO 3GNTA 2HQ1A 1YWGO 4BNVA 3ULKA 3K2EA 4J3FA 2BGMA 5JBIA 3WGIA 5CHEA 5DCWA 5B4TA 1JWBB 1JAYA 2Y1OA 3PK0A 1U2DA 4U7WA 1KEPA 3JD2A 1NTOA 5CAEA 3EW7A 4MKXA 2X4GA 3F1LA 2SCUA 4HXYA 4LMRA 4R54A 1FDVA 3ORFA 4WCDA 4CQLB 3JYNA 1VM6A 2VUUA 3IL2A 1C0IA 4J9VA 3K9QO 3I4CA 4CMAA 3DZBA 4WNCA 3QSGA 2IZ1A 2GR9A 2X0IA 2DTDA 2JFHA 4DLLA 4DMMA 5CDYA 3OIGA 1JKIA 3CEAA 2OP1A 3GVIA 3ZV6A 2QIOA 4IQ0A 4XA8A 4D3DA 5JDIC 1Q0HA 3H3JA 2XPCA 3JSAA 4TRJA 4BMNA 1ZJYA 3KEQA 3RVDA 1LDNA 2UUOA 1B8PA 5TF4A 1UAYA 1E3JA 3BYZA 4CV3A 1BGVA 4DLBA 1YB5A 4PZEA 4XRRA 5BSFA 4M86A 4Z0PA 1RWBA 3D7LA 4GL4A 1B16A 1HDRA 2D5AA 3F5SA 4RDHA 1O89A 3AY3A 2OOSA 5EMHA 4IGEA 3DO5A 1CERA 4GQAA 2QQ5A 4MVJD 1H2BA 2O48X 2D1YA 2ZTMA 1UP7A 3PDUA 1N9GA 3D0OA 2AG8A 3DBLA 4BKQA 3RBZA 3H9UA 4PLVA 4IIUA 1QRRA 4IS2A 3VTFA 3ZCXA 2YV3A 3ZNPA 2FHSA 1ZK0A 3GAFA 4UVIA 3WWYA 4JLWA 1YL7A 3KYBA 3AW9A 4FFPA 4LRTB 3ZV5A 4II2A 1Z7EA 3T7EA 4Z3KA 4ZQGA 3DZIA 2D4AA 3RJ5A 9LDTA 4BO3A 1DC3A 1OFGA 3PWSA 3KO8A 1S7CA 1JAXA 4WEQA 1YBMA 3V1TC 3WYEA 5K6AC 1XA0A 2DUUA 4FW8A 2QZZA 4BO5A 2RIRA 2DAPA 1U7HA 4NPCA 5IF3A 4J0EA 3WXBA 1G0NA 2UDPA 4XQCA 4CUZA 3GA0A 1E0DA 5KVCA 4WKGA 4ZN6A 3E1KA 4DQVA 2C2YA 4CJXA 1HZZA 2Y67A 4CQMD 4DIBA 2DBVO 5JAZA 1XGKA 1MLDA 3I9KA 1QYCA 3VZQA 3EZYA 4R1TA 4CM7A 1Q0LA 3LDHA 2DM6A 4I8XA 2UAGA 1I3NA 3Q0EA 4GGOA 2IE0A 4L4SA 2CY0A 2EHDA 3VVCA 4ALJA 5A06A 3PQDA 4RF5A 1IUKA 5KJFA 1ML3A 1YBAA 4HFRA 2PGJA 2PV7A 4RVFA 4B7XA 4CQLA 4ZICA 5TNXA 3B1FA 1VSVA 3ZI0A 1LSSA 4FFRA 3OP4A 3JQGB 3MCVA 1YXMA 1W8DA 5H81A 1O95A 3HUDA 4J4TA 3RC9A 4ZA2A 3E9MA 1NR7A 3FWZA 3DZJA 3JTMA 1GFSA 2BFMA 1HTBA 5FWNA 1NXQA 5JY1A 1I32A 1UAGA 2Y0EA 1ZSYA 2C82A 2W2LD 3OJOA 2C0CA 3JD1A 1DDOA 4CM8A 1LSJA 1P3DA 4Z0TA 3JYPA 4Q3CA 4RCVA 1UUFA 3FNFA 4H7PA 4R51A 4J4HA 3ZWWA 3JQBA 3D5TA 2NU9A 2EV9A 3PRJA 4BL5A 2O3UA 3JQGA 3ITDA 3HDYA 4D44A 1K6XA 2Q49A 4E0BA 4W82A 1E5QA 1M6HA 2VYNA 2EF1A 2P9GA 4H15A 3WMXA 3A9WA 3LC1O 4RL6A 1UZLA 3ZU4A 3A14A 4NBTA 3UCEA 2Z95A 2HJRA 4FCCA 1KEWA 1PR3A 1H9AA 4EITA 1PZFA 1GPDG 1P1JA 3CINA 4WCFA 4IJUA 5T8KC 1KVSA 3DHYA 2JJYA 3S2EA 1ULSA 2Y68A 3VOSA 2RCYA 3ETGA 3MTGA 1S6YA 1Q7BA 4R4JA 1U9JA 4RPHA 1U3UA 2BFAA 3GK3A 4BB5A 5I7SA 3LT2A 4OXYA 4GKVA 4NG5A 1YKFA 3MJCA 4IDFA 5TIIA 3OICA 4PLZA 1KS9A 4RLSA 2GD1O 5ENVA 3FTPA 5CG1A 4RV9A 4IJKA 1FDTA 2EERA 3IKVA 4K1LA 4ROSA 5EERA 2A92A 5KVSA 4BNMA 2BGLA 4ND3A 1LSUA 5L7YA 3VH1A 3L07A 1A72A 3WLEA 1SOWA 3GT0A 3NT4A 4ND5A 5A5EA 2X5KO 3O03A 1CJCA 2DT5A 5AXDA 3FTNA 4J1QA 4CR8A 1CIVA 3EUWA 3TOZA 4YT8A 3QLJA 1PSDA 3I9JA 1CF2O 4GGPA 1UDAA 2YFQA 4M54A 1O8CA 3OEYA 1HDOA 4FQ8A 1HF3A 5CP8A 1WXDA 4ALLA 3RUFA 3K73O 3WICA 1VJTA 1Z6ZA 1HE5A 3IJRA 1MB4A 4KQXA 1H9BA 2ZJ1A 4I9HA 4P38A 4PZCA 4QSMA 4YA6A 3W6UA 5ILOA 3W6ZA 1R12A 2E82A 1TEHA 1W73A 2EKPA 2C20A 4G2NA 5JLAA 4XR4A 8LDHA 5GZ6A 3KHUA 2JD2A 2AXQA 3B20A 1P1IA 3H5RA 5CPBA 4WJZA 5A02A 4N5MA 2W8ZA 3AI3A 3NUGA 1HYGA 3HQ4O 4Y6SA 4XX0A 3JQDA 2I65A 3R3SA 4F46A 5JSFA 2NVUA 4CPDA 3RASA 1WPQA 4BV9A 3S2GA 1T2DA 1H93A 1ZVMA 1K6JA 2R00A 1E92A 3C1TA 4EJMA 4W6ZA 2WTBA 1U3VA 4MIYA 1SEPA 1ZK4A 4HP8A 1XKQA 4R5HA 4IUYA 1R66A 2VRBA 3NDRA 4RQUA 4UUPA 5FI5A 4CM4B 1E7WA 3MWEB 3Q2IA 5BNIA 3JQ9A 3NJ8A 2VZ0A 1YDEA 3DZKA 1C0KA 3ON5A 4GAEA 3DBRB 2JAPA 2OUIA 3EZLA 2DUWA 5CDGA 2FRDA 3QVWA 1Q7GA 4E2ZA 2AEFA 1R0LA 5FFFA 1TT5A 3L9WA 4W9NA 5KWEA 1H2HA 5BNTA 1NNUA 1U8FO 1CRWG 3L77A 1E7YA 4IINA 5A9RA 3RUAA 2O3JA 1PGQA 3PEFA 4NBVA 3HB5X 4CM9D 1DFGA 3BHIA 3D5QA 4Y6RA 3VHRA 2BI7A 3H5NA 1D4FA 1PGJA 2C07A 3DAFA 4IXTA 2YYYA 2EKQA 3H8VA 3A4VA 1B2LA 1D1SA 1YS4A 3VH2A 4E5MA 3GHHA 1X14A 1QLHA 3VAZA 3WGYA 1PR9A 3HDQA 3HE3A 3TNLA 1MG0A 2NQ8A 5I9NA 4RVUA 5HA5A 3GUCA 1O5IA 1UXHA 3PFFA 4WK6A 3ITKA 5L3ZA 1GCUA 1BWSA 1XWFA 2WWRA 1SZJG 3DTTA 5A05A 3V1UA 3LVFO 1OI7A 4FBGA 4XGIA 2W2LA 3MWDB 3OJEA 4J6FA 4RLHA 1NVGA 5CDTA 3RUIA 3E8XA 3KOUA 4BNGA 3O8QB 1N9GB 4NU6A 4O6VA 3UICA 1ZK2A 3I6QA 4R5MA 1TVEA 4GH5A 3LT1A 1ZXBA 3DC2A 1LI4A 1ADFA 3AFNA 2YQ5A 3S55A 2OGUA 4Y6PA 1NYTA 3CMMA 2J5QA 4DYVA 2QX7A 4IS3A 4U8GA 5JXWA 1YB4A 1PJQA 4Z9XA 2VHXA 1RM0A 3LU1A 3CPSA 3K6JA 4QT0A 4YQZA 1JVBA 3QVXA 1HLPA 3GPIA 4KUEA 1EK5A 4UAGA 4ZGWA 1N92A 1Y9EA 1HKUA 3LF1A 4MP8A 4E31A 4PLPA 3HSKA 1OAAA 3JD0A 3PQEA 2DLDA 2I99A 4PG4A 4YR9A 1YVEI 2C7GA 3RQSA 1U7TA 3H5AA 1A9ZA 1GUFA 2OHXA 2JD1A 4GLLA 2CVZA 5GZ1A 2PTGA 2D0IA 3OJ0A 2VQ3A 4L73A 4W7HA 3BTSA 2VHVA 4W7IA 3WQQA 2E48A 5GZ3A 2GN4A 2JKVA 3DR3A 4FR5A 4HWKA 4J1NA 2AQKA 4MVJA 3BIOA 2YHIB 4JGBA 4MJLA 4Q3AA 4WLOA 1GYRA 1VJ1A 3QW2A 3KLMX 1X1TA 2CVOA 4AJOA 2HLPA 1ZEJA 3WGQA 1A5ZA 3FBTA 1DFHA 1I3MA 