3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
3IGZB 1ED8A 3DYCA 2GSOA 3OT9A 3B5QA 3MK2A 5DLTA 4LR8A 4N7TA 3UN5A 1ALIA 2GSNA 4FDJA 2QZUA 1AJAA 1KH4A 4MIVA 4GTWA 4KAYA 1EW9A 4UOPA 5LQQA 1KHJA 4ZG6A 5LRMA 5LRNA 1E1ZP 2RH6A 3NKOA 2IUCB 1KHKA 5LIAA 2W5VA 5EGEA 1E33P 1P49A 2VQRA 3M8ZA 3MK0A 1O99A 1AJBA 4LR2A 4ZG7A 3T01A 3UO0A 2X98A 1ALHA 4UPHA 3LXQA 5L0EA 5INHA 1Y6VA 1ELYA 3M8YA 2W8DA 2W5TA 3M8WA 4KJGA 4CXSA 3IDDA 4QAXA 2D1GA 2GA3A 1SHNA 3A52A 3NVLA 4LQYA 4CXUA 3SZYA 4ZGAA 3NKRA 1URAA 3UNYA 2ANHA 3CMRA 1HQAA 3M7VA 4LRDA 4LR9A 1B8JA 3BDGA 3IGYB 5DLVA 1EJJA 3UN3A 1ELXA 1ANIA 2XR9A 2W5XA 3UN2A 2GSUA 4CXKA 5HRTA 1EQJA 2W5WA 3WAVA 1ALJA 3KD8A 4UPLA 3DPCA 1Y7AA 4NWJA 4CYRA 4TN0A 3E2DA 5KXAA 3Q3QA 1KH7A 5IJQA 1N2KA 1AJCA 4LREA 3MK1A 3WBHA 4B56A 1AUKA 3SZZA 3NKNA 3BDFA 3T02A 1K7HA 4LR7A 2W5RA 1SHQA 3BDGB 5EGHA 1ANJA 4MY4A 5L0BA 1EI6A 1EW2A 5GOVA 3WAYA 4LRFA 1ALKA 1EW8A 4UPKA 4GTYA 1FSUA 1ED9A 2W5QA 3NKMA 5AJ9A 5TJ3A 4ZG9A 4CYSA 4GTXA 3TG0A 1AJDA 2W8SA 4LRBA 1E3CP 3TX0A 1HJKA 1KHNA 5DLWA 3WAWA 1HDHA 5K4PA 2W5SA 4KM4A 1E2SP 4KAVA 4UOOA 1URBA 1ZEDA 2G9YA 1ZEBA 1ZEFA 4YR1A 1ELZA 5L0KA 1O98A 4UORA 2IFYA 3TWZA 3WAXA 1KH9A 3T00A 5GRRA 1KHLA 4KJDA 2IUCA 2ZKTA 4NWXA 3NKQA 4LRCA 4LRAA 4MHXA 4FDIA 4UPIA 1N2LA 4GTZA 2GLQA 3BDHA 3ED4A 3NKPA 5IJSA 2XRGA 1KH5A 5C66A
chains in the Genus database with same CATH superfamily
4GKJJ 3AD7C 4WP3A 2HIYA 4I68A 4LVOP 5ETPA 4X64J 3Q8YA 2IM2A 1KVJA 4FNHA 1BQNB 1QAYA 4OHZA 2K3KA 1LW0B 3F0NA 5EGEA 1FD2A 2CYYA 3TVYA 2NLWA 2QV6A 1R3NA 2PFDA 5THWA 2WB4A 4W98A 2D1GA 4ZPDA 1UWBA 4I6YA 4FF1A 2MKSA 2OAUA 4RX6A 5DQHA 1MN7A 2BVZA 2HFSA 3DOLA 3G8TA 2GCFA 2XMKA 2EBGA 1AJCA 5L8RC 1B4SA 5LJ5Y 1KTQA 2C22A 1H2VZ 1HNVB 5DRKA 2XLKA 2Y8WA 3PYDA 1SQFA 3E01A 1T11A 4RWXA 3V6KA 4NZ0A 1H0HB 3NKMA 2AGOA 4FYYB 3E51A 2IDEA 1VK8A 4RNNA 1XBWA 4X65J 5CHCB 2M7SA 1YZ6A 3AJDA 3VAGA 3NGUA 3EZ5A 2R2RA 3BQ0A 3PKMA 1LOUA 3UCGA 4PXCA 1J5OB 4OX9J 2HVHA 3ULHA 5J1EA 3MK0A 3CEDA 2DR9A 3BGLA 2WRMA 2C2DA 5KT3A 3FCHA 4PQAA 4I64A 2Z2MA 4ZK7M 3TA0A 2UU9F 1S0OA 1IJEB 4Q0BA 3E2EA 4H4MB 3NNCA 3MHYA 2ZJPQ 5GVQA 1V3RA 4IQXA 1YITS 3UR0A 3A3PB 1KEKA 3FCWA 1FO1A 4MYUA 3BSCA 3M30A 4UTGA 4ZVEA 1SC3B 5J2PB 1YBAA 4PCQA 3E8OA 1T3NA 1A6LA 2UZAA 3AJ2A 1RT4A 5AJ3F 5HLFB 1TVRA 4NLSA 1KHLA 3WC2A 5DGAA 3H98A 2B4VA 1FRKA 2BRKA 2VQEF 1RCXB 1RHRB 1QM9A 4F2SA 4XDDA 4DJBA 2VIHA 2XI3A 2HBYB 1V5VA 4I6AA 4FYWB 1Q7LB 2XGPA 4ZLLA 1YJ7A 1CJUA 1FWPA 1P1TA 4ZVTB 1A0OB 3KTQA 3LA0A 1UA0A 3DC2A 4OZ1A 2B4PA 4M5KA 1TFWA 5J2NB 4KGZB 1FRHA 3O8WA 2G2OA 1S1XA 3FEYB 1ZTTA 1YKWA 4DPXA 5CD4A 2GGPB 4ZJQA 1RAEB 4UW2A 4DQRA 2AMCB 2A2CA 2ZH1A 3LP1A 3UI3A 4B3RJ 2HNYA 3KFWX 3LP2A 1RHQB 2CPEA 4DCOB 1RAIB 1RT7B 1LWEB 1NPRA 2X7IA 1N8RT 3BBCA 4YR1A 4RW7A 2FVQA 2NS1B 4CLTA 3VVTA 1DTQA 1TP7A 2XRGA 3JAMY 4WP8A 2FYXA 5IM0A 5DLTA 2WK4A 3TR5A 1G1XA 2AEFA 1HWJA 1NLKL 4X64F 3SZ2A 4JI0J 3GJSB 4KAIA 4J9MA 4F0KA 1U1OA 1GMWD 1RQ0A 1DARA 4CXUA 1H73A 1ANIA 3A8JA 4OZLA 2B7CB 2NSBA 4X62F 2VKRA 2LKZA 1DTTB 3FNNA 1LFPA 5IJQA 2YWKA 3ZXWA 1NJIT 2H51B 2BR0A 1JJ2R 1M90T 2IBOA 2W5RA 1QUVA 4NI2B 4QR0A 1PC4A 4LF8J 2ZHOA 3W66A 3K5OA 4K4ZA 1FX2A 3FC9A 4ZDNA 1VRTA 4CO3A 1AB8A 4TQRA 5K14B 3P8BB 3RBEA 4MMOA 1SQGA 4K0KF 3OHBA 4R0EA 2IAJA 4ZVRB 1ZS6A 5B0BA 3DI6A 2GJFA 3CCRS 1QSLA 3DU6A 4CLWA 2Y1IA 3IGZB 2IVMA 2R7QA 3PJXA 2G0CA 2H54B 2OI2A 4I2QB 4QIVA 3I0RA 1JLEA 2W1BA 3P5TL 3EPGA 3BKFA 3UO0A 1NM2A 3NBPA 3FZBA 3D3CJ 1B7FA 2GHWA 3QIDA 1Q8KA 2Q6BA 4RW9B 1SC6A 2VICA 1U1PA 3CJKA 4TQSA 3OFGA 2AD9A 2G2YA 4EK2A 1XNQF 3QBCA 2W2PP 2B3TB 3W5XA 3HFZB 3IS9B 2F9DA 2ZM6J 3Q22A 2ALZA 1RAGB 4DUYF 4C8LA 1CQNA 1DQAA 2CPYA 1N88A 2Y9HA 3AA9A 1FNXH 4LSNB 3CD7A 3L09A 4P72A 3I87A 4A8XA 2ZBIA 3MWBA 1J5EJ 3QSYB 3GU0A 2CJAA 4NWXA 4B08A 1DJ0A 3DMJB 3T6JA 3ZZUA 2A2DA 4BCAA 1NPKA 1ALIA 2QZUA 5K8NA 4A8QA 2CJBA 2JWNA 1F9FA 4RW6A 2HEKA 4O4GA 1HW8A 1F3FA 2R4FA 2U1AA 2MQOA 2HVIA 2OP5A 4OYBA 4OI3A 2YKMA 2ADBA 2DRDA 1P8GA 4A46A 2ZD1A 3W1YC 1RHMB 5C5JA 3W9IA 2OTJS 2ASDA 3VGVA 3R1HA 1OSCA 4ELVA 1X9SA 2W2MP 2YBVA 1E6VA 5B09A 2BEFA 5IOLA 4C2MA 4OL8A 3EICA 2YTCA 4MT1A 4DV3J 4X4PA 2DPJA 5D4NA 2I6WA 1PGZA 3CVKA 1U6BA 2JHEA 4DZ6A 3R6GB 3CMES 3SDEB 1PSDA 1T03A 3NL0A 1XEZA 3WIVA 1Q0NA 3MCOA 3QO9B 2R42A 1K44A 3V4IB 2BKOA 2EC2A 2RUSA 4PXEA 1NJWA 3MMJA 2CG8A 3OVBA 3FVYA 1H6KX 2AF6A 2CNNB 4IFYB 3KOAA 3HVAA 3ILLA 4NCGB 3PW4A 3M8PA 2CDQA 1WC6A 2COLA 2YPZA 2LECA 1TAQA 4EMDA 2XS7A 2MZ1A 2DNZA 1HD1A 3ISNC 2X98A 4UPHA 1KLNA 3ET6A 2GZOA 1BY9A 1TV6A 3OXGA 1N34F 1VK3A 4L76A 2MZSA 4Y2CA 2YKPA 2V2QA 2CVIA 4NXNF 2QN6B 2NREA 4J9QA 2GVZB 3C14A 4B3MJ 2RJZA 3EZOA 2F40A 4Q45A 3DRRA 1R8AA 2EFGA 1SL0A 5H9EJ 4HH0A 5CZXA 5TJ3A 4LF8F 1D09B 4WFXA 2MKYA 1UPMB 5A2QU 4FBUA 4DSKA 1YSJA 2ZJQQ 3OD2A 3RAQA 1EQMA 4H4KC 1S76D 4OI6A 2MGZA 2DITA 1FXLA 3ZTPA 3GFYA 3R7BB 2G13A 9ATCB 1URNA 4J9KA 4UOPA 3UR3C 2IJRA 1XMOF 1JLFB 2MHEA 4KGXB 3IM8A 3HSGA 2HK3A 1L3VA 3HHLB 1PJ6A 4USUA 4J7CA 4KJGA 3PJWA 1NH7A 1S9GB 5IQQA 4DCPB 3PW0A 4BLGA 5I3PA 4CXKA 2IVYA 4RNFA 2QSFA 3L9ZA 2DHAA 1UMJA 3EUNA 3M32B 2F4FA 3QPIA 5KG6A 3ENQA 3OVSA 2WAQD 1S6QB 1WDDA 1YJRA 1ZM4A 2CZVC 4YEAA 1HFEL 2GMHA 2HBRB 1XC9A 1WG1A 5L0BA 4BC7A 4H4KA 2K8GA 4KV8A 2ZM6F 2OHDA 4USMA 4DFPA 3OJUA 4WE1A 3HSJA 3MMBB 2ILYA 2YH1A 4IH7A 2W25A 3D0HE 4MK8A 1SCJB 2OEMA 3G6YA 2CPJA 1RTDA 1QSSA 2W7AA 2R8JA 4FF2A 1I94J 2L3MA 2ZWPA 4RW8A 5H9EK 1W2IA 2RNEA 4V1Ak 5SZTA 1DFDA 2AX1A 3M4XA 1JJ4A 1M5KC 4J9NA 4M5DB 3KYLA 3N0VA 2FHKA 3HD2A 2R8IA 1T9YA 2B9WA 1WOOA 2OPRA 3L3CA 3TA1A 2IHR1 5F3ZA 3M1VA 3R9LA 4KGVB 5KG4A 1YRTA 5MAOA 5DS7A 3UPFA 3UNGC 3R2DJ 4RNOA 1KHVA 1Q5VA 1KRPA 5KG7A 2HK2A 4AL5A 1DQ9A 3C3LA 1S0NA 3FEXB 2BX6A 3K8WA 1WI6A 1CJKA 3NCQA 2HWTA 2KYXA 1TUVA 1U0SA 2SXLA 3OLBA 2O66A 2IMWP 1SI9A 2HQGA 1PCAA 4M5JA 2XB2D 1G4CA 5D6GA 3PFEA 3DLBA 1T7PA 2ERRA 4NLVA 5ETQA 3I0SB 2HMIA 1T9WA 4GTWA 1OQ3A 1GX5A 5CAAA 1AUSL 1N6QA 2DEIA 2GFFA 4O3QA 1R0AB 4DDFA 1SC1B 3JTPA 4N56A 3M9OB 2AV5A 2JEIA 3MOJB 1W7WA 2E44A 4EZ9A 3P4UB 4DL5A 3T9ZA 4RBVA 4J9OA 1TL3A 3JSYA 1MMDA 3WX8A 2W5XA 5D4PA 4ZN1A 1HNIA 2DB1A 4U95A 2MXYA 3FRZA 1Q5YA 2XMVA 4QWDA 2DXEA 1RBLA 1RWPB 1NH8A 2H5JB 2M52A 4RWWA 5I3UA 5KFVA 2LU2A 4B3MF 2R7OA 2HBZB 4ECVA 3IWNC 4JV5J 3SBMA 2GMJA 1NAQA 2W7OA 4IRDA 3JSMB 4OZ0A 3PIOQ 3US5A 2XQCA 2UUAJ 4F4YA 2ZNYA 2JC0A 1WEZA 4DS4A 2HWIA 1DZ5A 2AHOB 1MWYA 2E7VA 2B7BB 1Q8BA 2CQ4A 1N2LA 5B0DA 5D78A 5KOXA 4HDGA 1LXJA 1ED8A 2J5AA 4DZDA 3GP9A 4NMXA 4EWTA 1TU0B 1U25A 3LAKA 4B3SF 1Y5NB 2B9YA 3KWMA 1RBOB 5CA5A 3IRWP 1IBMF 2RQCA 5DDRC 2ZEJA 3GG1A 5M2UA 4ILMA 5A8KB 2VF3A 3D9BA 2AQ4A 2B6AB 1VBYA 2PN6A 2EG2A 1RTJB 1KP6A 3HHDA 1N52B 2Q43A 2LXIA 4DR7J 3QSIA 4YS2A 3PW7A 1CPZA 2IDLA 5EUHA 4AQYJ 1N36F 4I4BA 3DRSB 2NCKL 5E3CA 5HQMA 1AW0A 2WW4A 3CJ4A 2FLLA 3B78A 3IR5B 3MEKA 1Q79A 5KFOA 3CD5A 1U2FA 1DHMA 1MWQA 5DG8A 1VQ4S 1RI7A 1RBAA 3U1LA 4HI1A 1VQ8S 5CD4H 1HMVB 4DR4F 2J0XA 1X7VA 3MM7B 3DM2B 2PSZA 2ZVSA 2DY9A 3WHIA 3CJTA 5DM6Q 2GIQA 4WU2A 2DT9A 2OD6A 3BGRB 4QWCA 1CULB 2IRYA 4ZPVR 2KKHA 1E6YA 3QAUA 3TRGA 4LJMA 1MMNA 2RF2A 4IOCQ 1B64A 3BM7A 2L08A 1JLBA 5C7PA 2HQ3A 2VJVA 5L1JA 4F36A 3H5UA 3K59A 4CYRA 1S5ZA 4KJIA 1L3SA 2VG6B 2AX0A 2EKYA 1H7XA 4LR7A 1YBUA 1QTNB 2LLZA 2QYCA 1T05B 4U7UD 1NMEB 3VWSA 5D0EA 3TEHB 1FHTA 2WHOA 1H74A 3FRYA 4ALZA 3KLEA 2V8VA 3AH6A 3WAWA 4QPXA 1F2GA 4MFBA 2RU9A 4KAVA 1RADB 3KK2A 1GXTA 4ED2A 4ES1A 2W4DA 5D0RA 4U67Q 2IUCA 2DTJA 2P6TA 1S1TB 4R5PA 4FVCA 2P6SA 2R2UA 4OMFG 1S4FA 1M1KT 1SKWA 1BXNA 1RHUB 1F5AA 1K0TA 3UDLA 3H20A 3JYTB 5KFWA 4Y6IA 3SV4A 2UUCJ 3MDFA 1R8HA 3FCVA 1EJ7L 4CXSA 2E1AA 1T94A 2B5JB 2JJ4D 2QFIA 1JLAB 2GA7A 1P9YA 3QIPA 2MMYA 2PA3A 4IDKB 4NEZA 4WIQA 2AEJA 2CQBA 1P27B 1OS5A 3PKYA 4WIIA 2JFKA 1U0HA 2FVRA 2RRNA 3GFZA 1A7GE 3HMJG 4NASA 3CD0A 2ADCA 3DLKA 1BQMB 4XTTA 2QRRA 1V3SA 5A0YA 1X0FA 3PACA 4IG0A 2KU7A 1S0VA 2ROEA 1HWLA 5EX0A 2OMOA 4KHPJ 4FKXA 1EHWA 4K4SA 3GJQB 1IBCB 4NOHA 2UUAF 2RQKA 4YB6A 4BS2A 1X0PA 3ILOA 4RPFA 1MN9A 1Z4UA 1SUQA 1NDLA 1C1CA 3CDUA 3VALA 1K8AT 1RABB 1VQ5S 1R7IA 1TL1A 3EPIA 1MROB 3CCVS 3WX4A 1IM4A 3D0IE 4LUBA 4UZBA 4F3MA 3DLGA 3MFHA 9RUBA 2ASLA 1S6PA 2N4DA 2WSEC 4K4WA 1WSRA 2CQ1A 3MPWA 3NKRA 2AJQA 5EHHA 3M7VA 1TAUA 4TY8A 5KG1A 2EEYA 1SJFA 4ED6A 1OMSA 1HBUB 5BYSA 1FE4A 4JP8A 2M8HA 4F7VA 4M94A 1S9FA 1B0PA 4DR7F 1XERA 5HVFA 2KI2A 2C1EB 1GMWA 1N5TA 3PCOB 1EW2A 3TQEA 1CS4B 1X31C 4ZLPA 3B6BA 2XY6A 5GMKa 1UPPA 5CXTA 3N6LA 1NKBA 1YJ9S 3ZNJ1 1TUWA 2N7YA 3TWZA 4YP3A 1BQNA 5K20B 1LW0A 3NKQA 3GPAA 1YRUA 2FLPA 3D1HA 3DLLQ 4OZ3A 2MZQA 3W2VB 5JMNA 2AP6A 3MTKA 4B3TF 1P6TA 3KLFB 3NXZA 2HG4A 4QIEA 3SQOP 1HD0A 1CQMA 1GTHA 3DGVA 1IN0A 2A6OA 2VG7B 1OPIA 4ZCKA 4C8MA 4HTIA 3QRQA 4DFKA 4J91A 2FD2A 1SJQA 3NOGA 2LCWA 1HNVA 1XNRJ 3PNIA 4GC7A 4Q0BB 1ICEB 4J9VA 2YX4A 3KMQA 2ZH8A 3LGMA 1M0SA 3W2WB 4UPLA 4CTAB 5KXAA 2AZ1A 4TN0A 4ZPTR 5HN0A 1CEZA 4F8RA 4E8UA 2BUNA 4DPTA 4B56A 2WONB 4CLZA 3M30B 2M2BA 4WF9Q 1IKXB 3O3LA 1UAWA 2Q6CA 1M5SA 3S8SA 2NUHA 4I67A 3KUGA 2FPHX 3LUYA 1TVRB 1J5OA 5J2MB 2F5GA 2VBYA 3OSPA 3ENWA 2NXJA 1IWGA 3TZXA 4N7TA 2DNLA 2VQFJ 4M8LA 1C0TB 2MZTA 4X4OA 5LMNF 3P3DA 4A8WA 2H9ZA 5IC6B 4H4MA 2DNGA 1Q53A 4RU2A 1RT6B 2UUCF 2Y1LB 1QE1B 2GA3A 1U8SA 4ZKAA 1UCNA 4YN3B 2YNHA 2H65B 2CPXA 4G1PA 2YNIB 5J2PA 3CC4S 2NXCA 2BE2B 4KE5A 1R8PA 2CIMA 1T9UA 2DHGA 3N4WA 1H2UX 2JZ5A 3BO4A 1TKTB 3LP1B 1FNOA 3N79A 3CULA 5HLFA 1FKOB 4K2JA 4DR3J 2V8HA 3TARA 3QFWA 3JB9k 1F6TA 1R6YA 2XLIA 1RK8A 2XTJP 4RW7B 5DZ7A 1DLOB 5E7OB 1GMUA 1RP5A 4KHPF 4MIAA 1OYEA 2XWYA 5DQIA 3GTYX 3TAMB 3DDNA 2GAHC 1KONA 4NZ6A 5J2NA 1VLYA 2G4BA 4OJ3A 3CCTA 4URSA 2JH3A 2DIVA 2IA0A 1M5OC 2LQ8A 2GGPA 2LQJA 2DIUA 3KHHA 5EN1A 4AE5A 2YWEA 2KG1A 4K2XA 4G1QB 3IR6B 3RW6A 2RD5C 3O6QA 4BDPA 3J7AN 3B82A 1IQZA 1RT7A 2JLFA 3PFOA 1LWEA 1Q8IA 3T1HJ 3RRKA 4C8ZA 1NHVA 1O5JA 3SSSA 1ZETA 2AU0A 3K0JA 3CCSS 3OBIA 3QZ7A 3HK2A 4Q2LA 1WSVA 3OR1B 1G6BA 3UDEA 4ICLB 2FC8A 2CVEA 1TL7B 3CT9A 1FJCA 1O98A 3NY0A 5BXIA 2IFYA 4I2PA 4NA1A 1VQYA 1N5QA 3EXYA 2IAJB 4OV1A 4DQIA 2GQQA 3HHNB 3QGHA 1W26A 4PUOB 2LQ9A 5KT2A 2YH0A 3DHWC 4LF4F 1Y7PA 4ZVGA 3NBPB 4C9DA 3OPKA 1X5PA 1DTTA 2Z2ZA 1HW9A 1RWVB 1VI7A 2IIHA 4FXDA 2FY1A 4LF7J 3MR5A 1WC4A 3PHEA 4F0MA 1R27B 1TK8A 4NI2A 3WC0A 4HT5A 2LXUA 5U47A 1XNRF 1SJ1A 5G0RB 3HKWA 5KFEA 2V67A 1IQTA 4X66F 4TYAA 1LV5A 4FNIA 1VBXA 3PTWA 5K14A 2DY1A 3H2VE 5A2QY 1X4BA 3BV8A 2F8EX 2AZ3A 2XZWA 4DPUA 3P45B 2MQPA 1RYRA 2FHOB 4K59A 3FDSA 5BR8J 3AQPA 4U96A 4I2QA 2MEWA 1O0PA 1AZSA 2BJEA 4PG5A 3IA0A 2M8DB 2VFUA 4KAYA 2WVFA 4RW6B 2FLNA 2QLWA 2CNOB 3SCIE 1AROP 2W5TA 4C48A 2Z0GA 4LQYA 3IS9A 4EI2A 3GQCA 3IGYB 3CMAS 1HNZF 1VQ6S 4FDFA 4GMKA 1I6JA 1U1NA 2GSUA 1EQJA 4I7FB 4LSNA 2JVRA 2QLBB 1TL4A 1PIEA 4DSEA 1LNQA 1RT5B 2BYCA 4L3NA 1DBDA 1NK9A 3DMJA 4EGLA 1SC4B 1HHTP 2DCLA 2OO4A 3WZ0A 3HZEA 2DVIA 1RISA 4YB1P 4DFJA 2DNYA 4QWEA 1WNEA 3I4HX 2GO8A 4GTZA 3UD4P 2YY3A 3DYCA 5LM7E 3R1LA 2RU3A 1MLAA 4LQ9A 3VZHA 3N01A 2EXUA 4HDHA 3C15B 4F0HA 2R7VA 2VC1A 4B9NA 1U7LA 2AJ0A 5FLXU 3IGVA 5HJXA 3P49B 1S99A 4F67A 4F3QA 1TKZB 1ZPVA 4A8KA 3I32A 4CQ1A 2V0NA 3Q0AA 1QAIA 3SDEA 3TZWA 4G65A 3QT7A 