3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
2D1GA 3NKMA 2IUCB 3MK0A 2VQRA 2GSOA 2W5TA 1N2LA 2W5RA 3TX0A 5AJ9A 2IFYA 4ZG7A 3WAWA 3SZZA 3Q3QA 3B5QA 3IDDA 3WAYA 4UOOA 1EW9A 4LRCA 3UNYA 1P49A 2IUCA 4LR7A 3E2DA 4GTYA 4GTZA 4TN0A 3WAXA 1ZEFA 3IGYB 3UN2A 1AJBA 2RH6A 2GLQA 5L0BA 4CXSA 1ANIA 1HJKA 3NKRA 3ED4A 4UORA 1KH4A 3BDGB 3BDHA 3IGZB 4LRFA 2ANHA 5DLTA 4ZG6A 4LREA 5EGHA 1ALHA 4LR9A 1KHJA 1ELXA 1SHNA 2QZUA 2GSNA 2W5SA 2W8DA 1N2KA 2W5QA 5GRRA 3WBHA 3BDGA 1EW8A 3NVLA 4B56A 3M8ZA 4QAXA 2G9YA 3MK2A 1ELZA 1ALJA 5HRTA 3A52A 4KAYA 4MIVA 1AJDA 1KH5A 3NKPA 3M8YA 1KH7A 3T00A 3WAVA 1EI6A 1AJAA 5EGEA 5L0EA 4CXKA 1URAA 3BDFA 3M7VA 4CXUA 1E1ZP 3DPCA 3MK1A 4ZGAA 3UN5A 3CMRA 4UPIA 3M8WA 4UPHA 1E33P 1ED8A 1E3CP 5DLVA 2W8SA 3TWZA 5GOVA 1Y7AA 1K7HA 5LQQA 4N7TA 3KD8A 4LRBA 4LR8A 1ZEBA 4LQYA 1EW2A 1Y6VA 4NWXA 3T02A 5LRMA 4KJGA 4FDIA 2GA3A 4MHXA 1EJJA 1B8JA 1E2SP 1KH9A 1HQAA 2XR9A 3LXQA 4GTXA 1ED9A 2ZKTA 2W5XA 5IJQA 4CYSA 2W5VA 1HDHA 1SHQA 3T01A 3DYCA 1ELYA 3NKOA 5LIAA 2X98A 4UOPA 3TG0A 4KM4A 4NWJA 1ALKA 4YR1A 1AUKA 4UPLA 5K4PA 1O99A 1KHKA 2XRGA 1ANJA 2GSUA 4KAVA 4CYRA 3UN3A 4KJDA 4MY4A 5KXAA 5TJ3A 5L0KA 1ZEDA 5DLWA 5IJSA 3NKNA 1O98A 4FDJA 3NKQA 2W5WA 1URBA 4GTWA 4LRAA 4LRDA 3UO0A 4UPKA 5C66A 5INHA 1FSUA 1AJCA 5LRNA 1KHLA 3SZYA 4ZG9A 3OT9A 1EQJA 1ALIA 4LR2A 1KHNA
chains in the Genus database with same CATH superfamily
1S59A 1GH8A 3ONQA 4RWWA 1T8EA 1VQ6S 2ZH3A 1B0TA 4GTZA 2F4FA 1S7IA 3PTWA 4ZPBA 5HQ8A 3E2EA 4FPIA 2ABYA 4C48A 4ILMA 1NEEA 2DH8A 1KQSR 2LA6A 4OI3A 1HQUB 3CUNA 4EK2A 4OV6A 1S12A 3BDGA 4F04B 4ID8A 4NLRA 4FF4A 3OTCA 2QA4G 5CD4A 4QJVA 3DOLB 2R4FA 4DJBA 1C2PA 2XLIA 3Q8VA 2KXFA 2OEJA 2XY6A 2BXJA 4WIQA 4DV0F 3H2VE 2L9WA 4MT1A 5C5JA 4DUZF 2X3GA 2ZC3A 1T9XA 2FIUA 2J5AA 2HQDA 2JNJA 3GFHA 2XMWA 3T5KA 1J5OB 4DV2F 3SYZA 1HW9A 2Y0SD 5BR8F 5GMKa 3OSPA 2GVZA 5CYMB 1EAYC 4ZK7M 5LMUJ 2AEMA 3DLEA 2FGOA 3ET6A 3SBMA 2QFJA 3O5TB 1RSCA 3VHQA 4CLWA 3R5CA 3BGRA 2GZOA 1T9TA 2B3TB 2HPUA 3ZZUA 3PACA 2DCLA 3T1AA 5F8JA 3BSAA 3FBCA 4ZVFA 1J2VA 2APOA 3ZTSA 2HAFA 1G7CB 5LJ3Y 3ZZOA 3JTOA 2E66A 2ZH5A 1SJ3P 4NLWA 1Q8LA 2F65A 3IR5B 2NZ4A 3V6DA 1TQLA 2MXYA 1WC6A 3GP9A 3LOUA 3GIJA 4WZQA 4AXJA 4X4NA 3MUTP 1YRTA 2V0NA 2ZUAA 5DDPC 4GKKF 3L3CA 3B8HA 4JI7F 4NEZA 2W9AA 2GA3A 1HWJA 5F8GA 3Q23A 1VBKA 2F7VA 4OHZA 2FTRA 1MNEA 3AOAA 1WF0A 2CQ1A 1IWGA 4A47A 2RILA 2GHVC 4CLLA 4USMA 2C1EB 3NKNA 1URBA 2QL5B 3P45B 1S9FA 2D1CA 3JXOA 3TRGA 3W65A 4RNOA 1OY8A 4KIAA 2GQ2A 3NNHA 2H48B 5K8NA 5D0HA 4ZG7A 1UJ5A 1VQMS 3TZWA 2Z56B 1FRIA 3QJJA 3QSYB 3N6NA 2ADBA 3NKRA 3D66A 3A4TA 5A0YA 1S0VA 4Z7CA 4KKOA 2M52A 3GG0A 1GMWA 4RW4A 3U1MA 2ZFHA 5JVHQ 3T5LA 3QGHA 2BZ2A 4CLTA 1URAA 4PKDB 1KLNA 2GC8A 2HKEA 2XI2A 1UW9A 4CRJA 4C11A 1RABB 4ES2A 3DOKA 5GOVA 3DRSA 3R5AA 4LRBA 1LWCB 5D3GB 1K0TA 2IAJA 3BGOP 2OMLA 5H9FJ 3JB9k 1GK8A 5E3AA 1AUKA 3QFWA 2XWYA 1JKHB 2BEFA 5IJSA 2JLFA 2AGQA 2XWXA 3K5PA 1QUPA 3MR3A 3KKFA 2BR0A 2J6TA 4DS5A 3DCAA 1S1WB 3BZQA 1K0VA 2MB0B 4BWMA 1N36J 5AE2A 3A13A 2IUCA 1IBKJ 2OAUA 4MK8A 4C3KA 4CO3A 4MH8A 2WW4A 2Z2MA 3DLGA 4C8MA 2W9BA 4DR3F 4DI6A 4NZ6A 2Y0BB 4NYZA 2RDIA 3N01A 4WPAA 1ELZA 2ZZNA 4B02A 3CCVS 2WAQD 4DV6J 5L0EA 1RCOB 3B82A 2MGZA 3NMAA 4B9VA 3U7JA 2EFPA 5GADI 1C0TA 3IBFB 4PYAA 5CD4H 2FZKB 1RAEB 4P74A 3LP0B 2YQ0A 4JI0F 1PC4A 3NKOA 3ETOA 1YZ7A 3HZGA 4KFBB 3WHIA 2PA8D 4WU2A 1OYEA 2HHPA 4HL9A 1JXVA 3HULA 2CVEA 2LA4A 1JLFB 2QLXA 2EKNA 2CQ3A 2R2TA 3FDSA 4CO4A 2EC0A 4C6AA 2IFYA 3PHTA 4ZJOA 4ZIVA 4E98A 2OO4A 3BPDA 2HWIA 4O4GB 2VKZG 3KLEB 4M95A 3IM9A 5A8KA 2DPJA 2RNEA 3I0RA 1MROB 1HHSA 2HVZA 1PYOB 3TVZA 1HBMB 4DUYJ 5EX3A 2NPFA 2VDHA 4RUBA 3QGPA 2CPEA 4JV5J 5CABA 2LQ8A 2R2SA 3FQLA 3C46A 4N7TA 4MK9A 5GAGU 4ZVQB 3FSXA 4PEOA 1KD1T 1NK5A 2Z58B 1T7PA 4Y6IA 3V6HA 4A8XA 4NWJA 3W62A 1O99A 1N4LA 4ED4A 2Z2YB 1BHNA 1ZEDA 4I6AA 2Y1RI 1LFWA 1I51B 1QE1B 2VD3A 5LM7E 3BSNA 4PQAA 3GIRA 3KJVA 1H38A 5KFLA 3DRPB 1KHNA 3A3PB 1VR6A 4J5OA 4OZNA 1JLAA 1B7FA 4LQ9A 1N5YB 2V5HG 4I2QA 4DR4J 3PM9A 2XSFA 1GT8A 2K7JA 2JFKA 1IR0A 1FKPB 3TW0A 3MAQA 2KVIA 3M6UA 5DQIA 1Q1KA 4WU3A 3DOMB 4DDFA 1XWLA 2V9KA 3A52A 5F8NA 4DR6F 4TU7A 2U1AA 1NJYA 1F5AA 2NSCA 2MQ8A 1IXKA 2UUBF 4USIA 2C2KB 3CJ8A 1SKWA 2B5JA 2A2CA 1U45A 2EFQA 2PI5A 4RUAA 2CAJA 4J9VA 1GMWD 1S49A 1DLOA 4Y00A 3M2RB 3C16A 3BB5A 1VIOA 4PPZA 3DU5A 1H72C 2XG8A 2QYCA 4NYPA 1H6KX 2V63A 4TYAA 1KHVA 1YJVA 2VQFJ 3PYGA 5DLGA 3J7YU 5IM0A 4C8OA 1LXNA 3GYGA 1HBNA 2WZ1A 5ADZA 3QFHA 1S0NA 4F4KA 2DRDA 3OL7A 2DIUA 1S4EA 4Z7YA 3W5ZA 4OZ1A 4X66J 5DLFA 4JI8F 4U6PA 1TZ0A 4B3SF 1O8BA 2V2ZA 3NGKA 1YVFA 1HJKA 3HSZA 2M8HA 3GJRB 4K0KJ 1VC5A 3NLCA 4YOEA 4Q7AA 2CQPA 5B09A 2OJ3A 2W5QA 3GCXP 4QBUA 2Z57B 1ALJA 5HRTA 1UMJA 1FXLA 2V67A 2XO6A 3L9ZA 2MEWA 4K50A 5A8RA 1HBUA 4FNIA 1RT4B 5FLXU 4CI0B 1ELOA 3FBFA 1Y7AA 4IG0B 2ZH9A 2R7RA 5CYJA 3Q8SB 1FK9B 3J7ZT 4OYBA 3U27A 4Y34A 4RPFA 1U1MA 5ETKA 2XBPA 2ZH2A 2Z8QA 2NXNA 3PRBA 3V6KA 4XPCA 3LO3A 1NK4A 5J2QA 4GMKA 2JOQA 1ZTWA 2UXCJ 3E51A 4RWXA 3MD3A 1N6QA 3EICA 1PG5B 2HLUA 1AROP 4M1KA 2QC3A 4A8SA 2WB4A 1I94F 4JI1J 1F9EB 2DTJA 2HK3A 4UZCA 1DTTB 5D77A 1KS2A 3C14A 3WAYA 2AIRB 3LALA 3IGYB 1YQHA 3MCMA 2C2OB 2PFFB 4F25A 1UFWA 3OR1B 2XS5A 2WCXA 5A76A 1P8GA 3GR1A 3OSNA 1Y10A 2IFXA 3DDKA 5ETQA 1RTHA 3OXLA 3GIKA 2M4MA 1AJAA 2MJNA 1X0FA 4DR7J 3LANA 2NQPA 2PEBA 1EQ0A 2BJ9A 2VOOA 2I5JA 1WHWA 3EJMA 4DX8H 2HIYA 3UI3A 3I5BA 1Z2LA 1U1LA 2ZHAA 3TAQA 4NI2A 5KFBA 5I3UA 2VV5A 2MJUA 1XNQJ 3ENAA 3BYPA 3H7HB 1HQEB 4EYIB 5TJ3A 3AD7C 1X4GA 2DPIA 2CJXB 3W8PA 1C1BB 3OQ2A 5B7WA 4R8UB 3ADAC 2SXLA 3UDLA 5B0BA 3KDNA 3VQSA 1SUQA 3PEJA 4WF9Q 2V2QA 4OX9F 5CCMA 2KKHA 4BS2A 5D78A 4LSLB 1VRTB 2ANHA 3C3LA 4K4UA 4DCJB 1HWKA 3RRGA 2FLOA 3TO8A 2YX7A 1X4EA 1S10A 2W01A 2D7SA 2J6SA 1Q5VA 3CIZA 4KAYA 1HKAA 1VC0A 4MIVA 3F56A 3MEGA 2DHXA 3BGUA 2VPZB 3W64A 3LH2S 2CPIA 4ZS6A 1JQGA 3CDBA 3GCWP 3HHEA 4PWDB 4GTXA 2EK6A 2C3YA 2VG7B 5F41A 5GADU 1FRKA 3FRZA 5T7LB 5GVQA 3SQGB 1U2FA 2IM3A 1EKRA 5THWA 4V1Ak 4PWWA 4TLQA 1H0HB 3RAXA 1Q86T 3NAIA 5DGAA 1VI7A 4DL3A 5KFZA 2XMUA 2VBWA 2HFZA 1RT5B 3VGTA 5C42B 3G6ES 2VJVA 3I0SA 3T3FA 2NZCA 2CWKA 3M2VB 2RUSA 3R1LA 4CLSA 2DNKA 5DETA 3QT8A 4C8NA 4B56A 1N36F 4QWCA 4WXWA 2F9DA 3JAMU 4DSKA 4A46A 4O3NA 3B78A 1YITS 1IBKF 4DLEA 1EJ7L 4G3IA 2QMXA 2G0IA 1FVQA 2LMIA 1K7HA 4NXNF 1RT2A 4LQYA 4EYHB 3TQEA 2BOPA 1TL1B 2MKHA 4U8YA 1KRPA 2CPXA 1A9NB 4NMXA 1R6YA 4PAAA 1M5OC 4DV6F 1BXNA 1YX2A 2KXHA 2OPQB 4F7VA 2A0FB 2L08A 5DG8A 3KUEA 5JMNA 1YHQS 2QLBB 4XK8C 1CS4B 2N3LA 3CJKA 3C19A 1MU2B 3CC7S 3MURP 4UOGA 2KG1A 2J7WA 3K5NA 1NJZA 4LR9A 3H2UB 5D4NA 4I1TA 2OD6A 2RD5C 2B56A 3SZZA 1U1QA 1X4AA 1JLCA 4PG6A 1F5CA 3HT0A 3L7PA 2F5GA 2OPRA 2NS1B 3EVWA 1VQ4S 5DLTA 4F4ZA 1PBUA 1ALHA 3IWXA 1NPPA 2NREA 4UZBA 4P75A 1A6LA 3TI0A 2Q43A 3RBEA 1RWPB 4OZLA 2IC3B 2BANB 4TY9A 4A48A 1HPZA 2BJ3A 1YG0A 4JUZA 1CULB 3KD8A 3TVKA 4P71A 4IFVA 3IFEA 4ECSA 2FQQB 2EI5A 1D9AA 1XR5A 3NWGA 3MUVP 1VJQA 4ECQA 4RX6A 4IH7A 4NOHA 5U47A 2MKJA 5EUHA 1JLBA 2AJ0A 5HMYA 1R3NA 4Z37A 1PJ5A 4B17A 1XMOJ 2PMHA 1NHVA 5DDQC 1L3KA 5K14B 4TU8A 2QEXS 3T6JA 3PW7A 2V8GA 1JX4A 3THTA 1NAQA 4ZN1A 3N4WA 3ISZA 2ZNZA 3IAM9 1RQ0A 4J9NA 3D28A 1FT8A 1SH2A 1QAIA 2YNIA 4H4OB 5JJBA 2CQGA 4JI3J 4J90A 2V8DA 5DRKA 