1LQUA 3AJRA 4LCJA 4ND1A 1QYVA 2IEDA 4JNKA 1EVYA 1EEHA 1VJ0A 4XYGA 2FPIA 3WIEA 4JIGA 4FSHA 4CODB 2OO5A 2P9EA 2Q50A 3ST7A 1T2AA 1B26A 2GYYA 4AJJA 1GZ4A 3PHIA 4I5GA 4IBOA 4Q3DA 5JCXA 3OQ6A 3L6EA 4LVUA 1E3SA 2QG4A 1DIAA 2OL4A 5BSGA 3PYXA 4B8WA 4YQYA 3LSYA 4MVJP 3NRCA 2I5PO 3GDGA 3DDNA 5JC1A 4BNJA 4ND2A 1V0JA 2RH8A 4ONEA 4CMHA 1DHTA 3H2ZA 5U9CA 1GZ6A 4MVJE 1E1MA 1ZSNA 2PA3A 4QTZA 4YAGA 4BUCA 2P4HX 1PGNA 4AJIA 1XG5A 1IL0A 2ZB8A 5COAA 3TOXA 2FZWA 3W1VA 3IDSA 4WECA 3WLFA 2PKRA 1B3RA 1QP8A 2AE2A 3TRIA 1EVZA 1QORA 1T4BA 4U5QA 4CR6A 4Z9FA 4CQMB 2PKQP 2PY6A 3OF2A 4CMCA 1PU2A 4A5OA 4I1IA 1DAPA 4DBVO 3GGGA 3VTZA 2OZPA 3VH3A 1EDOA 2DTXA 3C1OA 4PGFA 1RPNA 5BNFA 1RKXA 3RROA 1ENOA 2C5AA 1GADO 4YYZA 5TQVA 1G0OA 3QV1A 4M1QA 3PHGA 1KVRA 3AK4A 1X7GA 1KEUA 2B4QA 5AYVA 3PIDA 1UJMA 1T2EA 3F47A 5CEFA 5F1PA 1GYPA 1I01A 3C8MA 2B0JA 2VUTA 1U5CA 4U0KA 1PS9A 1TA4A 2VYVD 4M89A 2IODA 3EVTA 1DPGA 3EMKA 5AVOA 5TSDA 4X54A 3ZGYA 3QWIA 4HY3A 4CV2A 3GY0A 2YDYA 3LLSA 4UVDA 5BSEA 4CL3A 5H83A 1U5AA 3F9IA 5HBRA 4IDBA 2ZK7A 2NWQA 2VT2A 2BGKA 2VYND 3ONDA 3PHLA 2BFOA 1E3WA 3WFIA 1L7DA 4R1UA 3PQFA 3HN2A 2IYOA 1ISMA 4RZHA 3EVNA 1XDWA 2AEMA 3GN2A 5BT9A 1L1FA 1EFLA 3JQ7B 5L4NA 1BTOA 3LC7O 5C5IA 1KC3A 2CSUA 2G1UA 1O6ZA 3PIIA 3UVEA 1TB4A 4GKBA 3O4RA 4BOYA 2FN7A 1RM3A 2PZJA 3I9MA 1SEVA 5DCUA 1HDXA 1AE1A 1Z75A 2AMFA 4ZQEA 3NDIA 1ZEMA 4F3YA 1WMBA 4K6CA 4RF4A 3WSVA 3BHJA 3D64A 1G1AA 4PVCA 5DNAA 4AJKA 1BVRA 3MTJA 1ADCA 3N74A 4XJSA 3I52A 2ZTVA 4CUKA 2X23A 1QV6A 3AOGA 3M1LA 3VC7A 1PGPA 3NDJA 3RCBA 5JAQA 1YBVA 2VWPA 4E30A 3UUWA 1P1RA 4M55A 3RFTA 2NTNA 4UUNA 1K5HA 2Y1EA 3OIFA 4J9UE 1ENPA 2H63A 2P4QA 2FPPA 5HS4A 5F21A 3WYBA 3E6AA 1NWHA 3RJ9A 4FFMA 3L4BA 1T24A 1XYGA 1FF9A 2VTEA 1NAIA 3DBHB 5IG2A 4BB6A 3CMCO 3E5MA 3WTCA 4O59O 4C7JA 2EJVA 1NPYA 4PRKA 4D0SA 1HYEA 4RZIA 1N8KA 2CD9A 4KWIA 4R69A 1DRUA 4KQWA 2R00C 5JYEA 5BQFA 2QYTA 2VWHA 3INTA 2XOXA 3WGZA 2EP5A 1IPFA 2JCXA 2GO1A 4FD3A 4EGFA 2FR1A 4MP3A 3TF5A 4FGSA 2R2GA 4QFDA 2JFFA 1MXFA 3VPHA 4RJTA 2DBRA 1MFPA 2JD0A 1E7SA 2P68A 3WJ7A 5ITVA 4NHEA 3FN4A 3PWKA 4IDAA 3DBHA 2D59A 2E49A 1JTVA 3ZH2A 2X7HA 1ENZA 3MOIA 2BRUA 2VZ8A 2AQIA 2ZCVA 3FD8A 4A26A 4CMKA 1J0XO 2DKNA 4JX8A 4YJGB 4ZRMA 2G76A 3F1KA 4KDFA 1BXZA 3SC4A 5TLSA 2IZZA 2J5RA 3F4BA 2O7SA 4GX0A 4P8RA 1NFRA 2TMDA 4NJMB 3ZWYA 1HE4A 1N5DA 1W0CA 4EUFA 1VL8A 3GZNA 2Y1DA 4GX5A 4BMSA 1IOLA 1ADBA 4NFSA 1DLIA 1XCBA 1PJBA 4HFJA 4TQGA 3DXFA 4YJHB 3SEFA 3KYDA 3NX4A 4OH1A 3U5TA 4HADA 2FOIA 3DBLB 3UKOA 5A9SA 4DQXA 2PZMA 1JDJA 2PFGA 2QRJA 4QXMA 3KETA 4JQCA 4NH4A 3ABIA 5HM8A 3BZUA 1LLQA 4R9SA 1FDWA 2W98A 4OMUA 1PS0A 1T25A 3FI9A 3SJ7A 1UDBA 4A03A 1DB3A 4HNGA 1E7QA 2EGGA 1OOEA 2PGDA 4TVOA 1NM5A 4NU5A 1Y7TA 4L4XA 2E37A 3TQHA 4D42A 1RYEA 1UDCA 3H6KA 3K8ZA 4ND4A 1H5QA 1YB1A 1N1EA 4GVXA 3R6DA 2WSBA 4NJMA 1QLJA 3GGOA 4ZD6A 4XJTA 1YJQA 2E6UX 4UREA 4HV4A 2HMWA 1X15A 3JYLA 1D7OA 2WDZA 3FPLA 4WCFB 2Y05A 3ANMA 3ROKA 1P0CA 2FR8A 3GGPA 1ZMOA 3BMNB 4BNHA 1CEQA 2AA3A 2G0TA 3P2OA 3KV3O 1YONA 4OAQA 4BNUA 5C3MA 2O3QA 1EZ4A 3BMQB 3G79A 3Q9NA 3ZHZA 1A7AA 4JCOA 5U4QA 3ZWAA 1XU7A 1JLLA 3ZNQA 3RU7A 3IP3A 5TS3A 3ZHYA 2Q46A 2HMUA 4BQPA 2VNSA 5L4LA 3DWFA 4CR7A 3Q6IA 3OA2A 3I9LA 3JQ7A 2ZB7A 3ZDFA 3PWZA 3KBOA 4J7CA 4NI5A 4RVSA 1M2WA 3ZWMA 1MX3A 3WGOA 1VL0A 2GZ3A 2WMDA 5L7WA 1I33A 3RFXA 2D3TA 3IOYA 4U6SA 4WASA 1ZBQA 5JAMA 3SXPA 3ADPA 3GG2A 1C1XA 1GQQA 2P9CA 4J7UA 3M2TA 3GMSA 4RF3A 3D4NA 3OEWA 2B5VA 1F06A 3FRJA 1DIBA 4S1VA 5I8ZA 3HHPA 4FS3A 3OJFA 3ZWVA 3L4BC 5JAIA 1DJNA 2I9PA 2OORA 2HUNA 1HWYA 5I7VA 5ES3A 3NT5A 4CUJA 4G5HA 1BXGB 2EW8A 1JA9A 1SAYA 3U9LA 3BMQA 3TZCA 3AFMA 4M87A 4A2CA 4O63O 3H65A 5G0WA 3VVBA 5BSHA 1J4AA 3C1AA 1YQXA 1LC0A 1Q7CA 3G17A 1DLJA 1NR1A 5DN9A 3PZRA 3JQ9C 3M6IA 3GHYA 1R6DA 3OA0A 5LDGA 3ZWNA 4XGNA 2PZKA 2HDHA 3TZHA 1NVMB 2CDCA 5G4KA 5JCJA 4RPLA 5ER9A 1C1XB 3RUCA 3PLRA 5CG2A 4I5DA 4NQZA 4P4NA 5TJ9A 1R15A 1E6WA 3DHNA 2DBZA 4E5YA 1PJTA 5L45A 5T67A 4CM4A 2O3SA 1PL7A 3KZVA 3FWNA 1E1NA 2VNAA 1XEAA 2CDAA 3QWAA 4RVGA 4JP3A 3VPFA 2GDZA 1SCUA 4XKJA 4L9RA 3PYLA 4NBRA 7MDHA 3LC2O 1FDUA 5JE8A 2HMVA 4K9DA 3FNEA 5A3JA 1ZUD1 1KETA 1ZW1A 4CLRB 4J7XA 5JO0A 4KTTE 3TZKA 2Y66A 3PFWO 1ZNQO 4JJFA 1JKJA 1Y5MA 3JQAA 2Q45A 2QW8A 1OC4A 4PZDA 2OP0A 4LN1A 4DGSA 3O9ZA 5TGDA 2O4UX 3B1KA 1DEHA 5JDCC 1MC5A 5DOZA 4IY1A 3PJDA 4GSKA 1VRWA 1ZXLA 3UAGA 3I83A 5TX7A 3TZQA 5CDSA 1PQUA 1PZHA 3SLGA 4CM9A 2QRLA 3EC7A 4BO9A 1UZNA 3CE6A 3QA9A 2YJZA 1A4IA 5MGBA 1NASA 4EUHA 4OXNA 4DC1A 1JWAB 4ALIA 1GYQA 2EKLA 4PG8A 4WCFC 4YT2A 5JMWA 2O3RA 3STHA 1K2WA 4QECA 3VZSA 1B8UA 1A7KA 2HJSA 