3ONQA 3RB3A 2R7WA 2DR5A 5F9NA 3QO9A 3V4IA 2QL5B 3SQGB 2J76E 2KVIA 2QIFA 3DCAA 4C0BA 1KKHA 1EKSA 1FF2A 2JC1A 1M5HA 5KOWA 1VIOA 2AEMA 3NWGA 2RB7A 3NNHA 4IFYA 4Y65A 3EMTA 4NCGA 3EGVA 4DV0J 2BJ9A 1U4BA 4OYAA 2J9DA 3POTA 1S6UA 4MYTA 4ZN3A 4KH1B 1KLMB 4A4JA 4YY3J 1OIAA 4FDIA 5L1KA 3GIRA 4L75A 5KAKA 2KG0A 4MKBA 2FTRA 1ROFA 1FDNA 1FFGB 2MQQA 2FIUA 4E2FB 2FZKB 1U8WA 3TUZC 4CT8A 3DOMA 2B43A 3HHLC 1Y6VA 4NZ7A 2YKNB 3ZZ0A 2QA4G 2GVZA 4X4TA 3OJSA 1RJJA 3N5FA 1DAXA 1YVFA 3R5GA 1PILA 1X4FA 2AJ4A 2FJDB 1FTCA 1H7WA 4QZVB 2UUBJ 5F8HA 1YI2S 3CCMS 4JOUA 1VQOS 2RRBA 4RLEA 3LWLA 1QVGR 2UXCF 1PJ7A 4NYZA 4YR2A 3LO3A 2ZJRQ 2QSWA 1ACMB 1FRIA 2PMHA 1NRKA 4P7VA 2W5QA 1OSDA 2KM8B 3MR6A 1SQEA 4Z37A 4WE1B 1G3OA 1HWUA 1NHKL 3M2VB 2BE7D 1M5VC 3T00A 4LSLB 2G0IA 1JLFA 4PQUB 3V81B 3HVRA 2LDYA 1NSKL 2EWHA 2M9KA 4RO0A 4MK9A 3HHLA 3MUTP 4GRSA 6FD1A 2AJ1A 3OT9A 5DDQC 4H4OB 2BM1A 2ACYA 1JJHA 2QG9B 5LRNA 1NZ8A 1S9GA 4N8NA 2KFNA 5KFUA 2JRSA 3W61A 1P49A 1WHVA 1U02A 1YJNS 3Q8UA 1U09A 1S6QA 1TK0A 4DR1J 4C8KA 1SB6A 1RKIA 2FJBB 1YJTA 3TUPA 3A12A 2BE9B 4ZP6A 3UN2A 2MKJA 3NS7B 1KQSR 4QYRA 1NEEA 4NLDA 4D3GA 3DRYA 3NKNA 1LWXA 3T1YJ 3MMBA 3EJMA 4IRKA 1EI6A 4ED0A 2HAIA 2AGPA 4OHWA 4EYHB 2Z56B 4LF6J 1FKPB 1IXKA 2DNPA 3O5TB 4EEYA 3UDVA 1BHNA 4N76A 4ILLA 5K4PA 1QTMA 4ZPWR 3OL6A 1NO8A 2MKHA 2GIFA 4ZJOA 5DM7Q 1C2PA 4C3KA 5GAEU 3GR1A 2OMLA 1CSJA 3R5JB 2VDHA 5CQGA 2FGOA 1FVSA 2D41A 3OL9A 2KJVA 2D3OR 4M5DA 5DLFA 2GSOA 3TX8A 2HKEA 2ZZNA 3LTOA 1N6QB 3DLEA 4GO7X 1LK5A 2DCUB 3KJVB 2XS2A 3DDKA 1NK5A 3QGPA 2W5VA 1TL5A 5F0WA 4EBDA 3MM9B 2PA8D 1OYDA 2HRUA 1T02A 1PAUB 3M8YA 3CUNA 1UJ6A 3WDOA 1V5IB 4OZ5A 3M8RA 5DJBA 2W8LA 2FVPA 1T0TV 3AT1B 4CWBA 3NCPA 1HBMA 3PX0A 3TYTA 2EW9A 2OPPA 2YX1A 4O4RA 2HS3A 3HZGA 2CJ9A 3WAYA 3Q8QB 4DUZJ 3W3SA 1YLXA 3G2XA 4FXWA 3QRPA 1VHIA 4Y28C 3MAAB 4ATNA 1NBEB 2RHSB 3I0SA 2FQQB 2MYFA 4AYBD 3JS9A 2XNRA 1U47A 1LW2B 3ZTSA 4P75A 2JSXA 4CNYA 2RAQA 4YY3F 3I96A 3BQ2A 3D6HB 2UXBJ 2E1PA 1JLCB 2D7SA 2CDRB 4X84A 3SSRA 4USVA 4CLLA 2DNKA 3D67A 3KJNB 5KFMA 3VQTA 3HHKA 3GR0A 5E2QA 1IR1A 3C8YA 4DR6F 5F8MA 4IOAQ 5L46A 1RXOB 2HVZA 2UXDJ 2RVJA 1FESA 2UP1A 4OHVA 2FUG9 1NJXA 4DPOA 2K2PA 5L38A 3PO5A 2DGTA 2GHPA 1T3OA 3GYXB 3H4DA 1YIJS 3TZYA 2RQ4A 1N33J 3M9MB 5T14A 4WWSA 3JSRA 1RTIB 1HNXF 3D6TB 4ZLJA 3SFGA 3UVJB 1FSUA 1BGXT 1SXLA 1TZ0A 1KNZA 5A8KA 4C97A 4MIVA 2B6AA 2OKQA 4C8NA 5C2CA 3MCSA 1LK7A 1K1SA 3HJVA 3M8ZA 2LEPA 2KXHA 1RTJA 3I82A 5DETA 2MKCA 4P10A 2XLJA 3R5AA 4DX6A 5ETSA 4N47A 3K17A 3MR3A 1R6VA 4J9PA 2KZMA 1FEHA 2AJ2A 3KNAA 3T6BA 1R8BA 1KSPA 4DR1F 5IV4A 1HIYA 3DRSA 1SKSA 1KH7A 4DV4J 3TJ8A 4AL6A 2M3DA 1UP1A 5ETRA 4F02A 3GFHA 2HNDB 1WTFA 3NS6A 3IBFB 2RMLA 3M6UA 2IC3B 4H54A 2V50A 4FYXB 1FJ7A 2LDIA 3T3FA 3KLEB 3TA2A 2XYPB 2W8SA 3FUYA 4LF6F 2IBKA 1HMVA 3MM7A 3DM2A 3S01A 1N32J 2QO3A 4M5GA 4FYDA 4X4UA 3W65A 3PJ9A 2NXUA 3BGRA 2DHXA 1TMJA 1CULA 1KH5A 1F9EB 4ZJLA 4DV6J 2IVFB 3H90A 3Q8PB 1E1ZP 2J9EA 2ZH7A 1N0UA 4P7TA 4NRUA 2VOOA 4UUXA 1KQGB 4DN9A 3RB4A 3MUVP 2OFHX 2D3ZA 2ASJA 2GQCA 3ZTOA 3W9JA 4NCAA 5GAHI 2MZRA 4FPIA 1T05A 5DLVA 1FDDA 3U02A 2YNGA 5GAHU 3AFGA 4G6VB 4OYIA 1UEUA 2EG1A 5L1LA 3H2UB 3GSDA 1AUKA 4CO1A 1JMTA 1S57A 1NKEA 2RDDA 4WK1A 3O2IA 2Z8QA 3SEOA 1S1TA 1DURA 1OY6A 3V2UC 4DUZF 5E0OA 2VONA 4IG0B 1JB0C 4DSFA 3GB0A 2E7WA 5AXKA 3NNAA 2I2YA 1KH9A 4C11A 2QFJA 4N41A 3ILJA 3JYTA 3CCJS 2BA9A 2ZFHA 4ZVSB 1ZM2A 2X3DA 4LF9F 1NDKA 1U1MA 2OPQA 3RZAA 2B5JA 1F2HA 2UXBF 1JNZB 1JLAA 3CC2S 4CO4A 1YTYA 4N5SA 2E5LJ 3C66A 2HRYA 3VR1A 4K5RA 4C4WA 1R0CB 1HARA 5CYMB 4LQ3A 4XPCA 2DD8S 1XR7A 3BF4A 4KB7A 2ZUGA 3QLHA 1L5UA 1WTBA 4DL0C 3KK3B 4IUFA 2ZUAA 1BQMA 4ZP9A 4IQMA 2ZH6A 4KGMA 3T02A 1ZA1B 3AD9C 4OYOA 3M6VA 3IO1A 2W4PA 4PRFA 3T5KA 3FMWA 3MEGB 3MMAB 3IP0A 2HYIB 4EO8A 3MEEB 1TTHB 1WDTA 1VGYA 2D9PA 3R97A 3GIIA 2VJUA 5KFIA 1GFWB 2IYGA 2CQ0A 3FZ2A 4YR3A 2QMUB 4MKVA 1MROA 1N33F 4NCBA 5B0GA 3MF5A 3C16B 2QLJB 2RRAA 1VLOA 2XO6A 5KFTA 2XZTB 2B51A 3LF0A 3DOKB 4LBIA 1X9WA 2XHWA 4X62J 3OXLA 3CJQA 1BMQB 3KG0A 3HT3A 1VCTA 2W24A 3ZZOA 1EARA 4IOBA 2XMMA 2VPZB 1N5VA 2OELA 1U24A 3NAHA 1HBUA 2KXNB 3MPVA 5IQ6A 4RR5A 3N9UC 1XK8A 3J7YI 2KO1A 4ID8A 2PDAA 1WEXA 1CS4A 2D9OA 3J7YU 5HRTA 2NZ4A 3RBXA 1N48A 4Y2AA 3P96A 4DXLA 2QMWA 4K0KJ 4ANCA 3ELHA 4LSZB 3KG4A 4WJBA 1VHFA 1QD1A 4DV4F 4AL7A 5GOVA 1EZZB 2K3IA 2E1RA 1ZM9A 4F4AA 5DG7A 3W2VA 3FSXA 2C2ZB 3Q23A 1KQKA 3KLFA 1O8BA 2QLFB 1RWXB 4LF1A 4LRCA 4PWDB 1N32F 3A4TA 2VG7A 1KWMA 4F3OA 2EFQA 5K8PA 4ZG6A 2AIRB 4CP5A 1XNQJ 4DV6F 4ZA1A 2YNFB 5HMWA 3W2WA 4CTAA 2DR6A 1L3UA 5EGYA 3BKTA 4DUYJ 2C3YA 4FF3A 4PAAA 2YNHB 2WONA 3PZPA 1FJGF 1UEKA 5AXNA 1IKXA 2Q1LA 2U2FA 3ISZA 4DCJB 2XBPA 2W5WA 3WAVA 1X5OA 4QBUA 4DL4A 3BN7A 5HSPA 1G2EA 4L3KA 2FB0A 2W9BA 2WVCA 2A1BA 3HVWA 3I9ZA 3OL7A 4ITSA 5J2MA 3OFHA 3PM9A 4WFZA 2QZ8A 1NPPA 3MM6B 2HLTA 4PWUA 3DLHA 4B9VA 1QY7A 4YR0A 4OI0A 5G4DA 1QJHA 5HQLA 1VIXA 4MH8A 2JL9A 3ZO7A 3TAPA 1AYEA 3MOZA 1C0TA 2AYBA 5KFCA 1RTZA 3H5YA 4RNMA 4UPIA 2YQ3A 3D7SB 2GMLA 1U49A 3FQKA 1MW7A 2HIQA 5FD1A 2G0JA 4LR8A 1RT6A 2MQ8A 1GX6A 4DSIA 1QE1A 1HHSA 1YZ7A 2AKWB 4DV5J 4WU3A 2YNIA 3MD1A 1NKCA 2BE2A 3F73A 4NXMJ 2I1RA 1PC5A 3TUJC 2V9WA 3CW2C 2E5LF 1TKTA 2MKIA 2NSCA 1FKOA 5BYQA 4DEZA 5AE2A 2HZCA 4CLKA 4K4YA 3H5SA 2GQ2A 2QA4S 2N4CA 3JSBA 5ETVA 3CJSA 1FFSB 2YKOA 1VR6A 1K7HA 2VA2A 2CPIA 4Y2IA 2XC9A 1RAHB 2XMUA 1DLOA 2AGQA 4USIA 2ZHBA 4B9LA 2J0WA 4Q8EA 2W9CB 2X1BA 4KKOB 3NRBA 4DI6A 2VOPA 1V9OA 3TAMA 4I2PB 4DX8H 5HROB 1FA0A 2IJFA 2DGVA 5KFAA 3FJ2A 3D4JA 3KK1B 2XMAA 3SMZA 4NE9C 1N34J 2PE8A 5FLXY 1NK8A 2UVWA 4CYUB 2CPFA 1GEHA 2MB0B 4NXNJ 4GVBB 4HT7A 3LPEA 4QWBA 5DQGA 4CH1A 2XZDB 4G1QA 3D6MB 3T01A 1WC5A 1PJ5A 2KH9A 4QPTA 2W2OP 2XMJA 1H72C 2HHTA 2VB6A 3RG6A 2VFSA 3FBBA 3KLGB 3UNYA 1T9XA 4C98A 1K0VA 3UN3A 1OO0B 3FEZA 2MTLA 4M5HA 4PWWA 3V5RA 3CO0P 3IM9A 3OR1A 2X51A 4HKQA 5D4LA 4ICLA 1UVKA 3NMAA 1S77D 5D8HB 1TL7A 2UV8G 3T5HA 4B02A 5F3TA 4NLXA 3G82B 5KFGA 2AYEA 2KHDA 4GTYA 5AJ9A 4DHVA 3F44A 4UY85 1XMOJ 5FIIA 1K73T 1FK9B 2VC0A 1I1GA 4PUOA 1FRJA 1M1GA 4DUTA 5C42A 2ZKUA 2X1AA 2XHCA 4YHHJ 3NGTA 5HMYA 2CJQA 2PD1A 2C2EA 1AZSB 4EBEA 2HAFA 2GHVC 1W25A 4WYWA 1FJEB 2R2SA 4CH7A 4JV2A 2XM3A 2VFTA 2CQDA 5C2GA 4K8RA 4EFAC 5LSOA 2HWHA 2YXLA 1HHQA 3AAWB 5G0RA 3HPOA 2Z2YB 3AQOA 2KN4A 3ZC4A 1S72S 4ZS6A 3VHQA 3D68A 1IBLF 1FD8A 2YWFA 4N77A 2XI2A 1WD6A 1MWZA 4RW4B 4ER8A 3PX4A 1SBRA 1FKAF 4MIBA 4A8FA 1UWAA 4LFAF 3CDAA 1H3DA 2YVSA 1F9HA 2HFUA 4M1KA 5HO4A 1IBKF 4Q5VA 2FJXA 4IR9A 3EVWA 4CIOA 4KY3A 2V2VA 5HP1B 5CZVA 4UPKA 3RUBL 1KHNA 2ZDOA 3HI9A 4HHHA 1RTHB 4IO1A 1LEOA 2N82B 2ZH2A 2B4UA 4UORA 4PKDB 3NMRA 1WKKA 2J6SA 1VJQA 2CQIA 3IMQJ 4NLUA 3R7NB 1S1WB 1AT1B 3VCDA 1D9DA 3CGIA 4X4NA 2E1MC 4O3OA 1RA7A 4W92B 4V19X 1MSWD 2I8EA 3KLVA 1PG5B 4URGA 3F56A 4I7FA 3GE9A 4DV5F 3M8WA 4A8YA 1WI8A 1JKHB 1FCAA 4NXMF 3M05A 1RT5A 2PO4A 3D0GE 2F8HA 4ETZA 3BBBA 4ED3A 2BQRA 2XNQA 4JI4F 3PYFA 2OGUA 3OTDA 1P9QC 1WHYA 1B7YB 2K7KA 3ZTRA 3MAHA 3RR7A 5ETNA 3C6TB 4ED4A 1D0EA 4LRFA 2HGNA 3QZ8A 2BANB 1X9MA 2GX8A 4NLTA 4UOCA 4P2SA 5D3GB 3SCKE 3GZ7A 1XTZA 3POTB 2VH7A 3C15A 3KDNA 1RAFB 3HKZD 1UVIA 1CVJA 2GLQA 4OHXA 3IG1B 3GONA 1S9EB 1RWMB 1TKZA 3HVTB 1RAJA 3HX9A 3DOMB 4QIWD 2HS4A 4PG8A 1EX8A 3EDRB 3ICLA 5K9FA 4CLFA 2HQDA 4IO9Q 4KC5A 1KOOA 2JFDA 5DO2A 3K5NA 3PR5B 2C2KB 5LJ3Y 2V8PA 4WP9A 2D74B 3SQGA 2FVCA 2F65A 1TMMA 3R5DA 3QJPA 2HQCA 1HYSB 4L6V3 4ECXA 2FLOA 1JK9B 1WG5A 4JI6F 2RSQA 3IRXB 1Q16B 4DG1B 3EVMA 1KLMA 1XJWB 1S48A 2J6TA 5HVHA 1RE1B 4QJVA 2KM8C 4IYQA 4B3SJ 5ETTA 3IN5A 1FWLA 1UFLA 3BYPA 5F8LA 3W7BA 1XMQJ 2R9LA 5B08A 3CCQS 4IH5A 1F1BB 2ATCB 4QIGA 3VQSA 4ANDA 3UCUP 2VDIA 1IBMJ 1FRXA 3V6DB 5A6PA 2HHHJ 2NQPA 4P74A 4FS1A 3N6NA 3NWRA 2XSFA 1MMLA 4YHHF 2R8KA 1S59A 1VOMA 2RDIA 2CAJA 4DX7A 3LPYA 2YKNA 5HK4A 1S0MA 3UDCA 4ZVFA 1REVB 2BM0A 3BGFA 3MMCB 1NK0A 3ETMA 2J0SD 1VC6A 4LFCJ 2PI4A 4J9RA 3W64A 4ZG7A 4OYPA 4K4XA 2HNZB 2W8DA 5IT0A 3QGIA 5KFLA 1N36J 2QYGA 2HQFA 3W5YA 2BABA 5IZHA 1U2RA 3QATA 2KJWA 2ZWOA 4HR2A 3VAJA 3DGPB 1B70B 1UVNA 4I69A 2MHNA 2KXFA 1I51B 3M2VA 1B99A 1KOHA 3G6VA 4QU7A 4LSLA 5IXUA 3K2YA 2NYIA 4PQUA 3HJFA 4OYMA 4DR4J 3V81A 1WELA 1NK7A 1Q78A 4HEA9 4WYLA 4USWA 4ECSA 4X4QA 1UVJA 4P9SA 4ZLNA 1ELZA 4H4OA 3CCES 1SVDA 1RACB 4MKAA 3Q8SB 3J81j 3J80U 5CABA 3D1OA 3AY0A 3NAIA 2KTQA 5LSLA 1SIZA 5JVGQ 3DLEB 3DRPB 4OJ1A 5CYQB 5IC4B 1YJVA 4U6PA 4MAKA 3U1NA 1KVKA 5HMZA 2FZGB 2JDJA 2VV5A 4QAXA 1ZZFA 3SZYA 1HBMB 2XO7A 2QA2A 4KPYA 2MZJA 4F4XA 2OPPB 5D0HA 3Q2SC 5HI7A 2IPOB 1FKPA 3CD6S 1HBNB 3LALA 4AT1B 2OIHA 1NSAA 4FZVA 1F0XA 2EKNA 2H4WB 3HF5A 1ANJA 2ZE2B 3QT5A 2B0GA 3K7RA 1VYAA 2DO4A 1GK8A 2CUYA 5B0AA 4DWIA 1ZAWA 3A3OB 3S1TA 1U6ZA 3MUMP 3EYZA 1SV5B 3G86A 3OUYB 2WB1D 3A8EA 3KJVA 4M5MA 2WSFC 2IRXA 4U9RA 4OX6A 4LRAA 2FGCA 5LT5A 1FI4A 3MM9A 3PY8A 3GIMA 3BDHA 1UETA 4W90B 3H4BA 3L4BC 2HPUA 3AB2B 2CQGA 3NKYA 5IS2A 1GMVA 2CWXA 4F25A 4M5IA 2HFNA 3ZZTA 4JV0A 2Q3PA 2WCXA 2HVDA 3A8KA 4WFNQ 4QR2A 3I5BA 4OZJA 4DV1J 2P5VA 3PYEA 3BZQA 3CMRA 4F26A 2F63A 1QLNA 3R8YA 5L9NA 3A13A 3MAAA 3G87A 4ZPAA 1SJ3P 1Y11A 5KT4A 4U7CA 2ZBCA 2Y0BB 3TQ1A 4YFUA 1NXIA 1LW2A 3TG0A 3KG1A 3DFEA 1EP4B 2NYHA 4ZCMA 1VBZA 1ZPWX 1JLCA 2Z2LA 4LVNP 3W5ZA 5KFYA 4P73A 1XMQF 2ATLA 5CYJA 2JOQA 4J37A 2V69A 3GV8B 2H48B 2HHHF 5KFFA 3IFEA 4DSLA 4YMEA 3D5MA 2O01C 3KXDA 5HAOA 1PBAA 2VQRA 2F9JA 5A8RA 4WTYA 2V4RA 3D28A 2QT7A 1R8CA 3BSNA 4LFCF 1QDUB 5M2RA 1KHWA 1SHNA 3NVLA 1FXDA 3RBDA 2JVOA 2V6AA 3HHLD 5I4MA 1S1UB 4A48A 2EFNA 1C0UB 5T7LB 2X1FA 3AXKA 1FVQA 3VAFA 4NYPA 2ACMA 1SH3A 1YG0A 3LGHA 3R5CA 3PRDA 2L41A 2O1PA 2P2CB 4USKA 3LWMA 4JYAJ 2YKQA 1Y3KA 5A8WB 1RTIA 2O5DA 4QIFA 4B3TJ 1UKUA 3UVJA 2M4MA 2EK1A 1T9VA 2BOAA 4M5LA 2QEXS 5F8GA 4ECYA 3TANA 3BB5A 1K1QA 2OPSB 1LWCB 5LL6d 3HP6A 1RAOA 2E5JA 2HS0A 2ZBRA 4BWJA 4HL9A 4QWAA 2R3VA 1JXEA 2PGCA 3J81U 1QVFR 3G9CA 1JLGB 2HFOA 4DR5F 3AXMA 1JX4A 5L0EA 3EWGA 1XIQA 3R7SB 4USTA 2MSTA 4YB5A 4RUHA 5I42B 1AA1B 3PW5A 5IT9U 1PAEX 4WFBQ 3BSAA 2DGUA 4JI7F 5J2QB 2HNDA 2YNGB 4CO2A 1RT2B 2IC3A 1YQHA 2IJNA 1GXUA 1KVIA 3HO1A 4C7QA 2XG8A 4C0OC 2E9ZA 1VQPS 2DGSA 3D1QA 1C1BB 2CJKA 1RWNB 3W8GA 2IFXA 1S4EA 1TUGB 1AJDA 3MPYA 2XCAA 2F4VJ 5LMNJ 2FHJD 4C11B 2ZVIA 1WACA 3RU0A 1VQ7S 4ZHRB 4PPDA 5KT5A 2VBZA 4PG7A 2OPQB 3ETOA 1X4AA 4OQJA 5GMEA 3PO4A 1EW9A 4J5OA 5LRMA 2CNLB 1ELOA 3EGNA 5FDLB 3L7UA 4O23A 2MLYA 1JXLA 1KS2A 3P6YC 1O99A 5GAGI 2BKNA 4DL6A 5GAGU 3OTOF 5EWEA 2CG4A 3KJQB 1PYOB 1L3KA 2NZCA 3QLHB 4RBTA 2V4QA 4DV1F 4KGKA 2J0QD 2D1CA 1M5PC 1X8DA 3C6UB 4W4MA 4WBFA 5F8NA 3F41A 1GAOA 2V2KA 5HMXA 2A10A 3CDBA 2JLGA 4WXWA 3DXSX 2H3EB 2XY7A 2DH8A 3BEGB 4DV2F 5F8JA 3GWCA 2JEJA 5D0GA 3GMGA 4GTXA 4B17A 1RCOB 2J8SA 1RYSA 2AJFE 2FJEB 3S6EA 2J8AA 3EZUA 4DL2A 4X4VA 1IKYA 3GIJA 2I5JA 2Z30B 4JI5F 4WKRA 3CWJA 5IV3A 4DL7A 1V6HA 4LIRA 4N8OA 2N7CA 2IY5B 5K8MA 1TKDA 3PV8A 2GSNA 5CYMA 4R8UB 5LQQA 4ED7A 1IR0A 1YHQS 1S1VB 3K89A 1NCLA 3DHXA 5KG3A 1HPZB 1VQ9S 3SYZA 4DX5A 3QMQA 3KK3A 3LAMA 3PG9A 4GKJF 4BHQA 4WCEQ 3D3BJ 3RYLA 3K5MA 4NLYA 4DQPA 2VZ9A 3MEGA 3MMAA 2ZHAA 3BN4A 3MEEA 5KT7A 1KD1T 4JUZA 1VDHA 3RRGA 2JEGA 3BDGB 4B9SA 4YOEA 1Y0HA 1GNKA 3OQ2A 