3DRRA 3W5XA 4XO0A 2DR5A 2LKZA 2GGPA 3RJMB 2OFHX 3UFCX 3MPDA 2KO1A 1MWQA 4DSLA 3ENWA 1S1TA 4ZVOB 2KN4A 4IQXA 2YTCA 2LEAA 1KC8T 3DU6A 3W9IA 2YKAA 4LUBA 3L7UA 2WRMA 3P4UB 4FN5A 3TP2A 2GW8A 2D74B 3AA9A 2MKCA 2IPOB 2FVQA 2O1PA 2UUTA 4LFBJ 2YH1A 1HBOA 1QY7A 1FWLA 1UVKA 5IT9Y 3QO9B 5J2PB 4MFBB 1WHVA 2PI4A 5KOXA 4ES3A 1YJ7A 2AJQA 4B08A 1SBRA 2W4CA 4DQPA 1REVB 2HFNA 1VRUA 3M6XA 4HT7A 2YWHA 1MMDA 2I8EA 2CQHA 2BRKA 2BE9B 1VC6A 1HMVB 2EFVA 5K8PA 4DN9A 2DGUA 3UNGC 1U25A 3QLHB 1N52B 1EETB 4LBHA 4IR1A 3RB4A 1NUEA 5H1SV 3TAMA 5J1PA 2EG2A 2R42A 2YKMB 1NKBA 4X66F 2J9DA 5A8WB 3G82A 4B9SA 4OZ2A 3LGNA 3N5FA 4CLKA 1WTFA 3UN5A 1S9GB 1V3ZA 2QGFB 1ED8A 4Y28C 4DHVA 2AYGA 1PILA 3PX4A 1NSPA 5LSOA 5J2NA 4FF3A 3TA1A 3M32B 4DFPA 1S1XB 1FD2A 4KO0B 1GQEA 4KSEB 3IRXA 2V69A 2VZ9A 2EW9A 1NKEA 3R5GA 1PJ6A 2DVIA 1WORA 2OHDA 3KLGA 4Y2MA 2MKYA 2BKOA 3QRRA 2VH7A 2GAGC 3QSIA 1UP1A 4LIWA 2UXCF 1QTNB 4I7FB 2XQCA 1AXQA 3MCOA 1YRXA 4NZ7A 8RUCA 2HVEA 4OHYA 1K73T 1EP4B 2GLQA 3AOCA 4JI4J 3RR8A 2DR9A 2F3JA 3R5DA 2U2FA 3A8IA 1JJHA 1SL2A 3A12A 4ECXA 3PNIA 3CJ0A 1RISA 4OJ3A 3R7BB 1LW2A 4ZA1A 4IOBA 2ZVSA 2OUGA 5LJ5Y 4AD6A 1SIZA 1NNDA 5L46A 1PSDA 3KMQA 3KJQB 2YWKA 4EO6A 4D3GA 4DWIA 4LF6J 4U67Q 1W26A 4IDKB 1E6YA 2XMTA 5LIAA 4R0JA 2UVVA 3BREA 3WDOA 4ED8A 4NLGA 4DR7F 3MD1A 2W9CB 1OSDA 2ZEJA 4QWAA 4GVBA 1GTHA 1N8RT 2IVFB 1N56A 3ZTRA 1QDUB 2LU1A 2NYHA 4NE9C 4J9KA 1FJCA 1HNVA 1BQMA 5BYRA 4AL6A 1SQEA 1XERA 1NJXA 1XNQF 1LV5A 4WWSA 5KFVA 5L1LA 1FX2A 3ZZYA 4UOOA 1DY3A 3T19A 3Q89A 4LT6A 3ULHA 5SZTA 1N54B 1TK5A 1HYSA 2LEBA 2HBYB 2XYPB 4B3TJ 1OO0B 2IBOA 2GJFA 1ZM9A 4KJIA 1UWBB 2ZOFA 4EBEA 2ZD1A 4K59A 2HNDA 5KFOA 2LXFA 3M7VA 1JLGA 3JTPA 3FUYA 1IKYA 3KLIB 4N76A 3MMAA 4KJGA 2FC8A 2ASYA 3OR2B 1IR1A 4EUVA 1FVSA 2OI2A 2JSXA 3LP2A 2DNLA 1AZSA 3NS7B 4QPTA 5ETSA 1CJVA 3N5BA 1LK7A 4CYRA 3E8OA 1RU2A 1IKWB 2NXCA 3FFIA 3FQKA 5HROA 5LMNJ 1TKXA 5BJRA 4UQTA 2B4OA 3THPA 2K7KA 1FE4A 3GZ7A 1Q82T 3FEZA 3CCTA 1AUDA 4X4PA 2RVJA 4YHHF 2FUG9 2YH0A 4C8YA 2F8EX 4DV4J 4J91A 4IR9A 3JSRA 3SSRA 3SQOP 1DQAA 7FDRA 4C98A 2VL1A 1TV6A 1S6OA 4PXDA 1CBKA 1SB6A 3LWMA 3RRHA 3Q8QB 2L9NA 2NXJA 4DSIA 5HO4A 2HBRB 3CC2S 1TL3B 4CLFA 2R7SA 4DPWA 2IM1A 1TUGB 3WX8A 2UUCF 3H0PA 3PR5B 2XR9A 1VLOA 5F8HA 3QJLA 1Y0HA 2EWHA 4FVCA 5F9LA 1MMNA 1GX6A 1UL3A 1CLFA 4L6V3 2D41A 1R8PA 2QA2A 4DF8A 2F40A 1T05B 1ZA1B 2L48A 2DY9A 3MMCB 2ATLA 2XYGB 2PA3A 3CCJS 2XNRA 4I2PB 3MWBA 5HBMA 3TUZC 3MEKA 3H5XA 3QAEA 2KRRA 4DEZA 2BM1A 1CEZA 1XNRJ 3VGVA 1KN6A 5ETTA 1XR7A 4J9SA 4RW9A 2HS3A 3HP6A 3BF4A 1N32F 2B9EA 2G2YA 3IWLA 4O44B 1TMJA 1BC6A 3CO0P 3BPSP 2BX6A 2LEPA 2LECA 2MSSA 3ELHA 1Q53A 1U0HA 3FZ2A 4ZGAA 3HCXA 3GSDA 2CVIA 1FEEA 2W8SA 3OPKA 4PQUA 2AJ1A 2V94A 2IYGA 3CB4A 4M5JA 1L3VA 3T02A 3W5YA 3GE9A 1W2BR 1UAWA 1U2CA 4NRUA 1UA1A 4X84A 3LAMA 2J0QD 3EZUA 2XO7A 4ECVA 4JV1A 4K8RA 1IQZA 4H4MA 2IJRA 2HK2A 5ETVA 4XIUA 2UXDJ 1VJWA 3OD2A 5INHA 1JLQB 1NH7A 1RT3A 3MEDA 5D0EA 2IDLA 5BYQA 3JAMY 3PJ9A 1RWVB 2W2NP 1NH8A 4OZJA 3TUJC 3WBZA 2CADA 1F3FA 1YIJS 4OMFG 3HXMA 3KK3B 3K59A 3S1TA 3DYAB 2XGPA 4FS1A 3GG1A 3PFEA 2HNZB 4L3NA 2B51A 1LWXA 3Q8PB 3CCUS 1HA1A 3MUMP 5B0FA 3KTQA 4UUXA 1XMOF 4DR5F 3VV2B 3RZAA 4DFMA 1VCTA 4CIOA 1RACB 1WHYA 2W8LA 4EFAC 2DY1A 5KG3A 3S01A 4MJKA 1S97A 4JI3F 4X4VA 1SV5B 4ED2A 2KVQE 2ROEA 1HDHA 2AJFE 1ELYA 4IG3B 4NEYA 1PAEX 3CJRA 1CJUA 4PCQA 5FJ4A 1N88A 4QYRA 2DNPA 4HTIA 2BE2B 2IMWP 1FKOB 3W2VB 3DHWC 2ZITA 3MMBB 3NGTA 4KGMA 2FHKA 2MMYA 1V6HA 2MQQA 4X4UA 5KG1A 2HVHA 1ALIA 1RAOA 2I2YA 1RHUB 5KFMA 4A8OA 3V4IA 2VQRA 1HWLA 2MQOA 1GNKA 1WSRA 3G4SS 3SDEA 2HEKA 3BH6B 3PZPA 4RBVA 4LFBF 1YLXA 3MEEA 4ZIWA 4RW7B 1RHJB 3GYNA 2NR0A 3HD2A 4GO5X 4QWEA 1B0PA 3TZXA 1RZMA 4FDFA 5E3CA 5DO2A 1RT1B 1SQGA 3POTB 1QSSA 3QGGA 3VZHA 1AW0A 2AEJA 2MQPA 3W9JA 4KV8B 5HLFB 1R8HA 2EBEA 1NRKA 1FA0A 1YBTA 4PABA 5KFSA 2QLWA 1LWEA 3PKYA 3E3XA 5G0RB 3KK2B 1V3SA 3D5MA 2RU9A 3NBPB 4DL6A 3OVBA 3BQ0A 4JP8A 1FJEB 1ZS6A 1K1QA 3N0VA 2VODA 1MMLA 4XPEA 3J7Z5 4AL7A 5KT3A 3BYRA 3BS9A 4ZP8A 2QSWA 2VB6A 4RKUC 2HWTA 3HI9A 2UV8A 3ZZPA 3IMQJ 1KHWA 1N33F 4I0WA 2Q1LA 2YNFA 1TUVA 2VFTA 1VRQC 3JQMA 4B3OA 4B3RF 2RUGA 1UW4A 1TK0A 2M88A 1J5OA 2HRUA 4DZ6A 1ZM3A 2YXLA 1RBLA 1RBOB 3GU0A 1APSA 1T9YA 1KOHA 3BDGB 2AT1B 3KUHA 3D6FB 1FF2A 1UVJA 5GRRA 2DR7A 1H7XA 3NVLA 2GCFA 5C24A 3L09A 4E0DA 1RAJA 3BQ1A 5KFTA 1F2HA 1Q0NA 2VG6A 2Z2ZA 1BD6A 4UQGA 1TTHB 2QRRA 2OEKA 4P73A 2J8AA 1NSKL 2FHJA 3EZ5A 4JI4F 1NHUA 4O3QA 3M30A 2F4VF 4EMDA 3IG1A 4MHXA 1RWXB 3OFGA 1UJ6A 1DFDA 5FDLA 3DDIA 1FTCA 3SEOA 4L76A 3ILIA 2Q79A 2GVZB 4ZCKA 4L72B 1XN9A 2G9OA 4W4MA 3DLEB 3ET6B 3WC0A 4OJHA 4ZVPB 3OLAA 3TJ9A 3MCNA 4FXDA 2HIQA 4LF6F 1XBWA 3BGRB 4ZG9A 3TEHB 3FGVA 4W98A 4DPOA 5HL7Q 2EVZA 2WVEA 1F60B 1M5SA 2G0CA 2JVOA 3ILLA 5IC6B 2WVFA 1IKVA 3DDNA 4HH1A 1WC5A 3V6DB 2POKA 1NB2A 3VF0B 2ZDOA 1FRMA 4ZPCA 2L3MA 3FCVA 3Q2SC 4JV0A 2FD2A 2FVRA 1C1CA 1KH7A 1FRJA 5ETMA 3NCQA 4G65A 3KYLA 3I5AA 1ZTTA 1HR0J 2M5YA 3A3NB 2YNHA 3I9ZA 2BJDA 3P6YC 4OJGA 3UVJA 3CCWA 3TVYA 4USTA 4USKA 2MQLA 2FJWA 1P9YA 1RT7A 5KG5A 3GWCA 1U26A 2QT7A 4F26A 2G4BA 4IQMA 3NKYA 2KFNA 3NKQA 5FIIA 4NLQA 1RKIA 2RQKA 1FSUA 4YUDA 2KM8B 4J9LA 3DLKA 4RW8A 3B6BA 5G4DA 4DV0J 3EVMA 4HDGA 3UCUP 2H4YB 4DV5J 4QU7A 4DUZJ 4F02A 2GA7A 2KFZA 2QFIA 1RWWB 3L4BC 4KKOB 4DV2J 4RW4B 2JLEA 5HATA 5DJBA 1LNQA 2R7XA 2AP6A 2QLFB 1X5PA 2CWXA 3MAHA 4C11B 3DOKB 3DRSB 5A6WA 2ZJPQ 4ZVEA 2IAJB 2EKYA 3V4MA 4DV4F 1Q4RA 1RCXB 1F9FA 1RE1B 2AEFA 4NCBA 1C4AA 2HS0A 3BO4A 1IQTA 5HP1A 4WZMA 1AYEA 2CFXA 2R8GA 2WBRA 2Y9HA 3QYYA 2OSQA 2AX1A 4ZLNA 4QWBA 4NCAA 4MKYA 1S9EA 1CJKA 2ZH6A 1J5EJ 1NKCA 1LWFA 3LP0A 2PN6A 3G71S 3KLFA 2KU7A 2IUCB 1BQNA 1EZZB 2C3PA 4GKKJ 4JI7J 2W8KA 3PIOQ 3B5QA 1XEZA 2IM2A 4TQSA 1X60A 1W2IA 5J1NA 4CO2A 4K4SA 2IJFA 4UY8T 3S7RA 3DLGB 2W9BB 4F2SA 1RT6A 2WVDA 3ZO7A 2J9EA 1X5OA 3HSDA 2QJ3A 2R9LA 2PFDA 1BUXA 2LDIA 4AUKA 2MGZB 4KTQA 1BLUA 3CMES 1C0TB 2BQ3A 4WK1A 2FVCA 1VFJA 3RGIA 1EI6A 3THVA 3AJ1A 4KY3A 3VAGA 2H5EA 5HVGA 1EB0A 4LQ3A 4F4YA 4AQYJ 2XCPA 4F8RA 2FHJD 3ZZRA 2CG4A 3LUYA 5KFRA 2A10A 5C25A 2HNYA 3OXGA 2KTQA 5I3QA 4NXMJ 2W1BA 4YMEA 2CQ2A 4X62J 3BR9A 2E9TA 4RU2A 2E5LJ 1RTJA 3TANA 1L3UA 1N2LA 3LPEA 5KT4A 2CQ4A 4F4AA 4DLGA 2KT5A 3JSMA 5A8KB 4ZVTB 3UNYA 3E2DA 3I0RB 3M8PA 2DXDA 2P6TA 4UT4A 1AJBA 3JQJA 2W7PA 1FRLA 2UXDF 2ZM6J 2CZ4A 4HHHA 3BDHA 2OSRA 2H3EB 1ZH5A 1HI0P 1T3OA 2YNGA 2DYAA 1GX5A 4A8FA 1Z1ZA 3HO1A 2R7QA 5AE3A 2EFGA 1X9MA 3AXKA 4F4XA 2B7BB 1U6FA 3RW7A 2UV8G 4IUFA 4LR8A 2F9JA 1NDCA 5KFPA 1N5QA 8AT1B 2WVCA 3O1LA 4QIWD 2IVYA 2P9GA 2MSTA 4NA2A 1MWYA 3KJVB 2RDDA 3A8JA 3G8QA 2E9ZA 4K4YA 2DNHA 2HQGA 1UWAA 3UDEA 5M2RA 3T1HF 1JLAB 1UA0A 3IC1A 1ZPWX 2ZVIA 2BACA 3H4DA 3DM2A 3GV5B 1TUWA 4ZCMA 2DGOA 4JI0J 1BE4A 3RU0A 5HI7A 3HLUA 4RNMA 2BJEA 3G8TA 5F8MA 2N7CA 2V8PA 1QVGR 1DQ9A 3EGWB 3I4PA 2MZJA 3MK2A 4QCLA 5D4OA 2B5JB 4CXKA 3D3CJ 3DHXA 1UKUA 1DLOB 2QA1A 3FVYA 2HYIB 3ITHA 3C16B 1FESA 4K2XA 4WP8A 1JMTA 2Z2LA 1FNMA 4PR6A 2N82B 4LFCJ 1NJIT 3PDNA 4JI5J 2HGNA 2ERRA 3VWSA 1Y7PA 1YJUA 5IM0B 2FYXA 1RTIA 2H4WB 1M1HA 4AXIA 3CE8A 2GJIA 1HBNB 1RI7A 2C42A 3NXZA 1ULRA 3MGJA 3Q8YA 4ICLA 3E01A 4PRFA 1SI9A 1T11A 1UZHA 2JLGA 5DQGA 1YBUA 3SFGA 3NKMA 1URRA 1FK9A 1FEHA 5EN1A 1TK8A 4OYXA 3J81Y 