4CMBA 4MDHA 1X0XA 4CV0A 1AGNA 4NFHA 4LRSB 1EVIA 3WDSA 1H6DA 1PJSA 4D3FA 4CLOA 3PI7A 2VOEA 1YOVB 2HK8A 3TPCA 4E2YA 4W99A 1MA0A 4IGFA 4YT5A 2IXAA 4YJDA 4NK4A 3V8BA 5J23A 1E3WB 1H0KA 2NM0A 4Q39A 4PCVA 3ASVA 4L4RA 3UCFA 1ARZA 1WZEA 2IXBA 3PTZA 2PH3A 3W4JA 2AG5A 2CFCA 3E82A 4D45A 2DC1A 4J0FA 4YACA 4CM3A 4FC6A 3GG9A 1XSEA 2RBEA 1GEGA 3ENNA 3QWHA 3TN7A 3FF4A 4L74A 1GDHA 8ADHA 2GZ2A 3X2FA 4B4OA 3ROMA 4DUPA 3R1IA 1HE3A 2A4KA 1HT0A 2VHZA 1CDOA 3ZWXA 4BKPA 3IP1A 1LSOA 4Y98A 3HZZA 1PZEA 3M1AA 4OJNA 4YDRA 3G3EA 5DULA 2EGHA 3QE3A 1NX6A 1RJWA 3OHSX 3U3XA 4XDZA 3GPDG 1EQ2A 1E6UA 4HUJA 1P9LA 3V5NA 4D41A 4E4YA 2O2SA 1R4NB 2GNAA 4ALKA 4BNWA 3IC5A 2FPGA 4B3JA 1NFFA 4QUKA 1AXGA 5KJEA 5AQ1A 2XF8A 2XXBA 3EDMA 2O50A 4E21A 3KYDB 4YRDA 1ONOA 3OM9A 4P22A 2HMTA 3SJUA 4BV8A 3S2IA 3DBRA 2UVDA 4CMJA 1I30A 2NNLD 2VWGA 4HKTA 2VWQA 1RM5A 3DMTA 1QMGA 2HKIA 1GV0A 5A9SB 4XB2A 4J1SA 1FK8A 1GTMA 1MGOA 3GVXA 4DWVA 1KIFA 3W8DA 2YHUA 4YXFA 1KC1A 4ALNA 4H3VA 4IQGA 3VPXA 3ZNNA 4OQYA 3SVTA 3ZWBA 1LX6A 5IZ4A 1N2SA 1BSVA 3KSZO 1HDYA 4BO0A 4I9UA 3DOJA 3WGHA 3VKVA 3H9QA 1HZJA 2NVWA 2Z5LA 3LT4A 3U49A 4KP7A 1ZSVA 3D3EA 4WEOA 3C24A 2G82A 3QVSA 3Q3CA 2Q3EA 5F5LA 1DXYA 3AUTA 1I24A 3AM4A 4BNYA 5AOVA 5ITWA 4OXKA 1ZK3A 1YOVA 3JCZA 7ADHA 3AM3A 4CMEC 1A71A 1H6BA 3PGXA 1ADGA 1Y5RA 3WBFA 3COSA 5MDHA 4G65A 3U4DA 4LGVA 5I7FA 1QV7A 3IS3A 4YTEA 2YV2A 1EMDA 1BG6A 2QYSA 3ANLA 5G2OA 4PIVA 3AY6A 1XQ6A 1NFQA 3PJFA 3WR5A 3HJAA 2GN8A 4D46A 3PZBA 4CMIB 3T7CA 1R37A 1IE3A 2V6GA 1C0PA 3K5PA 2AQHA 3JD3A 1HDCA 3C85A 1LXCA 1X7HA 3VH4A 2WYWA 4QQRA 4LSWA 1WDMA 1DO8A 1R16A 3BA1A 3G1UA 1XELA 3ZWOA 5I7EA 1XHLA 1MFZA 3GFGA 3ZW8A 3VZPA 3GVHA 3GOHA 2HK9A 4JJGA 4B79A 2X9VA 4FC7A 1BHSA 5T8KA 5B4VA 1MUUA 1U3TA 1ZJZA 4IDGA 2H5LA 2JHGA 5ADHA 4I08A 4AJ4A 4D0RA 4GI2A 2X9NA 3OQ1A 1GY8A 3RC1A 1BXKA 1TT5B 3I6IA 4IZIA 4EBFA 2DU8A 4FFLA 2I67A 4IDDA 4Z3DA 5TT1A 3U09A 4HX5A 1Z45A 4PG5A 2DPGA 1LDGA 4PG6A 4AJ1A 3JQBC 1JW9B 1XIVA 1P1KA 1C1DB 3TDKA 2PR2A 5IZCA 1HDZA 1N1GA 2O23A 1IZ0A 3KSUA 3ZV4A 5C7OO 4WOKA 2ZKLA 1UR5A 3DFZA 5H82A 4BGVA 1ZK1A 5CEJA 4BNZA 4J16A 5KCZA 4CV1A 1I2BA 4IXWA 4A27A 4FOOA 5IDYA 3RBXA 2WEKA 5KJCA 4OL9A 4K6FA 1ZKMA 4B4WA 5A9TA 4URFA 1ZCJA 4DL9A 4O0LA 3UCXA 3Q9UA 3SC6A 3F46A 2F1KA 2WD8A 3DZFA 4PLCA 1H6AA 4HBGA 4R3NA 3WNVA 5JY6A 3DMTC 1G6KA 4XIJA 3WYCA 2C29D 5A3VA 2FSVA 2QRKA 1PL6A 5I9MA 2EWMA 2O3TA 1K0UA 3NGLA 2JFGA 4BNXA 1B7GO 1NVTA 1P1HA 3I9OA 2ZQZA 1PEDA 3PJEA 2PZLA 4YJFB 3AU9A 2Y1FA 4ID9A 2J8ZA 4OHUA 5JMPA 1I2CA 1TI7A 3WGGA 1J5PA 3KYCA 3LT0A 4II3A 1QYXA 1Y8RA 2QZ9A 5EN4A 1GAEO 1E1KA 2PWZA 1DC6A 4GVLA 4EDFA 4OGWA 1HYHA 3BAZA 3R3JA 1P74A 3RAJA 2B5WA 2YQ4A 2OFPA 1KVTA 2ZCUA 4CLHA 3I1JA 3EK2A 4DBZA 4BKUA 2J3IA 3GQVA 3NTQA 1EUCA 2POQX 3PJGA 2BD0A 1PTJA 3JQCA 4GSLA 2PGLA 4R68A 1Y81A 3DB2A 3PHJA 4NJOA 4OOEA 4L75A 3KEOA 5DT9A 4MINA 3MJVA 5CFZA 2HO5A 5BR7A 2X0RA 4KZPA 3HFGA 2J5KA 5F1KA 3QY9A 1ZFNA 4FPXA 3RBVA 4E5KA 2I3GA 4UULA 1A27A 3LYLA 3ZN2A 3JQFA 4KTVE 1DAOA 4FGWA 5KKCA 3DQPA 1W4ZA 4WLEA 3QWFA 5CDUA 1HDGO 4B3IA 1P1FA 2GF2A 1FDSA 4JN6B 1PJ4A 3TJRA 3ROPA 3NV9A 1OBFO 3PLNA 3MZ0A 2X58A 3A28A 3INRA 4BGIA 4A7PA 1PWXA 1Y8RB 1YL5A 2RHRA 4TZTA 2OMEA 2YW9A 2A35A 5L53A 1NP3A 3QVTA 4NNJA 4UVHA 5L40A 3WTBA 4MVJG 2ZATA 1NBOA 1SMKA 2GASA 1TT7A 2Y93A 4JK3A 1E3IA 3H2SA 3DZGA 1KERA 3BTUA 3INGA 2VOJA 1X0VA 2GRAA 5KJ6A 3IKTA 1ULUA 1DHRA 3GN1A 2Q4EA 4B4VA 1HL3A 3MJSA 2OBNA 4OSPA 4AJLA 1HXHA 3WFJA 3F6YA 2A9FA 1V3UA 4UEOA 4XEHA 1BDMA 2GGSA 3DTYA 1QR6A 2Q1SA 3O38A 3VDRA 4LSMA 3SX2A 4BO2A 2AEJA 4EYEA 2Y0CA 4BGUA 4XD2A 1NHGA 4KUHA 1DIHA 2Q2WA 3RUHA 1EBUA 4BGEA 1PJ3A 3FNHA 5EQDA 2G5CA 1YH3A 5JDIA 1VLLA 2B37A 3HADA 4A10A 4QO7A 2B35A 1LUAA 1EUZA 1DFIA 3FR7A 5IXSA 3WGTA 2ZIZA 3WG9A 2YFHA 2X22A 4DVJA 4MKZA 3GUYA 1UP6A 3QWBA 1V8BA 2LDBA 3Q2KA 4ILKA 4O5OA 5ICSA 2F00A 1Z7BA 1EE9A 3PYMA 1TLTA 4JBIA 2X0NA 1ONPA 2LDXA 3BMCA 4B3HA 1W6UA 4LCEA 1DIGA 4QFCA 4A73A 1BDBA 4YAKA 3RU9A 4J49A 5L51A 4YVFA 2Z1MA 3KRTA 2AHRA 1V9LA 2JL1A 5TC4A 3ADOA 1YO6A 2PD6A 1L7EA 3KB6A 1WP4A 3AUSA 1O0SA 4IM7A 1LTHR 2WD7B 3H9EO 4FIZA 1PS8A 2BLLA 4UEJA 2FP4A 2VHWA 4CL8A 1LNQA 1I3LA 5T64A 1K3TA 4TSKA 3H7AA 1QXSA 1WZIA 4MOWA 1SOVA 4DPMA 3D3WA 2V6BA 4MKRA 2C7VA 2IDZA 1DIRA 1CYDA 3V2UA 3W4IA 3E48A 4E6PA 4B7UA 5K6AA 1EK6A 3IUPA 4TWRA 4ZJUA 4LK3A 1I10A 1KBZA 4PLYA 4OO3A 3D4PA 1E5LA 3OMLA 4P4GA 3QVOA 5THKA 5IZCC 3KYCB 4R1NA 1SC6A 1M67A 1HSZA 3GC6A 4OOFA 1QYDA 4OM8A 2X6TA 4P4LA 1QG6A 3CTMA 4UUOA 1O94A 1Q2XA 3DAGA 4QEDA 2V6FA 5AXAA 5EINA 4RQTA 4DREA 5KVVA 3ZNOA 2FR0A 4IQ8A 5JCJD 4XQEA 3WQSB 5I9LA 