3C16A 2IMOA 4JYAF 2XWXA 3MZIA 1HDHA 4PPZA 5ITHA 4LF4J 3DOKA 4K50A 3MM5B 1PKUA 3QT6A 3J7A1 4ZOSA 4NWBA 5BJRA 1CJTB 2FJVA 4KT0C 1RWKB 1IKWB 3KUEA 4DR2J 2FY8A 3JQJA 4XAKA 2L9WA 4X66J 1D3WA 4X65F 3I55S 3Q86A 3LXQA 4V19J 3VAKA 1WHXA 2KFZA 1RU1A 2VL1A 1AFIA 2MQMA 2KB2A 3W60A 1B8JA 3D66A 3GJTB 3GJRB 3QNWB 1FRLA 1HI0P 4OX9F 4ECUA 1SH2A 3HHEA 1B3TA 1U6FA 2W9BB 3DYAB 2KHCA 2M0GB 3QAEA 4Z7CA 1PYTA 1S10A 4AXJA 3PXGa 3Q89A 3M2RA 4RNHA 1ED9A 5E5NA 4PWDA 1IKVB 4IH6A 2R7TA 4LRBA 2UVVA 1WF2A 1UEVA 4USHA 1JWWA 3H5XA 1TR0A 3M8QB 2F4VF 4RUBA 4JV1A 4NLRA 1GH8A 3PDNA 2QGFB 2JX2A 1DY3A 1NZAA 2UVUA 3BS9A 2VHGA 3G8QA 2YNFA 2EVZA 4I0WA 4CO0A 2MSSA 4NA3A 1HNZJ 4P2XA 3N5BA 3EM1A 4O0NA 2OH2A 3MGJA 1Y5IB 2WOMB 4X4RA 3KDOA 4ECQA 3MM8B 3BDEA 5KFBA 1O6XA 1S79A 1XMBA 1BWVA 2RKIB 2FDNA 2CNKB 4O3SA 5DLGA 4KO0B 3S7RA 2YKAA 4Q2MA 2R7UA 5SUHA 4LR9A 3AJ1A 4ILRA 1WOPA 1GQEA 4WZQA 2FHMA 4P52A 2WVBA 2HFVA 3MM6A 5IWAJ 3UFCX 1R89A 2O3DA 1VQKS 4WK3A 6FDRA 2A6MA 1K47A 1RA6A 2NPIA 3BDFA 4O3NA 1SPBP 2PEHA 3A1YG 1WG4A 3A3NB 4DPWA 5B0FA 1AXQA 1AUDA 3PYGA 2LFVA 5KFSA 1URBA 3R3TA 4GVLA 4CO5A 1Q81T 4HVZA 3M9NB 3CE8A 2DK2A 2W7PA 1Q95G 4KJDA 2EC0A 3FKBA 5KFZA 4J90A 5K5MA 4B3RF 3ENVA 2E9TA 5C66A 1RB0A 1TKXB 2RIJA 2DISA 4UQGA 2P9CA 3I9V9 3MR7A 4FPRA 4RL1A 2KFYA 4E0DA 1KHKA 4NLQA 4YQWA 4WXOA 2A3JA 4RKUC 5INHA 1N54B 4BWMA 4AUKA 3HXMA 2CXEA 2WBRA 1FERA 1VFJA 2VG5B 3CJRA 2DYAA 2LQ5A 4XIUA 4B3OB 4KBIA 3M2UA 2DO0A 5ETOA 1V3ZA 2J7KA 4NWJA 2UV8A 2W9CA 4JI0F 4KKOA 4C6AA 2CPHA 5HROA 2BJ8A 1HQUB 3ZTQA 4CZCA 4KFBB 1NSPA 4PABA 3L7PA 1ALKA 2EFOA 3KK1A 2V34A 4K4TA 1HJKA 3W8PA 2V5HG 4KM4A 3CXCR 5C42B 3M6XA 2NXEA 3LANA 2XSJB 4QQBA 4CYUA 2DHHA 4KYZA 2V9KA 4GVBA 2K1RB 4QCLA 3CNQP 3HT0A 4J9UE 2LVWA 4KIAA 2HLUA 4DR2F 2CZ9A 1ZA2B 3KLGA 2QL7B 3B8HA 4JBCA 2V63A 2UXCJ 3BGUA 5L39A 4Y00A 1G7CB 2XYHB 3GYNA 4OHYA 1T95A 3CO9A 5J1NA 1RWUA 1HQAA 4LT6A 5AE3A 3SCLE 1EKRA 4OLPA 4A8MP 1ELXA 4PG4A 1HR0J 3G82A 2A18A 1VBKA 2Y0SD 4DMZA 3VGUA 1EQ0A 1ZTWA 4QW9A 1HQEB 3EDQB 1FK9A 3G4SS 5KFHA 3G6ES 3HSDA 1U26A 1T9TA 3BPDA 4OYWA 2W5SA 1ZEBA 1ZEFA 3DLJA 4YDXA 3EGZA 2LP4A 2HFZA 5LMUJ 1RHJB 2HZVA 2IM3A 3I5AA 1VQMS 1Q7YT 4FBTA 2OD4A 5HATA 3QYYA 1CC8A 2CQ3A 2IM1A 2Z4PA 4G3IA 4XPEA 3CSKA 2BRLA 3CJ5A 4L74A 4GKKJ 2KL8A 3PEHA 2B9XA 4RW4A 3FBEA 3BBFA 5D77A 1NUEA 3GV5B 1J5EF 4QU6A 4O44B 1UTAA 4Q8FA 4MJKA 1NJZA 1LXNA 3OFEA 1LKZA 4ZGAA 1URAA 3LP0B 3I5CA 4UZCA 4OX8A 5E3RA 8AT1B 3HFKA 5HP1A 2ZZTA 2BJ7A 2CPDA 3E2DA 1FFWB 4IFVA 3ITHB 1Q1KA 1N2KA 4TXSA 1HBOB 4URQU 1RTHA 5IWAF 3JQMA 1LWFB 3QJJA 2BQUA 3VZIA 1Q4RA 4ZVQB 3CMQA 2CWKA 1BLUA 3QT8A 3TOQA 3J80Y 3ENAA 2BJ3A 1S1WA 2G9YA 2KRBA 4FP9A 3BDPA 2J9CA 2HGLA 5KFQA 1GXLA 3CB4A 1FT8A 5K8OA 4DV3F 5JVHQ 3SXLA 2D69A 2DNMA 4BBYA 3PIPQ 4CI0B 4NRTA 4E98A 2VFRA 2ZH9A 1JKHA 4HTJA 3MEDB 3OVAA 3KHGA 3NGRA 2XULA 4OJGA 1JIHA 5CCMA 2OFGX 1YDLA 2FJWA 2HHQA 1KC8T 2GV1A 3HDSA 1X4GA 2GS8A 1XQIA 2MKKA 3A52A 3U7JA 1UJ4A 2VU5A 4FKYA 2E5HA 3LOUA 3C6TA 4XK8C 2YQ1A 2H5IB 5MLCV 4ED1A 2XGQA 1N0VC 2BANA 2N3LA 2AYGA 4EYIB 1RT1B 1Q82T 5IT4A 5D3GA 3SZZA 5M2PA 1D9FA 2X3GA 3KJFB 5AXMA 2LA4A 2I9SA 4USJC 4TNOA 5IFMA 1REGX 3OTEA 3FSIA 4DOZA 4J9LA 5HBMB 3IG1A 3OR2B 1RLCL 3HM9A 1S9EA 1YGYA 4NMLA 4KTQA 3KLIB 3WBZA 3HVTA 3QWUA 3BO3A 1UFWA 5T41A 4O3PA 4F4KA 1DRZA 3BH6B 4DR6J 3ZZRA 3PEJA 7FDRA 4FXVA 1KH4A 1R31A 2F1FA 1SKRA 5KFNA 2FC9A 3UW1A 3KHLA 3BJYA 1NK4A 1HI1A 3PRBA 1WOSA 2N3OA 1HYSA 4F4WA 1CBKA 3AHPA 3B4DA 3MECB 1D9AA 4NEYA 1R43A 3IRXA 2MPUA 2ANHA 1BD6A 2MQNA 4TU7A 3B54A 2XR9A 4DG1A 2HHXA 3X3UA 2J6UA 3GFXA 2ZC4A 2F8MA 1VQLS 1PBUA 1HR0F 3R5BA 2L9NA 4QYZJ 1HNXJ 1Q8LA 2E5IA 3I31A 3V6DA 2DGQA 3NP5A 4HLBA 4X4SA 4GC6A 4UQTA 2ILZA 3H42A 4EBCA 3T41A 2BACA 2GVDB 5AT1B 1BC6A 3Q8VA 4UT4A 5ETMA 3IAM9 2CA9A 2AW0A 1REVA 3MMCA 5LXRA 2DGOA 2G2ZA 5LMUF 2DRBA 1ALJA 3C2PA 2HNZA 5KFPA 3KUHA 3B5QA 3FFIB 3SV3A 4TU9A 3NEKA 4PEOA 3IAS9 1FTRA 1HQ2A 4OYXA 4CCHA 1UZHA 3U1MA 2B9EA 3T9NA 4EUVA 4ZIVA 1U1RA 2VUGA 3LQVA 5ETKA 1WC1A 1XR6A 3DGPA 2D3O1 4GKKF 2G9OA 4UOGA 4ED5A 4TLQA 3M6WA 2LQBA 2UUTA 2BDPA 4ES2A 2W8KA 4ZCIA 1SL2A 1I5OB 1I94F 4BC9A 2YWWA 1RT3B 2HRTA 4ED8A 1N5YB 8RUCA 4DLGA 3DPCA 3VGTA 1P1LA 3SFUA 2NUUG 3BREA 4DLEA 1VISA 2HGMA 4CT9A 3CJ0A 4P71A 4JB8B 1WKJA 1VRUB 3KLHB 1UL3A 5C25B 1WF1A 4MK7A 3H7HB 1D1UA 2ABYA 4TLRA 4WFYA 1SKUB 4PXBA 2CJYB 1KFSA 2GO9A 3D54A 1J2VA 3DRPA 3QQCD 2E1CA 5DZ6A 4HHUA 5CYQA 2L9DA 2LEBA 4Q44A 4UUWA 3THVA 3RR8A 3J81Y 2WSCC 4QYZK 2RE1A 2G1HA 3IR7B 3SSQA 3AOBA 4LF5J 5IT9Y 2KT5A 4OIXA 2FHJA 4NLGA 1MU2B 2V4JB 1JLQA 5CCLA 4LIWA 3CJ2A 2VA3A 2Z58B 1JXVA 3VGSA 4ES3A 1HBNA 3MR2A 4K7QA 3CCZA 2BJ1A 4CM2A 4HACB 5A76A 3WQPA 2ZE2A 4R0JA 5L1IA 1MNEA 3HFVA 2PMWA 1Z1ZA 4MIWA 2GJIA 1SV5A 5F0UA 4LF9J 3OUYA 2K06A 3WIUA 4NLPA 4ECZA 2CZ4A 4CYSA 3W63A 5HVGA 4UOOA 3T1AA 1EETB 4ZP7A 7FD1A 2IRUA 2KVQE 2VKZG 1VMBA 1CJVB 2YX7A 2M70A 2MY7A 2Q66A 4CLSA 1YJUA 4JV5F 4IG3A 5KFKA 3C19A 1F5CA 2DR7A 1HLWA 5C24B 2MJUA 5A8RB 1E33P 2DKOB 2KRRA 3TEGA 1ELYA 4DS5A 3NGKA 3DN9A 1VS3A 2RS8A 3GSIA 1J27A 4FN5A 3K58A 3BGOP 4I6WA 4B9UA 2GJ2A 3HD1A 1RKJA 3G6XA 4FYVB 2BW2A 2WVEA 1SH0A 2BQ3A 3MURP 1EP4A 5DDPC 2HHUA 1UWBB 3EX7B 1YJWS 5KG0A 2KT2A 3DOLB 2C3UA 1RWWB 3SI8A 3V4MA 1B0TA 1FDAA 2ZH5A 4TVAB 1IWAA 3E01B 1O51A 3H8YA 3OTCA 2ZKTA 4ID5A 3JTOA 1GTEA 4Y2KA 5E3QA 1S6OA 1KQFB 4AQYF 4FF4A 4DU8A 4ELUA 3UN5A 3PX6A 1ULRA 1UA1A 1UVMA 1B0VA 5KFXA 2E66A 2JEFA 1S1UA 4TY9A 4LR2A 1C0UA 5T7LA 2EK6A 1RLDA 5E41A 3FK4A 3H40A 5EDWA 2QJ3A 2QE5A 5H1SV 4F2RA 1FWKA 2J9DE 1URRA 5J1EB 2KYZA 5EWGA 2B56A 4OI1A 5A8WA 3UCZP 1WC0A 1ZYQA 3FMBA 4P2MA 1IM6A 2P9GA 1KFDA 2HW3A 2OLWA 2C42A 2MDAA 3BKUA 3Q8RB 5B0EA 4CNZA 1FNMA 1KR4A 3FBFA 3TZZA 1D8ZA 5GMDA 2QTWA 2OPSA 2W2NP 1LWCA 3TJ9A 3L95X 1RWOB 3W62A 1T8EA 1JLGA 4KR0B 2UVRA 3EE3A 1JJCB 1FJGJ 3TVKA 5I42A 4CDIA 1RT4B 1ZAVA 2CADA 4KHRA 5D4OA 5J2QA 1CG2A 2P8IA 3ZZZA 1HA1A 4LF5F 1RT2A 1S7HA 1NSQA 1NB7A 4L73A 4CLPA 2IM0A 3UD5A 4C8YA 4CLUA 2DR8A 2RH3A 1CJUB 1C1BA 1U1QA 2EI5A 2MY8A 1GT8A 3IGNA 4YB7A 2DRAA 1UJ5A 1X4HA 4PYAA 5EWFA 2GC8A 2HHPA 2R8HA 1HNWJ 2DH9A 4DF8A 1BUXA 4ZHRA 1S1XB 2H5EA 4RZRA 1MG7A 5H9FJ 1X60A 1Q86T 3AODA 3GIKA 1IKYB 2EFVA 2I5JB 4DQQA 1Z2LA 2MQLA 2W01A 4FS2A 5E3PA 5FDLA 2C3MA 2GAGC 2HNYB 3LP2B 5E33A 1WORA 4ZCLA 2BOPA 2J7UA 4EZ6A 3BSOA 2KZZA 4P6QA 2C3PA 4O3RA 3BQ1A 1FRMA 2CJXB 1YWXA 2ZBQA 3D2WA 5E3AA 1DTQB 2DHSA 3C6UA 3HSZA 2W4CA 4OI2A 5IM0B 4D3HA 2RQMA 1RDRA 4J9SA 3A8IA 4ZITA 3AOAA 2YWHA 3OL8A 1EAYC 5LSRA 2NR0A 3BPSP 2C2RA 1U45A 3CCLS 2OEJA 1Y3JA 2C28A 2KT3A 3E3XA 4MY4A 5KG5A 4K4UA 1C4CA 2XCPA 1X4DA 3G96A 3QGGA 4JI1J 3TJAA 4R8UA 5L0KA 3K5LA 2VD3A 2GW8A 1S1VA 3RAXA 2Y1JA 3N6MA 1SL1A 1HPZA 1M1HA 2BW7A 2WW8A 1H38A 4MHXA 1VRTB 4ELTA 5B7WA 2RHQB 2PC6A 5KT6A 1VC0A 3GILA 2PI5A 1AJAA 1PYSB 3V6JA 2RH6A 3H25A 5H9FK 2QA1A 5LIAA 3TW0A 3U27A 3DI6B 1YRXA 5KFDA 1QUPA 2I38A 5JXSA 3M8SA 1ZOTA 4ANEA 3I0RB 1JLEB 4ETXA 1HL6A 2RT3A 4Q7AA 1N5SA 4LRDA 3BDGA 3FBCA 3UE2A 3B4MA 3QJLA 1WUUA 2LYVA 1ZZNA 4TU8A 3OSNA 2HSEB 3QRRA 3CJKB 1N56A 2EBEA 3FQLA 3AD8C 2ZOFA 3MM5A 4Y3CA 2DGWA 3TVZA 3M2RB 2HHVA 4QR1A 1CJTA 4ZG9A 3HLUA 4F04B 1IKWA 3K57A 1QAJA 4K4VA 1SIWB 1U48A 2ALYB 2CKWA 3PW2A 4UOFA 1EB0A 2CFXA 3MFIA 2CQ2A 3R2CJ 4U8VA 1ITPA 1DQ8A 5A6WA 5DDOC 2KDOA 1IBLJ 3RTVA 3ZZPA 4CLYA 1HI8A 4LMZA 1IUJA 4C3LA 4LFAJ 2IA6A 3TO8A 2LMIA 2QC3A 3CDWA 3VAIA 2O67A 3OLAA 1IBKJ 5HJYA 1ZBTA 3PVXA 4HYKA 3DYAA 2HHWA 4RW9A 1NNDA 3TNVA 4ZVUB 4O4GB 2P9EA 3K5PA 1UFKA 2VQFF 3GYGA 2YKMB 1QSYA 1IKVA 2B8QA 2ZD1B 5RUBA 2XMWA 1NDCA 4QW8A 1NJYA 4JI2J 3M8QA 1HWKA 1Y5LB 2HHSA 1HNWF 2POKA 1E6VB 5DLWA 3KKFA 3RJMB 2XYGB 3OTBA 3FGVA 4MTPA 3I4PA 1LQ9A 3RAMA 4U8YA 4RBUA 3RRHA 2WOMA 3MM8A 5LOQA 1T03B 1D8YA 3RBZA 3BYRA 4DBQA 2V8DA 2ZOGA 1YX2A 2RKIA 4DR3F 4NLWA 3R27A 2WTFA 4KO0A 1KHJA 4WPAA 4JI4J 3MCNA 3GV7B 1X5TA 2CRLA 4A47A 5JJBA 3GLJA 4UOHA 3DNCA 4OZ2A 4DPYA 4OLOA 2C3OA 3JAMU 2CQPA 1RHKB 4B9TA 2HVEA 3M8PB 3TI0A 3GCWP 4KSEB 4F50A 5L9XA 4OX7A 2AWZA 1H2TZ 4S0MA 3M2UB 1OQ6A 1NHUA 2VBWA 3HULA 4WKYA 3K8VA 4ZVPB 4JI3J 4A8SA 1VJWA 3ET6B 3DDIA 3ILIA 1XR5A 1TV6B 3RGIA 2FVSA 3LH2S 4AD6A 1RGVA 3MD3A 5KFJA 3SCJE 1SHQA 1NU4A 4OYZA 3TP2A 4RJVA 2VODA 1JQGA 3IXQA 1E3CP 4HHJA 4DU7A 3C14B 1TKXA 5F41A 2LU1A 3G71S 3DXBA 3O1LA 4ENOA 2DNNA 3CDEA 4JI1F 3H2LA 1F5BA 3DRRB 3CJ8A 3T1HF 3IC1A 3JXOA 5ETLA 5J1PA 4L72B 3AOCA 1Y10A 1VC5A 2PIIA 3V6HA 2ASYA 3TAQA 2DNRA 2DXDA 2BBEA 4UY8T 2VG5A 1I3OB 1CC7A 2MGZB 4B3OA 1AJBA 4TN2A 4JI6J 4WZMA 4Y0FA 2ZH4A 3RB0A 4ZIWA 2ZZMA 4DV7J 3SIPB 4G1IA 1UZDA 1U1KA 2PMZD 1HQUA 3GG0A 4KFBA 4OV6A 1Y00A 4ECTA 2V94A 2E5GA 3NS5A 2A0FB 4YUDA 2D3UA 1SJRA 3T19A 5AXLA 4LREA 2H4YB 3L7OA 4RUCA 2XSJA 2EPIA 2DJWA 5EGHA 1C4AA 3CCWA 2K1RA 4LBPA 4LF7F 3T5LA 8ATCB 4EO6A 2APOA 2EFPA 1S12A 2DNHA 1X5SA 7AT1B 4KRWA 2R7RA 2CQCA 4KV8B 4MKYA 3LGNA 4YDDB 1WJ9A 2CQHA 1ZH5A 3RW7A 3CIZA 3MK2A 2R2TA 3HCXA 2RS2A 2BKPA 4Q43A 4XDCA 1NK6A 4M63A 1RTDB 5BR8F 3KNGA 1AFJA 1WEYA 1OY8A 3CJ3A 4ZPBA 1HQEA 2VASA 4GO5X 4RW8B 2DEJA 2C2MB 1LFWA 2ZITA 1HWIA 4U7UK 4AXIA 2B8PA 2MLZA 4IFVB 2ROPA 1YK9A 3VVUA 3C46A 2Y1RI 3Q3QA 3M32A 4AFFA 1VQNS 2ZH3A 1W2BR 2OPRB 3X1LB 3EXCX 3M1VB 1FX4A 3THTA 3CIMA 4F4ZA 3DKDA 3QFHA 4ECRA 2FJAB 4JI2F 2DH7A 3OW2R 1K9MT 5KTQA 2QL9B 4QOTA 3DU5A 2XY5A 1IVZA 1U1LA 1TFYA 4TKTA 5HL7Q 3NGDA 4PG6A 2MJNA 2YQ0A 1U2CA 5IJSA 3VAHA 2E7XA 2YWGA 1CJKB 3JTNA 4O44A 4IRCA 5GAEI 1CLFA 5FJ4A 4HH1A 4Y34A 2OTLS 1WKLA 2M5YA 2ZOMA 2K7JA 5JUMA 3LP0A 2ZBPA 2QLXA 1RU2A 2F3JA 2XEXA 3ADAC 2C2NA 1IJFB 3OFFA 3KMSA 4JI8J 3UD3P 3ITHA 2HMIB 2HBQB 1HBOA 2BV3A 2J7WA 4I56A 3AB4B 1LWFA 3RB6A 4PYDA 4LFBJ 3BH7B 2L48A 3KHRA 4ECWA 3NLCA 2VPWB 4PR6A 4JI3F 3IBCB 4EU0A 4C0HA 1KN6A 1RUSA 1TL3B 5ADZA 1UW9A 1TK5A 1FE0A 2WVDA 1HNIB 1SJ4P 1OY9A 3OV7A 4KQZA 3W9HA 3NCRA 1VRQC 1HKAA 2FZCB 4UF4A 5I3UB 3MEDA 2LA6A 3VF0B 2VPYB 4LF2A 1FEEA 2VFVA 1S7IA 4FDJA 1ZAXA 2DPIA 2NPFA 4C8OA 2DXFA 1ZM3A 4DSJA 4DV0F 4WTOB 2OSQA 4PXDA 1R0AA 3ZFVA 1ALHA 4ERDA 2OSRA 3PR4A 2R7SA 4CH0S 2YPYA 2G1DA 1RT1A 2OUGA 2HZAA 2OJ3A 4KH0B 3NOCA 3N28A 3UWTA 4DV7F 3CC7S 2JLEA 2X1GA 3CCUS 2DNOA 4CM0A 1Y7AA 4NPOA 3VV2B 4XO0A 3MK1A 5HBMA 3OR2A 4TYBA 3MTJA 3ISND 1BQXA 3KLIA 1X4CA 3THPA 2WBMA 1BE4A 4P2FA 4X2BA 2JNJA 4O0IA 3NG8A 1BWEA 1S49A 1WWHA 4OJHA 3JSMA 1KBRA 4OI4A 4DF4A 1Z2ZA 4NL5A 4NYOA 5AE1A 2UUBF 5BYRA 4ZMMA 5GRRA 2BXJA 2R8GA 1RAAB 1Y9OA 3NKPA 2E29A 3DRXA 3FSYA 2Y8YA 2H1YA 3UQSA 5DGBA 4WFAQ 2QMXA 2HQIA 3MECA 3MCMA 3Q2TC 1TQLA 3JQKA 1VQSA 2Z57B 3MPUB 5KFRA 3R6LB 5KG2A 3MAQA 2B4OA 2BZ2A 5HANA 2W9AA 2DBBA 2C2OB 2R7XA 5GADI 3BR9A 4IKAA 2BMBA 5GADU 1FDBA 1E6YB 2LEAA 3MI7X 2GVDA 3ZNUA 4DL3A 2RF2B 4KHMA 4B9MA 5B0CA 1JLBB 1TELA 4DQSA 4OFZA 3OXFA 3CPWR 3IWXA 2WZ1A 2BJDA 1RSCA 1UW4A 1UVLA 2AT1B 1OPZA 1XN9A 2M88A 3FFIA 3VAMA 4DR5J 2AYMA 4ZVHA 3ZZYA 4HI2A 3P5BP 3PRVA 4K5SA 4LBHA 4Z2XA 3AA8A 4IR1A 3T1YF 5D15A 2IYIA 3TUIC 2I0XA 5CH7B 3CF5Q 4NLOA 5EX3A 3EGWB 4JI7J 3Q83A 3I6PA 3EVOA 4MFBB 3KK2B 3NKOA 4FVMA 2IUCB 1OWXA 3IWLA 4R5PB 4NX9A 1QAXA 3J7ZT 1JLQB 4M5NA 1RT3A 2ROGA 1N5YA 4Z7YA 2LXFA 2UU9J 3IDDA 4RU9A 3LW5C 4JI8F 4ZP8A 1VRUA 3KLHA 1A9NB 5C25A 3VTIA 4DN0A 1EJJA 4Y2MA 3NGSA 1X4EA 2NXNA 5DG9A 4LFBF 1JNRB 4OZNA 3KD8A 3WBHA 5I3QA 1Y4ZB 4R25A 3J7Z5 1S97A 2PEBA 2VG6A 5F9LA 2V2ZA 3QIPB 1H98A 3MXHP 3H59A 1EW8A 2V68A 1XWLA 2E9RX 1N4LA 6AT1B 2RILA 4I1TA 4M95A 1F3VA 3BO2A 1L3TA 3QWPA 5AJ3J 1E2SP 4A8OA 1ZEDA 2PFFB 3G8SA 2VQEJ 1U0HB 5HQ8A 3PHTA 1MU2A 3OTOJ 2V4JA 1NB2A 1PO6A 2ZC3A 3DLKB 4IG3B 5A0YB 4PZVA 2GIRA 4NA2A 2RUGA 2HURA 4HACA 2DGXA 2Q79A 1EIYB 2V8GA 3Q24A 2XMTA 2VBXA 1IR2A 1SUQB 1FXRA 1C1CB 4DV2J 4KPCA 2F7VA 1YBTA 2XS5A 1TL1B 2CPZA 3H0PA 2DNQA 2ZDPA 1WF0A 3GCXP 2MLXA 2ZNZA 3DLGB 3T5JA 1RZMA 2QX0A 1S6PB 4IDKA 2W2QP 4JI5J 5LXYA 4ZPCA 2PT0A 2UUWA 1EETA 4TY8B 3IBWA 4DFMA 1KDNA 3O44A 3BR8A 4ZVOB 5F8IA 2OEKA 1WC3A 1OJ4A 3I56S 3CTRA 4C3MA 1CJVA 3TX0A 2UXDF 2VPXB 1WHWA 2Y3YA 2RDJA 4RUAA 4CRJA 3MPDA 3WAXA 1R0BG 3OHAA 4ID5B 1KTVA 1F60B 2GNKA 5C24A 3D6FB 1NDPA 1APSA 3ED4A