1TMMA 3TZZA 3I31A 1M5VC 3CCES 2WSCC 3P3DA 4NASA 2AZ1A 1WC3A 3GTYX 2HZAA 2JEFA 1FFGB 4CLPA 4F0HA 3PJWA 2V6AA 2GSNA 2B7CB 2E7WA 5A8RB 1HBUB 4ZVRB 2VPWB 2ROPA 2BUNA 1DTTA 1OQ3A 3PW4A 2FJBB 4ANDA 2F63A 1HD0A 4P6QA 2FPHX 4LF9J 2IA6A 3QIPA 2UU9F 2JFDA 1ZEBA 2AD9A 3W2WA 1WDTA 5J2QB 4OYIA 4XDCA 2CDQA 5ETOA 3GJQB 1U8SA 1WELA 2HGLA 4LSNA 5K4PA 4FXWA 4OYPA 3T5HA 1S0MA 1HFEL 1T02A 4PXBA 4ED1A 4KBIA 3TARA 3AT1B 1KHLA 1UVIA 1RGVA 1FJGF 2FZCB 4M5GA 3C14B 4ECRA 3O6QA 2FGCA 5IFMA 2PDAA 3T41A 1WC0A 1YK9A 2J8SA 4FF2A 3N79A 1HNZJ 1AFJA 2KDOA 3CF5Q 4I6WA 3BSOA 4CXSA 3F44A 2ZZTA 3W60A 3GIMA 3MR5A 5EGHA 1TL5A 2BKNA 3NGRA 1RTHB 4OYAA 4BWJA 1H2VZ 2J9CA 1KDNA 3G96A 2AF6A 2KT3A 3PVXA 3HJFA 4C3MA 1M90T 2EG1A 4DX7A 1FD8A 2ZE2A 4Y2KA 2I5JB 3BDFA 2XULA 4QIFA 5EDWA 3OFHA 2ZC4A 1RXOB 4OLPA 4B3SJ 4NI2B 5I3UB 1HLWA 2MKSA 2X51A 3GPAA 2J6UA 1HHTP 4EU0A 1UETA 2AKWB 3T01A 5CH7B 2DGXA 2VC0A 4C0HA 1S1UA 4TYBA 2FLLA 2D9PA 2VQEJ 1AFIA 5M2UA 1HR0F 2OIHA 1EIYB 4MY4A 5H9EJ 2DIVA 2ZWOA 2GAHC 2HMIA 5CYQA 4A8MP 4UUWA 1AJCA 1SUQB 3EGNA 1CC7A 1RB0A 1Y00A 1Q78A 3AA8A 3PW2A 4WCEQ 2V34A 1ZPVA 2KL8A 2ASLA 1FWPA 2CNOB 4YR0A 1RTDA 4DG1A 5RUBA 1WEYA 4J9PA 1FFWB 3CCLS 3MEGB 2GVDA 4NL5A 4DV5F 2RHSB 5B0GA 1WTBA 2CNKB 2P6SA 5IXUA 3J7YI 2ZWPA 1QD1A 2GIFA 1I94J 3H5UA 1X4BA 3S8SA 2CQCA 3KOAA 2AZ3A 1E2SP 4CP5A 1D8ZA 1NU4A 4OL8A 4O3SA 3CSKA 2JHEA 4ZVUB 5B0CA 2LYVA 3BV8A 2QMUB 4YR2A 4M5MA 1PC5A 5LRNA 4MKVA 3H98A 3VR1A 1TL1A 2FVSA 2UXBF 3K5OA 1N5TA 5K9FA 4P2SA 2LQBA 4U8VA 1J5EF 1U1PA 1UEUA 5AE1A 4AE5A 4OX6A 1S6QA 1M5PC 5KFKA 5KT5A 4ELVA 1QSLA 1TL7A 1T03A 2QZUA 5HQLA 1S72S 3A8KA 4WYWA 2VFVA 4PUOA 2ASDA 1F1BB 2DT9A 3HF5A 3R6LB 9ATCB 4Q44A 5KT6A 1NZAA 1RT2B 4G6VB 1KONA 3CJ5A 3DI6B 4KR0B 1PYSB 4Y2IA 4A8QA 2WVBA 4ZHRA 2HQIA 3FCHA 4OX9J 4KPCA 3ETMA 4F67A 4FF1A 2PEHA 3H2LA 2NCKL 2R7UA 1RA6A 1BWVA 3EUNA 4C0BA 4AT1B 1Q7YT 4IFYA 3CJKB 2IIHA 3UN3A 2RHQB 4BC9A 2PMZD 1VGYA 3VAHA 2KJVA 1WOPA 1N0UA 1QSYA 1CULA 1FNOA 2BQUA 1YRUA 1TVRA 1NPRA 4AQYF 1D9FA 2V8HA 5IQ6A 1JLCB 3GFXA 4M5LA 2OPRB 2YKNA 3SCJE 2V4JA 3QZ7A 5KTQA 4DSFA 5BYSA 2OELA 1QTMA 4NXMF 4P2MA 2OH2A 4X62F 2VA2A 2ZBPA 2LFVA 4DX5A 1PJ7A 2E5LF 1SHNA 2BOAA 1QAYA 2Z0GA 3JTNA 2G9YA 1HPZB 2GO8A 3CCMS 2ZM6F 2RJZA 4IFVB 2QL9B 1YJ9S 2W7OA 2DK2A 4OV1A 4ZPWR 1B0VA 2G2OA 2ALYB 3J81j 2BRLA 4X64J 3K5MA 3JSYA 3MDFA 1JLBB 4ZLPA 2J76E 2B9XA 3VALA 2GQCA 4ANCA 3PX0A 5I4MA 2KFYA 4ED6A 4YB6A 3O44A 2CQ0A 3EMTA 3DGPA 4O23A 1FRXA 1JNZB 2R8JA 3KNGA 1RLCL 4J37A 3M8QA 4DN0A 5CCLA 4NXNJ 4IRDA 5AJ9A 2CZ9A 2RS8A 3RBXA 4NX9A 4C9DA 2KHDA 4N47A 2NXEA 2OP5A 2YNIB 4FNHA 2Z4PA 2J7KA 3Q2TC 2DITA 4MKBA 3UD3P 3UDCA 3DRRB 3ZNUA 2GGPB 5CHCB 2O5DA 2HHTA 1OJ4A 3FMWA 1QUVA 1SPBP 1S1TB 4CZCA 2N4CA 3WAVA 5KFAA 2DGVA 3I5CA 2B6AA 2H1YA 3KLVA 2ZJQQ 3AHPA 4B9UA 1X7VA 1VQYA 4EZ6A 2DNYA 3TNVA 3HSGA 4FBTA 1HBOB 5L9NA 1RJJA 3BKUA 4NCGA 2W7AA 3MOJB 4LF4F 4W90B 3EXCX 1S9GA 5EWGA 2M70A 1VRUB 3ZZ0A 4LFCF 3CO9A 1VQPS 5D4PA 2ACYA 4JI5F 1HNIA 2M0GB 4CQ1A 2MKKA 3CNQP 1CPZA 5IT9U 2L9DA 4JI2J 3LF0A 2I9SA 2K06A 4G1QA 4TN0A 2UP1A 2UUAF 3RB6A 1RAAB 5LXYA 1YTYA 4KB7A 2OLWA 3CMQA 2E7XA 3TAMB 1HI8A 2JC0A 3G82B 1UJ4A 2CPFA 3IGNA 1OS5A 4NLYA 1N2KA 2F1FA 5AXNA 1KWMA 1VQ5S 5B08A 4X4TA 2M8DB 3LGHA 3UR0A 1DRZA 2XSJB 1T9VA 1WI6A 1KTVA 2EC2A 2VU5A 4PXCA 1ACMB 3R2DJ 5E3RA 4K4XA 1OSCA 3QQCD 5K5MA 2W2OP 4TVAB 4E8UA 1RAGB 4YN3B 2C3OA 2JWNA 4ECTA 5K8MA 5IJQA 2QO3A 4C3LA 1R0AA 4OYZA 2X98A 2RH3A 1RWOB 2X1BA 4KGVB 4DV7J 4NZ0A 2HHHF 5IZHA 2LDYA 3KLGB 2CA9A 3AB2B 4LF9F 4U95A 4PXEA 3FZBA 3VGUA 3BBBA 2HQCA 1F9HA 1OY6A 2MDAA 2VKRA 4LIRA 4M63A 1W7WA 1NHKL 1UTAA 4OFZA 1IJFB 1N5SA 1SC1B 2C3UA 1NK6A 3MMJA 4OZ0A 3I87A 4WBFA 3C2PA 3DMJA 3D67A 2BE7D 1ZA2B 2W25A 3CCQS 7AT1B 4CTAB 2VC1A 3NAHA 3TQ1A 4KGZB 1HNZF 2WK4A 3DLHA 1VOMA 2YKQA 4UTGA 1SJFA 2D69A 1BGXT 4NYOA 3UE2A 3IN5A 1E6YB 5I42B 4CWBA 1R43A 2IM0A 2FJXA 4K4ZA 2HBQB 1MW7A 2P9CA 1VQOS 3GJTB 3JYTA 2HFOA 4ILLA 4CM2A 4GVBB 2I38A 2VICA 4N77A 1IBCB 3D0IE 1K9MT 1HNVB 1BQMB 2DNRA 2YWGA 2VIHA 4TNOA 2LVWA 3T9NA 1F0XA 1ITPA 2D1GA 3TAPA 1I5OB 1V9OA 3ILOA 2VQEF 4Y2CA 4AFFA 3PJXA 2LQ5A 3SSQA 1D9DA 2CPZA 2GO9A 1HYSB 4YY3J 1LOUA 4B9NA 1E6VA 2AQ4A 4HI1A 4LFAF 4UOFA 2XMJA 1X8DA 2A6MA 3IS9A 3LGMA 2HZVA 2R2UA 2ZD1B 3H5YA 4YEAA 1EW8A 4J9MA 1JLGB 4Q0BA 2WONA 3BDEA 1IKYB 3MZIA 2FJDB 3MK1A 4LSZB 2VHGA 2AW0A 3NNCA 2AGOA 1C0UA 1Q7LB 1KTQA 3ENVA 2J0WA 3LP2B 1AZSB 1DTQA 2FHMA 3US5A 2HHWA 4ZVSB 1CJVB 1ZZNA 2A6OA 4UOPA 3MOZA 1C4CA 3EWGA 3FFIB 2KT2A 4WTYA 4XTTA 1U0SA 4HEA9 5HROB 2Y1IA 3F41A 4RO0A 1KLMA 1IWAA 1TKXB 3H20A 4UPKA 3KHGA 4DL0C 2NLWA 4HH0A 2V50A 4P7VA 1UVMA 3T5JA 4UOHA 1SXLA 1RU1A 4XDDA 4DCOB 5EHHA 3IBWA 5KFHA 4I4BA 1UPMB 3J7A1 3WAXA 2VDIA 1RAFB 4WTOB 2ZH4A 1O6XA 4C4WA 1Z2ZA 3PYDA 2X3DA 1WD6A 2NXUA 4UY85 1RAHB 4PG5A 2RDJA 3L7OA 1TV6B 2YX4A 4C8LA 4QR0A 2MZTA 5F8IA 5GAEI 2DH9A 4TY8A 1FFSB 1SKSA 3OL6A 5JXSA 2PE8A 4YB5A 4ZVHA 4UPIA 5EGYA 1VS3A 1JB0C 1JLEA 1GXUA 2XGQA 1FO1A 1X31C 1TKDA 4DUTA 1U6BA 3KHRA 1FKAF 1V3RA 4GVLA 3T9ZA 3QAUA 3FJ2A 3LQVA 2JRSA 4UPLA 2RAQA 2MZSA 1RWMB 4KH1B 3IWNC 3SV4A 4LVNP 7FD1A 2ADCA 1D1UA 4J9QA 2KM8C 1VIXA 1X9SA 4OLOA 3Q83A 2Q6CA 5KFXA 2E5IA 2C2DA 4R0EA 1N48A 4RW9B 4ZJLA 3C15A 4QR1A 4KC5A 1L5UA 1TAQA 2M3DA 4QYZJ 3NWRA 3DGVA 1TKZA 4JYAJ 1HWUA 5DQHA 2RRAA 4B9LA 2E1MC 3BEGB 4ETZA 4ZKAA 3W66A 1U0HB 2B43A 5ETRA 1W25A 2GMLA 2ZHBA 3VAJA 2QIFA 3IR7B 4DQSA 5LSLA 4PQUB 3MF5A 2HHVA 4OJ1A 2MQMA 4M5NA 1JWWA 1T95A 4YHHJ 2EK1A 3F0NA 3FNNA 2UZAA 1R27B 4DL7A 1VK3A 2HWHA 4H4MB 1D8YA 3RYLA 3OXFA 1U4BA 3OHAA 2MLZA 4ZLLA 1RT3B 3MEDB 3FKBA 4MKAA 2CPJA 5DM7Q 1I1GA 2IHR1 2RF2A 4X64F 3IAS9 4TXSA 4KT0C 3K17A 4IO1A 2K1RA 1BY9A 2UUCJ 1NXIA 2JH3A 3OTDA 4NMLA 1WEZA 2IA0A 3KK1A 1OYDA 5ETPA 3X1LB 5I3PA 5LOQA 1SC6A 4BHQA 1O5JA 5IQQA 3OLBA 4ED5A 3FMBA 3K89A 4DR1J 4DU7A 3EDRB 2V2KA 2UVRA 2OPPA 2DR8A 2HFUA 4RW7A 1E3CP 4YDXA 4KHRA 2CJQA 1IM6A 2DNOA 1B8JA 1DURA 4ITSA 4D3HA 1GMVA 4RBTA 4DPUA 4J7CA 1FI4A 1N32J 1X4HA 2B0GA 4KJDA 3R7SB 2OMOA 2BKPA 1XR6A 1ZETA 2OPSA 2XZDB 3V4IB 1KVKA 2JC1A 3T1YJ 1DZ5A 5HMWA 5G0RA 4K4WA 1HIYA 3K5LA 1OQ6A 1YJRA 2BM0A 3K7RA 4QIEA 3MEEB 4LF5J 2UUWA 2IRUA 1U48A 4FKYA 1NBEB 3G6XA 2YWFA 4DR2F 4WFNQ 1SVDA 2HS4A 1X5TA 4OHXA 3NNAA 5L1KA 5C2GA 2ZHOA 3MPVA 1EKSA 3MM8A 3KHHA 3AB4B 3OTEA 1P1LA 4JI2F 1B4SA 4WP9A 3AH6A 1SJ1A 1LWEB 5B0EA 1SCJB 1ZAVA 3H8YA 3OTOJ 3CCRS 4QR2A 1NK8A 3H4BA 4RW6B 3SIPB 1LXJA 2R7VA 3WIUA 1F2GA 1XJWB 4F2RA 5DS7A 4GC6A 2GIQA 4QU6A 1NMEB 4DR5J 3AJDA 4DV3J 4CNYA 2IVMA 4KAVA 1YBAA 4U7CA 3HM9A 1NSAA 2YNFB 4LMZA 1JJ2R 1AUSL 3EPIA 4B3OB 3LP1B 3CD6S 2W2MP 4DV7F 3J80Y 4I69A 4DCPB 4RLEA 4KQZA 5C24B 5HSPA 4ZPAA 3KLHA 2RKIA 2VG6B 5HN0A 4URQU 4ENOA 2AHOB 4A8YA 2HBZB 4HHUA 1KH5A 4EZ9A 1B3TA 1HNXF 3M30B 4RUHA 3IG1B 1RHMB 4TKTA 5HVFA 5AJ3F 2YBVA 5FDLB 3HHLA 2F8MA 3UW1A 4I67A 3MTJA 2E29A 1F5BA 3A8EA 1LKZA 3IP0A 3SCKE 3RUBL 2WOMA 4O3RA 3P8BB 1U1RA 1CJTA 2GMHA 3D1OA 2XMKA 3G6YA 1QLNA 3N9UC 3R8YA 4F50A 4FYYB 4LRAA 2HRTA 3HVTA 2DO0A 1VISA 2QX0A 3MM7A 4N5SA 4F4WA 5C7PA 3D6HB 3EGVA 1IKVB 4U96A 3TYTA 5E33A 5MLCV 2GNKA 3M1VA 4MMOA 1I3OB 3ED4A 2VG5A 1C1CB 4KPYA 3H42A 2G1DA 3CJTA 3EVOA 1CQNA 2PMWA 3PYEA 2YNHB 1N33J 1S6PA 3VTIA 4YY3F 2CNLB 3ISND 3RR7A 5GMEA 