4XQ9A 2V65A 4KMSA 1F12A 1YGYA 4PLGA 4WNIA 3D1LA 5LC1A 3MJTA 3JQAB 4NBUA 2B69A 4YCAA 3DEYX 4AICA 4B7CA 3HDHA 3EY4A 4WLUA 1PQPA 4K28A 3NAQA 1GU7A 2H1SA 4GX1A 1WMAA 4KDEA 3GNQA 4E33A 1HSOA 1A9YA 3O26A 4ITUA 2OBYA 2NVUB 4PLTA 1V35A 3ROQA 5IDQA 1JKFA 1V3VA 2D5CA 3HNPA 4J2OA 4XDYA 3S8MA 4NZ9A 1HETA 2CF5A 3JQEA 2HU2A 4BKRA 1E7RA 1P44A 4N5LA 1EDZA 4JBGA 4L76A 1O9BA 2I76A 2P5UA 2I66A 1VL6A 4E12A 4NDNE 5G0SA 3BMCB 5IDXA 1B14A 2IRWA 1SO8A 3I5MA 1HE2A 1PWZA 1UXIA 4XR9A 4DC0A 4E2WA 1QYWA 1AN9A 1IY8A 4D79A 4M8SA 3EHEA 3WSWA 4AJHA 2J3KA 4Y67A 3FPCA 3ZU2A 4BHTA 5T6BA 3ZHXA 4XYLA 1E3LA 2TMGA 4DYDA 4E2XA 2ET6A 2ZTUA 4WE3A 5TT0A 3CKYA 4MIEA 3MOGA 4C7KA 4BNFA 1VC2A 3L6DA 1HRDA 4MVJF 3HN7A 5EESA 3R0IA 5C37A 3RI3A 4RPKA 4D43A 1EBFA 2JAHA 4TVBA 1C0LA 4XIYA 4BNTA 2W2KA 2JCVA 1PX0A 4E32A 3ZHBA 2P2SA 1KY5A 2X86A 5DF1A 2JCYA 5FYDA 4TKMA 5KNLA 5HS6A 1CWUA 4BO4A 2ZB3A 2FZEA 1XU9A 1KVQA 5COQA 2PNFA 4DPKA 3IQDB 3RUEA 4HFMA 5T5QA 1IHXA 3DOCA 3EAGA 3PVZA 3RWBA 5K9ZA 6ADHA 2NU8A 2EG9A 2GPTA 9LDBA 4YEDA 3K92A 3G0OA 4JP2A 1LBEA 3FCOA 4G81A 3RC2A 5LCXA 4TRMA 1A4UA 1E1LA 1N7HA 4Z9YA 4FJ2A 1VKOA 4DIOA 1IULA 4RVHA 3EYWA 1YJ8A 4F6CA 1E3EA 1AXEA 2ZB4A 1U1IA 4FFNA 4RF2A 5G0TA 5B37A 3U4CA 4B4UA 3MJEA 2DVMA 3X2EA 2Q2QA 3QRWA 4CM1A 2Y99A 4L0QA 4Z6KA 2NU6A 5JW6A 4GLOA 5COBA 1T1RA 3PDJA 4F45A 1P33A 1RM4A 3UXYA 4BO6A 3DHEA 4H16A 3UOGA 4RDIA 3IMFA 3FNGA 4DMLA 3AOEA 1EFKA 1YDWA 4GMGA 1FXSA 4QO8A 1YQDA 4ZRNA 4CLOB 1B8VA 1GD1O 1NQAO 2YZ7A 4UVGA 3RC7A 4N18A 3S1LA 5HRUA 4KOAA 1GUYA 4JBHA 4U0JA 3Q1LA 4NMHA 1LDBA 1R0SA 4YRBA 3NTRA 1M66A 1WWKA 4JJIA 1UXJA 4GMFA 2CF6A 1BRMA 3ZU3A 2UV8A 3EGOA 1IB6A 4YB8A 1MXHA 3BTOA 2H9IA 4BNKA 3I3OA 1Z73A 1VPDA 5IN5A 1R4MA 5IDWA 3AWDA 1ISJA 3U4HA 1LU9A 1SNYA 4WOJA 1T26A 2B4RO 4ESOA 2IEBA 1Z74A 1GCOA 1HLDA 4AJEA 2H6EA 2P5YA 4UEKA 4YJHA 1KOLA 3RUDA 1X13A 3KXDA 5DP1A 4ZU3A 2W2KB 2Y1GA 4FJ0A 5A4DA 4INAA 1C14A 1WLYA 1GQ2A 3B70A 3GLQA 1YE3A 4GWGA 1U8XX 3BTVA 4MPDA 3GZNB 4AJPA 5ICMA 1GV1A 3K2BA 3P5SA 3P2YA 4IDEA 4J4BA 1XQ1A 2VRCD 3AUUA 4E3ZA 1DRWA 2BMAA 1AHIA 5ILGA 2FSSA 2XAAA 4I9NA 2X0JA 3H9GA 3RKRA 2HSDA 3GRKA 4L8VA 5C7LO 2VCYA 3MEQA 3P19A 3JQ6A 2YUTA 3PP8A 2ZYDA 1ZIDA 4KUGA 2C54A 4BVAA 2CVQA 5ENDA 3BMOB 4EW6A 1P45A 1MV8A 2CMDA 3CUKA 5DDIP 4DQUA 2Q99A 3RFVA 3AI1A 4Y9DA 1NQTA 3OBBA 4AG3A 1V3TA 4PN3A 3V2GA 5C7IO 1GZ3A 5L7TA 6LDHA 3OH8A 2Q1TA 3FBGA 4J1TA 1IHYA 3CZMA 4M49A 2B36A 4TRNA 2NU7A 1FJHA 4R41A 2PLAA 1LQTA 1OC2A 1ISFA 4N54A 1NAHA 1WDLA 3HG7A 2I3AA 4S3MA 1CETA 1C3VA 4YJGA 1LRLA 1KY4A 1VI2A 1MP0A 2ILTA 4D7AA 4Q3BA 3GEDA 1BVUA 4NBWA 1PJLA 4DTIA 3CXRA 4PG7A 3JYOA 4GX2A 1EE2A 5JFOA 1EQUA 3WS7A 5F3RA 3WOHA 2RHCA 3A1NA 1JN0A 4OSOA 3QP9A 1ID1A 2YDXA 5A03A 1K6IA 3I9NA 2VUSA 3TSCA 1YL6A 2EW2A 3WX0A 2WYVA 2WE8A 1XLTA 3WWZA 3I23A 4BO1A 3LZ6A 4F6LA 5EQFA 4FFOA 2BF7A 5AXCA 3P7MA 4FJ1A 4XWYA 1LLCA 3TFQA 1BW9A 2EP7A 2PH5A 3NT2A 2D8AA 4TKLA 1T2CA 3UGKA 1HEUA 4LW8A 5A04A 2E4AA 5G4LA 4NR0A 4JROA 4UVEA 3NEPX 4LVCA 3T4EA 5B1YA 2YHIA 3NJ4A 1PJCA 3CH6A 3OIDA 1NPDA 4E5NA 2V6MA 3GEMA 4XYMA 2UUPA 4PLHA 3AY7A 3GDOA 3WBBA 1F0YA 2FMUA 3OSUA 1Q1NA 2R6JA 4R1SA 2QHXA 3GRPA 3ETEA 4NFYA 1SB9A 4RPJA 2J6IA 5G0UA 1DJQA 4EUEA 5DBIA 3CSDA 3WIDA 3DMYA 4MIOA 4OKIA 1JQBA 3NTOA 1WVGA 2ZQYA 3MJ4A 3GFBA 2OXIA 1YQGA 5KTKA 1U28A 3E03A 4YAEA 3ZWCA 5GY7A 4LMPA 3BXXA 2VRCA 2EIHA 2J3HA 5TRTA 3V2HA 4BIIA 4BNIA 5A1TA 4N7RA 3KLPX 4WLFA 4AFNA 3C7CB 5IN4A 3QJ5A 4BNLA 4DLAA 3WMWA 2Z1NA 1UXGA 4BO7A 3F5QA 2GSDA 1SPXA
chains in the Genus database with same CATH superfamily
1QH0A 3AIIA 1D6NA 1JVSA 1K97A 3HYSA 2VK1A 4FN4A 3CPHA 3VC1A 2ECQA 3ZCSA 4EGSA 3NO4A 1ESNA 2NACA 3MTQA 4RIIA 3M9XA 2RD2A 2C4KA 5HF6A 2PWPA 4KAAA 3CIFA 4A0SA 3KKOA 2H08A 4RZQA 4CM8B 2KLHA 3BKXA 4MVJM 1ESDA 3QOYA 2VDJA 4TN5A 2W43A 5KC9A 4LFAB 3K9WA 3QTTA 4MIKA 4IHQA 1ZH8A 4YUXA 5ALWA 5JYDA 1WTCA 5AW4A 1OROA 4AIIA 1K7FB 1Q7RA 1QGYA 1QKIA 1SCQA 1NVFA 5K0ZA 5T7BA 4EKEA 2PIDA 3IT2A 1IH8A 1Y1TA 4L3OA 1DOHA 4QWWA 2FEOA 3T4XA 3AWIA 5IM5A 2D8MA 1JT2A 2CE2X 2TRSB 3P9IA 3IAHA 1KK3A 3JAWB 3B1VA 2FJPA 2PKQO 3ZI7A 4G0XA 3P4UA 1J1UA 3A4TA 1PJ2A 4DIFA 4LEIA 4W9NC 4PZLA 1RZUA 4X45A 1RHRA 4EA6A 4MVJI 2VHJA 2A5LA 3LDUA 3U1TA 1ZH0A 2KM1A 1VE9A 1MG5A 2UZ3A 3OEEA 4JUAA 4YAFA 5KYTA 2NTJA 3DDSA 5KHAA 1NPTO 2HCTA 1N4DA 3ZU5A 4X66B 1SVWA 3Q7TA 2AXPA 3MMXA 3U2QA 2O06A 3TAUA 1FW6A 1CR2A 2ZE7A 1ISSA 2X9LA 4OX9Y 3E9NA 3WLSA 4PZ9A 3OZTA 2P91A 1TTQB 3BWYA 2FAXA 1TF7A 2XNKA 4U6QA 4LX0A 1LC3A 2RHBA 3QOWA 1GEEA 3GVCA 1SXJE 1XVAA 1WSAA 3EGXB 1P3Y1 3K9GA 1SXJD 1X1EA 3CUVA 4PAQA 4PSVA 2G9NA 