chains in the Genus database with same CATH topology
3IGZB 1ED8A 3DYCA 2GSOA 3OT9A 3B5QA 3MK2A 5DLTA 4LR8A 4N7TA 3UN5A 1ALIA 2GSNA 4FDJA 2QZUA 1AJAA 1KH4A 4MIVA 4GTWA 4KAYA 1EW9A 4UOPA 5LQQA 1KHJA 4ZG6A 5LRMA 5LRNA 1E1ZP 2RH6A 3NKOA 2IUCB 1KHKA 5LIAA 2W5VA 5EGEA 1E33P 1P49A 2VQRA 3M8ZA 3MK0A 1O99A 1AJBA 4LR2A 4ZG7A 3T01A 3UO0A 2X98A 1ALHA 4UPHA 3LXQA 5L0EA 5INHA 1Y6VA 1ELYA 3M8YA 2W8DA 2W5TA 3M8WA 4KJGA 4CXSA 3IDDA 4QAXA 2D1GA 2GA3A 1SHNA 3A52A 3NVLA 4LQYA 4CXUA 3SZYA 4ZGAA 3NKRA 1URAA 3UNYA 2ANHA 3CMRA 1HQAA 3M7VA 4LRDA 4LR9A 1B8JA 3BDGA 3IGYB 5DLVA 1EJJA 3UN3A 1ELXA 1ANIA 2XR9A 2W5XA 3UN2A 2GSUA 4CXKA 5HRTA 1EQJA 2W5WA 3WAVA 1ALJA 3KD8A 4UPLA 3DPCA 1Y7AA 4NWJA 4CYRA 4TN0A 3E2DA 5KXAA 3Q3QA 1KH7A 5IJQA 1N2KA 1AJCA 4LREA 3MK1A 3WBHA 4B56A 1AUKA 3SZZA 3NKNA 3BDFA 3T02A 1K7HA 4LR7A 2W5RA 1SHQA 3BDGB 5EGHA 1ANJA 4MY4A 5L0BA 1EI6A 1EW2A 5GOVA 3WAYA 4LRFA 1ALKA 1EW8A 4UPKA 4GTYA 1FSUA 1ED9A 2W5QA 3NKMA 5AJ9A 5TJ3A 4ZG9A 4CYSA 4GTXA 3TG0A 1AJDA 2W8SA 4LRBA 1E3CP 3TX0A 1HJKA 1KHNA 5DLWA 3WAWA 1HDHA 5K4PA 2W5SA 4KM4A 1E2SP 4KAVA 4UOOA 1URBA 1ZEDA 2G9YA 1ZEBA 1ZEFA 4YR1A 1ELZA 5L0KA 1O98A 4UORA 2IFYA 3TWZA 3WAXA 1KH9A 3T00A 5GRRA 1KHLA 4KJDA 2IUCA 2ZKTA 4NWXA 3NKQA 4LRCA 4LRAA 4MHXA 4FDIA 4UPIA 1N2LA 4GTZA 2GLQA 3BDHA 3ED4A 3NKPA 5IJSA 2XRGA 1KH5A 5C66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGZ B;  1ED8 A;  3DYC A;  2GSO A;  3OT9 A;  3B5Q A;  3MK2 A;  5DLT A;  4LR8 A;  4N7T A;  3UN5 A;  1ALI A;  2GSN A;  4FDJ A;  2QZU A;  1AJA A;  1KH4 A;  4MIV A;  4GTW A;  4KAY A;  1EW9 A;  4UOP A;  5LQQ A;  1KHJ A;  4ZG6 A;  5LRM A;  5LRN A;  1E1Z P;  2RH6 A;  3NKO A;  2IUC B;  1KHK A;  5LIA A;  2W5V A;  5EGE A;  1E33 P;  1P49 A;  2VQR A;  3M8Z A;  3MK0 A;  1O99 A;  1AJB A;  4LR2 A;  4ZG7 A;  3T01 A;  3UO0 A;  2X98 A;  1ALH A;  4UPH A;  3LXQ A;  5L0E A;  5INH A;  1Y6V A;  1ELY A;  3M8Y A;  2W8D A;  2W5T A;  3M8W A;  4KJG A;  4CXS A;  3IDD A;  4QAX A;  2D1G A;  2GA3 A;  1SHN A;  3A52 A;  3NVL A;  4LQY A;  4CXU A;  3SZY A;  4ZGA A;  3NKR A;  1URA A;  3UNY A;  2ANH A;  3CMR A;  1HQA A;  3M7V A;  4LRD A;  4LR9 A;  1B8J A;  3BDG A;  3IGY B;  5DLV A;  1EJJ A;  3UN3 A;  1ELX A;  1ANI A;  2XR9 A;  2W5X A;  3UN2 A;  2GSU A;  4CXK A;  5HRT A;  1EQJ A;  2W5W A;  3WAV A;  1ALJ A;  3KD8 A;  4UPL A;  3DPC A;  1Y7A A;  4NWJ A;  4CYR A;  4TN0 A;  3E2D A;  5KXA A;  3Q3Q A;  1KH7 A;  5IJQ A;  1N2K A;  1AJC A;  4LRE A;  3MK1 A;  3WBH A;  4B56 A;  1AUK A;  3SZZ A;  3NKN A;  3BDF A;  3T02 A;  1K7H A;  4LR7 A;  2W5R A;  1SHQ A;  3BDG B;  5EGH A;  1ANJ A;  4MY4 A;  5L0B A;  1EI6 A;  1EW2 A;  5GOV A;  3WAY A;  4LRF A;  1ALK A;  1EW8 A;  4UPK A;  4GTY A;  1FSU A;  1ED9 A;  2W5Q A;  3NKM A;  5AJ9 A;  5TJ3 A;  4ZG9 A;  4CYS A;  4GTX A;  3TG0 A;  1AJD A;  2W8S A;  4LRB A;  1E3C P;  3TX0 A;  1HJK A;  1KHN A;  5DLW A;  3WAW A;  1HDH A;  5K4P A;  2W5S A;  4KM4 A;  1E2S P;  4KAV A;  4UOO A;  1URB A;  1ZED A;  2G9Y A;  1ZEB A;  1ZEF A;  4YR1 A;  1ELZ A;  5L0K A;  1O98 A;  4UOR A;  2IFY A;  3TWZ A;  3WAX A;  1KH9 A;  3T00 A;  5GRR A;  1KHL A;  4KJD A;  2IUC A;  2ZKT A;  4NWX A;  3NKQ A;  4LRC A;  4LRA A;  4MHX A;  4FDI A;  4UPI A;  1N2L A;  4GTZ A;  2GLQ A;  3BDH A;  3ED4 A;  3NKP A;  5IJS A;  2XRG A;  1KH5 A;  5C66 A; 
#chains in the Genus database with same CATH topology
 4GKJ J;  3AD7 C;  4WP3 A;  2HIY A;  4I68 A;  4LVO P;  5ETP A;  4X64 J;  3Q8Y A;  2IM2 A;  1KVJ A;  4FNH A;  1BQN B;  1QAY A;  4OHZ A;  2K3K A;  1LW0 B;  3F0N A;  5EGE A;  1FD2 A;  2CYY A;  3TVY A;  2NLW A;  2QV6 A;  1R3N A;  2PFD A;  5THW A;  2WB4 A;  4W98 A;  2D1G A;  4ZPD A;  1UWB A;  4I6Y A;  4FF1 A;  2MKS A;  2OAU A;  4RX6 A;  5DQH A;  1MN7 A;  2BVZ A;  2HFS A;  3DOL A;  3G8T A;  2GCF A;  2XMK A;  2EBG A;  1AJC A;  5L8R C;  1B4S A;  5LJ5 Y;  1KTQ A;  2C22 A;  1H2V Z;  1HNV B;  5DRK A;  2XLK A;  2Y8W A;  3PYD A;  1SQF A;  3E01 A;  1T11 A;  4RWX A;  3V6K A;  4NZ0 A;  1H0H B;  3NKM A;  2AGO A;  4FYY B;  3E51 A;  2IDE A;  1VK8 A;  4RNN A;  1XBW A;  4X65 J;  5CHC B;  2M7S A;  1YZ6 A;  3AJD A;  3VAG A;  3NGU A;  3EZ5 A;  2R2R A;  3BQ0 A;  3PKM A;  1LOU A;  3UCG A;  4PXC A;  1J5O B;  4OX9 J;  2HVH A;  3ULH A;  5J1E A;  3MK0 A;  3CED A;  2DR9 A;  3BGL A;  2WRM A;  2C2D A;  5KT3 A;  3FCH A;  4PQA A;  4I64 A;  2Z2M A;  4ZK7 M;  3TA0 A;  2UU9 F;  1S0O A;  1IJE B;  4Q0B A;  3E2E A;  4H4M B;  3NNC A;  3MHY A;  2ZJP Q;  5GVQ A;  1V3R A;  4IQX A;  1YIT S;  3UR0 A;  3A3P B;  1KEK A;  3FCW A;  1FO1 A;  4MYU A;  3BSC A;  3M30 A;  4UTG A;  4ZVE A;  1SC3 B;  5J2P B;  1YBA A;  4PCQ A;  3E8O A;  1T3N A;  1A6L A;  2UZA A;  3AJ2 A;  1RT4 A;  5AJ3 F;  5HLF B;  1TVR A;  4NLS A;  1KHL A;  3WC2 A;  5DGA A;  3H98 A;  2B4V A;  1FRK A;  2BRK A;  2VQE F;  1RCX B;  1RHR B;  1QM9 A;  4F2S A;  4XDD A;  4DJB A;  2VIH A;  2XI3 A;  2HBY B;  1V5V A;  4I6A A;  4FYW B;  1Q7L B;  2XGP A;  4ZLL A;  1YJ7 A;  1CJU A;  1FWP A;  1P1T A;  4ZVT B;  1A0O B;  3KTQ A;  3LA0 A;  1UA0 A;  3DC2 A;  4OZ1 A;  2B4P A;  4M5K A;  1TFW A;  5J2N B;  4KGZ B;  1FRH A;  3O8W A;  2G2O A;  1S1X A;  3FEY B;  1ZTT A;  1YKW A;  4DPX A;  5CD4 A;  2GGP B;  4ZJQ A;  1RAE B;  4UW2 A;  4DQR A;  2AMC B;  2A2C A;  2ZH1 A;  3LP1 A;  3UI3 A;  4B3R J;  2HNY A;  3KFW X;  3LP2 A;  1RHQ B;  2CPE A;  4DCO B;  1RAI B;  1RT7 B;  1LWE B;  1NPR A;  2X7I A;  1N8R T;  3BBC A;  4YR1 A;  4RW7 A;  2FVQ A;  2NS1 B;  4CLT A;  3VVT A;  1DTQ A;  1TP7 A;  2XRG A;  3JAM Y;  4WP8 A;  2FYX A;  5IM0 A;  5DLT A;  2WK4 A;  3TR5 A;  1G1X A;  2AEF A;  1HWJ A;  1NLK L;  4X64 F;  3SZ2 A;  4JI0 J;  3GJS B;  4KAI A;  4J9M A;  4F0K A;  1U1O A;  1GMW D;  1RQ0 A;  1DAR A;  4CXU A;  1H73 A;  1ANI A;  3A8J A;  4OZL A;  2B7C B;  2NSB A;  4X62 F;  2VKR A;  2LKZ A;  1DTT B;  3FNN A;  1LFP A;  5IJQ A;  2YWK A;  3ZXW A;  1NJI T;  2H51 B;  2BR0 A;  1JJ2 R;  1M90 T;  2IBO A;  2W5R A;  1QUV A;  4NI2 B;  4QR0 A;  1PC4 A;  4LF8 J;  2ZHO A;  3W66 A;  3K5O A;  4K4Z A;  1FX2 A;  3FC9 A;  4ZDN A;  1VRT A;  4CO3 A;  1AB8 A;  4TQR A;  5K14 B;  3P8B B;  3RBE A;  4MMO A;  1SQG A;  4K0K F;  3OHB A;  4R0E A;  2IAJ A;  4ZVR B;  1ZS6 A;  5B0B A;  3DI6 A;  2GJF A;  3CCR S;  1QSL A;  3DU6 A;  4CLW A;  2Y1I A;  3IGZ B;  2IVM A;  2R7Q A;  3PJX A;  2G0C A;  2H54 B;  2OI2 A;  4I2Q B;  4QIV A;  3I0R A;  1JLE A;  2W1B A;  3P5T L;  3EPG A;  3BKF A;  3UO0 A;  1NM2 A;  3NBP A;  3FZB A;  3D3C J;  1B7F A;  2GHW A;  3QID A;  1Q8K A;  2Q6B A;  4RW9 B;  1SC6 A;  2VIC A;  1U1P A;  3CJK A;  4TQS A;  3OFG A;  2AD9 A;  2G2Y A;  4EK2 A;  1XNQ F;  3QBC A;  2W2P P;  2B3T B;  3W5X A;  3HFZ B;  3IS9 B;  2F9D A;  2ZM6 J;  3Q22 A;  2ALZ A;  1RAG B;  4DUY F;  4C8L A;  1CQN A;  1DQA A;  2CPY A;  1N88 A;  2Y9H A;  3AA9 A;  1FNX H;  4LSN B;  3CD7 A;  3L09 A;  4P72 A;  3I87 A;  4A8X A;  2ZBI A;  3MWB A;  1J5E J;  3QSY B;  3GU0 A;  2CJA A;  4NWX A;  4B08 A;  1DJ0 A;  3DMJ B;  3T6J A;  3ZZU A;  2A2D A;  4BCA A;  1NPK A;  1ALI A;  2QZU A;  5K8N A;  4A8Q A;  2CJB A;  2JWN A;  1F9F A;  4RW6 A;  2HEK A;  4O4G A;  1HW8 A;  1F3F A;  2R4F A;  2U1A A;  2MQO A;  2HVI A;  2OP5 A;  4OYB A;  4OI3 A;  2YKM A;  2ADB A;  2DRD A;  1P8G A;  4A46 A;  2ZD1 A;  3W1Y C;  1RHM B;  5C5J A;  3W9I A;  2OTJ S;  2ASD A;  3VGV A;  3R1H A;  1OSC A;  4ELV A;  1X9S A;  2W2M P;  2YBV A;  1E6V A;  5B09 A;  2BEF A;  5IOL A;  4C2M A;  4OL8 A;  3EIC A;  2YTC A;  4MT1 A;  4DV3 J;  4X4P A;  2DPJ A;  5D4N A;  2I6W A;  1PGZ A;  3CVK A;  1U6B A;  2JHE A;  4DZ6 A;  3R6G B;  3CME S;  3SDE B;  1PSD A;  1T03 A;  3NL0 A;  1XEZ A;  3WIV A;  1Q0N A;  3MCO A;  3QO9 B;  2R42 A;  1K44 A;  3V4I B;  2BKO A;  2EC2 A;  2RUS A;  4PXE A;  1NJW A;  3MMJ A;  2CG8 A;  3OVB A;  3FVY A;  1H6K X;  2AF6 A;  2CNN B;  4IFY B;  3KOA A;  3HVA A;  3ILL A;  4NCG B;  3PW4 A;  3M8P A;  2CDQ A;  1WC6 A;  2COL A;  2YPZ A;  2LEC A;  1TAQ A;  4EMD A;  2XS7 A;  2MZ1 A;  2DNZ A;  1HD1 A;  3ISN C;  2X98 A;  4UPH A;  1KLN A;  3ET6 A;  2GZO A;  1BY9 A;  1TV6 A;  3OXG A;  1N34 F;  1VK3 A;  4L76 A;  2MZS A;  4Y2C A;  2YKP A;  2V2Q A;  2CVI A;  4NXN F;  2QN6 B;  2NRE A;  4J9Q A;  2GVZ B;  3C14 A;  4B3M J;  2RJZ A;  3EZO A;  2F40 A;  4Q45 A;  3DRR A;  1R8A A;  2EFG A;  1SL0 A;  5H9E J;  4HH0 A;  5CZX A;  5TJ3 A;  4LF8 F;  1D09 B;  4WFX A;  2MKY A;  1UPM B;  5A2Q U;  4FBU A;  4DSK A;  1YSJ A;  2ZJQ Q;  3OD2 A;  3RAQ A;  1EQM A;  4H4K C;  1S76 D;  4OI6 A;  2MGZ A;  2DIT A;  1FXL A;  3ZTP A;  3GFY A;  3R7B B;  2G13 A;  9ATC B;  1URN A;  4J9K A;  4UOP A;  3UR3 C;  2IJR A;  1XMO F;  1JLF B;  2MHE A;  4KGX B;  3IM8 A;  3HSG A;  2HK3 A;  1L3V A;  3HHL B;  1PJ6 A;  4USU A;  4J7C A;  4KJG A;  3PJW A;  1NH7 A;  1S9G B;  5IQQ A;  4DCP B;  3PW0 A;  4BLG A;  5I3P A;  4CXK A;  2IVY A;  4RNF A;  2QSF A;  3L9Z A;  2DHA A;  1UMJ A;  3EUN A;  3M32 B;  2F4F A;  3QPI A;  5KG6 A;  3ENQ A;  3OVS A;  2WAQ D;  1S6Q B;  1WDD A;  1YJR A;  1ZM4 A;  2CZV C;  4YEA A;  1HFE L;  2GMH A;  2HBR B;  1XC9 A;  1WG1 A;  5L0B A;  4BC7 A;  4H4K A;  2K8G A;  4KV8 A;  2ZM6 F;  2OHD A;  4USM A;  4DFP A;  3OJU A;  4WE1 A;  3HSJ A;  3MMB B;  2ILY A;  2YH1 A;  4IH7 A;  2W25 A;  3D0H E;  4MK8 A;  1SCJ B;  2OEM A;  3G6Y A;  2CPJ A;  1RTD A;  1QSS A;  2W7A A;  2R8J A;  4FF2 A;  1I94 J;  2L3M A;  2ZWP A;  4RW8 A;  5H9E K;  1W2I A;  2RNE A;  4V1A k;  5SZT A;  1DFD A;  2AX1 A;  3M4X A;  1JJ4 A;  1M5K C;  4J9N A;  4M5D B;  3KYL A;  3N0V A;  2FHK A;  3HD2 A;  2R8I A;  1T9Y A;  2B9W A;  1WOO A;  2OPR A;  3L3C A;  3TA1 A;  2IHR 1;  5F3Z A;  3M1V A;  3R9L A;  4KGV B;  5KG4 A;  1YRT A;  5MAO A;  5DS7 A;  3UPF A;  3UNG C;  3R2D J;  4RNO A;  1KHV A;  1Q5V A;  1KRP A;  5KG7 A;  2HK2 A;  4AL5 A;  1DQ9 A;  3C3L A;  1S0N A;  3FEX B;  2BX6 A;  3K8W A;  1WI6 A;  1CJK A;  3NCQ A;  2HWT A;  2KYX A;  1TUV A;  1U0S A;  2SXL A;  3OLB A;  2O66 A;  2IMW P;  1SI9 A;  2HQG A;  1PCA A;  4M5J A;  2XB2 D;  1G4C A;  5D6G A;  3PFE A;  3DLB A;  1T7P A;  2ERR A;  4NLV A;  5ETQ A;  3I0S B;  2HMI A;  1T9W A;  4GTW A;  1OQ3 A;  1GX5 A;  5CAA A;  1AUS L;  1N6Q A;  2DEI A;  2GFF A;  4O3Q A;  1R0A B;  4DDF A;  