3UVJB 3CC4S 5GMDA 4B3RJ 5GAEU 1ZAXA 5DLVA 3K2YA 2ZKUA 3UWTA 3AFGA 1RT7B 4RU9A 2E44A 3QT6A 3ZZTA 2FJEB 1DBDA 2O67A 2W24A 4JBCA 4MYUA 4ECZA 2FVPA 3GONA 4P9SA 3PXGa 4ANEA 3DLKB 4RW8B 4P72A 3R27A 3CMAS 4HVZA 2GX8A 4J9OA 1B99A 1UVLA 4QIGA 2C2EA 4ZCIA 2CYYA 2O66A 1VBXA 2VPXB 3Q8UA 1KNZA 2AYMA 3QIDA 1H7WA 5IC4B 3MAAA 2F4VJ 4ID5A 2X7IA 1RYRA 5ETLA 1YDLA 1NDLA 4USJC 2C28A 2AGPA 1U02A 2FHOB 2IDEA 4FKXA 3M6VA 1FJ7A 4BBYA 2IJNA 2YPYA 1QAJA 4PWUA 4F36A 5EX0A 3CT9A 4TN2A 3D6MB 2G2ZA 1WI8A 5A2QU 1WKKA 2Q3PA 1SJRA 1XK8A 3PG9A 4EO8A 2V8VA 1WEXA 2BBEA 5BXIA 5L1JA 4UF4A 3QPIA 2XY5A 5JVGQ 1NCLA 2A18A 2EFOA 4RNNA 5HP1B 2KJWA 3HDSA 2AJ4A 1MN9A 4M5DA 1ICEB 4CYSA 1U09A 5L1IA 4FP9A 3PRDA 5E3QA 3H40A 1S9EB 2R8KA 1CJKB 4L73A 5DZ6A 2VFSA 3BR8A 2D3OR 1TELA 4X4QA 4LF7J 1LWFB 4KGKA 3NOCA 3KLFB 1BQNB 3KG1A 2CJAA 3IO1A 4ZDNA 3HVWA 4LBPA 2IY5B 3NGUA 4WIIA 1RT6B 3GSIA 4ED0A 3GMGA 5KFYA 3EZOA 2HQFA 1RAIB 1S5ZA 2AWZA 5KFCA 4KE5A 4JI6J 4ELUA 1N5VA 2X1FA 1G2EA 3M2UA 3V81A 3GJSB 2E1RA 3LWLA 1ZYQA 1KSPA 3CVKA 4X4SA 3I55S 1VQSA 5J1EA 1BQXA 4JYAF 1Y5LB 3DLLQ 5C25B 2HLTA 5J2MA 2MY8A 2HNYB 4LVOP 1YZ6A 3C66A 3BSCA 3LTOA 4S0MA 2GMJA 2V4QA 3HHLD 3OBIA 1T94A 4M94A 1FX4A 3R2CJ 3AODA 2BYCA 3BJYA 1S57A 1RTJB 3MM5A 2VFUA 2JEJA 4EEYA 1XMQF 4DS4A 4M5KA 2PT0A 4ATNA 3JSMB 3CIMA 1KQFB 3PKMA 4TQRA 4LF8F 3M8PB 2W5TA 4IOCQ 5F0WA 3M4XA 2EBGA 2CUYA 1LFPA 1EW9A 1NK7A 3ZFVA 4FYWB 3C6TA 3FBEA 2GIRA 1VHIA 2YNGB 2KXNB 1U1NA 4Q2MA 2ZNYA 4HACA 1VQ7S 2DEJA 2WBMA 2L41A 2Y8WA 3W9HA 1ELXA 5F9NA 3I96A 2ZBCA 3ISNC 4QW9A 4R5PA 4DPXA 3AOBA 1GAOA 3T00A 3KWMA 1ZBTA 3ZTPA 1HQ2A 1JIHA 2YQ3A 1LW0A 4P2FA 1D0EA 2H54B 3QGIA 2CIMA 5IT4A 3CJQA 1WG4A 3V6JA 1EJJA 1Y5NB 4ZP7A 4ZLJA 4DR1F 3AQOA 3OJUA 4KM4A 1EHWA 3M9OB 3MM6A 4DL2A 3FSYA 5L0KA 1ZM4A 2G1HA 3HJVA 2DNNA 1UEKA 3PRVA 1L3TA 4GRSA 2XMVA 2DHAA 3DM2B 2DHSA 3A1YG 2ILZA 4GKJJ 2RRBA 5AXKA 1UCNA 4OYMA 2EPIA 3FBBA 4GO7X 5T14A 3PIPQ 3O8WA 1K44A 4FBUA 3T1YF 1FE0A 1YSJA 4ECUA 3J7AN 3OFFA 3PO5A 3CD7A 5CA5A 1OY9A 5KG2A 5DDOC 4LF5F 4A8KA 3OJSA 4BCAA 3W1YC 4ZP9A 3MM9A 3SMZA 3ITHB 4YQWA 4HTJA 2RRNA 3BBFA 2C3MA 1LEOA 1RK8A 3UQSA 1RADB 2IYIA 4FYVB 4G1PA 3MTKA 2HFSA 2C2RA 5LQQA 1TKTA 3HD1A 1NB7A 2CQIA 3LPYA 1RDRA 1RTIB 4URSA 5D8HB 5F0UA 2XTJP 2CRLA 2RS2A 4ICLB 3E01B 4RBUA 2CJYB 3OTOF 2AJ2A 3OUYA 4P7TA 3HZEA 5D6GA 1NPKA 1S1VA 2XY7A 2YY3A 4ALZA 4HR2A 3GFZA 4H4KA 2YKPA 3Q86A 3VQTA 4Y65A 3CULA 1RHQB 3Q24A 4KRWA 3HVAA 1U8WA 4QIVA 3B4DA 4DV3F 3PX6A 3TJ8A 2FY8A 2O3DA 3MECA 4WE1A 3J81U 2DGWA 2VBXA 4X4OA 3WQPA 4KHMA 2WSEC 1Q5YA 4ETXA 3GV8B 2DJWA 3WBHA 1NDPA 3M9MB 3T1HJ 1FXRA 4K2JA 3MI7X 3QIPB 5LMUF 2H9ZA 3ZC4A 4V19J 3RG6A 3W2WB 1SKRA 1KVIA 3BGLA 4CO1A 3D4JA 3RAMA 4LSNB 3HMJG 1ED9A 4YP3A 1SHQA 1CSJA 2DNGA 3ZTQA 1VDHA 3HHLC 5KT2A 4RL1A 3M8SA 4LBIA 3PEHA 3R3TA 1XIQA 1IKXA 4NA1A 1HWIA 4CYUA 3SZYA 3C6UA 4L74A 2E7VA 1VK8A 3X3UA 3SSSA 5HANA 9RUBA 1VMBA 2DKOB 2W5RA 3D1HA 1VBZA 3WAWA 2MPUA 3OVSA 3GV7B 3G8SA 4LR7A 5CXTA 3UD5A 3AJ2A 1FERA 3G6VA 5KG6A 3PCOB 2BJ1A 3QRQA 2A2DA 2ZE2B 1HNWJ 3FRYA 4ES1A 1HQUA 2XS7A 3TOQA 1RWKB 4K4TA 1E33P 2NUHA 1QAXA 1P6TA 2N7YA 2KRBA 3DOLA 2QMWA 1Y11A 1S1UB 3AAWB 1X4CA 3BKTA 3IBCB 2JZ5A 4WXOA 4O3OA 4OYOA 2RE1A 2ZH1A 3R1HA 1ROFA 5DZ7A 3ZZZA 2V68A 1KHKA 2HMIB 1DAXA 2EXUA 5CYQB 3BDPA 4K5RA 1DJ0A 5KFIA 3NS5A 4HKQA 4A4JA 5CYMA 2UU9J 3MPUB 3D0HE 1RTDB 4DG1B 4ZPTR 3PO4A 3HT3A 3JSBA 3CDUA 3CGIA 2GVDB 2JEGA 4C97A 3PW0A 2WHOA 2XZWA 4K5SA 1MLAA 4QPXA 4U7UD 1SQFA 1X9WA 5KG7A 4FYXB 1FJGJ 5KFGA 3RAQA 2WTFA 4YB1P 1XMBA 1E1ZP 2MYFA 2XHWA 3N28A 2RU3A 4OZ3A 2CDRB 4ZCLA 1MWZA 5T41A 4N56A 2ZUGA 4NWXA 4FDIA 2OTLS 2HSEB 3K8VA 1GXLA 4R25A 3JS9A 4URGA 3R5BA 3D68A 3VAFA 4CH0S 3DI6A 1AT1B 1NDKA 3BM7A 2J7UA 1NK0A 1YJWS 2OFGX 3QMQA 4CT8A 4LF7F 1S6QB 4USWA 1TL7B 1T03B 4PUOB 3TA2A 3EXYA 3KDOA 4FYDA 4ZHRB 1AJDA 1S0OA 2P2CB 1YJNS 3IXQA 3AXMA 3HVRA 4AYBD 1D3WA 4EI2A 1NLKL 2E5GA 1VLYA 4JI6F 2MLXA 3CJ4A 1EARA 1R8CA 4NLSA 4NLOA 4IFYB 1DARA 1LWCA 4PPDA 1JJCB 2CJ9A 4V19X 5D3GA 1ALKA 1B64A 3UCGA 3EDQB 5KXAA 4NLUA 5D15A 5HVHA 3GILA 5A0YB 1TVRB 1Q79A 3DRYA 2QL7B 3U1NA 1JKHA 4F0KA 2HVIA 4YFUA 4DUYF 5KG0A 2YKNB 5E7OB 4N8OA 2V4JB 5A2QY 4JV5F 4OHVA 2DGSA 1JNRB 1S1WA 4F0MA 1R0CB 3R97A 3IDDA 3PY8A 1IBLJ 3D54A 3RBZA 3OL9A 3AY0A 3R7NB 3GLJA 4O4RA 3CD5A 4RUCA 3V2UC 1U1KA 4O3PA 2G13A 4NPOA 2E1CA 3R5JB 4EBDA 2MY7A 4MTPA 2CKWA 5KG4A 3EPGA 2BW7A 3CXCR 1IBMJ 4OI2A 4DBQA 1MSWD 1L3SA 1WKLA 1H2UX 2XMMA 1X5SA 2B8QA 2K3IA 1WOOA 1S76D 2DBBA 3CDWA 4J9UE 3TUPA 2CXEA 5HMXA 4IO9Q 4CT9A 2UXBJ 3WIVA 5LL6d 4OI4A 1IM4A 1NK9A 5GAHI 4ECYA 4KHPJ 4EBCA 4DR4F 1U24A 5IV4A 2HG4A 3DGPB 4U9RA 1WACA 4KGXB 1Q8KA 4PG4A 3LAKA 1P9QC 3M8QB 1M1KT 3QATA 5IT0A 2NUUG 3IM8A 4KFBA 1UFKA 2OEMA 2R7TA 1G3OA 4C0OC 2YQ1A 3NGSA 2XMAA 1JLFA 2H5IB 4FZVA 3HX9A 1P49A 2R8HA 2OTJS 4DFJA 2VOPA 5IOLA 5F3ZA 1ZZFA 4W92B 3NL0A 4O4GA 4JV2A 4UOCA 3KLEA 1JXLA 1FRHA 4KH0B 2W5SA 4GKJF 1Y4ZB 1R6VA 1T9WA 1MROA 3W3SA 2VQFF 2B6AB 4I64A 3AQPA 2ZJRQ 2FZGB 1PAUB 4MYTA 4RR5A 1DQ8A 3OL8A 2EFNA 4LJMA 1HBMA 4CNZA 4A8WA 2FJAB 2Y1JA 1KFSA 3P5BP 4JB8B 4CLZA 2ZDPA 2LLZA 2XLKA 3TJAA 3B54A 4P2XA 3TEGA 4NCGB 2D3O1 3DYCA 1UFLA 2DCUB 5KFUA 1TP7A 2XSJA 2XRGA 4QOTA 3I56S 4K0KF 4PZVA 4M5HA 2CG8A 1DHMA 1HNIB 4FDJA 2XEXA 3BH7B 1V5IB 4MAKA 3EE3A 1TAUA 1OMSA 2XNQA 2YWWA 4Q2LA 1Q95G 1RA7A 4G1QB 1QE1A 1GFWB 4WFAQ 3P96A 4TLRA 1QJHA 2K2PA 3DRPA 1P27B 3MPWA 4H4KC 3KG4A 4PG8A 4IRKA 3OW2R 1HHQA 2D3UA 4CH7A 1N5YA 3IGZB 1B7YB 2N4DA 4ZG6A 3HHNB 1FKPA 1SH0A 1KHJA 1Z4UA 1ZM2A 5IWAJ 4DL5A 1RLDA 3FEXB 1HW8A 1RHRB 4ZJQA 2DB1A 2FY1A 5A6PA 1RP5A 3DOMA 5KFWA 1HD1A 3KFWX 2DNZA 4IRCA 1R31A 2MZQA 4GC7A 5F8LA 2CJBA 4PYDA 5DDRC 4IKAA 2RMLA 1M1GA 4JI1F 4ZMMA 1R0AB 1Y6VA 3D2WA 2AX0A 3DC2A 4FVMA 1X4DA 1KH9A 3DLJA 3ZTOA 4CTAA 3WZ0A 1PBAA 4I2QB 1SIWB 1N34J 1S48A 3M2RA 4NLVA 1KQKA 5KFEA 1WKJA 3VVTA 1O98A 2QN6B 2JDJA 1RUSA 3W61A 3KHLA 2DR6A 2DISA 3M05A 3IR6B 3NS6A 5I42A 1SJ4P 2BABA 4B3MJ 2DGTA 4ED7A 3M6WA 2AYEA 3K8WA 1Y5IB 1U2RA 3KMSA 2Y3YA 1TU0B 2BV3A 3DMJB 1YJTA 3TX8A 5L0BA 1WUUA 4Z2XA 1KOOA 1M5KC 2GS8A 3DN9A 3TR5A 4LF4J 2D3ZA 3FEYB 5H9EK 1GMUA 4QAXA 4FS2A 5FLXY 1K8AT 3MCSA 3G87A 5CZXA 3EYZA 1KKHA 4OYWA 1FHTA 1RWUA 4HT5A 1OPZA 4USHA 3JYTB 2UUAJ 1HNWF 1JK9B 3CCZA 1FNXH 1RT4A 5KFQA 1AB8A 4K7QA 5EWFA 1UZDA 4IG0A 1YI2S 3H59A 3FCWA 4YDDB 2GSUA 4GTWA 2DO4A 3RRKA 1M5HA 1OWXA 2HHQA 2XS2A 2ALZA 4OI0A 2QV6A 2DHGA 1OPIA 2XZTB 1FDNA 1WJ9A 1E6VB 2DHHA 1S77D 4IH5A 5KT7A 3IS9B 4GTYA 2VBYA 5MAOA 5B0DA 3VVUA 1UVNA 2HHUA 5HJYA 3I9V9 2JJ4D 2HHHJ 1V5VA 2MQNA 3CTRA 3TA0A 4C7QA 1GEHA 1LK5A 2AV5A 4Q0BB 2W8DA 2WONB 3HFKA 1G6BA 1KVJA 3M8ZA 3GR0A 3OR1A 4ERDA 1C0UB 1VQ8S 5LXRA 2VUGA 1KR4A 5EGEA 1N6QB 1OIAA 1DTQB 4DV1J 3HPOA 8ATCB 2AMCB 4FXVA 1SL0A 4L3KA 4NLDA 3K58A 3HFZB 1BWEA 2A1BA 3NEKA 1Y3KA 3EM1A 1VQNS 2B9YA 2ZKTA 1KLMB 4ZITA 4MK7A 1H3DA 4YR1A 2VONA 4NWBA 2FLPA 2HAIA 4Y2AA 2HHXA 4ILRA 1TFYA 5HMZA 4I56A 6FDRA 1PYTA 1U1OA 1HQEA 3UO0A 3D7SB 1T0TV 1RHKB 3OT9A 1FDAA 2F8HA 2H65B 4CCHA 3RTVA 1C1BA 4R8UA 3D9BA 2KG0A 3DLBA 1G4CA 1PO6A 3FSIA 1WWHA 5L8RC 3EGZA 3P49B 4NRTA 3QWPA 1IJEB 3WX4A 5K20B 1O51A 5DGBA 4TY8B 2H5JB 2JX2A 4LSLA 5LSRA 1VRTA 5SUHA 3H25A 1U47A 3FC9A 2LQJA 5IV3A 3GYXB 5KFDA 1REGX 