2QXTA 2J6HA 3JQAD 4IJWA 3ORYA 2O8NA 2GD0A 1WUHS 2J7PA 2WUVA 5BQPA 4AJOA 4EGCB 4RTMA 3Q8MA 3ANSA 1LK0A 1X1AA 2XXJA 4N5IX 1QHXA 4OYRA 1I8TA 5B3KA 2EJUA 3U6KA 1HT2E 3REOA 1K68A 4EBBA 2RG7A 4LJ5A 1IHDA 3PNVA 3FZEA 2I54A 1WZ2A 2DQSA 4L2IA 3FYCA 3HVIA 2UUBB 1I2AA 2BKVA 4PPNA 5B36A 1KY3A 2BZ0A 3HP7A 4DDTA 4EKIA 1MJGA 3SVZA 3K96A 3FR8A 5DNEA 3L5OA 2QVXX 1VSUA 3C7DB 3QPBA 5JNUA 3KXIA 4M36A 3UJ3X 4YT4A 5IFLA 3VKUA 3RT7A 2WYIA 3KL4A 4ZOLA 1YSCA 2C7RA 3C3WA 1RWQA 3E05A 1NRWA 3S27A 2RHWA 2QGZA 2DQZA 2O7VA 2Q3MA 3GNSA 1A2BA 3TW6A 1VJRA 4IPTA 2Z6VA 2WTEA 2XTAA 4OJQA 4OIFA 4M0PA 4TV8B 4DLWA 1Y1PA 2AVDA 4NBKA 5L9AA 1L5OA 2CK3A 1DKUA 3PXXA 1D7AA 4EWLA 1CY7A 2HRQA 1JS1X 4R9RA 4RENA 3FSRA 5GMOA 2JGDB 1RRCA 4OI0A 3K0CC 1J49A 3GJZA 3O8QA 4AX8A 3T61A 1Q19A 3K1TA 2XGGA 1QR2A 2G9UA 1ZVJA 3EGXA 4QASA 4YPOA 3EPLA 4JI4B 4UDXX 5ESRA 3T7RA 1TM5E 4Y2JA 4RKQA 1PK7A 2VP3A 4LXUA 4ZDIA 1W1WA 3PHHA 2NTEA 1ISIA 5E4TA 2YJ4A 5CBPA 1JSCA 3H1EA 4H2DA 4EJSC 1IXYA 2P5SA 3W8FA 2GJ4A 2B3DA 1WJGA 5K3SA 3JX9A 1TOAA 2E4XA 3GQBA 1VJ5A 2FZVA 1UZMA 4KV9A 3HO1A 4IEFB 3AOEC 2W4MA 1FPQA 5EAIA 4YCSA 2PWAA 4ZZ2A 2WM3A 3HCRA 3U17A 1Z82A 2JHFA 2ZRAA 3JQFC 1PZGA 2VZ9A 3S2FA 3SE0A 1UBOS 2JJ1A 4ZHSA 5KPDA 1NF9A 2NTYC 2GAAA 3K5HA 4BNNA 3RIHA 1KTIA 4C7XA 3IQIX 2O1WA 2AV6A 3QQPA 5E7IA 3QK7A 4K88A 1MEJA 3UYLA 4MR8A 1W5AA 2B20A 2Q0SA 2PU7A 2IF0A 2JFVA 2CFRA 2ZSAA 3GIWA 4RA9A 2RE8A 4WUVA 1LA2A 2PN1A 2ZIWB 2DQ4A 3A3KA 4O1MA 5AW1A 1GARA 1ZZEA 1W4AA 2BFNA 4MICA 3NKLA 2R47A 4HUQB 4NIMA 1V9CA 4GKKB 3VR3D 2E5LB 5B1EA 1J1ZA 2XA2A 1Y8QA 4M1MA 5FR1A 1U2SA 2Y1LA 2CDNA 2PX5A 4KAFA 4JLDA 4NK5A 4I50B 2R25B 1JQJC 1JIKA 2FUG6 3A4NA 3PUIA 4Q1AA 4WLNA 2BI8A 1VHDA 4F7DA 4ZIRA 3FA2A 1KPHA 1P19A 4K7JA 2OYRA 1GTJ1 4A2WA 2HRCA 4DIKA 2VYVA 3PRYA 2NUTB 3PIRA 4KFUA 5DJ5A 5BNWA 4MGEA 4WNAA 1B6RA 1WE2A 1U1GA 1R4AA 2P75A 2G4LA 3U0BA 2PMDA 4AL4A 3OTOB 4ZEWA 4X3CA 5EXSA 1GPLA 2CCJA 3IDAA 1TQ2A 4KR0A 3W6NA 1ODFA 2AC7A 2X8LA 5A3SA 2E6KA 3CW9A 4N5DA 4QTTB 1G3QA 4EJ6A 3DMGA 4N5HX 1V6AA 3UMCA 3S1AA 2ZYVX 5LP1A 1EESA 3JQQA 1GRNA 4LZAA 4RHUA 1S7GA 3FPFA 4EG1A 3CH5A 2BELA 4FBLA 4DANA 2FQYA 2XSZD 2B2NA 4UTXA 2V7XA 5A5FA 2CL0X 5FWDA 5IDVA 3R5SA 1T5TA 5ISMA 2A1TS 2ZRPA 4GOLD 3BERA 1IYZA 1Z07A 1VFNA 2BAGA 2YHSA 1FX1A 5AQEA 4ZT6A 3WQRA 7GPBA 1PT9A 2NNWB 3FH0A 1V8FA 2HSGA 2H52A 4AZSA 3LXXA 3DBVO 3L0DA 1VLZA 1WCXA 3DAPA 1O3YA 4NYMR 4X6YA 4N0PA 5I8WA 2RGCA 2JGNA 1W49A 3B13B 3AB8A 4E7PA 1J8MF 2NVBA 2IEAA 4KLNA 4R3WA 1T0JB 3AC0A 1ULBA 2CN1A 2OFFA 4JYPA 1R6VA 3KUUA 1TC1A 2I29A 5K0LA 3ZLVA 4AJ2A 4UAUA 2IZ0A 4E1AA 4NCIA 5JD4A 3WLQA 3MAAC 4WGFA 3KU1A 3W2HA 4BPBA 1RHQA 1KQ3A 1OMOA 4PCUA 5D5HA 2RHHA 1JDBB 1M1ZA 2DBQA 3O47A 3DT6A 4I8DA 1TKCA 4ZT4A 5G1NA 2WIAA 4MKIA 3IXQA 1UP4A 1X7DA 4G6ZA 4O4JF 3VU3A 4ARBA 3U4IA 5CFMA 2E87A 1QH9A 3HJHA 3NXKA 3BGIA 4KLRA 5MN5A 3RYHA 2EJWA 3UGQA 3JAMA 1GAQA 1YRLA 4I4TA 3VI4B 4G1CA 2ZR8A 3FCSB 3GRYA 2WVJA 2OHHA 4ZXFA 3MRVA 2W83A 1DJMA 2BCEA 2WDPA 3PPIA 4Q3EA 3ZK7A 3HCOA 4XPIB 1E2GA 1LB1B 1QGUB 1Z17A 2VNIA 2XX3A 1BDJA 3SXUA 3AFGA 3BGVA 4EZBA 1X9GA 1XAHA 2WKQA 3IVAA 1SY7A 3GAZA 2XTJA 1KJNA 3ELUA 2C5HA 2Q62A 3L7NA 1IXKA 2DQKA 5EE9A 3GXBA 1CULC 1GTL1 3IQEA 3MAGA 3BJMA 3QPAA 1PL8A 1W5SA 3B8HA 3OECA 2P69A 1FRNA 4GEKA 5I5GA 3T1VA 4BKOA 1MO6A 3LQKA 3FPBA 3RIXA 1L5FA 4RWZA 1OLXA 3D6NB 4WXEA 4IMRA 4L0DA 4GYKA 5EPOA 5TQ2B 4TTVA 5D84A 2HIAA 5DOVA 2ATIA 3AIMA 3HY3A 5DBFA 3UHAA 3ZHUA 3L04A 2L2QA 4ZMRA 4DUGD 4ENPA 5JJLA 4MV7A 4EYOA 1ECFA 5ICGA 3VU1A 4R8MA 2HK7A 3DL2A 3GZJA 3IJPA 3QKSB 3RVQA 3RFUA 2R5FA 3ZHRA 4EAAA 4ZQHA 4AVYA 9MHTA 5HRAA 5JSUA 3FDZB 1LBQA 3FROA 3GMDA 2BHTA 3B1JA 1I5RA 3NBKA 1N2OA 4PSAA 4BMVA 4LRYA 3T7SA 1XF1A 4D9GA 4EJ0A 4ESHA 2LKDA 2OHOA 7ABPA 3CC8A 1ISPA 1MC4A 2FJ0A 1I3KA 5TPZD 3KSBC 4L57A 3SM9A 3C3YA 1CQIA 3H9JA 1VLMA 3FWPA 3BDAA 2C00A 4LI0A 4JI7B 2HAEA 4Q3NA 1XTSA 4O8ZA 3PFCA 4YH1A 1V8DA 2Q9UA 1FLAA 4V1CI 2IW3A 2XOKA 3FHLA 5M5BA 1LRJA 1JG7A 1D2MA 5G0VA 3W90A 2BTEA 3STUA 2VHYA 1PEKE 5BUQA 1L3CA 2I62A 2W90A 3KU4A 3L79A 4D3SA 1QUFA 3KS9A 5FWYB 3LQ2A 4MITA 3UWOA 3EXEB 4WBNA 3T35A 3JZAA 4IHJB 3H13A 2DR0A 5JC8A 4E5VA 4KODA 3HDJA 1GR0A 3C6KA 2BFPA 1HOTA 4F71A 1WXFA 3TTTA 4DLYA 2HRZA 1YASA 3W06A 3PC8C 2VP4A 4OQFA 1EVEA 1TMGE 4P81A 4PXAA 1NV8A 2XRYA 5FEUA 2X5OA 1LJ8A 4RHXA 3I2YX 1B15A 3IBTA 4NFLA 1C7FA 2QVCA 5DZSA 5C0OE 4DA0A 5GINE 2VT3A 4G8BA 1XCPA 2QLMA 1FW8A 3AI2A 4EG6A 5JNLA 3A6GA 4PY2A 3IOCA 1WB4A 2H9AA 3K31A 4Q3OA 3JYQA 4QJIA 3JD4A 5DX8A 1GGVA 1Z0DA 2C4WA 3OIVA 4QL3A 4R2KA 2I78A 3IO3A 4YP0A 3SX0A 3K8QA 1K4YA 1KA9H 2O1EA 3M1YA 