1SC1 B;  3JTP A;  4N56 A;  3M9O B;  2AV5 A;  2JEI A;  3MOJ B;  1W7W A;  2E44 A;  4EZ9 A;  3P4U B;  4DL5 A;  3T9Z A;  4RBV A;  4J9O A;  1TL3 A;  3JSY A;  1MMD A;  3WX8 A;  2W5X A;  5D4P A;  4ZN1 A;  1HNI A;  2DB1 A;  4U95 A;  2MXY A;  3FRZ A;  1Q5Y A;  2XMV A;  4QWD A;  2DXE A;  1RBL A;  1RWP B;  1NH8 A;  2H5J B;  2M52 A;  4RWW A;  5I3U A;  5KFV A;  2LU2 A;  4B3M F;  2R7O A;  2HBZ B;  4ECV A;  3IWN C;  4JV5 J;  3SBM A;  2GMJ A;  1NAQ A;  2W7O A;  4IRD A;  3JSM B;  4OZ0 A;  3PIO Q;  3US5 A;  2XQC A;  2UUA J;  4F4Y A;  2ZNY A;  2JC0 A;  1WEZ A;  4DS4 A;  2HWI A;  1DZ5 A;  2AHO B;  1MWY A;  2E7V A;  2B7B B;  1Q8B A;  2CQ4 A;  1N2L A;  5B0D A;  5D78 A;  5KOX A;  4HDG A;  1LXJ A;  1ED8 A;  2J5A A;  4DZD A;  3GP9 A;  4NMX A;  4EWT A;  1TU0 B;  1U25 A;  3LAK A;  4B3S F;  1Y5N B;  2B9Y A;  3KWM A;  1RBO B;  5CA5 A;  3IRW P;  1IBM F;  2RQC A;  5DDR C;  2ZEJ A;  3GG1 A;  5M2U A;  4ILM A;  5A8K B;  2VF3 A;  3D9B A;  2AQ4 A;  2B6A B;  1VBY A;  2PN6 A;  2EG2 A;  1RTJ B;  1KP6 A;  3HHD A;  1N52 B;  2Q43 A;  2LXI A;  4DR7 J;  3QSI A;  4YS2 A;  3PW7 A;  1CPZ A;  2IDL A;  5EUH A;  4AQY J;  1N36 F;  4I4B A;  3DRS B;  2NCK L;  5E3C A;  5HQM A;  1AW0 A;  2WW4 A;  3CJ4 A;  2FLL A;  3B78 A;  3IR5 B;  3MEK A;  1Q79 A;  5KFO A;  3CD5 A;  1U2F A;  1DHM A;  1MWQ A;  5DG8 A;  1VQ4 S;  1RI7 A;  1RBA A;  3U1L A;  4HI1 A;  1VQ8 S;  5CD4 H;  1HMV B;  4DR4 F;  2J0X A;  1X7V A;  3MM7 B;  3DM2 B;  2PSZ A;  2ZVS A;  2DY9 A;  3WHI A;  3CJT A;  5DM6 Q;  2GIQ A;  4WU2 A;  2DT9 A;  2OD6 A;  3BGR B;  4QWC A;  1CUL B;  2IRY A;  4ZPV R;  2KKH A;  1E6Y A;  3QAU A;  3TRG A;  4LJM A;  1MMN A;  2RF2 A;  4IOC Q;  1B64 A;  3BM7 A;  2L08 A;  1JLB A;  5C7P A;  2HQ3 A;  2VJV A;  5L1J A;  4F36 A;  3H5U A;  3K59 A;  4CYR A;  1S5Z A;  4KJI A;  1L3S A;  2VG6 B;  2AX0 A;  2EKY A;  1H7X A;  4LR7 A;  1YBU A;  1QTN B;  2LLZ A;  2QYC A;  1T05 B;  4U7U D;  1NME B;  3VWS A;  5D0E A;  3TEH B;  1FHT A;  2WHO A;  1H74 A;  3FRY A;  4ALZ A;  3KLE A;  2V8V A;  3AH6 A;  3WAW A;  4QPX A;  1F2G A;  4MFB A;  2RU9 A;  4KAV A;  1RAD B;  3KK2 A;  1GXT A;  4ED2 A;  4ES1 A;  2W4D A;  5D0R A;  4U67 Q;  2IUC A;  2DTJ A;  2P6T A;  1S1T B;  4R5P A;  4FVC A;  2P6S A;  2R2U A;  4OMF G;  1S4F A;  1M1K T;  1SKW A;  1BXN A;  1RHU B;  1F5A A;  1K0T A;  3UDL A;  3H20 A;  3JYT B;  5KFW A;  4Y6I A;  3SV4 A;  2UUC J;  3MDF A;  1R8H A;  3FCV A;  1EJ7 L;  4CXS A;  2E1A A;  1T94 A;  2B5J B;  2JJ4 D;  2QFI A;  1JLA B;  2GA7 A;  1P9Y A;  3QIP A;  2MMY A;  2PA3 A;  4IDK B;  4NEZ A;  4WIQ A;  2AEJ A;  2CQB A;  1P27 B;  1OS5 A;  3PKY A;  4WII A;  2JFK A;  1U0H A;  2FVR A;  2RRN A;  3GFZ A;  1A7G E;  3HMJ G;  4NAS A;  3CD0 A;  2ADC A;  3DLK A;  1BQM B;  4XTT A;  2QRR A;  1V3S A;  5A0Y A;  1X0F A;  3PAC A;  4IG0 A;  2KU7 A;  1S0V A;  2ROE A;  1HWL A;  5EX0 A;  2OMO A;  4KHP J;  4FKX A;  1EHW A;  4K4S A;  3GJQ B;  1IBC B;  4NOH A;  2UUA F;  2RQK A;  4YB6 A;  4BS2 A;  1X0P A;  3ILO A;  4RPF A;  1MN9 A;  1Z4U A;  1SUQ A;  1NDL A;  1C1C A;  3CDU A;  3VAL A;  1K8A T;  1RAB B;  1VQ5 S;  1R7I A;  1TL1 A;  3EPI A;  1MRO B;  3CCV S;  3WX4 A;  1IM4 A;  3D0I E;  4LUB A;  4UZB A;  4F3M A;  3DLG A;  3MFH A;  9RUB A;  2ASL A;  1S6P A;  2N4D A;  2WSE C;  4K4W A;  1WSR A;  2CQ1 A;  3MPW A;  3NKR A;  2AJQ A;  5EHH A;  3M7V A;  1TAU A;  4TY8 A;  5KG1 A;  2EEY A;  1SJF A;  4ED6 A;  1OMS A;  1HBU B;  5BYS A;  1FE4 A;  4JP8 A;  2M8H A;  4F7V A;  4M94 A;  1S9F A;  1B0P A;  4DR7 F;  1XER A;  5HVF A;  2KI2 A;  2C1E B;  1GMW A;  1N5T A;  3PCO B;  1EW2 A;  3TQE A;  1CS4 B;  1X31 C;  4ZLP A;  3B6B A;  2XY6 A;  5GMK a;  1UPP A;  5CXT A;  3N6L A;  1NKB A;  1YJ9 S;  3ZNJ 1;  1TUW A;  2N7Y A;  3TWZ A;  4YP3 A;  1BQN A;  5K20 B;  1LW0 A;  3NKQ A;  3GPA A;  1YRU A;  2FLP A;  3D1H A;  3DLL Q;  4OZ3 A;  2MZQ A;  3W2V B;  5JMN A;  2AP6 A;  3MTK A;  4B3T F;  1P6T A;  3KLF B;  3NXZ A;  2HG4 A;  4QIE A;  3SQO P;  1HD0 A;  1CQM A;  1GTH A;  3DGV A;  1IN0 A;  2A6O A;  2VG7 B;  1OPI A;  4ZCK A;  4C8M A;  4HTI A;  3QRQ A;  4DFK A;  4J91 A;  2FD2 A;  1SJQ A;  3NOG A;  2LCW A;  1HNV A;  1XNR J;  3PNI A;  4GC7 A;  4Q0B B;  1ICE B;  4J9V A;  2YX4 A;  3KMQ A;  2ZH8 A;  3LGM A;  1M0S A;  3W2W B;  4UPL A;  4CTA B;  5KXA A;  2AZ1 A;  4TN0 A;  4ZPT R;  5HN0 A;  1CEZ A;  4F8R A;  4E8U A;  2BUN A;  4DPT A;  4B56 A;  2WON B;  4CLZ A;  3M30 B;  2M2B A;  4WF9 Q;  1IKX B;  3O3L A;  1UAW A;  2Q6C A;  1M5S A;  3S8S A;  2NUH A;  4I67 A;  3KUG A;  2FPH X;  3LUY A;  1TVR B;  1J5O A;  5J2M B;  2F5G A;  2VBY A;  3OSP A;  3ENW A;  2NXJ A;  1IWG A;  3TZX A;  4N7T A;  2DNL A;  2VQF J;  4M8L A;  1C0T B;  2MZT A;  4X4O A;  5LMN F;  3P3D A;  4A8W A;  2H9Z A;  5IC6 B;  4H4M A;  2DNG A;  1Q53 A;  4RU2 A;  1RT6 B;  2UUC F;  2Y1L B;  1QE1 B;  2GA3 A;  1U8S A;  4ZKA A;  1UCN A;  4YN3 B;  2YNH A;  2H65 B;  2CPX A;  4G1P A;  2YNI B;  5J2P A;  3CC4 S;  2NXC A;  2BE2 B;  4KE5 A;  1R8P A;  2CIM A;  1T9U A;  2DHG A;  3N4W A;  1H2U X;  2JZ5 A;  3BO4 A;  1TKT B;  3LP1 B;  1FNO A;  3N79 A;  3CUL A;  5HLF A;  1FKO B;  4K2J A;  4DR3 J;  2V8H A;  3TAR A;  3QFW A;  3JB9 k;  1F6T A;  1R6Y A;  2XLI A;  1RK8 A;  2XTJ P;  4RW7 B;  5DZ7 A;  1DLO B;  5E7O B;  1GMU A;  1RP5 A;  4KHP F;  4MIA A;  1OYE A;  2XWY A;  5DQI A;  3GTY X;  3TAM B;  3DDN A;  2GAH C;  1KON A;  4NZ6 A;  5J2N A;  1VLY A;  2G4B A;  4OJ3 A;  3CCT A;  4URS A;  2JH3 A;  2DIV A;  2IA0 A;  1M5O C;  2LQ8 A;  2GGP A;  2LQJ A;  2DIU A;  3KHH A;  5EN1 A;  4AE5 A;  2YWE A;  2KG1 A;  4K2X A;  4G1Q B;  3IR6 B;  3RW6 A;  2RD5 C;  3O6Q A;  4BDP A;  3J7A N;  3B82 A;  1IQZ A;  1RT7 A;  2JLF A;  3PFO A;  1LWE A;  1Q8I A;  3T1H J;  3RRK A;  4C8Z A;  1NHV A;  1O5J A;  3SSS A;  1ZET A;  2AU0 A;  3K0J A;  3CCS S;  3OBI A;  3QZ7 A;  3HK2 A;  4Q2L A;  1WSV A;  3OR1 B;  1G6B A;  3UDE A;  4ICL B;  2FC8 A;  2CVE A;  1TL7 B;  3CT9 A;  1FJC A;  1O98 A;  3NY0 A;  5BXI A;  2IFY A;  4I2P A;  4NA1 A;  1VQY A;  1N5Q A;  3EXY A;  2IAJ B;  4OV1 A;  4DQI A;  2GQQ A;  3HHN B;  3QGH A;  1W26 A;  4PUO B;  2LQ9 A;  5KT2 A;  2YH0 A;  3DHW C;  4LF4 F;  1Y7P A;  4ZVG A;  3NBP B;  4C9D A;  3OPK A;  1X5P A;  1DTT A;  2Z2Z A;  1HW9 A;  1RWV B;  1VI7 A;  2IIH A;  4FXD A;  2FY1 A;  4LF7 J;  3MR5 A;  1WC4 A;  3PHE A;  4F0M A;  1R27 B;  1TK8 A;  4NI2 A;  3WC0 A;  4HT5 A;  2LXU A;  5U47 A;  1XNR F;  1SJ1 A;  5G0R B;  3HKW A;  5KFE A;  2V67 A;  1IQT A;  4X66 F;  4TYA A;  1LV5 A;  4FNI A;  1VBX A;  3PTW A;  5K14 A;  2DY1 A;  3H2V E;  5A2Q Y;  1X4B A;  3BV8 A;  2F8E X;  2AZ3 A;  2XZW A;  4DPU A;  3P45 B;  2MQP A;  1RYR A;  2FHO B;  4K59 A;  3FDS A;  5BR8 J;  3AQP A;  4U96 A;  4I2Q A;  2MEW A;  1O0P A;  1AZS A;  2BJE A;  4PG5 A;  3IA0 A;  2M8D B;  2VFU A;  4KAY A;  2WVF A;  4RW6 B;  2FLN A;  2QLW A;  2CNO B;  3SCI E;  1ARO P;  2W5T A;  4C48 A;  2Z0G A;  4LQY A;  3IS9 A;  4EI2 A;  3GQC A;  3IGY B;  3CMA S;  1HNZ F;  1VQ6 S;  4FDF A;  4GMK A;  1I6J A;  1U1N A;  2GSU A;  1EQJ A;  4I7F B;  4LSN A;  2JVR A;  2QLB B;  1TL4 A;  1PIE A;  4DSE A;  1LNQ A;  1RT5 B;  2BYC A;  4L3N A;  1DBD A;  1NK9 A;  3DMJ A;  4EGL A;  1SC4 B;  1HHT P;  2DCL A;  2OO4 A;  3WZ0 A;  3HZE A;  2DVI A;  1RIS A;  4YB1 P;  4DFJ A;  2DNY A;  4QWE A;  1WNE A;  3I4H X;  2GO8 A;  4GTZ A;  3UD4 P;  2YY3 A;  3DYC A;  5LM7 E;  3R1L A;  2RU3 A;  1MLA A;  4LQ9 A;  3VZH A;  3N01 A;  2EXU A;  4HDH A;  3C15 B;  4F0H A;  2R7V A;  2VC1 A;  4B9N A;  1U7L A;  2AJ0 A;  5FLX U;  3IGV A;  5HJX A;  3P49 B;  1S99 A;  4F67 A;  4F3Q A;  1TKZ B;  1ZPV A;  4A8K A;  3I32 A;  4CQ1 A;  2V0N A;  3Q0A A;  1QAI A;  3SDE A;  3TZW A;  4G65 A;  3QT7 A;  3ONQ A;  3RB3 A;  2R7W A;  2DR5 A;  5F9N A;  3QO9 A;  3V4I A;  2QL5 B;  3SQG B;  2J76 E;  2KVI A;  2QIF A;  3DCA A;  4C0B A;  1KKH A;  1EKS A;  1FF2 A;  2JC1 A;  1M5H A;  5KOW A;  1VIO A;  2AEM A;  3NWG A;  2RB7 A;  3NNH A;  4IFY A;  4Y65 A;  3EMT A;  4NCG A;  3EGV A;  4DV0 J;  2BJ9 A;  1U4B A;  4OYA A;  2J9D A;  3POT A;  1S6U A;  4MYT A;  4ZN3 A;  4KH1 B;  1KLM B;  4A4J A;  4YY3 J;  1OIA A;  4FDI A;  5L1K A;  3GIR A;  4L75 A;  5KAK A;  2KG0 A;  4MKB A;  2FTR A;  1ROF A;  1FDN A;  1FFG B;  2MQQ A;  2FIU A;  4E2F B;  2FZK B;  1U8W A;  3TUZ C;  4CT8 A;  3DOM A;  2B43 A;  3HHL C;  1Y6V A;  4NZ7 A;  2YKN B;  3ZZ0 A;  2QA4 G;  2GVZ A;  4X4T A;  3OJS A;  1RJJ A;  3N5F A;  1DAX A;  1YVF A;  3R5G A;  1PIL A;  1X4F A;  2AJ4 A;  2FJD B;  1FTC A;  1H7W A;  4QZV B;  2UUB J;  5F8H A;  1YI2 S;  3CCM S;  4JOU A;  1VQO S;  2RRB A;  4RLE A;  3LWL A;  1QVG R;  2UXC F;  1PJ7 A;  4NYZ A;  4YR2 A;  3LO3 A;  2ZJR Q;  2QSW A;  1ACM B;  1FRI A;  2PMH A;  1NRK A;  4P7V A;  2W5Q A;  1OSD A;  2KM8 B;  3MR6 A;  1SQE A;  4Z37 A;  4WE1 B;  1G3O A;  1HWU A;  1NHK L;  3M2V B;  2BE7 D;  1M5V C;  3T00 A;  4LSL B;  2G0I A;  1JLF A;  4PQU B;  3V81 B;  3HVR A;  2LDY A;  1NSK L;  2EWH A;  2M9K A;  4RO0 A;  4MK9 A;  3HHL A;  3MUT P;  4GRS A;  6FD1 A;  2AJ1 A;  3OT9 A;  5DDQ C;  4H4O B;  2BM1 A;  2ACY A;  1JJH A;  2QG9 B;  5LRN A;  1NZ8 A;  1S9G A;  4N8N A;  2KFN A;  5KFU A;  2JRS A;  3W61 A;  1P49 A;  1WHV A;  1U02 A;  1YJN S;  3Q8U A;  1U09 A;  1S6Q A;  1TK0 A;  4DR1 J;  4C8K A;  1SB6 A;  1RKI A;  2FJB B;  1YJT A;  3TUP A;  3A12 A;  2BE9 B;  4ZP6 A;  3UN2 A;  2MKJ A;  3NS7 B;  1KQS R;  4QYR A;  1NEE A;  4NLD A;  4D3G A;  3DRY A;  3NKN A;  1LWX A;  3T1Y J;  3MMB A;  3EJM A;  4IRK A;  1EI6 A;  4ED0 A;  2HAI A;  2AGP A;  4OHW A;  4EYH B;  2Z56 B;  4LF6 J;  1FKP B;  1IXK A;  2DNP A;  3O5T B;  4EEY A;  3UDV A;  1BHN A;  4N76 A;  4ILL A;  5K4P A;  1QTM A;  4ZPW R;  3OL6 A;  1NO8 A;  2MKH A;  2GIF A;  4ZJO A;  5DM7 Q;  1C2P A;  4C3K A;  5GAE U;  3GR1 A;  2OML A;  1CSJ A;  3R5J B;  2VDH A;  5CQG A;  2FGO A;  1FVS A;  2D41 A;  3OL9 A;  2KJV A;  2D3O R;  4M5D A;  5DLF A;  2GSO A;  3TX8 A;  2HKE A;  2ZZN A;  3LTO A;  1N6Q B;  3DLE A;  4GO7 X;  1LK5 A;  2DCU B;  3KJV B;  2XS2 A;  3DDK A;  1NK5 A;  3QGP A;  2W5V A;  1TL5 A;  5F0W A;  4EBD A;  3MM9 B;  2PA8 D;  1OYD A;  2HRU A;  1T02 A;  1PAU B;  3M8Y A;  3CUN A;  1UJ6 A;  3WDO A;  1V5I B;  4OZ5 A;  3M8R A;  5DJB A;  2W8L A;  2FVP A;  1T0T V;  3AT1 B;  4CWB A;  3NCP A;  1HBM A;  3PX0 A;  3TYT A;  2EW9 A;  2OPP A;  2YX1 A;  4O4R A;  2HS3 A;  3HZG A;  2CJ9 A;  3WAY A;  3Q8Q B;  4DUZ J;  3W3S A;  1YLX A;  3G2X A;  4FXW A;  3QRP A;  1VHI A;  4Y28 C;  3MAA B;  4ATN A;  1NBE B;  2RHS B;  3I0S A;  2FQQ B;  2MYF A;  4AYB D;  3JS9 A;  2XNR A;  1U47 A;  1LW2 B;  3ZTS A;  4P75 A;  2JSX A;  4CNY A;  2RAQ A;  4YY3 F;  3I96 A;  3BQ2 A;  3D6H B;  2UXB J;  2E1P A;  1JLC B;  2D7S A;  2CDR B;  4X84 A;  3SSR A;  4USV A;  4CLL A;  2DNK A;  3D67 A;  3KJN B;  5KFM A;  3VQT A;  3HHK A;  3GR0 A;  5E2Q A;  1IR1 A;  3C8Y A;  4DR6 F;  5F8M A;  4IOA Q;  5L46 A;  1RXO B;  2HVZ A;  2UXD J;  2RVJ A;  1FES A;  2UP1 A;  4OHV A;  2FUG 9;  1NJX A;  4DPO A;  2K2P A;  5L38 A;  3PO5 A;  2DGT A;  2GHP A;  1T3O A;  3GYX B;  3H4D A;  1YIJ S;  3TZY A;  2RQ4 A;  