4F3OA 1JLEB 3B4MA 1NO8A 3F73A 1XQIA 3CMRA 2WB1D 4WFBQ 2XCAA 2KI2A 4WFYA 2RSQA 5D4LA 2XYHB 2KYXA 2GJ2A 1PGZA 4OI6A 1ZOTA 4LFAJ 1HQAA 3LXQA 4KAIA 4Q5VA 3HFVA 1B70B 2C2ZB 2K3KA 1K1SA 4JOUA 4PWDA 2M7SA 4QW8A 5GAHU 4B9TA 2VG7A 5T7LA 3I32A 3L95X 3I82A 2GV1A 3SQGA 3MXHP 3D3BJ 5FD1A 3UR3C 5H9FK 4ZOSA 4YB7A 2V9WA 3DNCA 4ZVGA 1KFDA 4H54A 3SI8A 1VQKS 3C15B 3BN4A 3OV7A 1VHFA 1VBYA 4LRCA 4O0NA 1Y9OA 1TKZB 1RT5A 2P9EA 5C42A 4F3MA 3NMRA 1CQMA 1GXTA 3AD8C 4FPRA 4DQIA 3QJPA 3MHYA 2VA3A 4PG7A 3M2VA 2XB2D 2CPYA 3DRXA 3MFHA 3JQKA 4RNFA 3K57A 4OQJA 2BVZA 1WDDA 3VAIA 5C2CA 3NGDA 3NG8A 1IBLF 4XAKA 2ILYA 4CXUA 1H74A 2Z30B 3WC2A 2MLYA 4DXLA 1S99A 4RNHA 4RJVA 2D9OA 1EW2A 2DGQA 2RQ4A 3MFIA 4WFXA 2W5XA 1A0OB 4MIBA 4MIWA 1IBMF 3I0SB 3TG0A 2YPZA 4WP3A 4QZVB 4YS2A 2RT3A 2RF2B 1UEVA 3MR7A 2OPQA 3W8GA 4KHPF 1XC9A 2K1RB 2BJ7A 3GQCA 3BKFA 1GTEA 2LCWA 1AA1B 4ER8A 2IRXA 2G0JA 1CS4A 2VF3A 1MU2A 2ZOMA 4CM0A 3KK1B 1CVJA 3P5TL 2ZBRA 2BMBA 4LF1A 1UPPA 4YR3A 1VQLS 3HKWA 3G2XA 2DRAA 1SC3B 3IA0A 1KH4A 4OI1A 2GQQA 2Y1LB 2MHNA 3TUIC 2QLJB 2UVWA 3VAKA 2B9WA 2CQBA 2MZRA 2OPPB 2MHEA 2GHWA 1N0VC 3NOGA 1U49A 2DD8S 3LW5C 3IGVA 4U7UK 5ETNA 1RYSA 2R7OA 4NLPA 4X65J 2IC3A 2BANA 2LXIA 3UD4P 1R89A 1YKWA 2LQ9A 2V2VA 2CPDA 2OPSB 2GFFA 2ROGA 4IOAQ 1JXEA 1H98A 3VAMA 2QSFA 1A7GE 3V5RA 1YWXA 2E1AA 3DXBA 5L9XA 1KQGB 5C66A 3ILJA 2UVUA 4RW6A 1R8AA 2P8IA 4Q45A 3H90A 3IRWP 1NM2A 1RKJA 1FCAA 3MM8B 1P1TA 4ZPDA 3VGSA 1T9UA 5K14A 2PD1A 4KYZA 4G1IA 2RQCA 3VCDA 4DF4A 3UDVA 2QZ8A 3A3OB 3LP1A 1EQMA 5DM6Q 4DQQA 4M8LA 2J0XA 5IS2A 5HK4A 4H4OA 2KYZA 4ED3A 2ATCB 1PCAA 4EWTA 5IWAF 4HYKA 1NJWA 2BDPA 1WF2A 1MG7A 5E3PA 2DH7A 2XI3A 1Q8IA 3Q0AA 4DOZA 1WOSA 1YGYA 2OGUA 4DPYA 1JJ4A 3QT5A 2FB0A 4NLTA 1WSVA 2WSFC 3QO9A 1S7HA 5J2PA 2PIIA 4MFBA 1QVFR 1N34F 1SH3A 2CJKA 4CDIA 2C2MB 1REVA 4Y3CA 3KLHB 2RKIB 2YX1A 1ANIA 3LA0A 3GB0A 3RB3A 2M9KA 3I4HX 3J80U 2K8GA 4B3MF 2M2BA 2VASA 1HMVA 4CO5A 2HHSA 2VFRA 3CD0A 3QLHA 3NRBA 4Q43A 1VQ9S 2VPYB 2NYIA 1EETA 2JEIA 3HHLB 2YKMA 2ZH7A 5A8WA 5KFJA 1D09B 3O2IA 3M8WA 2BQRA 4BC7A 4DR2J 2QTWA 1M0SA 3ENQA 2WOMB 5E2QA 2CQDA 4IYQA 1CJTB 5CAAA 3PHEA 4ELTA 3DKDA 3CW2C 1ANJA 1HI1A 3M32A 3HVTB 1S1XA 4KO0A 4B3TF 1MN7A 4OX8A 2Q66A 2PSZA 3MM7B 1K47A 2C2NA 3KJFB 4WK3A 1LQ9A 2FDNA 5M2PA 4DPTA 3RB0A 4DSJA 3QT7A 2LXUA 3D0GE 4IH6A 1SJQA 2LU2A 3M1VB 3TX0A 1XTZA 2HVDA 2VG5B 2V4RA 5HQMA 4M5IA 1URNA 2DNMA 4I7FA 5KFNA 5J2NB 3CCSS 4N8NA 3PFOA 2ZBIA 1EP4A 1S6PB 3N6MA 2WW8A 2H51B 3IRXB 4Q8FA 2KZMA 3M8YA 1Q16B 2W4DA 2ZBQA 3KG0A 1S6UA 5LMNF 3RW6A 3T6BA 4ZP6A 5BR8J 1IR2A 2MZ1A 1FTRA 2Y8YA 2PC6A 4X4RA 3CWJA 3AD9C 1SL1A 2W5VA 5CQGA 1WC4A 4Y0FA 4DV1F 3KUGA 2XC9A 2CZVC 4IDKA 1Y3JA 2HQ3A 2YWEA 3QRPA 3GIIA 4QQBA 2W9CA 1HNXJ 2N3OA 4O0IA 3MAAB 4ID5B 1IN0A 4TU9A 2RB7A 4DZDA 2IBKA 3HKZD 4CLUA 5AJ3J 3MK0A 1QM9A 5F3TA 2FJVA 4USVA 2OKQA 1KP6A 3OFEA 1LW2B 1CG2A 2IRYA 2QE5A 3PV8A 2XLJA 1FDDA 4UORA 4QWDA 1U6ZA 3S6EA 3N6LA 2BA9A 2PGCA 2I1RA 2EEYA 4E2FB 3ICLA 2DNQA 3BQ2A 5E0OA 3KNAA 2IMOA 2Q6BA 4CH1A 4AL5A 3NKPA 3BO2A 2VBZA 1UWBA 3NCRA 2R8IA 1WNEA 1X4FA 2E1PA 4M5DB 3ZXWA 5AXLA 2YVSA 1IVZA 5D0RA 3M9NB 4MIAA 1F3VA 4ZPVR 4J9RA 1NZ8A 3HSJA 3NP5A 3KLIA 1T3NA 3W7BA 1XNRF 3ZNJ1 4QYZK 3MPYA 3OR2A 3SCLE 1FWKA 2E5JA 3BN7A 5DLWA 1WG1A 5EWEA 2C22A 1Q8BA 4HHJA 1O0PA 4WKRA 2XM3A 2OD4A 1ZAWA 4DU8A 5AXMA 3MR6A 1IKWA 2PO4A 3W63A 2R2RA 5K8OA 2HNDB 4WFZA 2KB2A 2BJ8A 2B4PA 1KBRA 5LT5A 4L75A 3HHKA 2E5HA 3CDAA 2AYBA 3MMAB 5ITHA 4LREA 2BW2A 2R3VA 1PIEA 3H5SA 3M2UB 5E41A 3V81B 1WF1A 1H73A 1U7LA 3CEDA 3HHDA 1IUJA 4CO0A 1S4FA 5J1EB 3QBCA 2QG9B 4DMZA 3QWUA 4BDPA 3UPFA 5J2MB 4DX6A 5LRMA 3K0JA 1R8BA 4HI2A 3BO3A 4BLGA 2B4VA 1TL3A 4NLXA 5CZVA 4C2MA 2J0SD 1R7IA 3SFUA 3G86A 4WYLA 3CPWR 5L38A 3MM5B 2P5VA 3PYFA 6FD1A 2COLA 3UCZP 4OHWA 3NY0A 2W5WA 3GFYA 5KFFA 1J27A 4WKYA 4OIXA 3G9CA 3C8YA 4B9MA 2KHCA 1BMQB 1T05A 4LR2A 2DEIA 3EX7B 6AT1B 3MMCA 4DR3J 2GSOA 5D0GA 4P52A 3C6TB 4RZRA 3CDEA 3Q8RB 1HARA 3Q3QA 4I2PA 4HACB 3UN2A 3RBDA 2CPHA 2DXEA 4C8ZA 2A3JA 2AU0A 2W4PA 1RWNB 2O01C 3DXSX 5HAOA 4R5PB 1NSQA 3SCIE 1G1XA 2HW3A 3SXLA 1LW0B 3R9LA 3R6GB 3TZYA 2I0XA 4HLBA 4O44A 5AT1B 3O3LA 3SV3A 2ASJA 5E5NA 1TL4A 3CJ3A 1I6JA 3MM6B 5HBMB 2ZOGA 3FK4A 4Q8EA 1S79A 4DFKA 5DG7A 1TFWA 4X65F 5B0AA 1RTZA 4LRDA 4OX7A 1HL6A 1EQJA 5L39A 2KH9A 2HFVA 3MR2A 3M8RA 1JLQA 3KXDA 3HK2A 2ACMA 3KJNB 2J9DE 2W2QP 2HRYA 2GHPA 2QYGA 1PKUA 2RH6A 3OTBA 4K4VA 4ECWA 3KK3A 4LRFA 1CC8A 2B4UA 3DYAA 3MM9B 2HNZA 2MKIA 2NSBA 3U02A 2HURA 2FC9A 2HZCA 4DQRA 5JUMA 3SZ2A 2JL9A 2MTLA 4I6YA 1XMQJ 4ZN3A 3BGFA 4LF8J 1TKTB 3DPCA 3U1LA 4HDHA 1KEKA 4F3QA 3TWZA 2KZZA 1TR0A 1H2TZ 5DG9A 3QZ8A 1WG5A 2B8PA 4C8KA 4N41A 3D1QA 5KOWA 4UW2A 3I6PA 3OUYB 3OVAA 1WC1A 2E9RX 1FDBA 3OHBA 1SKUB 4DSEA 1R0BG 1SV5A 2RIJA 1S1VB 2I6WA 4IG3A 5HJXA 2X1GA 4DL4A 1VYAA 2W2PP 2LP4A 3PR4A 4OZ5A 1FXDA 2BE2A 2R7WA 1FKOA 3W2VA 1RBAA 3MMBA 4P10A 2CNNB 2ZZMA 1Q81T 4USUA 2RQMA 3MECB 4WE1B 4DR6J 3DFEA 1ZEFA 2QA4S 4I68A 2UUBJ 3BBCA 3Q22A 4NA3A 1EX8A 3CJ2A 3NCPA 2FLNA 2VJUA 1CJUB 5KAKA 5GAGI 1RT1A 3POTA 2X1AA 3D6TB 3VZIA 4UPHA 1F6TA 3CJSA 2DRBA 4KV8A 5HLFA 2HGMA 3PW5A 1X0PA 4WJBA 3SDEB 3KK2A 1SC4B 3NBPA 2YKOA 1IKXB 4EGLA 2NPIA 4X2BA 4JI8J 4CYUB 3QNWB 1WHXA 3C6UB 2JVRA 4LF2A 2XHCA 2DXFA 4CLYA 2ZH8A
chains in the Genus database with same CATH topology
2D1GA 3NKMA 2IUCB 3MK0A 2VQRA 2GSOA 2W5TA 1N2LA 2W5RA 3TX0A 5AJ9A 2IFYA 4ZG7A 3WAWA 3SZZA 3Q3QA 3B5QA 3IDDA 3WAYA 4UOOA 1EW9A 4LRCA 3UNYA 1P49A 2IUCA 4LR7A 3E2DA 4GTYA 4GTZA 4TN0A 3WAXA 1ZEFA 3IGYB 3UN2A 1AJBA 2RH6A 2GLQA 5L0BA 4CXSA 1ANIA 1HJKA 3NKRA 3ED4A 4UORA 1KH4A 3BDGB 3BDHA 3IGZB 4LRFA 2ANHA 5DLTA 4ZG6A 4LREA 5EGHA 1ALHA 4LR9A 1KHJA 1ELXA 1SHNA 2QZUA 2GSNA 2W5SA 2W8DA 1N2KA 2W5QA 5GRRA 3WBHA 3BDGA 1EW8A 3NVLA 4B56A 3M8ZA 4QAXA 2G9YA 3MK2A 1ELZA 1ALJA 5HRTA 3A52A 4KAYA 4MIVA 1AJDA 1KH5A 3NKPA 3M8YA 1KH7A 3T00A 3WAVA 1EI6A 1AJAA 5EGEA 5L0EA 4CXKA 1URAA 3BDFA 3M7VA 4CXUA 1E1ZP 3DPCA 3MK1A 4ZGAA 3UN5A 3CMRA 4UPIA 3M8WA 4UPHA 1E33P 1ED8A 1E3CP 5DLVA 2W8SA 3TWZA 5GOVA 1Y7AA 1K7HA 5LQQA 4N7TA 3KD8A 4LRBA 4LR8A 1ZEBA 4LQYA 1EW2A 1Y6VA 4NWXA 3T02A 5LRMA 4KJGA 4FDIA 2GA3A 4MHXA 1EJJA 1B8JA 1E2SP 1KH9A 1HQAA 2XR9A 3LXQA 4GTXA 1ED9A 2ZKTA 2W5XA 5IJQA 4CYSA 2W5VA 1HDHA 1SHQA 3T01A 3DYCA 1ELYA 3NKOA 5LIAA 2X98A 4UOPA 3TG0A 4KM4A 4NWJA 1ALKA 4YR1A 1AUKA 4UPLA 5K4PA 1O99A 1KHKA 2XRGA 1ANJA 2GSUA 4KAVA 4CYRA 3UN3A 4KJDA 4MY4A 5KXAA 5TJ3A 5L0KA 1ZEDA 5DLWA 5IJSA 3NKNA 1O98A 4FDJA 3NKQA 2W5WA 1URBA 4GTWA 4LRAA 4LRDA 3UO0A 4UPKA 5C66A 5INHA 1FSUA 1AJCA 5LRNA 1KHLA 3SZYA 4ZG9A 3OT9A 1EQJA 1ALIA 4LR2A 1KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1G A;  3NKM A;  2IUC B;  3MK0 A;  2VQR A;  2GSO A;  2W5T A;  1N2L A;  2W5R A;  3TX0 A;  5AJ9 A;  2IFY A;  4ZG7 A;  3WAW A;  3SZZ A;  3Q3Q A;  3B5Q A;  3IDD A;  3WAY A;  4UOO A;  1EW9 A;  4LRC A;  3UNY A;  1P49 A;  2IUC A;  4LR7 A;  3E2D A;  4GTY A;  4GTZ A;  4TN0 A;  3WAX A;  1ZEF A;  3IGY B;  3UN2 A;  1AJB A;  2RH6 A;  2GLQ A;  5L0B A;  4CXS A;  1ANI A;  1HJK A;  3NKR A;  3ED4 A;  4UOR A;  1KH4 A;  3BDG B;  3BDH A;  3IGZ B;  4LRF A;  2ANH A;  5DLT A;  4ZG6 A;  4LRE A;  5EGH A;  1ALH A;  4LR9 A;  1KHJ A;  1ELX A;  1SHN A;  