1JZSA 3F2VA 4IXDA 4WZBB 3T99A 5B4TA 2IWHA 3B60A 1F2VA 5KWSA 4MUXA 3JD2A 3B1XA 4LOHA 3F7MA 3EW7A 3DTVD 2X4GA 1IJKA 3LFUA 4IX9A 2SCUA 4OQ4A 1PG5A 2J0UB 4NY1A 4RH1A 4RE5A 3DNPA 3D3QA 5CLFA 2GARA 4ZPJA 3RYIA 2PIAA 4RSMA 2B6NA 4D9BA 3K9QO 4F86A 1QGZA 2CNWA 2R8YA 4MPTA 4KK4A 2ZYWX 1K63A 2C2WA 2R11A 2WJ6A 3QSGA 1HH4A 5KX5F 1U0NA 2X0IA 4DLLA 5E7JA 2JFHA 2FX3A 3OIGA 5L3SB 1JKIA 2YXEA 3UWDA 2OP1A 4MRSA 4RYLA 2Q7OE 2I6SA 1TK3A 1RWVA 3D4LA 3KQVA 5JWRA 3D2LA 2F3PA 3EGWA 2AMVA 4F4UA 3RVDA 1KFBB 5HIMA 1C4WA 3J7AC 2ENUA 4ZAFA 1B0ZA 2PS9A 3DVAA 3V7UA 3U1BA 4TTSA 1ATZA 5IK2D 2I87A 4RD2A 4BFLA 1TTHA 2ZZNA 5JCZA 3LFTA 2C7BA 2OEPA 2PT7A 3OZGA 4XB6B 1V5IA 3GV0A 4X7RA 3I8OA 1B16A 3KWJA 1E2JA 5EP4A 2XEXA 1NYLA 1S2DA 2G09A 2XGMA 3DE2X 3M3PA 3L8YA 1DNPA 2W2NA 4HJXA 4QBIA 5DHPA 5EMHA 4LQDA 4AF6A 4HPJB 1VE1A 2L69A 4JUFA 4S1PA 3UPUA 4RY0A 1VPWA 4KWCA 1TFUA 4DRXA 4YY3B 3QELA 3H2YA 2A4MA 3GPBA 1XZEA 3KZXA 3D0OA 3KR0A 5H70A 4QGAA 4FX2A 1NUTA 3BJRA 3PEWA 3NMUF 5B2EA 5F3WB 3VTFA 1P17A 2GCNA 3P9NA 3F9RA 2FHSA 4QDXA 3UY4A 1ZK0A 4C78A 3GAFA 4KQ1A 5B1SA 1J90A 2A86A 4JLWA 5JVDF 4XUEA 4RTJA 1TTTA 3CRVA 5EJ4A 1Z7EA 3E15A 5AK4A 4YREA 3DZIA 4BBJA 2NW6A 2FX5A 1DC3A 4HGRA 1IFXA 1M7BA 1JAXA 1DDIA 1E5XA 1S7CA 4JVSB 4NVRA 4P36A 4BX0A 3AVUA 4FW8A 2DAPA 1Z0ZA 1UDWA 1FZQA 1HMPA 1OSNA 1V71A 3O2SB 1QJ4A 1G0NA 3HVJA 4S1TA 3WXBA 1S8OA 3BDVA 3CNHA 3ZLJA 5H1YA 3JALA 1J21A 4S0ZA 5ALDA 1SCNE 5KVCA 3KSAC 2OB1A 3L8MA 2ZEJA 5LP6C 5SY9A 3OT1A 4WXHA 2ZJBA 3P94A 1IN7A 1YRWA 3UT6A 4CQMD 1D4AA 3UGJA 5J2TB 4TL6A 3AEUA 3QOFA 5ULLA 5JAZA 5EXPA 1GXSB 3A31A 2P9YA 4NOJA 4OQNA 5LQMA 4HQ0A 4YUYA 4Q5IA 4R1TA 4CM7A 1Z8HA 3A27A 3AP1A 1L7XA 4I8XA 2LNDA 1JJAA 3TLBA 3KKLA 4G36A 3JRWA 4M9UA 2CY0A 2EHDA 4YASA 2YV4A 4OHCA 4UCXA 5KJFA 4RF5A 5LU8A 3G2KA 3JAKA 2PUVA 2PGJA 3BE5A 4B7XA 4V38A 1P4HA 2WB2A 2WG2A 4AY4A 3B1FA 1VSVA 2CLDX 3LX8A 4N82A 5HCIA 3GEPA 4ZO6A 1VECA 4OHZA 1J0EA 1MR3F 4H1WA 3HUDA 3IOMA 4J4TA 4L95C 4NAUA 2R4QA 4KQ9A 3JARA 1N5IA 3RC9A 3TR6A 3WL3A 4L5JA 4EB8A 2KE5A 3FWZA 4PC3A 1IXZA 1ITZA 1JDBC 1UPCA 1V11A 1MPXA 2O14A 2G67A 3QJGA 4R7TA 4U2GA 1XXLA 1KQGA 2ZRDA 3PQ3A 3KT3A 3M3DA 2QMOA 3SHTA 5DLDA 1JILA 2Y0EA 5JY1A 3V2IA 1ZSYA 4OQPA 1GGFA 2AI3A 5T4FA 4C5CA 4CM8A 1LBTA 3SMVA 2CXSA 1KKUA 2JW5A 4XSVA 2NZWA 3UAWA 1XDGA 3D5TA 3JQBA 4LBVA 4AMYA 2OWDA 2NU9A 3HL0A 2NO7A 2EV9A 3PRJA 3EPJA 4BL5A 1GRCA 1M7GA 4RFVA 2VLIA 1D2NA 1XTVA 3OESA 4XOUA 4E0BA 3OFJA 4W82A 3BREA 3WAKA 1M6HA 4QQFA 5F1YA 4IKEA 2VYNA 2EF1A 4Z0NA 2BEVA 4I6JA 3F0TA 2EG5A 3ZU4A 5I51A 1FFHA 5KAMA 4M60A 5CBKA 1AGXA 1USVA 4WN3A 2JIZA 3R5XA 1EWKA 3RTBA 2EDAA 2QQEA 4BVBA 4C08A 4EDHA 5BMOA 5F7XA 1PR3A 3EMVA 1H9AA 1TQHA 3K0AB 3UENA 2QG6A 2JIMA 2XQVA 1WOYA 1DOAA 1KVSA 3GELA 4RHTA 3UXEA 3R76A 4D02A 1JIIA 1L5KA 4DLPA 2RCYA 2VYQA 4EO9A 3U19A 1S6YA 1Q7BA 2Z4RA 3WKCA 3E5HA 3TLZA 4Y2SA 2JEZA 2P8JA 3LT2A 4P4UA 3AEZA 3Q5GA 4OXYA 2IEYA 4XDHA 1QS0A 3UIEA 5DYYA 1CJVC 3OICA 3GJSA 1QQBA 2GD1O 4LWQA 1RXEA 1T8UA 2QUBA 4XUGB 1PAUA 5HKBA 1FEZA 2XZPA 2YZKA 4K1LA 4F3CA 1J7JA 3L7IA 4BNMA 1K7YA 2R68A 1CYEA 4OBWA 2B1QA 5AI6A 1LSUA 3SR3A 2FMHA 2HL6A 1SHKA 3E7DA 1A72A 1Q16A 1Z4PX 2W5UA 3GAMA 4HB3A 4JS0A 1SOWA 5BSTA 3I01M 4BJ3A 1PK8A 4ND5A 4V02A 2UUCB 1XC7A 3P9CA 5J5AA 3VNVA 2X5KO 2ZPTX 3F8SA 2J3QA 3FDZA 4BQNA 1GL6A 2JBWA 2XMQA 3EUWA 3PNOA 4YT8A 3IVCA 3UT5B 2F55A 3I9JA 4P0PB 4GI5A 4HXFB 3RVSA 4WADA 4GXTA 4ALLA 3D54D 3WBKA 2JVIA 3BSSA 1VJTA 4HGZA 3S7TA 3TE6A 4KAJA 2RI6A 3IJRA 4D82A 4KQXA 1H9BA 4L5IA 2AF4C 2FVYA 8MHTA 3W6ZA 3KQLA 2J32A 1EFVA 4XI9A 1Q7TA 1R12A 3SQWA 2QORA 1W73A 2X15A 4KO3S 5HGJA 4G2NA 3E9RA 3SYMA 8LDHA 2QMZA 2OWEA 2VNKA 3O74A 3AJ8A 3B20A 1I4DD 2B8TA 3GZTB 4MTCA 4TTTS 1PX2A 1T3LA 3EGEA 5JQGF 5IMSA 3AI3A 4WOBA 4XWWA 1ZD4A 1LK7A 1NTRA 3RVOA 4XX0A 1RQLA 2HNKA 3DO6A 3DVRX 2VHTA 4MV6A 5CDFA 3HWWA 5FBHA 4GC9A 2C4VA 2WU0A 3HCCA 3OCVA 1YNOA 4F46A 3UTDA 5BT8A 2FX2A 2QEQA 3CGGA 1M6NA 2P67A 3RASA 2Q6TA 5BURA 1F2UB 1XQYA 2A3NA 2HSZA 4HAIA 4AC9A 1ZVMA 1K6JA 2R00A 1CS0B 1US8A 2WF7A 4UUAA 4HP8A 1TKAA 1UBLS 2R8BA 5J1TB 5A0FA 4UUPA 5FI5A 3Q2IA 1BQ3A 3BAFA 4G5QA 4UBJA 1M6VB 3CISA 1NBIA 5AM2A 3DS8A 3DZKA 3ON5A 1VBKA 1XDZA 4C7OB 4WJLA 3GUVA 3JS5A 4LJ6A 2ATEA 1M34A 2JAPA 3DBRB 2COUA 2E55A 3O90A 4FP9A 4L7QA 4HAZA 2PFSA 2FEAA 2P2LA 3P5BA 2FRDA 2JBAA 3MS4A 4WV3A 4E2ZA 1EXNA 1MJHA 3I2JA 2I2DA 3DOEA 1FTYA 4ZOBA 4A92A 5DYIA 4MV1A 5FFFA 3CEJA 3HB9A 1CUZA 2YASA 3RVJA 5JH7F 1CRWG 3D6FA 3EBPA 1GRRA 1BIFA 3RUAA 1PGQA 3EDQA 4U2CA 1DFGA 1SPBS 3T1TA 2RARA 3ITNA 3OO1A 2REXB 2RGDA 3U37A 1E69A 3H5NA 4GICA 1PGJA 