1N33 J;  3M9M B;  5T14 A;  4WWS A;  3JSR A;  1RTI B;  1HNX F;  3D6T B;  4ZLJ A;  3SFG A;  3UVJ B;  1FSU A;  1BGX T;  1SXL A;  1TZ0 A;  1KNZ A;  5A8K A;  4C97 A;  4MIV A;  2B6A A;  2OKQ A;  4C8N A;  5C2C A;  3MCS A;  1LK7 A;  1K1S A;  3HJV A;  3M8Z A;  2LEP A;  2KXH A;  1RTJ A;  3I82 A;  5DET A;  2MKC A;  4P10 A;  2XLJ A;  3R5A A;  4DX6 A;  5ETS A;  4N47 A;  3K17 A;  3MR3 A;  1R6V A;  4J9P A;  2KZM A;  1FEH A;  2AJ2 A;  3KNA A;  3T6B A;  1R8B A;  1KSP A;  4DR1 F;  5IV4 A;  1HIY A;  3DRS A;  1SKS A;  1KH7 A;  4DV4 J;  3TJ8 A;  4AL6 A;  2M3D A;  1UP1 A;  5ETR A;  4F02 A;  3GFH A;  2HND B;  1WTF A;  3NS6 A;  3IBF B;  2RML A;  3M6U A;  2IC3 B;  4H54 A;  2V50 A;  4FYX B;  1FJ7 A;  2LDI A;  3T3F A;  3KLE B;  3TA2 A;  2XYP B;  2W8S A;  3FUY A;  4LF6 F;  2IBK A;  1HMV A;  3MM7 A;  3DM2 A;  3S01 A;  1N32 J;  2QO3 A;  4M5G A;  4FYD A;  4X4U A;  3W65 A;  3PJ9 A;  2NXU A;  3BGR A;  2DHX A;  1TMJ A;  1CUL A;  1KH5 A;  1F9E B;  4ZJL A;  4DV6 J;  2IVF B;  3H90 A;  3Q8P B;  1E1Z P;  2J9E A;  2ZH7 A;  1N0U A;  4P7T A;  4NRU A;  2VOO A;  4UUX A;  1KQG B;  4DN9 A;  3RB4 A;  3MUV P;  2OFH X;  2D3Z A;  2ASJ A;  2GQC A;  3ZTO A;  3W9J A;  4NCA A;  5GAH I;  2MZR A;  4FPI A;  1T05 A;  5DLV A;  1FDD A;  3U02 A;  2YNG A;  5GAH U;  3AFG A;  4G6V B;  4OYI A;  1UEU A;  2EG1 A;  5L1L A;  3H2U B;  3GSD A;  1AUK A;  4CO1 A;  1JMT A;  1S57 A;  1NKE A;  2RDD A;  4WK1 A;  3O2I A;  2Z8Q A;  3SEO A;  1S1T A;  1DUR A;  1OY6 A;  3V2U C;  4DUZ F;  5E0O A;  2VON A;  4IG0 B;  1JB0 C;  4DSF A;  3GB0 A;  2E7W A;  5AXK A;  3NNA A;  2I2Y A;  1KH9 A;  4C11 A;  2QFJ A;  4N41 A;  3ILJ A;  3JYT A;  3CCJ S;  2BA9 A;  2ZFH A;  4ZVS B;  1ZM2 A;  2X3D A;  4LF9 F;  1NDK A;  1U1M A;  2OPQ A;  3RZA A;  2B5J A;  1F2H A;  2UXB F;  1JNZ B;  1JLA A;  3CC2 S;  4CO4 A;  1YTY A;  4N5S A;  2E5L J;  3C66 A;  2HRY A;  3VR1 A;  4K5R A;  4C4W A;  1R0C B;  1HAR A;  5CYM B;  4LQ3 A;  4XPC A;  2DD8 S;  1XR7 A;  3BF4 A;  4KB7 A;  2ZUG A;  3QLH A;  1L5U A;  1WTB A;  4DL0 C;  3KK3 B;  4IUF A;  2ZUA A;  1BQM A;  4ZP9 A;  4IQM A;  2ZH6 A;  4KGM A;  3T02 A;  1ZA1 B;  3AD9 C;  4OYO A;  3M6V A;  3IO1 A;  2W4P A;  4PRF A;  3T5K A;  3FMW A;  3MEG B;  3MMA B;  3IP0 A;  2HYI B;  4EO8 A;  3MEE B;  1TTH B;  1WDT A;  1VGY A;  2D9P A;  3R97 A;  3GII A;  2VJU A;  5KFI A;  1GFW B;  2IYG A;  2CQ0 A;  3FZ2 A;  4YR3 A;  2QMU B;  4MKV A;  1MRO A;  1N33 F;  4NCB A;  5B0G A;  3MF5 A;  3C16 B;  2QLJ B;  2RRA A;  1VLO A;  2XO6 A;  5KFT A;  2XZT B;  2B51 A;  3LF0 A;  3DOK B;  4LBI A;  1X9W A;  2XHW A;  4X62 J;  3OXL A;  3CJQ A;  1BMQ B;  3KG0 A;  3HT3 A;  1VCT A;  2W24 A;  3ZZO A;  1EAR A;  4IOB A;  2XMM A;  2VPZ B;  1N5V A;  2OEL A;  1U24 A;  3NAH A;  1HBU A;  2KXN B;  3MPV A;  5IQ6 A;  4RR5 A;  3N9U C;  1XK8 A;  3J7Y I;  2KO1 A;  4ID8 A;  2PDA A;  1WEX A;  1CS4 A;  2D9O A;  3J7Y U;  5HRT A;  2NZ4 A;  3RBX A;  1N48 A;  4Y2A A;  3P96 A;  4DXL A;  2QMW A;  4K0K J;  4ANC A;  3ELH A;  4LSZ B;  3KG4 A;  4WJB A;  1VHF A;  1QD1 A;  4DV4 F;  4AL7 A;  5GOV A;  1EZZ B;  2K3I A;  2E1R A;  1ZM9 A;  4F4A A;  5DG7 A;  3W2V A;  3FSX A;  2C2Z B;  3Q23 A;  1KQK A;  3KLF A;  1O8B A;  2QLF B;  1RWX B;  4LF1 A;  4LRC A;  4PWD B;  1N32 F;  3A4T A;  2VG7 A;  1KWM A;  4F3O A;  2EFQ A;  5K8P A;  4ZG6 A;  2AIR B;  4CP5 A;  1XNQ J;  4DV6 F;  4ZA1 A;  2YNF B;  5HMW A;  3W2W A;  4CTA A;  2DR6 A;  1L3U A;  5EGY A;  3BKT A;  4DUY J;  2C3Y A;  4FF3 A;  4PAA A;  2YNH B;  2WON A;  3PZP A;  1FJG F;  1UEK A;  5AXN A;  1IKX A;  2Q1L A;  2U2F A;  3ISZ A;  4DCJ B;  2XBP A;  2W5W A;  3WAV A;  1X5O A;  4QBU A;  4DL4 A;  3BN7 A;  5HSP A;  1G2E A;  4L3K A;  2FB0 A;  2W9B A;  2WVC A;  2A1B A;  3HVW A;  3I9Z A;  3OL7 A;  4ITS A;  5J2M A;  3OFH A;  3PM9 A;  4WFZ A;  2QZ8 A;  1NPP A;  3MM6 B;  2HLT A;  4PWU A;  3DLH A;  4B9V A;  1QY7 A;  4YR0 A;  4OI0 A;  5G4D A;  1QJH A;  5HQL A;  1VIX A;  4MH8 A;  2JL9 A;  3ZO7 A;  3TAP A;  1AYE A;  3MOZ A;  1C0T A;  2AYB A;  5KFC A;  1RTZ A;  3H5Y A;  4RNM A;  4UPI A;  2YQ3 A;  3D7S B;  2GML A;  1U49 A;  3FQK A;  1MW7 A;  2HIQ A;  5FD1 A;  2G0J A;  4LR8 A;  1RT6 A;  2MQ8 A;  1GX6 A;  4DSI A;  1QE1 A;  1HHS A;  1YZ7 A;  2AKW B;  4DV5 J;  4WU3 A;  2YNI A;  3MD1 A;  1NKC A;  2BE2 A;  3F73 A;  4NXM J;  2I1R A;  1PC5 A;  3TUJ C;  2V9W A;  3CW2 C;  2E5L F;  1TKT A;  2MKI A;  2NSC A;  1FKO A;  5BYQ A;  4DEZ A;  5AE2 A;  2HZC A;  4CLK A;  4K4Y A;  3H5S A;  2GQ2 A;  2QA4 S;  2N4C A;  3JSB A;  5ETV A;  3CJS A;  1FFS B;  2YKO A;  1VR6 A;  1K7H A;  2VA2 A;  2CPI A;  4Y2I A;  2XC9 A;  1RAH B;  2XMU A;  1DLO A;  2AGQ A;  4USI A;  2ZHB A;  4B9L A;  2J0W A;  4Q8E A;  2W9C B;  2X1B A;  4KKO B;  3NRB A;  4DI6 A;  2VOP A;  1V9O A;  3TAM A;  4I2P B;  4DX8 H;  5HRO B;  1FA0 A;  2IJF A;  2DGV A;  5KFA A;  3FJ2 A;  3D4J A;  3KK1 B;  2XMA A;  3SMZ A;  4NE9 C;  1N34 J;  2PE8 A;  5FLX Y;  1NK8 A;  2UVW A;  4CYU B;  2CPF A;  1GEH A;  2MB0 B;  4NXN J;  4GVB B;  4HT7 A;  3LPE A;  4QWB A;  5DQG A;  4CH1 A;  2XZD B;  4G1Q A;  3D6M B;  3T01 A;  1WC5 A;  1PJ5 A;  2KH9 A;  4QPT A;  2W2O P;  2XMJ A;  1H72 C;  2HHT A;  2VB6 A;  3RG6 A;  2VFS A;  3FBB A;  3KLG B;  3UNY A;  1T9X A;  4C98 A;  1K0V A;  3UN3 A;  1OO0 B;  3FEZ A;  2MTL A;  4M5H A;  4PWW A;  3V5R A;  3CO0 P;  3IM9 A;  3OR1 A;  2X51 A;  4HKQ A;  5D4L A;  4ICL A;  1UVK A;  3NMA A;  1S77 D;  5D8H B;  1TL7 A;  2UV8 G;  3T5H A;  4B02 A;  5F3T A;  4NLX A;  3G82 B;  5KFG A;  2AYE A;  2KHD A;  4GTY A;  5AJ9 A;  4DHV A;  3F44 A;  4UY8 5;  1XMO J;  5FII A;  1K73 T;  1FK9 B;  2VC0 A;  1I1G A;  4PUO A;  1FRJ A;  1M1G A;  4DUT A;  5C42 A;  2ZKU A;  2X1A A;  2XHC A;  4YHH J;  3NGT A;  5HMY A;  2CJQ A;  2PD1 A;  2C2E A;  1AZS B;  4EBE A;  2HAF A;  2GHV C;  1W25 A;  4WYW A;  1FJE B;  2R2S A;  4CH7 A;  4JV2 A;  2XM3 A;  2VFT A;  2CQD A;  5C2G A;  4K8R A;  4EFA C;  5LSO A;  2HWH A;  2YXL A;  1HHQ A;  3AAW B;  5G0R A;  3HPO A;  2Z2Y B;  3AQO A;  2KN4 A;  3ZC4 A;  1S72 S;  4ZS6 A;  3VHQ A;  3D68 A;  1IBL F;  1FD8 A;  2YWF A;  4N77 A;  2XI2 A;  1WD6 A;  1MWZ A;  4RW4 B;  4ER8 A;  3PX4 A;  1SBR A;  1FKA F;  4MIB A;  4A8F A;  1UWA A;  4LFA F;  3CDA A;  1H3D A;  2YVS A;  1F9H A;  2HFU A;  4M1K A;  5HO4 A;  1IBK F;  4Q5V A;  2FJX A;  4IR9 A;  3EVW A;  4CIO A;  4KY3 A;  2V2V A;  5HP1 B;  5CZV A;  4UPK A;  3RUB L;  1KHN A;  2ZDO A;  3HI9 A;  4HHH A;  1RTH B;  4IO1 A;  1LEO A;  2N82 B;  2ZH2 A;  2B4U A;  4UOR A;  4PKD B;  3NMR A;  1WKK A;  2J6S A;  1VJQ A;  2CQI A;  3IMQ J;  4NLU A;  3R7N B;  1S1W B;  1AT1 B;  3VCD A;  1D9D A;  3CGI A;  4X4N A;  2E1M C;  4O3O A;  1RA7 A;  4W92 B;  4V19 X;  1MSW D;  2I8E A;  3KLV A;  1PG5 B;  4URG A;  3F56 A;  4I7F A;  3GE9 A;  4DV5 F;  3M8W A;  4A8Y A;  1WI8 A;  1JKH B;  1FCA A;  4NXM F;  3M05 A;  1RT5 A;  2PO4 A;  3D0G E;  2F8H A;  4ETZ A;  3BBB A;  4ED3 A;  2BQR A;  2XNQ A;  4JI4 F;  3PYF A;  2OGU A;  3OTD A;  1P9Q C;  1WHY A;  1B7Y B;  2K7K A;  3ZTR A;  3MAH A;  3RR7 A;  5ETN A;  3C6T B;  4ED4 A;  1D0E A;  4LRF A;  2HGN A;  3QZ8 A;  2BAN B;  1X9M A;  2GX8 A;  4NLT A;  4UOC A;  4P2S A;  5D3G B;  3SCK E;  3GZ7 A;  1XTZ A;  3POT B;  2VH7 A;  3C15 A;  3KDN A;  1RAF B;  3HKZ D;  1UVI A;  1CVJ A;  2GLQ A;  4OHX A;  3IG1 B;  3GON A;  1S9E B;  1RWM B;  1TKZ A;  3HVT B;  1RAJ A;  3HX9 A;  3DOM B;  4QIW D;  2HS4 A;  4PG8 A;  1EX8 A;  3EDR B;  3ICL A;  5K9F A;  4CLF A;  2HQD A;  4IO9 Q;  4KC5 A;  1KOO A;  2JFD A;  5DO2 A;  3K5N A;  3PR5 B;  2C2K B;  5LJ3 Y;  2V8P A;  4WP9 A;  2D74 B;  3SQG A;  2FVC A;  2F65 A;  1TMM A;  3R5D A;  3QJP A;  2HQC A;  1HYS B;  4L6V 3;  4ECX A;  2FLO A;  1JK9 B;  1WG5 A;  4JI6 F;  2RSQ A;  3IRX B;  1Q16 B;  4DG1 B;  3EVM A;  1KLM A;  1XJW B;  1S48 A;  2J6T A;  5HVH A;  1RE1 B;  4QJV A;  2KM8 C;  4IYQ A;  4B3S J;  5ETT A;  3IN5 A;  1FWL A;  1UFL A;  3BYP A;  5F8L A;  3W7B A;  1XMQ J;  2R9L A;  5B08 A;  3CCQ S;  4IH5 A;  1F1B B;  2ATC B;  4QIG A;  3VQS A;  4AND A;  3UCU P;  2VDI A;  1IBM J;  1FRX A;  3V6D B;  5A6P A;  2HHH J;  2NQP A;  4P74 A;  4FS1 A;  3N6N A;  3NWR A;  2XSF A;  1MML A;  4YHH F;  2R8K A;  1S59 A;  1VOM A;  2RDI A;  2CAJ A;  4DX7 A;  3LPY A;  2YKN A;  5HK4 A;  1S0M A;  3UDC A;  4ZVF A;  1REV B;  2BM0 A;  3BGF A;  3MMC B;  1NK0 A;  3ETM A;  2J0S D;  1VC6 A;  4LFC J;  2PI4 A;  4J9R A;  3W64 A;  4ZG7 A;  4OYP A;  4K4X A;  2HNZ B;  2W8D A;  5IT0 A;  3QGI A;  5KFL A;  1N36 J;  2QYG A;  2HQF A;  3W5Y A;  2BAB A;  5IZH A;  1U2R A;  3QAT A;  2KJW A;  2ZWO A;  4HR2 A;  3VAJ A;  3DGP B;  1B70 B;  1UVN A;  4I69 A;  2MHN A;  2KXF A;  1I51 B;  3M2V A;  1B99 A;  1KOH A;  3G6V A;  4QU7 A;  4LSL A;  5IXU A;  3K2Y A;  2NYI A;  4PQU A;  3HJF A;  4OYM A;  4DR4 J;  3V81 A;  1WEL A;  1NK7 A;  1Q78 A;  4HEA 9;  4WYL A;  4USW A;  4ECS A;  4X4Q A;  1UVJ A;  4P9S A;  4ZLN A;  1ELZ A;  4H4O A;  3CCE S;  1SVD A;  1RAC B;  4MKA A;  3Q8S B;  3J81 j;  3J80 U;  5CAB A;  3D1O A;  3AY0 A;  3NAI A;  2KTQ A;  5LSL A;  1SIZ A;  5JVG Q;  3DLE B;  3DRP B;  4OJ1 A;  5CYQ B;  5IC4 B;  1YJV A;  4U6P A;  4MAK A;  3U1N A;  1KVK A;  5HMZ A;  2FZG B;  2JDJ A;  2VV5 A;  4QAX A;  1ZZF A;  3SZY A;  1HBM B;  2XO7 A;  2QA2 A;  4KPY A;  2MZJ A;  4F4X A;  2OPP B;  5D0H A;  3Q2S C;  5HI7 A;  2IPO B;  1FKP A;  3CD6 S;  1HBN B;  3LAL A;  4AT1 B;  2OIH A;  1NSA A;  4FZV A;  1F0X A;  2EKN A;  2H4W B;  3HF5 A;  1ANJ A;  2ZE2 B;  3QT5 A;  2B0G A;  3K7R A;  1VYA A;  2DO4 A;  1GK8 A;  2CUY A;  5B0A A;  4DWI A;  1ZAW A;  3A3O B;  3S1T A;  1U6Z A;  3MUM P;  3EYZ A;  1SV5 B;  3G86 A;  3OUY B;  2WB1 D;  3A8E A;  3KJV A;  4M5M A;  2WSF C;  2IRX A;  4U9R A;  4OX6 A;  4LRA A;  2FGC A;  5LT5 A;  1FI4 A;  3MM9 A;  3PY8 A;  3GIM A;  3BDH A;  1UET A;  4W90 B;  3H4B A;  3L4B C;  2HPU A;  3AB2 B;  2CQG A;  3NKY A;  5IS2 A;  1GMV A;  2CWX A;  4F25 A;  4M5I A;  2HFN A;  3ZZT A;  4JV0 A;  2Q3P A;  2WCX A;  2HVD A;  3A8K A;  4WFN Q;  4QR2 A;  3I5B A;  4OZJ A;  4DV1 J;  2P5V A;  3PYE A;  3BZQ A;  3CMR A;  4F26 A;  2F63 A;  1QLN A;  3R8Y A;  5L9N A;  3A13 A;  3MAA A;  3G87 A;  4ZPA A;  1SJ3 P;  1Y11 A;  5KT4 A;  4U7C A;  2ZBC A;  2Y0B B;  3TQ1 A;  4YFU A;  1NXI A;  1LW2 A;  3TG0 A;  3KG1 A;  3DFE A;  1EP4 B;  2NYH A;  4ZCM A;  1VBZ A;  1ZPW X;  1JLC A;  2Z2L A;  4LVN P;  3W5Z A;  5KFY A;  4P73 A;  1XMQ F;  2ATL A;  5CYJ A;  2JOQ A;  4J37 A;  2V69 A;  3GV8 B;  2H48 B;  2HHH F;  5KFF A;  3IFE A;  4DSL A;  4YME A;  3D5M A;  2O01 C;  3KXD A;  5HAO A;  1PBA A;  2VQR A;  2F9J A;  5A8R A;  4WTY A;  2V4R A;  3D28 A;  2QT7 A;  1R8C A;  3BSN A;  4LFC F;  1QDU B;  5M2R A;  1KHW A;  1SHN A;  3NVL A;  1FXD A;  3RBD A;  2JVO A;  2V6A A;  3HHL D;  5I4M A;  1S1U B;  4A48 A;  2EFN A;  1C0U B;  5T7L B;  2X1F A;  3AXK A;  1FVQ A;  3VAF A;  4NYP A;  2ACM A;  1SH3 A;  1YG0 A;  3LGH A;  3R5C A;  3PRD A;  2L41 A;  2O1P A;  2P2C B;  4USK A;  3LWM A;  4JYA J;  2YKQ A;  1Y3K A;  5A8W B;  1RTI A;  2O5D A;  4QIF A;  4B3T J;  1UKU A;  3UVJ A;  2M4M A;  2EK1 A;  1T9V A;  