2QZU A;  2GSN A;  2W5S A;  2W8D A;  1N2K A;  2W5Q A;  5GRR A;  3WBH A;  3BDG A;  1EW8 A;  3NVL A;  4B56 A;  3M8Z A;  4QAX A;  2G9Y A;  3MK2 A;  1ELZ A;  1ALJ A;  5HRT A;  3A52 A;  4KAY A;  4MIV A;  1AJD A;  1KH5 A;  3NKP A;  3M8Y A;  1KH7 A;  3T00 A;  3WAV A;  1EI6 A;  1AJA A;  5EGE A;  5L0E A;  4CXK A;  1URA A;  3BDF A;  3M7V A;  4CXU A;  1E1Z P;  3DPC A;  3MK1 A;  4ZGA A;  3UN5 A;  3CMR A;  4UPI A;  3M8W A;  4UPH A;  1E33 P;  1ED8 A;  1E3C P;  5DLV A;  2W8S A;  3TWZ A;  5GOV A;  1Y7A A;  1K7H A;  5LQQ A;  4N7T A;  3KD8 A;  4LRB A;  4LR8 A;  1ZEB A;  4LQY A;  1EW2 A;  1Y6V A;  4NWX A;  3T02 A;  5LRM A;  4KJG A;  4FDI A;  2GA3 A;  4MHX A;  1EJJ A;  1B8J A;  1E2S P;  1KH9 A;  1HQA A;  2XR9 A;  3LXQ A;  4GTX A;  1ED9 A;  2ZKT A;  2W5X A;  5IJQ A;  4CYS A;  2W5V A;  1HDH A;  1SHQ A;  3T01 A;  3DYC A;  1ELY A;  3NKO A;  5LIA A;  2X98 A;  4UOP A;  3TG0 A;  4KM4 A;  4NWJ A;  1ALK A;  4YR1 A;  1AUK A;  4UPL A;  5K4P A;  1O99 A;  1KHK A;  2XRG A;  1ANJ A;  2GSU A;  4KAV A;  4CYR A;  3UN3 A;  4KJD A;  4MY4 A;  5KXA A;  5TJ3 A;  5L0K A;  1ZED A;  5DLW A;  5IJS A;  3NKN A;  1O98 A;  4FDJ A;  3NKQ A;  2W5W A;  1URB A;  4GTW A;  4LRA A;  4LRD A;  3UO0 A;  4UPK A;  5C66 A;  5INH A;  1FSU A;  1AJC A;  5LRN A;  1KHL A;  3SZY A;  4ZG9 A;  3OT9 A;  1EQJ A;  1ALI A;  4LR2 A;  1KHN A; 
#chains in the Genus database with same CATH topology
 1S59 A;  1GH8 A;  3ONQ A;  4RWW A;  1T8E A;  1VQ6 S;  2ZH3 A;  1B0T A;  4GTZ A;  2F4F A;  1S7I A;  3PTW A;  4ZPB A;  5HQ8 A;  3E2E A;  4FPI A;  2ABY A;  4C48 A;  4ILM A;  1NEE A;  2DH8 A;  1KQS R;  2LA6 A;  4OI3 A;  1HQU B;  3CUN A;  4EK2 A;  4OV6 A;  1S12 A;  3BDG A;  4F04 B;  4ID8 A;  4NLR A;  4FF4 A;  3OTC A;  2QA4 G;  5CD4 A;  4QJV A;  3DOL B;  2R4F A;  4DJB A;  1C2P A;  2XLI A;  3Q8V A;  2KXF A;  2OEJ A;  2XY6 A;  2BXJ A;  4WIQ A;  4DV0 F;  3H2V E;  2L9W A;  4MT1 A;  5C5J A;  4DUZ F;  2X3G A;  2ZC3 A;  1T9X A;  2FIU A;  2J5A A;  2HQD A;  2JNJ A;  3GFH A;  2XMW A;  3T5K A;  1J5O B;  4DV2 F;  3SYZ A;  1HW9 A;  2Y0S D;  5BR8 F;  5GMK a;  3OSP A;  2GVZ A;  5CYM B;  1EAY C;  4ZK7 M;  5LMU J;  2AEM A;  3DLE A;  2FGO A;  3ET6 A;  3SBM A;  2QFJ A;  3O5T B;  1RSC A;  3VHQ A;  4CLW A;  3R5C A;  3BGR A;  2GZO A;  1T9T A;  2B3T B;  2HPU A;  3ZZU A;  3PAC A;  2DCL A;  3T1A A;  5F8J A;  3BSA A;  3FBC A;  4ZVF A;  1J2V A;  2APO A;  3ZTS A;  2HAF A;  1G7C B;  5LJ3 Y;  3ZZO A;  3JTO A;  2E66 A;  2ZH5 A;  1SJ3 P;  4NLW A;  1Q8L A;  2F65 A;  3IR5 B;  2NZ4 A;  3V6D A;  1TQL A;  2MXY A;  1WC6 A;  3GP9 A;  3LOU A;  3GIJ A;  4WZQ A;  4AXJ A;  4X4N A;  3MUT P;  1YRT A;  2V0N A;  2ZUA A;  5DDP C;  4GKK F;  3L3C A;  3B8H A;  4JI7 F;  4NEZ A;  2W9A A;  2GA3 A;  1HWJ A;  5F8G A;  3Q23 A;  1VBK A;  2F7V A;  4OHZ A;  2FTR A;  1MNE A;  3AOA A;  1WF0 A;  2CQ1 A;  1IWG A;  4A47 A;  2RIL A;  2GHV C;  4CLL A;  4USM A;  2C1E B;  3NKN A;  1URB A;  2QL5 B;  3P45 B;  1S9F A;  2D1C A;  3JXO A;  3TRG A;  3W65 A;  4RNO A;  1OY8 A;  4KIA A;  2GQ2 A;  3NNH A;  2H48 B;  5K8N A;  5D0H A;  4ZG7 A;  1UJ5 A;  1VQM S;  3TZW A;  2Z56 B;  1FRI A;  3QJJ A;  3QSY B;  3N6N A;  2ADB A;  3NKR A;  3D66 A;  3A4T A;  5A0Y A;  1S0V A;  4Z7C A;  4KKO A;  2M52 A;  3GG0 A;  1GMW A;  4RW4 A;  3U1M A;  2ZFH A;  5JVH Q;  3T5L A;  3QGH A;  2BZ2 A;  4CLT A;  1URA A;  4PKD B;  1KLN A;  2GC8 A;  2HKE A;  2XI2 A;  1UW9 A;  4CRJ A;  4C11 A;  1RAB B;  4ES2 A;  3DOK A;  5GOV A;  3DRS A;  3R5A A;  4LRB A;  1LWC B;  5D3G B;  1K0T A;  2IAJ A;  3BGO P;  2OML A;  5H9F J;  3JB9 k;  1GK8 A;  5E3A A;  1AUK A;  3QFW A;  2XWY A;  1JKH B;  2BEF A;  5IJS A;  2JLF A;  2AGQ A;  2XWX A;  3K5P A;  1QUP A;  3MR3 A;  3KKF A;  2BR0 A;  2J6T A;  4DS5 A;  3DCA A;  1S1W B;  3BZQ A;  1K0V A;  2MB0 B;  4BWM A;  1N36 J;  5AE2 A;  3A13 A;  2IUC A;  1IBK J;  2OAU A;  4MK8 A;  4C3K A;  4CO3 A;  4MH8 A;  2WW4 A;  2Z2M A;  3DLG A;  4C8M A;  2W9B A;  4DR3 F;  4DI6 A;  4NZ6 A;  2Y0B B;  4NYZ A;  2RDI A;  3N01 A;  4WPA A;  1ELZ A;  2ZZN A;  4B02 A;  3CCV S;  2WAQ D;  4DV6 J;  5L0E A;  1RCO B;  3B82 A;  2MGZ A;  3NMA A;  4B9V A;  3U7J A;  2EFP A;  5GAD I;  1C0T A;  3IBF B;  4PYA A;  5CD4 H;  2FZK B;  1RAE B;  4P74 A;  3LP0 B;  2YQ0 A;  4JI0 F;  1PC4 A;  3NKO A;  3ETO A;  1YZ7 A;  3HZG A;  4KFB B;  3WHI A;  2PA8 D;  4WU2 A;  1OYE A;  2HHP A;  4HL9 A;  1JXV A;  3HUL A;  2CVE A;  2LA4 A;  1JLF B;  2QLX A;  2EKN A;  2CQ3 A;  2R2T A;  3FDS A;  4CO4 A;  2EC0 A;  4C6A A;  2IFY A;  3PHT A;  4ZJO A;  4ZIV A;  4E98 A;  2OO4 A;  3BPD A;  2HWI A;  4O4G B;  2VKZ G;  3KLE B;  4M95 A;  3IM9 A;  5A8K A;  2DPJ A;  2RNE A;  3I0R A;  1MRO B;  1HHS A;  2HVZ A;  1PYO B;  3TVZ A;  1HBM B;  4DUY J;  5EX3 A;  2NPF A;  2VDH A;  4RUB A;  3QGP A;  2CPE A;  4JV5 J;  5CAB A;  2LQ8 A;  2R2S A;  3FQL A;  3C46 A;  4N7T A;  4MK9 A;  5GAG U;  4ZVQ B;  3FSX A;  4PEO A;  1KD1 T;  1NK5 A;  2Z58 B;  1T7P A;  4Y6I A;  3V6H A;  4A8X A;  4NWJ A;  3W62 A;  1O99 A;  1N4L A;  4ED4 A;  2Z2Y B;  1BHN A;  1ZED A;  4I6A A;  2Y1R I;  1LFW A;  1I51 B;  1QE1 B;  2VD3 A;  5LM7 E;  3BSN A;  4PQA A;  3GIR A;  3KJV A;  1H38 A;  5KFL A;  3DRP B;  1KHN A;  3A3P B;  1VR6 A;  4J5O A;  4OZN A;  1JLA A;  1B7F A;  4LQ9 A;  1N5Y B;  2V5H G;  4I2Q A;  4DR4 J;  3PM9 A;  2XSF A;  1GT8 A;  2K7J A;  2JFK A;  1IR0 A;  1FKP B;  3TW0 A;  3MAQ A;  2KVI A;  3M6U A;  5DQI A;  1Q1K A;  4WU3 A;  3DOM B;  4DDF A;  1XWL A;  2V9K A;  3A52 A;  5F8N A;  4DR6 F;  4TU7 A;  2U1A A;  1NJY A;  1F5A A;  2NSC A;  2MQ8 A;  1IXK A;  2UUB F;  4USI A;  2C2K B;  3CJ8 A;  1SKW A;  2B5J A;  2A2C A;  1U45 A;  2EFQ A;  2PI5 A;  4RUA A;  2CAJ A;  4J9V A;  1GMW D;  1S49 A;  1DLO A;  4Y00 A;  3M2R B;  3C16 A;  3BB5 A;  1VIO A;  4PPZ A;  3DU5 A;  1H72 C;  2XG8 A;  2QYC A;  4NYP A;  1H6K X;  2V63 A;  4TYA A;  1KHV A;  1YJV A;  2VQF J;  3PYG A;  5DLG A;  3J7Y U;  5IM0 A;  4C8O A;  1LXN A;  3GYG A;  1HBN A;  2WZ1 A;  5ADZ A;  3QFH A;  1S0N A;  4F4K A;  2DRD A;  3OL7 A;  2DIU A;  1S4E A;  4Z7Y A;  3W5Z A;  4OZ1 A;  4X66 J;  5DLF A;  4JI8 F;  4U6P A;  1TZ0 A;  4B3S F;  1O8B A;  2V2Z A;  3NGK A;  1YVF A;  1HJK A;  3HSZ A;  2M8H A;  3GJR B;  4K0K J;  1VC5 A;  3NLC A;  4YOE A;  4Q7A A;  2CQP A;  5B09 A;  2OJ3 A;  2W5Q A;  3GCX P;  4QBU A;  2Z57 B;  1ALJ A;  5HRT A;  1UMJ A;  1FXL A;  2V67 A;  2XO6 A;  3L9Z A;  2MEW A;  4K50 A;  5A8R A;  1HBU A;  4FNI A;  1RT4 B;  5FLX U;  4CI0 B;  1ELO A;  3FBF A;  1Y7A A;  4IG0 B;  2ZH9 A;  2R7R A;  5CYJ A;  3Q8S B;  1FK9 B;  3J7Z T;  4OYB A;  3U27 A;  4Y34 A;  4RPF A;  1U1M A;  5ETK A;  2XBP A;  2ZH2 A;  2Z8Q A;  2NXN A;  3PRB A;  3V6K A;  4XPC A;  3LO3 A;  1NK4 A;  5J2Q A;  4GMK A;  2JOQ A;  1ZTW A;  2UXC J;  3E51 A;  4RWX A;  3MD3 A;  1N6Q A;  3EIC A;  1PG5 B;  2HLU A;  1ARO P;  4M1K A;  2QC3 A;  4A8S A;  2WB4 A;  1I94 F;  4JI1 J;  1F9E B;  2DTJ A;  2HK3 A;  4UZC A;  1DTT B;  5D77 A;  1KS2 A;  3C14 A;  3WAY A;  2AIR B;  3LAL A;  3IGY B;  1YQH A;  3MCM A;  2C2O B;  2PFF B;  4F25 A;  1UFW A;  3OR1 B;  2XS5 A;  2WCX A;  5A76 A;  1P8G A;  3GR1 A;  3OSN A;  1Y10 A;  2IFX A;  3DDK A;  5ETQ A;  1RTH A;  3OXL A;  3GIK A;  