2C07A 1CP3A 3E70C 4IXTA 4OBXA 3S2YA 4QT4A 3A1FA 3GRAA 3OTIA 1LF0A 1YS4A 4UHBA 1SU7A 2R96A 4PHFA 2UVPA 1QFJA 1X14A 3SOPA 1NNSA 3VAZA 3HUTA 5G40A 5H59A 1DRKA 3WGYA 5CXQA 1MG0A 4GBMA 2VLBA 1NUQA 2CDRA 1BH2A 3F3MA 4PS0A 4DARA 5I9NA 4RVUA 4P08A 3ZQ4A 1O5IA 1S2GA 1RCUA 3BQNB 4JMLA 3C15C 4MX8A 1XWFA 4G5FA 4NU0A 4S2UA 3S2SA 3DTTA 5A05A 3V1UA 1QF9A 3F2IA 4Q7MB 5ECDA 1OI7A 1XDDA 2W2LA 1BX3A 5C31A 3TB6A 1NVGA 5EHNA 1P2DA 3G2NA 2C3MA 621PA 1GFWA 3QUCA 3MS2A 1VZ2A 5K0BA 5E6RB 3O8QB 1PNRA 2PCJA 1N9GB 4O6VA 3EE6A 1RBYA 3UICA 1ZK2A 4MYTA 3F49S 1L7AA 1O6BA 1AY0A 3CCBA 4ZPXA 2V7QA 1OD6A 4WK2B 1P7WA 3NC0C 4PQFA 3AFNA 2C88A 4MULA 1AS3A 2P62A 3S55A 3VC2A 4ER5A 3FPAA 4N0QA 1NYTA 2Z3ZA 3CMMA 2QX7A 1KIMA 2AFHB 1U2EA 3WZMA 4F4HA 1T35A 2H00A 4K6HA 5FI0B 3LU1A 1K86A 1ES9A 2WG1A 5E8JA 1R18A 5KAPA 3U3KA 4UAGA 1AURA 1SQGA 1N92A 2MYUA 3TRJA 4ZGWA 1F4VA 1N3IA 3DHWC 5SZKB 2WABA 1OAAA 2O2DA 5IVIA 2DLDA 2IFTA 1N7JA 2A14A 2O0LA 1PT5A 3HPRA 5FWXA 2RKOA 3ETHA 1YJBA 4TTPA 3IDOA 4F93B 1GUFA 5JD5A 4GQIA 3LE8A 2D0IA 3TJMA 1GILA 2CLIB 3CCFA 1ZI6A 4QFMA 3ZDBA 5DU2A 2GYWA 4JJ7A 1NY6A 2VHVA 2ZAIA 3LO8A 4EVRA 2E48A 4W5NA 3IA7A 2GN4A 2IHUA 1K4MA 3PVCA 4WIAA 1X70A 1XDUA 4MJLA 3IBYA 4G9EA 5JEDA 4WK4B 1ZN7A 3QW2A 4BP8A 1NJSA 1K88A 4RD4A 3CF0A 5F12A 1A2KC 2ADFA 3O3MB 2CVOA 4HS9A 5JZVA 5DHQA 3WGQA 1A5ZA 3A7DA 4NBNA 1GDTA 3W2GA 1LQUA 1P2FA 2WF8A 4ND1A 1FY2A 2IEDA 3DWEX 3E8MA 4F97A 1FJXA 1JH8A 1EEHA 4MHOA 1S0UA 1QNLA 2RH9B 2HW8A 1TJYA 1ZONA 4EY7A 1E4OA 4FFWA 4UATA 5CB4A 3K6SA 4I1RA 1D2AA 4TV9F 1Q6YA 3OZAA 3ST7A 2VC2B 2VJKA 3QF4B 1MU0A 1T2AA 2CXHA 2GYYA 3QI2A 4C03A 2NAFA 2Z3VA 1GZ4A 3PHIA 1D9ZA 1N6OA 1VDZA 3OAAD 2LZ0A 4HDMB 4WH0A 2FFQA 2ZJAA 4EG3A 3OQ6A 4B8ZA 2ZROA 4ZTBA 2VK8A 4N3CA 2NOAA 1E3SA 3RTGA 3N8HA 2UVPB 2VJAA 2Z08A 3NWEA 4HDNA 3QXSA 4BZWA 1DCTA 2J31A 1CUFA 2ZDHA 3NRCA 3GDGA 3WLIA 3DDNA 4Y6GB 4CMHA 2RH8A 2MSWA 3DPUA 3DD5A 5BYKA 1M1UA 3KELA 3RYFA 1K7EB 4OQLA 1M6EX 3DEHA 1E1MA 3VAYA 4WK0B 2ZJOA 5KNBH 3IUEA 5DWQA 3SZRA 1GM5A 1O95C 5A4KA 4EJ2A 4O29A 4K9LA 1PGNA 2ERXA 1FLVA 3WIOA 1DJOA 2ZB8A 2YHBA 3LCRA 1I13A 1V9SA 1DINA 1XYYA 2B94A 1NU6A 1XDBA 3U39A 1SKYE 2ZIGA 5CA1A 1V4BA 4EG4A 3FLBA 2H0RA 1NYQA 4DF3A 4Q4HA 4KWEA 2RKBA 3LCVB 4BRZA 3KOXA 4M1WA 4RS4A 3VNQA 3VZCA 1L4EA 3W7VA 1TYCA 3FKJA 1RZRA 3BZWA 3PC7A 3TRIA 1T4BA 2JJQA 2VK4A 4DDMA 2IU6A 3L4EA 2HMAA 3VC3A 1WBBA 1I2DA 1GLVA 3CLHA 3HHEA 5C8DA 3K0KA 5HSGA 2Q6VA 3BILA 4YX9A 2PKQP 3CONA 3IJEB 9ATCA 3IXMA 1L4GA 1JFFA 3V4FA 1K8YB 4DBVO 5SV2A 2XCIA 2DTXA 2HTFA 3C1OA 2F64A 4FCVA 2GXQA 4F9TA 1KZ6A 4GYJA 4PGFA 5JI2E 5BYBA 3RROA 1I4LD 1KK2A 4OX9B 1GADO 2YNMD 2DY0A 5EUBA 4LS3A 1P2TA 3BA6A 4M1QA 4WAUA 5DWDA 3TK1A 4YYZA 1L6IA 5JECA 1X7GA 2GETA 1E8MA 4YCMA 1UJMA 4PSKA 2Y92A 5FNVB 3HUEA 1E2NA 2OY0A 1R5OA 2VPQA 1CE8B 4R2WA 1LKZA 2B0JA 3MRTA 3FSEA 3GNLA 3ZVLA 1YKGA 4M89A 1EFTA 1SVSA 1CUYA 3EMKA 3EVTA 1TADA 4XWKA 2I2BA 1JNXX 4REOA 4HY3A 5EEHA 3GY0A 3DM9B 5D8DA 1JEOA 6YASA 3LLSA 3O8BA 1G4AE 4MR7B 3WWPA 5BRNA 3WVNA 2QSZA 5JNTA 5J3JA 3EEYA 4WXPA 3IBGA 1XTPA 2WYHA 1M2KA 5HBRA 2Z8XA 3B9QA 1SC3A 4KO2S 2VJMA 2YKGA 1NI3A 4R1UA 1W25A 1Q91A 3NBXX 4D4MA 1JEYB 1H2AS 5K99A 5J4YA 1LQ2A 3QI7A 1ISMA 1QBKC 5MGNA 5BWNA 4FT2A 2AT1A 3RWMB 1NW8A 3NKFA 3A4IA 1DEKA 3P8ZA 1TPYA 2I6FA 1E79D 3MQ4A 3QVMA 3ZG6A 4YDQA 1O6ZA 3AF2A 3UVEA 5C4GB 1MRZA 5BWBA 2NO0A 4FI3F 5LYJF 4HWTA 1U4NA 1W88B 4A0GA 4BOYA 1PV4A 1A9QA 2FN7A 2PZJA 2RGUA 3FYSA 3HVUA 4FYHA 1SG6A 2EJTA 2WC1A 1SEVA 1VG9B 1AE1A 1Z75A 2AMFA 3B8EA 1C7JA 3G2IA 1P6XA 4H08A 3PUYA 4ZQEA 4BMPB 4F3YA 1Z25A 1WG8A 2A57A 2VJPA 3EGVA 1SXHA 2KBEA 2GKGA 3EUAA 3O4VA 5DTMA 3D64A 4FMBB 3WSVA 1I94B 1G1AA 3I1FA 4PVCA 5DNAA 3ZE1B 4AJKA 1BVRA 3HA2A 3HMQA 4PO3X 4HLQB 3OCZA 3A3YA 3MTJA 5ARDA 1G59A 1ADCA 1K7SN 1U65A 2H4XA 3I52A 4LZLA 1TAUA 4CUKA 4QUAA 4ZEXA 2O8DA 3OPYI 3QLTA 4UZEA 5C8VA 1KMHB 4F0JA 1XEXB 2FCRA 4AS2A 4WL0A 1DKPA 5CAEA 4GOOD 3UPTA 1KSFX 1BCSB 1P1RA 2P2NA 1G60A 1RKBA 2GEFA 1GG5A 3EOZA 5A1JA 3R0QA 3KKMA 4PX2A 1K5HA 1EGHA 2Y1EA 2XECA 4J9UE 2OENG 1TJ3A 2FPPA 3A1UA 3V4VB 5F21A 2OCAA 1JE1A 1S2LA 3E6AA 5GONF 3WYBA 2YS6A 1EIWA 4DB4A 5E0KB 3EPRA 2YS7A 4EMSA 3WJ2A 2RK3A 1HX7A 3O4FA 2PRJA 4ZYUA 2R6FA 3KVNA 3D7NA 4BB6A 1HNWB 5DTEA 1NN1A 4QXQA 1BHJA 2P8SA 1NPYA 1Y3FE 3SIWA 3TR0A 4D0SA 1XJ5A 3LAWA 1RRPA 2ZRFA 3GRUA 1PW7A 2PSSA 2GTIA 2X4LA 4HYEA 2B8NA 2R6HA 2ECFA 4KWIA 4NYJQ 5GM1A 1PG2A 2BOVA 3EVFA 5B55A 3C3EA 2QYTA 4Z86A 4EG0A 4B80A 5KTYA 5HZKA 1Y48E 1IPFA 2JCXA 1HZZC 3B5EA 2FR1A 4DJFC 2QJTA 1Z5UA 2DR3A 6ABPA 2GK7A 4OATA 5E1BA 3PX2A 3B9BA 4QFDA 4H1UA 3VPHA 