2BOA A;  4M5L A;  2QEX S;  5F8G A;  4ECY A;  3TAN A;  3BB5 A;  1K1Q A;  2OPS B;  1LWC B;  5LL6 d;  3HP6 A;  1RAO A;  2E5J A;  2HS0 A;  2ZBR A;  4BWJ A;  4HL9 A;  4QWA A;  2R3V A;  1JXE A;  2PGC A;  3J81 U;  1QVF R;  3G9C A;  1JLG B;  2HFO A;  4DR5 F;  3AXM A;  1JX4 A;  5L0E A;  3EWG A;  1XIQ A;  3R7S B;  4UST A;  2MST A;  4YB5 A;  4RUH A;  5I42 B;  1AA1 B;  3PW5 A;  5IT9 U;  1PAE X;  4WFB Q;  3BSA A;  2DGU A;  4JI7 F;  5J2Q B;  2HND A;  2YNG B;  4CO2 A;  1RT2 B;  2IC3 A;  1YQH A;  2IJN A;  1GXU A;  1KVI A;  3HO1 A;  4C7Q A;  2XG8 A;  4C0O C;  2E9Z A;  1VQP S;  2DGS A;  3D1Q A;  1C1B B;  2CJK A;  1RWN B;  3W8G A;  2IFX A;  1S4E A;  1TUG B;  1AJD A;  3MPY A;  2XCA A;  2F4V J;  5LMN J;  2FHJ D;  4C11 B;  2ZVI A;  1WAC A;  3RU0 A;  1VQ7 S;  4ZHR B;  4PPD A;  5KT5 A;  2VBZ A;  4PG7 A;  2OPQ B;  3ETO A;  1X4A A;  4OQJ A;  5GME A;  3PO4 A;  1EW9 A;  4J5O A;  5LRM A;  2CNL B;  1ELO A;  3EGN A;  5FDL B;  3L7U A;  4O23 A;  2MLY A;  1JXL A;  1KS2 A;  3P6Y C;  1O99 A;  5GAG I;  2BKN A;  4DL6 A;  5GAG U;  3OTO F;  5EWE A;  2CG4 A;  3KJQ B;  1PYO B;  1L3K A;  2NZC A;  3QLH B;  4RBT A;  2V4Q A;  4DV1 F;  4KGK A;  2J0Q D;  2D1C A;  1M5P C;  1X8D A;  3C6U B;  4W4M A;  4WBF A;  5F8N A;  3F41 A;  1GAO A;  2V2K A;  5HMX A;  2A10 A;  3CDB A;  2JLG A;  4WXW A;  3DXS X;  2H3E B;  2XY7 A;  2DH8 A;  3BEG B;  4DV2 F;  5F8J A;  3GWC A;  2JEJ A;  5D0G A;  3GMG A;  4GTX A;  4B17 A;  1RCO B;  2J8S A;  1RYS A;  2AJF E;  2FJE B;  3S6E A;  2J8A A;  3EZU A;  4DL2 A;  4X4V A;  1IKY A;  3GIJ A;  2I5J A;  2Z30 B;  4JI5 F;  4WKR A;  3CWJ A;  5IV3 A;  4DL7 A;  1V6H A;  4LIR A;  4N8O A;  2N7C A;  2IY5 B;  5K8M A;  1TKD A;  3PV8 A;  2GSN A;  5CYM A;  4R8U B;  5LQQ A;  4ED7 A;  1IR0 A;  1YHQ S;  1S1V B;  3K89 A;  1NCL A;  3DHX A;  5KG3 A;  1HPZ B;  1VQ9 S;  3SYZ A;  4DX5 A;  3QMQ A;  3KK3 A;  3LAM A;  3PG9 A;  4GKJ F;  4BHQ A;  4WCE Q;  3D3B J;  3RYL A;  3K5M A;  4NLY A;  4DQP A;  2VZ9 A;  3MEG A;  3MMA A;  2ZHA A;  3BN4 A;  3MEE A;  5KT7 A;  1KD1 T;  4JUZ A;  1VDH A;  3RRG A;  2JEG A;  3BDG B;  4B9S A;  4YOE A;  1Y0H A;  1GNK A;  3OQ2 A;  3C16 A;  2IMO A;  4JYA F;  2XWX A;  3MZI A;  1HDH A;  4PPZ A;  5ITH A;  4LF4 J;  3DOK A;  4K50 A;  3MM5 B;  1PKU A;  3QT6 A;  3J7A 1;  4ZOS A;  4NWB A;  5BJR A;  1CJT B;  2FJV A;  4KT0 C;  1RWK B;  1IKW B;  3KUE A;  4DR2 J;  2FY8 A;  3JQJ A;  4XAK A;  2L9W A;  4X66 J;  1D3W A;  4X65 F;  3I55 S;  3Q86 A;  3LXQ A;  4V19 J;  3VAK A;  1WHX A;  2KFZ A;  1RU1 A;  2VL1 A;  1AFI A;  2MQM A;  2KB2 A;  3W60 A;  1B8J A;  3D66 A;  3GJT B;  3GJR B;  3QNW B;  1FRL A;  1HI0 P;  4OX9 F;  4ECU A;  1SH2 A;  3HHE A;  1B3T A;  1U6F A;  2W9B B;  3DYA B;  2KHC A;  2M0G B;  3QAE A;  4Z7C A;  1PYT A;  1S10 A;  4AXJ A;  3PXG a;  3Q89 A;  3M2R A;  4RNH A;  1ED9 A;  5E5N A;  4PWD A;  1IKV B;  4IH6 A;  2R7T A;  4LRB A;  2UVV A;  1WF2 A;  1UEV A;  4USH A;  1JWW A;  3H5X A;  1TR0 A;  3M8Q B;  2F4V F;  4RUB A;  4JV1 A;  4NLR A;  1GH8 A;  3PDN A;  2QGF B;  2JX2 A;  1DY3 A;  1NZA A;  2UVU A;  3BS9 A;  2VHG A;  3G8Q A;  2YNF A;  2EVZ A;  4I0W A;  4CO0 A;  2MSS A;  4NA3 A;  1HNZ J;  4P2X A;  3N5B A;  3EM1 A;  4O0N A;  2OH2 A;  3MGJ A;  1Y5I B;  2WOM B;  4X4R A;  3KDO A;  4ECQ A;  3MM8 B;  3BDE A;  5KFB A;  1O6X A;  1S79 A;  1XMB A;  1BWV A;  2RKI B;  2FDN A;  2CNK B;  4O3S A;  5DLG A;  4KO0 B;  3S7R A;  2YKA A;  4Q2M A;  2R7U A;  5SUH A;  4LR9 A;  3AJ1 A;  4ILR A;  1WOP A;  1GQE A;  4WZQ A;  2FHM A;  4P52 A;  2WVB A;  2HFV A;  3MM6 A;  5IWA J;  3UFC X;  1R89 A;  2O3D A;  1VQK S;  4WK3 A;  6FDR A;  2A6M A;  1K47 A;  1RA6 A;  2NPI A;  3BDF A;  4O3N A;  1SPB P;  2PEH A;  3A1Y G;  1WG4 A;  3A3N B;  4DPW A;  5B0F A;  1AXQ A;  1AUD A;  3PYG A;  2LFV A;  5KFS A;  1URB A;  3R3T A;  4GVL A;  4CO5 A;  1Q81 T;  4HVZ A;  3M9N B;  3CE8 A;  2DK2 A;  2W7P A;  1Q95 G;  4KJD A;  2EC0 A;  3FKB A;  5KFZ A;  4J90 A;  5K5M A;  4B3R F;  3ENV A;  2E9T A;  5C66 A;  1RB0 A;  1TKX B;  2RIJ A;  2DIS A;  4UQG A;  2P9C A;  3I9V 9;  3MR7 A;  4FPR A;  4RL1 A;  2KFY A;  4E0D A;  1KHK A;  4NLQ A;  4YQW A;  4WXO A;  2A3J A;  4RKU C;  5INH A;  1N54 B;  4BWM A;  4AUK A;  3HXM A;  2CXE A;  2WBR A;  1FER A;  1VFJ A;  2VG5 B;  3CJR A;  2DYA A;  2LQ5 A;  4XIU A;  4B3O B;  4KBI A;  3M2U A;  2DO0 A;  5ETO A;  1V3Z A;  2J7K A;  4NWJ A;  2UV8 A;  2W9C A;  4JI0 F;  4KKO A;  4C6A A;  2CPH A;  5HRO A;  2BJ8 A;  1HQU B;  3ZTQ A;  4CZC A;  4KFB B;  1NSP A;  4PAB A;  3L7P A;  1ALK A;  2EFO A;  3KK1 A;  2V34 A;  4K4T A;  1HJK A;  3W8P A;  2V5H G;  4KM4 A;  3CXC R;  5C42 B;  3M6X A;  2NXE A;  3LAN A;  2XSJ B;  4QQB A;  4CYU A;  2DHH A;  4KYZ A;  2V9K A;  4GVB A;  2K1R B;  4QCL A;  3CNQ P;  3HT0 A;  4J9U E;  2LVW A;  4KIA A;  2HLU A;  4DR2 F;  2CZ9 A;  1ZA2 B;  3KLG A;  2QL7 B;  3B8H A;  4JBC A;  2V63 A;  2UXC J;  3BGU A;  5L39 A;  4Y00 A;  1G7C B;  2XYH B;  3GYN A;  4OHY A;  1T95 A;  3CO9 A;  5J1N A;  1RWU A;  1HQA A;  4LT6 A;  5AE3 A;  3SCL E;  1EKR A;  4OLP A;  4A8M P;  1ELX A;  4PG4 A;  1HR0 J;  3G82 A;  2A18 A;  1VBK A;  2Y0S D;  4DMZ A;  3VGU A;  1EQ0 A;  1ZTW A;  4QW9 A;  1HQE B;  3EDQ B;  1FK9 A;  3G4S S;  5KFH A;  3G6E S;  3HSD A;  1U26 A;  1T9T A;  3BPD A;  4OYW A;  2W5S A;  1ZEB A;  1ZEF A;  3DLJ A;  4YDX A;  3EGZ A;  2LP4 A;  2HFZ A;  5LMU J;  1RHJ B;  2HZV A;  2IM3 A;  3I5A A;  1VQM S;  1Q7Y T;  4FBT A;  2OD4 A;  5HAT A;  3QYY A;  1CC8 A;  2CQ3 A;  2IM1 A;  2Z4P A;  4G3I A;  4XPE A;  3CSK A;  2BRL A;  3CJ5 A;  4L74 A;  4GKK J;  2KL8 A;  3PEH A;  2B9X A;  4RW4 A;  3FBE A;  3BBF A;  5D77 A;  1NUE A;  3GV5 B;  1J5E F;  4QU6 A;  4O44 B;  1UTA A;  4Q8F A;  4MJK A;  1NJZ A;  1LXN A;  3OFE A;  1LKZ A;  4ZGA A;  1URA A;  3LP0 B;  3I5C A;  4UZC A;  4OX8 A;  5E3R A;  8AT1 B;  3HFK A;  5HP1 A;  2ZZT A;  2BJ7 A;  2CPD A;  3E2D A;  1FFW B;  4IFV A;  3ITH B;  1Q1K A;  1N2K A;  4TXS A;  1HBO B;  4URQ U;  1RTH A;  5IWA F;  3JQM A;  1LWF B;  3QJJ A;  2BQU A;  3VZI A;  1Q4R A;  4ZVQ B;  3CMQ A;  2CWK A;  1BLU A;  3QT8 A;  3TOQ A;  3J80 Y;  3ENA A;  2BJ3 A;  1S1W A;  2G9Y A;  2KRB A;  4FP9 A;  3BDP A;  2J9C A;  2HGL A;  5KFQ A;  1GXL A;  3CB4 A;  1FT8 A;  5K8O A;  4DV3 F;  5JVH Q;  3SXL A;  2D69 A;  2DNM A;  4BBY A;  3PIP Q;  4CI0 B;  4NRT A;  4E98 A;  2VFR A;  2ZH9 A;  1JKH A;  4HTJ A;  3MED B;  3OVA A;  3KHG A;  3NGR A;  2XUL A;  4OJG A;  1JIH A;  5CCM A;  2OFG X;  1YDL A;  2FJW A;  2HHQ A;  1KC8 T;  2GV1 A;  3HDS A;  1X4G A;  2GS8 A;  1XQI A;  2MKK A;  3A52 A;  3U7J A;  1UJ4 A;  2VU5 A;  4FKY A;  2E5H A;  3LOU A;  3C6T A;  4XK8 C;  2YQ1 A;  2H5I B;  5MLC V;  4ED1 A;  2XGQ A;  1N0V C;  2BAN A;  2N3L A;  2AYG A;  4EYI B;  1RT1 B;  1Q82 T;  5IT4 A;  5D3G A;  3SZZ A;  5M2P A;  1D9F A;  2X3G A;  3KJF B;  5AXM A;  2LA4 A;  2I9S A;  4USJ C;  4TNO A;  5IFM A;  1REG X;  3OTE A;  3FSI A;  4DOZ A;  4J9L A;  5HBM B;  3IG1 A;  3OR2 B;  1RLC L;  3HM9 A;  1S9E A;  1YGY A;  4NML A;  4KTQ A;  3KLI B;  3WBZ A;  3HVT A;  3QWU A;  3BO3 A;  1UFW A;  5T41 A;  4O3P A;  4F4K A;  1DRZ A;  3BH6 B;  4DR6 J;  3ZZR A;  3PEJ A;  7FDR A;  4FXV A;  1KH4 A;  1R31 A;  2F1F A;  1SKR A;  5KFN A;  2FC9 A;  3UW1 A;  3KHL A;  3BJY A;  1NK4 A;  1HI1 A;  3PRB A;  1WOS A;  2N3O A;  1HYS A;  4F4W A;  1CBK A;  3AHP A;  3B4D A;  3MEC B;  1D9A A;  4NEY A;  1R43 A;  3IRX A;  2MPU A;  2ANH A;  1BD6 A;  2MQN A;  4TU7 A;  3B54 A;  2XR9 A;  4DG1 A;  2HHX A;  3X3U A;  2J6U A;  3GFX A;  2ZC4 A;  2F8M A;  1VQL S;  1PBU A;  1HR0 F;  3R5B A;  2L9N A;  4QYZ J;  1HNX J;  1Q8L A;  2E5I A;  3I31 A;  3V6D A;  2DGQ A;  3NP5 A;  4HLB A;  4X4S A;  4GC6 A;  4UQT A;  2ILZ A;  3H42 A;  4EBC A;  3T41 A;  2BAC A;  2GVD B;  5AT1 B;  1BC6 A;  3Q8V A;  4UT4 A;  5ETM A;  3IAM 9;  2CA9 A;  2AW0 A;  1REV A;  3MMC A;  5LXR A;  2DGO A;  2G2Z A;  5LMU F;  2DRB A;  1ALJ A;  3C2P A;  2HNZ A;  5KFP A;  3KUH A;  3B5Q A;  3FFI B;  3SV3 A;  4TU9 A;  3NEK A;  4PEO A;  3IAS 9;  1FTR A;  1HQ2 A;  4OYX A;  4CCH A;  1UZH A;  3U1M A;  2B9E A;  3T9N A;  4EUV A;  4ZIV A;  1U1R A;  2VUG A;  3LQV A;  5ETK A;  1WC1 A;  1XR6 A;  3DGP A;  2D3O 1;  4GKK F;  2G9O A;  4UOG A;  4ED5 A;  4TLQ A;  3M6W A;  2LQB A;  2UUT A;  2BDP A;  4ES2 A;  2W8K A;  4ZCI A;  1SL2 A;  1I5O B;  1I94 F;  4BC9 A;  2YWW A;  1RT3 B;  2HRT A;  4ED8 A;  1N5Y B;  8RUC A;  4DLG A;  3DPC A;  3VGT A;  1P1L A;  3SFU A;  2NUU G;  3BRE A;  4DLE A;  1VIS A;  2HGM A;  4CT9 A;  3CJ0 A;  4P71 A;  4JB8 B;  1WKJ A;  1VRU B;  3KLH B;  1UL3 A;  5C25 B;  1WF1 A;  4MK7 A;  3H7H B;  1D1U A;  2ABY A;  4TLR A;  4WFY A;  1SKU B;  4PXB A;  2CJY B;  1KFS A;  2GO9 A;  3D54 A;  1J2V A;  3DRP A;  3QQC D;  2E1C A;  5DZ6 A;  4HHU A;  5CYQ A;  2L9D A;  2LEB A;  4Q44 A;  4UUW A;  3THV A;  3RR8 A;  3J81 Y;  2WSC C;  4QYZ K;  2RE1 A;  2G1H A;  3IR7 B;  3SSQ A;  3AOB A;  4LF5 J;  5IT9 Y;  2KT5 A;  4OIX A;  2FHJ A;  4NLG A;  1MU2 B;  2V4J B;  1JLQ A;  5CCL A;  4LIW A;  3CJ2 A;  2VA3 A;  2Z58 B;  1JXV A;  3VGS A;  4ES3 A;  1HBN A;  3MR2 A;  4K7Q A;  3CCZ A;  2BJ1 A;  4CM2 A;  4HAC B;  5A76 A;  3WQP A;  2ZE2 A;  4R0J A;  5L1I A;  1MNE A;  3HFV A;  2PMW A;  1Z1Z A;  4MIW A;  2GJI A;  1SV5 A;  5F0U A;  4LF9 J;  3OUY A;  2K06 A;  3WIU A;  4NLP A;  4ECZ A;  2CZ4 A;  4CYS A;  3W63 A;  5HVG A;  4UOO A;  3T1A A;  1EET B;  4ZP7 A;  7FD1 A;  2IRU A;  2KVQ E;  2VKZ G;  1VMB A;  1CJV B;  2YX7 A;  2M70 A;  2MY7 A;  2Q66 A;  4CLS A;  1YJU A;  4JV5 F;  4IG3 A;  5KFK A;  3C19 A;  1F5C A;  2DR7 A;  1HLW A;  5C24 B;  2MJU A;  5A8R B;  1E33 P;  2DKO B;  2KRR A;  3TEG A;  1ELY A;  4DS5 A;  3NGK A;  3DN9 A;  1VS3 A;  2RS8 A;  3GSI A;  1J27 A;  4FN5 A;  3K58 A;  3BGO P;  4I6W A;  4B9U A;  2GJ2 A;  3HD1 A;  1RKJ A;  3G6X A;  4FYV B;  2BW2 A;  2WVE A;  1SH0 A;  2BQ3 A;  3MUR P;  1EP4 A;  5DDP C;  2HHU A;  1UWB B;  3EX7 B;  1YJW S;  5KG0 A;  2KT2 A;  3DOL B;  2C3U A;  1RWW B;  3SI8 A;  3V4M A;  1B0T A;  1FDA A;  2ZH5 A;  4TVA B;  1IWA A;  3E01 B;  1O51 A;  3H8Y A;  3OTC A;  2ZKT A;  4ID5 A;  3JTO A;  1GTE A;  4Y2K A;  5E3Q A;  1S6O A;  1KQF B;  4AQY F;  4FF4 A;  4DU8 A;  4ELU A;  3UN5 A;  3PX6 A;  1ULR A;  1UA1 A;  1UVM A;  1B0V A;  5KFX A;  2E66 A;  2JEF A;  1S1U A;  4TY9 A;  4LR2 A;  1C0U A;  5T7L A;  2EK6 A;  1RLD A;  5E41 A;  3FK4 A;  3H40 A;  5EDW A;  2QJ3 A;  2QE5 A;  5H1S V;  4F2R A;  1FWK A;  2J9D E;  1URR A;  5J1E B;  2KYZ A;  5EWG A;  2B56 A;  4OI1 A;  5A8W A;  3UCZ P;  1WC0 A;  1ZYQ A;  3FMB A;  4P2M A;  1IM6 A;  2P9G A;  1KFD A;  2HW3 A;  2OLW A;  2C42 A;  2MDA A;  3BKU A;  3Q8R B;  5B0E A;  4CNZ A;  1FNM A;  1KR4 A;  3FBF A;  3TZZ A;  1D8Z A;  5GMD A;  2QTW A;  2OPS A;  2W2N P;  1LWC A;  3TJ9 A;  3L95 X;  1RWO B;  3W62 A;  1T8E A;  1JLG A;  4KR0 B;  2UVR A;  3EE3 A;  1JJC B;  1FJG J;  3TVK A;  5I42 A;  4CDI A;  1RT4 B;  1ZAV A;  2CAD A;  4KHR A;  5D4O A;  5J2Q A;  1CG2 A;  2P8I A;  3ZZZ A;  1HA1 A;  4LF5 F;  1RT2 A;  1S7H A;  1NSQ A;  1NB7 A;  4L73 A;  4CLP A;  2IM0 A;  3UD5 A;  4C8Y A;  