2M4M A;  1AJA A;  2MJN A;  1X0F A;  4DR7 J;  3LAN A;  2NQP A;  2PEB A;  1EQ0 A;  2BJ9 A;  2VOO A;  2I5J A;  1WHW A;  3EJM A;  4DX8 H;  2HIY A;  3UI3 A;  3I5B A;  1Z2L A;  1U1L A;  2ZHA A;  3TAQ A;  4NI2 A;  5KFB A;  5I3U A;  2VV5 A;  2MJU A;  1XNQ J;  3ENA A;  3BYP A;  3H7H B;  1HQE B;  4EYI B;  5TJ3 A;  3AD7 C;  1X4G A;  2DPI A;  2CJX B;  3W8P A;  1C1B B;  3OQ2 A;  5B7W A;  4R8U B;  3ADA C;  2SXL A;  3UDL A;  5B0B A;  3KDN A;  3VQS A;  1SUQ A;  3PEJ A;  4WF9 Q;  2V2Q A;  4OX9 F;  5CCM A;  2KKH A;  4BS2 A;  5D78 A;  4LSL B;  1VRT B;  2ANH A;  3C3L A;  4K4U A;  4DCJ B;  1HWK A;  3RRG A;  2FLO A;  3TO8 A;  2YX7 A;  1X4E A;  1S10 A;  2W01 A;  2D7S A;  2J6S A;  1Q5V A;  3CIZ A;  4KAY A;  1HKA A;  1VC0 A;  4MIV A;  3F56 A;  3MEG A;  2DHX A;  3BGU A;  2VPZ B;  3W64 A;  3LH2 S;  2CPI A;  4ZS6 A;  1JQG A;  3CDB A;  3GCW P;  3HHE A;  4PWD B;  4GTX A;  2EK6 A;  2C3Y A;  2VG7 B;  5F41 A;  5GAD U;  1FRK A;  3FRZ A;  5T7L B;  5GVQ A;  3SQG B;  1U2F A;  2IM3 A;  1EKR A;  5THW A;  4V1A k;  4PWW A;  4TLQ A;  1H0H B;  3RAX A;  1Q86 T;  3NAI A;  5DGA A;  1VI7 A;  4DL3 A;  5KFZ A;  2XMU A;  2VBW A;  2HFZ A;  1RT5 B;  3VGT A;  5C42 B;  3G6E S;  2VJV A;  3I0S A;  3T3F A;  2NZC A;  2CWK A;  3M2V B;  2RUS A;  3R1L A;  4CLS A;  2DNK A;  5DET A;  3QT8 A;  4C8N A;  4B56 A;  1N36 F;  4QWC A;  4WXW A;  2F9D A;  3JAM U;  4DSK A;  4A46 A;  4O3N A;  3B78 A;  1YIT S;  1IBK F;  4DLE A;  1EJ7 L;  4G3I A;  2QMX A;  2G0I A;  1FVQ A;  2LMI A;  1K7H A;  4NXN F;  1RT2 A;  4LQY A;  4EYH B;  3TQE A;  2BOP A;  1TL1 B;  2MKH A;  4U8Y A;  1KRP A;  2CPX A;  1A9N B;  4NMX A;  1R6Y A;  4PAA A;  1M5O C;  4DV6 F;  1BXN A;  1YX2 A;  2KXH A;  2OPQ B;  4F7V A;  2A0F B;  2L08 A;  5DG8 A;  3KUE A;  5JMN A;  1YHQ S;  2QLB B;  4XK8 C;  1CS4 B;  2N3L A;  3CJK A;  3C19 A;  1MU2 B;  3CC7 S;  3MUR P;  4UOG A;  2KG1 A;  2J7W A;  3K5N A;  1NJZ A;  4LR9 A;  3H2U B;  5D4N A;  4I1T A;  2OD6 A;  2RD5 C;  2B56 A;  3SZZ A;  1U1Q A;  1X4A A;  1JLC A;  4PG6 A;  1F5C A;  3HT0 A;  3L7P A;  2F5G A;  2OPR A;  2NS1 B;  3EVW A;  1VQ4 S;  5DLT A;  4F4Z A;  1PBU A;  1ALH A;  3IWX A;  1NPP A;  2NRE A;  4UZB A;  4P75 A;  1A6L A;  3TI0 A;  2Q43 A;  3RBE A;  1RWP B;  4OZL A;  2IC3 B;  2BAN B;  4TY9 A;  4A48 A;  1HPZ A;  2BJ3 A;  1YG0 A;  4JUZ A;  1CUL B;  3KD8 A;  3TVK A;  4P71 A;  4IFV A;  3IFE A;  4ECS A;  2FQQ B;  2EI5 A;  1D9A A;  1XR5 A;  3NWG A;  3MUV P;  1VJQ A;  4ECQ A;  4RX6 A;  4IH7 A;  4NOH A;  5U47 A;  2MKJ A;  5EUH A;  1JLB A;  2AJ0 A;  5HMY A;  1R3N A;  4Z37 A;  1PJ5 A;  4B17 A;  1XMO J;  2PMH A;  1NHV A;  5DDQ C;  1L3K A;  5K14 B;  4TU8 A;  2QEX S;  3T6J A;  3PW7 A;  2V8G A;  1JX4 A;  3THT A;  1NAQ A;  4ZN1 A;  3N4W A;  3ISZ A;  2ZNZ A;  3IAM 9;  1RQ0 A;  4J9N A;  3D28 A;  1FT8 A;  1SH2 A;  1QAI A;  2YNI A;  4H4O B;  5JJB A;  2CQG A;  4JI3 J;  4J90 A;  2V8D A;  5DRK A;  3DRR A;  3W5X A;  4XO0 A;  2DR5 A;  2LKZ A;  2GGP A;  3RJM B;  2OFH X;  3UFC X;  3MPD A;  2KO1 A;  1MWQ A;  4DSL A;  3ENW A;  1S1T A;  4ZVO B;  2KN4 A;  4IQX A;  2YTC A;  2LEA A;  1KC8 T;  3DU6 A;  3W9I A;  2YKA A;  4LUB A;  3L7U A;  2WRM A;  3P4U B;  4FN5 A;  3TP2 A;  2GW8 A;  2D74 B;  3AA9 A;  2MKC A;  2IPO B;  2FVQ A;  2O1P A;  2UUT A;  4LFB J;  2YH1 A;  1HBO A;  1QY7 A;  1FWL A;  1UVK A;  5IT9 Y;  3QO9 B;  5J2P B;  4MFB B;  1WHV A;  2PI4 A;  5KOX A;  4ES3 A;  1YJ7 A;  2AJQ A;  4B08 A;  1SBR A;  2W4C A;  4DQP A;  1REV B;  2HFN A;  1VRU A;  3M6X A;  4HT7 A;  2YWH A;  1MMD A;  2I8E A;  2CQH A;  2BRK A;  2BE9 B;  1VC6 A;  1HMV B;  2EFV A;  5K8P A;  4DN9 A;  2DGU A;  3UNG C;  1U25 A;  3QLH B;  1N52 B;  1EET B;  4LBH A;  4IR1 A;  3RB4 A;  1NUE A;  5H1S V;  3TAM A;  5J1P A;  2EG2 A;  2R42 A;  2YKM B;  1NKB A;  4X66 F;  2J9D A;  5A8W B;  3G82 A;  4B9S A;  4OZ2 A;  3LGN A;  3N5F A;  4CLK A;  1WTF A;  3UN5 A;  1S9G B;  1V3Z A;  2QGF B;  1ED8 A;  4Y28 C;  4DHV A;  2AYG A;  1PIL A;  3PX4 A;  1NSP A;  5LSO A;  5J2N A;  4FF3 A;  3TA1 A;  3M32 B;  4DFP A;  1S1X B;  1FD2 A;  4KO0 B;  1GQE A;  4KSE B;  3IRX A;  2V69 A;  2VZ9 A;  2EW9 A;  1NKE A;  3R5G A;  1PJ6 A;  2DVI A;  1WOR A;  2OHD A;  3KLG A;  4Y2M A;  2MKY A;  2BKO A;  3QRR A;  2VH7 A;  2GAG C;  3QSI A;  1UP1 A;  4LIW A;  2UXC F;  1QTN B;  4I7F B;  2XQC A;  1AXQ A;  3MCO A;  1YRX A;  4NZ7 A;  8RUC A;  2HVE A;  4OHY A;  1K73 T;  1EP4 B;  2GLQ A;  3AOC A;  4JI4 J;  3RR8 A;  2DR9 A;  2F3J A;  3R5D A;  2U2F A;  3A8I A;  1JJH A;  1SL2 A;  3A12 A;  4ECX A;  3PNI A;  3CJ0 A;  1RIS A;  4OJ3 A;  3R7B B;  1LW2 A;  4ZA1 A;  4IOB A;  2ZVS A;  2OUG A;  5LJ5 Y;  4AD6 A;  1SIZ A;  1NND A;  5L46 A;  1PSD A;  3KMQ A;  3KJQ B;  2YWK A;  4EO6 A;  4D3G A;  4DWI A;  4LF6 J;  4U67 Q;  1W26 A;  4IDK B;  1E6Y A;  2XMT A;  5LIA A;  4R0J A;  2UVV A;  3BRE A;  3WDO A;  4ED8 A;  4NLG A;  4DR7 F;  3MD1 A;  2W9C B;  1OSD A;  2ZEJ A;  4QWA A;  4GVB A;  1GTH A;  1N8R T;  2IVF B;  1N56 A;  3ZTR A;  1QDU B;  2LU1 A;  2NYH A;  4NE9 C;  4J9K A;  1FJC A;  1HNV A;  1BQM A;  5BYR A;  4AL6 A;  1SQE A;  1XER A;  1NJX A;  1XNQ F;  1LV5 A;  4WWS A;  5KFV A;  5L1L A;  1FX2 A;  3ZZY A;  4UOO A;  1DY3 A;  3T19 A;  3Q89 A;  4LT6 A;  3ULH A;  5SZT A;  1N54 B;  1TK5 A;  1HYS A;  2LEB A;  2HBY B;  2XYP B;  4B3T J;  1OO0 B;  2IBO A;  2GJF A;  1ZM9 A;  4KJI A;  1UWB B;  2ZOF A;  4EBE A;  2ZD1 A;  4K59 A;  2HND A;  5KFO A;  2LXF A;  3M7V A;  1JLG A;  3JTP A;  3FUY A;  1IKY A;  3KLI B;  4N76 A;  3MMA A;  4KJG A;  2FC8 A;  2ASY A;  3OR2 B;  1IR1 A;  4EUV A;  1FVS A;  2OI2 A;  2JSX A;  3LP2 A;  2DNL A;  1AZS A;  3NS7 B;  4QPT A;  5ETS A;  1CJV A;  3N5B A;  1LK7 A;  4CYR A;  3E8O A;  1RU2 A;  1IKW B;  2NXC A;  3FFI A;  3FQK A;  5HRO A;  5LMN J;  1TKX A;  5BJR A;  4UQT A;  2B4O A;  3THP A;  2K7K A;  1FE4 A;  3GZ7 A;  1Q82 T;  3FEZ A;  3CCT A;  1AUD A;  4X4P A;  2RVJ A;  4YHH F;  2FUG 9;  2YH0 A;  4C8Y A;  2F8E X;  4DV4 J;  4J91 A;  4IR9 A;  3JSR A;  3SSR A;  3SQO P;  1DQA A;  7FDR A;  4C98 A;  2VL1 A;  1TV6 A;  1S6O A;  4PXD A;  1CBK A;  1SB6 A;  3LWM A;  3RRH A;  3Q8Q B;  2L9N A;  2NXJ A;  4DSI A;  5HO4 A;  2HBR B;  3CC2 S;  1TL3 B;  4CLF A;  2R7S A;  4DPW A;  2IM1 A;  1TUG B;  3WX8 A;  2UUC F;  3H0P A;  3PR5 B;  2XR9 A;  1VLO A;  5F8H A;  3QJL A;  1Y0H A;  2EWH A;  4FVC A;  5F9L A;  1MMN A;  1GX6 A;  1UL3 A;  1CLF A;  4L6V 3;  2D41 A;  1R8P A;  2QA2 A;  4DF8 A;  2F40 A;  1T05 B;  1ZA1 B;  2L48 A;  2DY9 A;  3MMC B;  2ATL A;  2XYG B;  2PA3 A;  3CCJ S;  2XNR A;  4I2P B;  3MWB A;  5HBM A;  3TUZ C;  3MEK A;  3H5X A;  3QAE A;  2KRR A;  4DEZ A;  2BM1 A;  1CEZ A;  1XNR J;  3VGV A;  1KN6 A;  5ETT A;  1XR7 A;  4J9S A;  4RW9 A;  2HS3 A;  3HP6 A;  3BF4 A;  1N32 F;  2B9E A;  2G2Y A;  3IWL A;  4O44 B;  1TMJ A;  1BC6 A;  3CO0 P;  3BPS P;  2BX6 A;  2LEP A;  2LEC A;  2MSS A;  3ELH A;  1Q53 A;  1U0H A;  3FZ2 A;  4ZGA A;  3HCX A;  3GSD A;  2CVI A;  1FEE A;  2W8S A;  3OPK A;  4PQU A;  2AJ1 A;  2V94 A;  2IYG A;  3CB4 A;  4M5J A;  1L3V A;  3T02 A;  3W5Y A;  3GE9 A;  1W2B R;  1UAW A;  1U2C A;  4NRU A;  1UA1 A;  4X84 A;  3LAM A;  2J0Q D;  3EZU A;  2XO7 A;  4ECV A;  4JV1 A;  4K8R A;  1IQZ A;  4H4M