2P68A 4ACBA 3N5KA 3AETA 4L5AA 3UGTA 1K27A 1HTWA 1JXQA 3GCWA 3IULA 4NHEA 4B9AA 3GJ0A 3ETNA 4M0LA 2PM8A 4DY4A 4U00A 2V0GA 4WKCA 3V4SA 5B7QA 3RYFB 3C3PA 3HGMA 4JQSA 2E49A 1JTVA 4PO8A 1CZLA 4ZI2A 2X7HA 3WL4A 4QPCA 3AL0C 1ENZA 3MOIA 4XUCA 4YRTA 1Z4IA 2VZ8A 3JY6A 3FD8A 5EJMA 4GOKA 4PPYA 4JVOA 421PA 5FOUA 1YD7A 4CEJA 4JJAA 1AKMA 4AWAA 3AVVA 3MUOA 2IYFA 3ZH9B 2EATA 3W5AA 1Q1EA 3AEKB 1DU4A 2NUPA 3DMFA 5MN6A 3G02A 1RWXA 5J2UB 2ICAA 4HH4A 1Z7YA 4NJEB 3KQPA 5FTWA 1Y6FA 1ND5A 1ADBA 4B17A 1C9DB 4YUWA 2AYXA 3NYIA 5JCOC 1VRVA 5D3ZA 4HFJA 1UK7A 4C2AA 3DXFA 4YJHB 4PTYA 1C7ZA 3PICA 5H4GA 5KTPA 3VJRA 1NP6A 3DDHA 4MS4A 5AI8A 4TUYB 3SHWA 4DQXA 1JDJA 1N7IA 1UWVA 2GLUA 3OM8A 1P5RA 3RYCA 2W22A 3ABIA 2ZM5A 1Y4DE 3OTGA 2XCQA 4J2TA 4MA5A 1FDWA 5GVRA 5J4KA 2W42A 5K8LA 1T25A 2PL5A 3FI9A 1QX3A 1DB3A 1UKAA 4HLUC 4TVOA 2PGDA 3STVA 1ZUHA 3JPYA 2QLFA 3H4TA 1WNFA 2UZIR 2F3QA 3AR7A 1RYEA 1DDGA 3TQHA 4DDUA 1RW4A 2JCBA 3H6KA 2IS2A 1H5QA 2OV3A 1YB1A 2WSBA 3F5MA 3DT9A 6AT1A 2GZAA 3AEUB 4V3CA 2VHUA 5BUSA 1WV1A 1YJQA 5CH3A 2JEOA 4DR5B 4UREA 2RGRA 4HV4A 2HJVA 1MAVA 2HMWA 2KYRA 2BR3A 3KSRA 1WZNA 3IALA 4A16A 3W9BA 2WDZA 1OXBB 4L3VA 4A1OA 3ANMA 4WY2A 3ROKA 4YXWD 2ORYA 1YRQA 2VAXA 5EMMA 5AKHA 1WD7A 5DYGA 2DT8A 3P2OA 4OAQA 4JGIA 3I6BA 3G79A 1TZCA 4D8XA 1N5JA 2ZANA 1FFXA 5U4QA 1JLLA 3DJYA 3K4HA 2I7XA 3IPXA 4EFDA 3IP3A 1P80A 1TX4B 3ZHYA 3EIEA 5CNJA 3X3HA 3KHSA 2QSUA 4BQPA 1TAGA 2JAUA 2WNSA 5AJVB 4C76A 3R9IA 5BUZA 2IHNA 4CR7A 3MHTA 3CBQA 1T8YA 3R0XA 4PX3A 4Q24A 5EZSA 1X1RA 4UW9A 3VU0A 1Y42X 1KJ9A 2D2XA 4MROA 3ZDFA 3RREA 1WA5A 2W4IA 3KBOA 4PQGA 1H1TA 3GLFE 4BU0A 3SG0A 5B3JC 2PL9A 2Q6KA 2NU8B 3WGOA 1VL0A 2WMDA 5L7WA 1C3OB 1I33A 3DVQX 3U4QB 1O0BA 5E2AA 3BRSA 3KAQA 1DL5A 3MCTA 1ZBQA 2X8JB 4Q4AB 1QG4A 2VUIB 2PJUA 3GG2A 2D1SA 4AULA 3STTA 3ZEAA 3LIPA 2I4MA 5BV8A 3HABA 1OXXK 1Q22A 2YZNA 3G7NA 3THXB 1U0BB 1V7CA 3A6LA 2ZJFA 4W63A 4R0VA 3D4NA 2WJ3A 5AM5A 1F06A 5IBRA 2OC4A 2QZ4A 2ZQ5A 3BWDD 3FUUA 3HHPA 1PRYA 3EWSA 3L4BC 5FTMA 3ZWVA 1Q1GA 3H4IA 1FNDA 1MN6A 2FPMA 3L7DA 2XWJI 3KHTA 3PUVA 1CRQA 3BRQA 1YC5A 2NXCA 3FUVA 1C7RA 4LBZA 1W93A 3AFMA 4QU9A 3A0RB 4O63O 5BYJA 3T0FA 3H65A 2JATA 5G0WA 2REQA 3G82C 1JZQA 1O97C 1J4AA 4IVQA 4LQ4A 1JLKA 1B73A 3C87A 5KB3A 3ZD6A 3PXBA 1MJGM 1Q7CA 2QT9A 2H1FA 2H3HA 4PC1A 2WTNA 3PQCA 3O1IC 5C52B 3AV0B 3CXUA 1JGTA 4O2BB 4JEUA 3RFFA 2E21A 3FW1A 5DN9A 5EKXA 3JQ9C 4LV8B 3G0IA 4Q0MA 1YZQA 3KUDA 3PSHA 1UOQA 3EXEA 4MJ3A 5SICE 5LDGA 4XGNA 1H8HA 4G0WA 2HDHA 4ZV7A 4D6PA 2EHJA 2NQ2C 3AHEA 5J40A 1GA4A 5DBOA 4PFQA 4Q7LA 1OH7A 2UZ1A 3QLUA 2HN9A 4YIKA 1R15A 4M0MA 1E6WA 5TJ9A 2ES4A 3DWIA 1UJ2A 1VCHA 5KYKA 3VR4H 4JLJA 1UBNA 1PL7A 3KZVA 3QWAA 1E1NA 2NPIA 1XEAA 2VNAA 2QTBA 1P91A 4RVGA 1UAAA 1E9EA 1WKVA 4DG8A 2REBA 3WB0A 2KBFA 2CCGA 1Y8CA 4RV4A 3ZJVA 1K6EA 1OXMA 2PLWA 3GLGB 3EWAA 3PYLA 1XP8A 4ZCPA 4NYJR 4MARA 2XGOA 2HMVA 2P7HA 4FDLA 4LC1A 4WHMA 1EIZA 1PFVA 3P4XA 2I2CA 2PL1A 1RXCA 3V32A 3IDFA 4KTTE 1G2OA 4KXLA 2QE7A 5LWHA 2DETA 1K8QA 4KXYA 5ESDA 4AN1A 1Y9JA 4B3DA 1TTPB 1Y5MA 3KWLA 5IAOA 2WQZA 2ZBEA 3C6XA 3LKZA 3PUKA 4TT3A 4HL6A 3QE4A 3N0WA 1EFVB 5C7YA 2QS9A 5HF5A 3O9ZA 2QAGB 3AL2A 5EXEA 4HB4A 3L05A 4V0QA 3ML1A 2BTQA 4IY1A 3ZDCA 1GHTA 5CFQA 1ZXLA 5EIWA 3IVMA 3HTXA 3TZQA 4QXPA 1SKQA 1VGRA 4DUYB 4CM9A 4ZOAA 4A8JA 2ZSHA 1FRVA 2GOYA 3CE6A 1L8OA 3L1JA 2OV2A 4LQCA 2YJZA 2QD2A 4KXWA 3PQ4A 2MINB 3EJ6A 1Z4LA 1JWAB 2WUWE 2GTHA 3HU2A 1B4DA 2ECOA 1BZYA 2W48A 1KZGB 3TMAA 2EKLA 2PJZA 4PG8A 2ZM6B 1MCZA 4YT2A 1DAMA 3EGCA 1V5GA 4K2HA 1K2WA 4J75A 1B8UA 1Q1ZA 2F7SA 1HM5A 1Y7LA 4RQAA 1MTZA 3QW4B 3IBFA 3ZVNA 1JQLB 3M5WA 4CV0A 5EIXA 3PFIA 4GLBA 4EGQA 1DUSA 1H6DA 1PJSA 2Q3FA 1NOKA 1RZRD 1T8SA 1DKMA 4H3SA 4ZVRA 3TPCA 1DZ3A 3NHRA 4IDHA 5FXMA 4G5XA 5SY4A 4D4LA 1MA0A 2XMZA 1WHTB 3NPMA 2G5PA 1SU8A 4YJDA 3AHDA 2H7VA 3BK2A 4C4XA 4EHFA 1XZQA 1JHYA 5HF8A 3IAS6 2VJBA 4D92A 1PTKA 3AUKA 4R9VA 3AHGA 3Q7RA 4Q4HB 2IXBA 3PTZA 1K8ZB 3AVWA 1RYZA 3JARB 4C89A 4HAYA 4J0FA 4DILA 2Q3CA 3FZNA 2RBEA 3BB4A 2H8GA 2HCJB 3TN7A 2AN9A 1EP1B 4U2FA 3FF4A 3W6PA 4P4TA 1FFXB 4B4OA 3L5KA 1KJIA 1YUNA 1SUEA 2A4KA 3AKEA 4LOLA 2F4NA 3K2IA 5LA6A 4KVZA 3ZWXA 3SIRA 4Y98A 3SYLA 3I28A 1PZEA 3M1AA 4G5OA 1E9CA 3G3EA 4LNUB 4QBFA 4NICA 4ZVSA 3JWHA 4FONA 4NEGA 3S70A 2EGHA 4B75A 1RJWA 2ROQA 2XTNA 3S44A 3E2IA 2CUZA 3GPDG 4ABYA 4Q9JA 1OCEA 2YINC 3OCUA 4HUJA 3PKIA 4TQAA 4O1HA 5AM0A 4D3XA 2VS1A 4G24A 1J97A 1UJ5A 4ETWA 2O2SA 4YMGA 4HX9A 4ZVOA 1HFKA 2W6OA 3N2KB 1K9SA 3IHWA 4KR9A 2NYAA 2WFLB 4B3JA 3JALB 4DWOA 2J48A 4QUKA 3OZUA 1THTA 5KJEA 4N3AA 2B1IA 2WM2A 5BQ3A 2WM8A 4MYUA 2O50A