4CLU A;  2DR8 A;  2RH3 A;  1CJU B;  1C1B A;  1U1Q A;  2EI5 A;  2MY8 A;  1GT8 A;  3IGN A;  4YB7 A;  2DRA A;  1UJ5 A;  1X4H A;  4PYA A;  5EWF A;  2GC8 A;  2HHP A;  2R8H A;  1HNW J;  2DH9 A;  4DF8 A;  1BUX A;  4ZHR A;  1S1X B;  2H5E A;  4RZR A;  1MG7 A;  5H9F J;  1X60 A;  1Q86 T;  3AOD A;  3GIK A;  1IKY B;  2EFV A;  2I5J B;  4DQQ A;  1Z2L A;  2MQL A;  2W01 A;  4FS2 A;  5E3P A;  5FDL A;  2C3M A;  2GAG C;  2HNY B;  3LP2 B;  5E33 A;  1WOR A;  4ZCL A;  2BOP A;  2J7U A;  4EZ6 A;  3BSO A;  2KZZ A;  4P6Q A;  2C3P A;  4O3R A;  3BQ1 A;  1FRM A;  2CJX B;  1YWX A;  2ZBQ A;  3D2W A;  5E3A A;  1DTQ B;  2DHS A;  3C6U A;  3HSZ A;  2W4C A;  4OI2 A;  5IM0 B;  4D3H A;  2RQM A;  1RDR A;  4J9S A;  3A8I A;  4ZIT A;  3AOA A;  2YWH A;  3OL8 A;  1EAY C;  5LSR A;  2NR0 A;  3BPS P;  2C2R A;  1U45 A;  3CCL S;  2OEJ A;  1Y3J A;  2C28 A;  2KT3 A;  3E3X A;  4MY4 A;  5KG5 A;  4K4U A;  1C4C A;  2XCP A;  1X4D A;  3G96 A;  3QGG A;  4JI1 J;  3TJA A;  4R8U A;  5L0K A;  3K5L A;  2VD3 A;  2GW8 A;  1S1V A;  3RAX A;  2Y1J A;  3N6M A;  1SL1 A;  1HPZ A;  1M1H A;  2BW7 A;  2WW8 A;  1H38 A;  4MHX A;  1VRT B;  4ELT A;  5B7W A;  2RHQ B;  2PC6 A;  5KT6 A;  1VC0 A;  3GIL A;  2PI5 A;  1AJA A;  1PYS B;  3V6J A;  2RH6 A;  3H25 A;  5H9F K;  2QA1 A;  5LIA A;  3TW0 A;  3U27 A;  3DI6 B;  1YRX A;  5KFD A;  1QUP A;  2I38 A;  5JXS A;  3M8S A;  1ZOT A;  4ANE A;  3I0R B;  1JLE B;  4ETX A;  1HL6 A;  2RT3 A;  4Q7A A;  1N5S A;  4LRD A;  3BDG A;  3FBC A;  3UE2 A;  3B4M A;  3QJL A;  1WUU A;  2LYV A;  1ZZN A;  4TU8 A;  3OSN A;  2HSE B;  3QRR A;  3CJK B;  1N56 A;  2EBE A;  3FQL A;  3AD8 C;  2ZOF A;  3MM5 A;  4Y3C A;  2DGW A;  3TVZ A;  3M2R B;  2HHV A;  4QR1 A;  1CJT A;  4ZG9 A;  3HLU A;  4F04 B;  1IKW A;  3K57 A;  1QAJ A;  4K4V A;  1SIW B;  1U48 A;  2ALY B;  2CKW A;  3PW2 A;  4UOF A;  1EB0 A;  2CFX A;  3MFI A;  2CQ2 A;  3R2C J;  4U8V A;  1ITP A;  1DQ8 A;  5A6W A;  5DDO C;  2KDO A;  1IBL J;  3RTV A;  3ZZP A;  4CLY A;  1HI8 A;  4LMZ A;  1IUJ A;  4C3L A;  4LFA J;  2IA6 A;  3TO8 A;  2LMI A;  2QC3 A;  3CDW A;  3VAI A;  2O67 A;  3OLA A;  1IBK J;  5HJY A;  1ZBT A;  3PVX A;  4HYK A;  3DYA A;  2HHW A;  4RW9 A;  1NND A;  3TNV A;  4ZVU B;  4O4G B;  2P9E A;  3K5P A;  1UFK A;  2VQF F;  3GYG A;  2YKM B;  1QSY A;  1IKV A;  2B8Q A;  2ZD1 B;  5RUB A;  2XMW A;  1NDC A;  4QW8 A;  1NJY A;  4JI2 J;  3M8Q A;  1HWK A;  1Y5L B;  2HHS A;  1HNW F;  2POK A;  1E6V B;  5DLW A;  3KKF A;  3RJM B;  2XYG B;  3OTB A;  3FGV A;  4MTP A;  3I4P A;  1LQ9 A;  3RAM A;  4U8Y A;  4RBU A;  3RRH A;  2WOM A;  3MM8 A;  5LOQ A;  1T03 B;  1D8Y A;  3RBZ A;  3BYR A;  4DBQ A;  2V8D A;  2ZOG A;  1YX2 A;  2RKI A;  4DR3 F;  4NLW A;  3R27 A;  2WTF A;  4KO0 A;  1KHJ A;  4WPA A;  4JI4 J;  3MCN A;  3GV7 B;  1X5T A;  2CRL A;  4A47 A;  5JJB A;  3GLJ A;  4UOH A;  3DNC A;  4OZ2 A;  4DPY A;  4OLO A;  2C3O A;  3JAM U;  2CQP A;  1RHK B;  4B9T A;  2HVE A;  3M8P B;  3TI0 A;  3GCW P;  4KSE B;  4F50 A;  5L9X A;  4OX7 A;  2AWZ A;  1H2T Z;  4S0M A;  3M2U B;  1OQ6 A;  1NHU A;  2VBW A;  3HUL A;  4WKY A;  3K8V A;  4ZVP B;  4JI3 J;  4A8S A;  1VJW A;  3ET6 B;  3DDI A;  3ILI A;  1XR5 A;  1TV6 B;  3RGI A;  2FVS A;  3LH2 S;  4AD6 A;  1RGV A;  3MD3 A;  5KFJ A;  3SCJ E;  1SHQ A;  1NU4 A;  4OYZ A;  3TP2 A;  4RJV A;  2VOD A;  1JQG A;  3IXQ A;  1E3C P;  4HHJ A;  4DU7 A;  3C14 B;  1TKX A;  5F41 A;  2LU1 A;  3G71 S;  3DXB A;  3O1L A;  4ENO A;  2DNN A;  3CDE A;  4JI1 F;  3H2L A;  1F5B A;  3DRR B;  3CJ8 A;  3T1H F;  3IC1 A;  3JXO A;  5ETL A;  5J1P A;  4L72 B;  3AOC A;  1Y10 A;  1VC5 A;  2PII A;  3V6H A;  2ASY A;  3TAQ A;  2DNR A;  2DXD A;  2BBE A;  4UY8 T;  2VG5 A;  1I3O B;  1CC7 A;  2MGZ B;  4B3O A;  1AJB A;  4TN2 A;  4JI6 J;  4WZM A;  4Y0F A;  2ZH4 A;  3RB0 A;  4ZIW A;  2ZZM A;  4DV7 J;  3SIP B;  4G1I A;  1UZD A;  1U1K A;  2PMZ D;  1HQU A;  3GG0 A;  4KFB A;  4OV6 A;  1Y00 A;  4ECT A;  2V94 A;  2E5G A;  3NS5 A;  2A0F B;  4YUD A;  2D3U A;  1SJR A;  3T19 A;  5AXL A;  4LRE A;  2H4Y B;  3L7O A;  4RUC A;  2XSJ A;  2EPI A;  2DJW A;  5EGH A;  1C4A A;  3CCW A;  2K1R A;  4LBP A;  4LF7 F;  3T5L A;  8ATC B;  4EO6 A;  2APO A;  2EFP A;  1S12 A;  2DNH A;  1X5S A;  7AT1 B;  4KRW A;  2R7R A;  2CQC A;  4KV8 B;  4MKY A;  3LGN A;  4YDD B;  1WJ9 A;  2CQH A;  1ZH5 A;  3RW7 A;  3CIZ A;  3MK2 A;  2R2T A;  3HCX A;  2RS2 A;  2BKP A;  4Q43 A;  4XDC A;  1NK6 A;  4M63 A;  1RTD B;  5BR8 F;  3KNG A;  1AFJ A;  1WEY A;  1OY8 A;  3CJ3 A;  4ZPB A;  1HQE A;  2VAS A;  4GO5 X;  4RW8 B;  2DEJ A;  2C2M B;  1LFW A;  2ZIT A;  1HWI A;  4U7U K;  4AXI A;  2B8P A;  2MLZ A;  4IFV B;  2ROP A;  1YK9 A;  3VVU A;  3C46 A;  2Y1R I;  3Q3Q A;  3M32 A;  4AFF A;  1VQN S;  2ZH3 A;  1W2B R;  2OPR B;  3X1L B;  3EXC X;  3M1V B;  1FX4 A;  3THT A;  3CIM A;  4F4Z A;  3DKD A;  3QFH A;  4ECR A;  2FJA B;  4JI2 F;  2DH7 A;  3OW2 R;  1K9M T;  5KTQ A;  2QL9 B;  4QOT A;  3DU5 A;  2XY5 A;  1IVZ A;  1U1L A;  1TFY A;  4TKT A;  5HL7 Q;  3NGD A;  4PG6 A;  2MJN A;  2YQ0 A;  1U2C A;  5IJS A;  3VAH A;  2E7X A;  2YWG A;  1CJK B;  3JTN A;  4O44 A;  4IRC A;  5GAE I;  1CLF A;  5FJ4 A;  4HH1 A;  4Y34 A;  2OTL S;  1WKL A;  2M5Y A;  2ZOM A;  2K7J A;  5JUM A;  3LP0 A;  2ZBP A;  2QLX A;  1RU2 A;  2F3J A;  2XEX A;  3ADA C;  2C2N A;  1IJF B;  3OFF A;  3KMS A;  4JI8 J;  3UD3 P;  3ITH A;  2HMI B;  2HBQ B;  1HBO A;  2BV3 A;  2J7W A;  4I56 A;  3AB4 B;  1LWF A;  3RB6 A;  4PYD A;  4LFB J;  3BH7 B;  2L48 A;  3KHR A;  4ECW A;  3NLC A;  2VPW B;  4PR6 A;  4JI3 F;  3IBC B;  4EU0 A;  4C0H A;  1KN6 A;  1RUS A;  1TL3 B;  5ADZ A;  1UW9 A;  1TK5 A;  1FE0 A;  2WVD A;  1HNI B;  1SJ4 P;  1OY9 A;  3OV7 A;  4KQZ A;  3W9H A;  3NCR A;  1VRQ C;  1HKA A;  2FZC B;  4UF4 A;  5I3U B;  3MED A;  2LA6 A;  3VF0 B;  2VPY B;  4LF2 A;  1FEE A;  2VFV A;  1S7I A;  4FDJ A;  1ZAX A;  2DPI A;  2NPF A;  4C8O A;  2DXF A;  1ZM3 A;  4DSJ A;  4DV0 F;  4WTO B;  2OSQ A;  4PXD A;  1R0A A;  3ZFV A;  1ALH A;  4ERD A;  2OSR A;  3PR4 A;  2R7S A;  4CH0 S;  2YPY A;  2G1D A;  1RT1 A;  2OUG A;  2HZA A;  2OJ3 A;  4KH0 B;  3NOC A;  3N28 A;  3UWT A;  4DV7 F;  3CC7 S;  2JLE A;  2X1G A;  3CCU S;  2DNO A;  4CM0 A;  1Y7A A;  4NPO A;  3VV2 B;  4XO0 A;  3MK1 A;  5HBM A;  3OR2 A;  4TYB A;  3MTJ A;  3ISN D;  1BQX A;  3KLI A;  1X4C A;  3THP A;  2WBM A;  1BE4 A;  4P2F A;  4X2B A;  2JNJ A;  4O0I A;  3NG8 A;  1BWE A;  1S49 A;  1WWH A;  4OJH A;  3JSM A;  1KBR A;  4OI4 A;  4DF4 A;  1Z2Z A;  4NL5 A;  4NYO A;  5AE1 A;  2UUB F;  5BYR A;  4ZMM A;  5GRR A;  2BXJ A;  2R8G A;  1RAA B;  1Y9O A;  3NKP A;  2E29 A;  3DRX A;  3FSY A;  2Y8Y A;  2H1Y A;  3UQS A;  5DGB A;  4WFA Q;  2QMX A;  2HQI A;  3MEC A;  3MCM A;  3Q2T C;  1TQL A;  3JQK A;  1VQS A;  2Z57 B;  3MPU B;  5KFR A;  3R6L B;  5KG2 A;  3MAQ A;  2B4O A;  2BZ2 A;  5HAN A;  2W9A A;  2DBB A;  2C2O B;  2R7X A;  5GAD I;  3BR9 A;  4IKA A;  2BMB A;  5GAD U;  1FDB A;  1E6Y B;  2LEA A;  3MI7 X;  2GVD A;  3ZNU A;  4DL3 A;  2RF2 B;  4KHM A;  4B9M A;  5B0C A;  1JLB B;  1TEL A;  4DQS A;  4OFZ A;  3OXF A;  3CPW R;  3IWX A;  2WZ1 A;  2BJD A;  1RSC A;  1UW4 A;  1UVL A;  2AT1 B;  1OPZ A;  1XN9 A;  2M88 A;  3FFI A;  3VAM A;  4DR5 J;  2AYM A;  4ZVH A;  3ZZY A;  4HI2 A;  3P5B P;  3PRV A;  4K5S A;  4LBH A;  4Z2X A;  3AA8 A;  4IR1 A;  3T1Y F;  5D15 A;  2IYI A;  3TUI C;  2I0X A;  5CH7 B;  3CF5 Q;  4NLO A;  5EX3 A;  3EGW B;  4JI7 J;  3Q83 A;  3I6P A;  3EVO A;  4MFB B;  3KK2 B;  3NKO A;  4FVM A;  2IUC B;  1OWX A;  3IWL A;  4R5P B;  4NX9 A;  1QAX A;  3J7Z T;  1JLQ B;  4M5N A;  1RT3 A;  2ROG A;  1N5Y A;  4Z7Y A;  2LXF A;  2UU9 J;  3IDD A;  4RU9 A;  3LW5 C;  4JI8 F;  4ZP8 A;  1VRU A;  3KLH A;  1A9N B;  5C25 A;  3VTI A;  4DN0 A;  1EJJ A;  4Y2M A;  3NGS A;  1X4E A;  2NXN A;  5DG9 A;  4LFB F;  1JNR B;  4OZN A;  3KD8 A;  3WBH A;  5I3Q A;  1Y4Z B;  4R25 A;  3J7Z 5;  1S97 A;  2PEB A;  2VG6 A;  5F9L A;  2V2Z A;  3QIP B;  1H98 A;  3MXH P;  3H59 A;  1EW8 A;  2V68 A;  1XWL A;  2E9R X;  1N4L A;  6AT1 B;  2RIL A;  4I1T A;  4M95 A;  1F3V A;  3BO2 A;  1L3T A;  3QWP A;  5AJ3 J;  1E2S P;  4A8O A;  1ZED A;  2PFF B;  3G8S A;  2VQE J;  1U0H B;  5HQ8 A;  3PHT A;  1MU2 A;  3OTO J;  2V4J A;  1NB2 A;  1PO6 A;  2ZC3 A;  3DLK B;  4IG3 B;  5A0Y B;  4PZV A;  2GIR A;  4NA2 A;  2RUG A;  2HUR A;  4HAC A;  2DGX A;  2Q79 A;  1EIY B;  2V8G A;  3Q24 A;  2XMT A;  2VBX A;  1IR2 A;  1SUQ B;  1FXR A;  1C1C B;  4DV2 J;  4KPC A;  2F7V A;  1YBT A;  2XS5 A;  1TL1 B;  2CPZ A;  3H0P A;  2DNQ A;  2ZDP A;  1WF0 A;  3GCX P;  2MLX A;  2ZNZ A;  3DLG B;  3T5J A;  1RZM A;  2QX0 A;  1S6P B;  4IDK A;  2W2Q P;  4JI5 J;  5LXY A;  4ZPC A;  2PT0 A;  2UUW A;  1EET A;  4TY8 B;  3IBW A;  4DFM A;  1KDN A;  3O44 A;  3BR8 A;  4ZVO B;  5F8I A;  2OEK A;  1WC3 A;  1OJ4 A;  3I56 S;  3CTR A;  4C3M A;  1CJV A;  3TX0 A;  2UXD F;  2VPX B;  1WHW A;  2Y3Y A;  2RDJ A;  4RUA A;  4CRJ A;  3MPD A;  3WAX A;  1R0B G;  3OHA A;  4ID5 B;  1KTV A;  1F60 B;  2GNK A;  5C24 A;  3D6F B;  1NDP A;  1APS A;  3ED4 A; 
#chains in the Genus database with same CATH homology
 3IGZ B;  1ED8 A;  3DYC A;  2GSO A;  3OT9 A;  3B5Q A;  3MK2 A;  5DLT A;  4LR8 A;  4N7T A;  3UN5 A;  1ALI A;  2GSN A;  4FDJ A;  2QZU A;  1AJA A;  1KH4 A;  4MIV A;  4GTW A;  4KAY A;  1EW9 A;  4UOP A;  5LQQ A;  1KHJ A;  4ZG6 A;  5LRM A;  5LRN A;  1E1Z P;  2RH6 A;  3NKO A;  2IUC B;  1KHK A;  5LIA A;  2W5V A;  5EGE A;  1E33 P;  1P49 A;  2VQR A;  3M8Z A;  3MK0 A;  1O99 A;  1AJB A;  4LR2 A;  4ZG7 A;  3T01 A;  3UO0 A;  2X98 A;  1ALH A;  4UPH A;  3LXQ A;  5L0E A;  5INH A;  1Y6V A;  1ELY A;  3M8Y A;  2W8D A;  2W5T A;  3M8W A;  4KJG A;  4CXS A;  3IDD A;  4QAX A;  2D1G A;  2GA3 A;  1SHN A;  3A52 A;  3NVL A;  4LQY A;  4CXU A;  3SZY A;  4ZGA A;  3NKR A;  1URA A;  3UNY A;  2ANH A;  3CMR A;  1HQA A;  3M7V A;  4LRD A;  4LR9 A;  1B8J A;  3BDG A;  3IGY B;  5DLV A;  1EJJ A;  3UN3 A;  1ELX A;  1ANI A;  2XR9 A;  2W5X A;  3UN2 A;  2GSU A;  4CXK A;  5HRT A;  1EQJ A;  2W5W A;  3WAV A;  1ALJ A;  3KD8 A;  4UPL A;  3DPC A;  1Y7A A;  4NWJ A;  4CYR A;  4TN0 A;  3E2D A;  5KXA A;  3Q3Q A;  1KH7 A;  5IJQ A;  1N2K A;  1AJC A;  4LRE A;  3MK1 A;  3WBH A;  4B56 A;  1AUK A;  3SZZ A;  3NKN A;  3BDF A;  3T02 A;  1K7H A;  4LR7 A;  2W5R A;  1SHQ A;  3BDG B;  5EGH A;  1ANJ A;  4MY4 A;  5L0B A;  1EI6 A;  1EW2 A;  5GOV A;  3WAY A;  4LRF A;  1ALK A;  1EW8 A;  4UPK A;  4GTY A;  1FSU A;  1ED9 A;  2W5Q A;  3NKM A;  5AJ9 A;  5TJ3 A;  4ZG9 A;  4CYS A;  4GTX A;  3TG0 A;  1AJD A;  2W8S A;  4LRB A;  1E3C P;  3TX0 A;  1HJK A;  1KHN A;  5DLW A;  3WAW A;  1HDH A;  5K4P A;  2W5S A;  4KM4 A;  1E2S P;  4KAV A;  4UOO A;  1URB A;  1ZED A;  2G9Y A;  1ZEB A;  1ZEF A;  4YR1 A;  1ELZ A;  5L0K A;  1O98 A;  4UOR A;  2IFY A;  3TWZ A;  3WAX A;  1KH9 A;  3T00 A;  5GRR A;  1KHL A;  4KJD A;  2IUC A;  2ZKT A;  4NWX A;  3NKQ A;  4LRC A;  4LRA A;  4MHX A;  4FDI A;  4UPI A;  1N2L A;  4GTZ A;  2GLQ A;  3BDH A;  3ED4 A;  3NKP A;  5IJS A;  2XRG A;  1KH5 A;  5C66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...