A;  2IJR A;  2HK2 A;  5ETV A;  4XIU A;  2UXD J;  1VJW A;  3OD2 A;  5INH A;  1JLQ B;  1NH7 A;  1RT3 A;  3MED A;  5D0E A;  2IDL A;  5BYQ A;  3JAM Y;  3PJ9 A;  1RWV B;  2W2N P;  1NH8 A;  4OZJ A;  3TUJ C;  3WBZ A;  2CAD A;  1F3F A;  1YIJ S;  4OMF G;  3HXM A;  3KK3 B;  3K59 A;  3S1T A;  3DYA B;  2XGP A;  4FS1 A;  3GG1 A;  3PFE A;  2HNZ B;  4L3N A;  2B51 A;  1LWX A;  3Q8P B;  3CCU S;  1HA1 A;  3MUM P;  5B0F A;  3KTQ A;  4UUX A;  1XMO F;  4DR5 F;  3VV2 B;  3RZA A;  4DFM A;  1VCT A;  4CIO A;  1RAC B;  1WHY A;  2W8L A;  4EFA C;  2DY1 A;  5KG3 A;  3S01 A;  4MJK A;  1S97 A;  4JI3 F;  4X4V A;  1SV5 B;  4ED2 A;  2KVQ E;  2ROE A;  1HDH A;  2AJF E;  1ELY A;  4IG3 B;  4NEY A;  1PAE X;  3CJR A;  1CJU A;  4PCQ A;  5FJ4 A;  1N88 A;  4QYR A;  2DNP A;  4HTI A;  2BE2 B;  2IMW P;  1FKO B;  3W2V B;  3DHW C;  2ZIT A;  3MMB B;  3NGT A;  4KGM A;  2FHK A;  2MMY A;  1V6H A;  2MQQ A;  4X4U A;  5KG1 A;  2HVH A;  1ALI A;  1RAO A;  2I2Y A;  1RHU B;  5KFM A;  4A8O A;  3V4I A;  2VQR A;  1HWL A;  2MQO A;  1GNK A;  1WSR A;  3G4S S;  3SDE A;  2HEK A;  3BH6 B;  3PZP A;  4RBV A;  4LFB F;  1YLX A;  3MEE A;  4ZIW A;  4RW7 B;  1RHJ B;  3GYN A;  2NR0 A;  3HD2 A;  4GO5 X;  4QWE A;  1B0P A;  3TZX A;  1RZM A;  4FDF A;  5E3C A;  5DO2 A;  1RT1 B;  1SQG A;  3POT B;  1QSS A;  3QGG A;  3VZH A;  1AW0 A;  2AEJ A;  2MQP A;  3W9J A;  4KV8 B;  5HLF B;  1R8H A;  2EBE A;  1NRK A;  1FA0 A;  1YBT A;  4PAB A;  5KFS A;  2QLW A;  1LWE A;  3PKY A;  3E3X A;  5G0R B;  3KK2 B;  1V3S A;  3D5M A;  2RU9 A;  3NBP B;  4DL6 A;  3OVB A;  3BQ0 A;  4JP8 A;  1FJE B;  1ZS6 A;  1K1Q A;  3N0V A;  2VOD A;  1MML A;  4XPE A;  3J7Z 5;  4AL7 A;  5KT3 A;  3BYR A;  3BS9 A;  4ZP8 A;  2QSW A;  2VB6 A;  4RKU C;  2HWT A;  3HI9 A;  2UV8 A;  3ZZP A;  3IMQ J;  1KHW A;  1N33 F;  4I0W A;  2Q1L A;  2YNF A;  1TUV A;  2VFT A;  1VRQ C;  3JQM A;  4B3O A;  4B3R F;  2RUG A;  1UW4 A;  1TK0 A;  2M88 A;  1J5O A;  2HRU A;  4DZ6 A;  1ZM3 A;  2YXL A;  1RBL A;  1RBO B;  3GU0 A;  1APS A;  1T9Y A;  1KOH A;  3BDG B;  2AT1 B;  3KUH A;  3D6F B;  1FF2 A;  1UVJ A;  5GRR A;  2DR7 A;  1H7X A;  3NVL A;  2GCF A;  5C24 A;  3L09 A;  4E0D A;  1RAJ A;  3BQ1 A;  5KFT A;  1F2H A;  1Q0N A;  2VG6 A;  2Z2Z A;  1BD6 A;  4UQG A;  1TTH B;  2QRR A;  2OEK A;  4P73 A;  2J8A A;  1NSK L;  2FHJ A;  3EZ5 A;  4JI4 F;  1NHU A;  4O3Q A;  3M30 A;  2F4V F;  4EMD A;  3IG1 A;  4MHX A;  1RWX B;  3OFG A;  1UJ6 A;  1DFD A;  5FDL A;  3DDI A;  1FTC A;  3SEO A;  4L76 A;  3ILI A;  2Q79 A;  2GVZ B;  4ZCK A;  4L72 B;  1XN9 A;  2G9O A;  4W4M A;  3DLE B;  3ET6 B;  3WC0 A;  4OJH A;  4ZVP B;  3OLA A;  3TJ9 A;  3MCN A;  4FXD A;  2HIQ A;  4LF6 F;  1XBW A;  3BGR B;  4ZG9 A;  3TEH B;  3FGV A;  4W98 A;  4DPO A;  5HL7 Q;  2EVZ A;  2WVE A;  1F60 B;  1M5S A;  2G0C A;  2JVO A;  3ILL A;  5IC6 B;  2WVF A;  1IKV A;  3DDN A;  4HH1 A;  1WC5 A;  3V6D B;  2POK A;  1NB2 A;  3VF0 B;  2ZDO A;  1FRM A;  4ZPC A;  2L3M A;  3FCV A;  3Q2S C;  4JV0 A;  2FD2 A;  2FVR A;  1C1C A;  1KH7 A;  1FRJ A;  5ETM A;  3NCQ A;  4G65 A;  3KYL A;  3I5A A;  1ZTT A;  1HR0 J;  2M5Y A;  3A3N B;  2YNH A;  3I9Z A;  2BJD A;  3P6Y C;  4OJG A;  3UVJ A;  3CCW A;  3TVY A;  4UST A;  4USK A;  2MQL A;  2FJW A;  1P9Y A;  1RT7 A;  5KG5 A;  3GWC A;  1U26 A;  2QT7 A;  4F26 A;  2G4B A;  4IQM A;  3NKY A;  2KFN A;  3NKQ A;  5FII A;  4NLQ A;  1RKI A;  2RQK A;  1FSU A;  4YUD A;  2KM8 B;  4J9L A;  3DLK A;  4RW8 A;  3B6B A;  5G4D A;  4DV0 J;  3EVM A;  4HDG A;  3UCU P;  2H4Y B;  4DV5 J;  4QU7 A;  4DUZ J;  4F02 A;  2GA7 A;  2KFZ A;  2QFI A;  1RWW B;  3L4B C;  4KKO B;  4DV2 J;  4RW4 B;  2JLE A;  5HAT A;  5DJB A;  1LNQ A;  2R7X A;  2AP6 A;  2QLF B;  1X5P A;  2CWX A;  3MAH A;  4C11 B;  3DOK B;  3DRS B;  5A6W A;  2ZJP Q;  4ZVE A;  2IAJ B;  2EKY A;  3V4M A;  4DV4 F;  1Q4R A;  1RCX B;  1F9F A;  1RE1 B;  2AEF A;  4NCB A;  1C4A A;  2HS0 A;  3BO4 A;  1IQT A;  5HP1 A;  4WZM A;  1AYE A;  2CFX A;  2R8G A;  2WBR A;  2Y9H A;  3QYY A;  2OSQ A;  2AX1 A;  4ZLN A;  4QWB A;  4NCA A;  4MKY A;  1S9E A;  1CJK A;  2ZH6 A;  1J5E J;  1NKC A;  1LWF A;  3LP0 A;  2PN6 A;  3G71 S;  3KLF A;  2KU7 A;  2IUC B;  1BQN A;  1EZZ B;  2C3P A;  4GKK J;  4JI7 J;  2W8K A;  3PIO Q;  3B5Q A;  1XEZ A;  2IM2 A;  4TQS A;  1X60 A;  1W2I A;  5J1N A;  4CO2 A;  4K4S A;  2IJF A;  4UY8 T;  3S7R A;  3DLG B;  2W9B B;  4F2S A;  1RT6 A;  2WVD A;  3ZO7 A;  2J9E A;  1X5O A;  3HSD A;  2QJ3 A;  2R9L A;  2PFD A;  1BUX A;  2LDI A;  4AUK A;  2MGZ B;  4KTQ A;  1BLU A;  3CME S;  1C0T B;  2BQ3 A;  4WK1 A;  2FVC A;  1VFJ A;  3RGI A;  1EI6 A;  3THV A;  3AJ1 A;  4KY3 A;  3VAG A;  2H5E A;  5HVG A;  1EB0 A;  4LQ3 A;  4F4Y A;  4AQY J;  2XCP A;  4F8R A;  2FHJ D;  3ZZR A;  2CG4 A;  3LUY A;  5KFR A;  2A10 A;  5C25 A;  2HNY A;  3OXG A;  2KTQ A;  5I3Q A;  4NXM J;  2W1B A;  4YME A;  2CQ2 A;  4X62 J;  3BR9 A;  2E9T A;  4RU2 A;  2E5L J;  1RTJ A;  3TAN A;  1L3U A;  1N2L A;  3LPE A;  5KT4 A;  2CQ4 A;  4F4A A;  4DLG A;  2KT5 A;  3JSM A;  5A8K B;  4ZVT B;  3UNY A;  3E2D A;  3I0R B;  3M8P A;  2DXD A;  2P6T A;  4UT4 A;  1AJB A;  3JQJ A;  2W7P A;  1FRL A;  2UXD F;  2ZM6 J;  2CZ4 A;  4HHH A;  3BDH A;  2OSR A;  2H3E B;  1ZH5 A;  1HI0 P;  1T3O A;  2YNG A;  2DYA A;  1GX5 A;  4A8F A;  1Z1Z A;  3HO1 A;  2R7Q A;  5AE3 A;  2EFG A;  1X9M A;  3AXK A;  4F4X A;  2B7B B;  1U6F A;  3RW7 A;  2UV8 G;  4IUF A;  4LR8 A;  2F9J A;  1NDC A;  5KFP A;  1N5Q A;  8AT1 B;  2WVC A;  3O1L A;  4QIW D;  2IVY A;  2P9G A;  2MST A;  4NA2 A;  1MWY A;  3KJV B;  2RDD A;  3A8J A;  3G8Q A;  2E9Z A;  4K4Y A;  2DNH A;  2HQG A;  1UWA A;  3UDE A;  5M2R A;  3T1H F;  1JLA B;  1UA0 A;  3IC1 A;  1ZPW X;  2ZVI A;  2BAC A;  3H4D A;  3DM2 A;  3GV5 B;  1TUW A;  4ZCM A;  2DGO A;  4JI0 J;  1BE4 A;  3RU0 A;  5HI7 A;  3HLU A;  4RNM A;  2BJE A;  3G8T A;  5F8M A;  2N7C A;  2V8P A;  1QVG R;  1DQ9 A;  3EGW B;  3I4P A;  2MZJ A;  3MK2 A;  4QCL A;  5D4O A;  2B5J B;  4CXK A;  3D3C J;  3DHX A;  1UKU A;  1DLO B;  2QA1 A;  3FVY A;  2HYI B;  3ITH A;  3C16 B;  1FES A;  4K2X A;  4WP8 A;  1JMT A;  2Z2L A;  1FNM A;  4PR6 A;  2N82 B;  4LFC J;  1NJI T;  3PDN A;  4JI5 J;  2HGN A;  2ERR A;  3VWS A;  1Y7P A;  1YJU A;  5IM0 B;  2FYX A;  1RTI A;  2H4W B;  1M1H A;  4AXI A;  3CE8 A;  2GJI A;  1HBN B;  1RI7 A;  2C42 A;  3NXZ A;  1ULR A;  3MGJ A;  3Q8Y A;  4ICL A;  3E01 A;  4PRF A;  1SI9 A;  1T11 A;  1UZH A;  2JLG A;  5DQG A;  1YBU A;  3SFG A;  3NKM A;  1URR A;  1FK9 A;  1FEH A;  5EN1 A;  1TK8 A;  4OYX A;  3J81 Y;  1TMM A;  3TZZ A;  3I31 A;  1M5V C;  3CCE S;  2WSC C;  3P3D A;  4NAS A;  2AZ1 A;  1WC3 A;  3GTY X;  2HZA A;  2JEF A;  1FFG B;  4CLP A;  4F0H A;  3PJW A;  2V6A A;  2GSN A;  2B7C B;  2E7W A;  5A8R B;  1HBU B;  4ZVR B;  2VPW B;  2ROP A;  2BUN A;  1DTT A;  1OQ3 A;  3PW4 A;  2FJB B;  4AND A;  2F63 A;  1HD0 A;  4P6Q A;  2FPH X;  4LF9 J;  2IA6 A;  3QIP A;  2UU9 F;  2JFD A;  1ZEB A;  2AD9 A;  3W2W A;  1WDT A;  5J2Q B;  4OYI A;  4XDC A;  2CDQ A;  5ETO A;  3GJQ B;  1U8S A;  1WEL A;  2HGL A;  4LSN A;  5K4P A;  4FXW A;  4OYP A;  3T5H A;  1S0M A;  1HFE L;  1T02 A;  4PXB A;  4ED1 A;  4KBI A;  3TAR A;  3AT1 B;  1KHL A;  1UVI A;  1RGV A;  1FJG F;  2FZC B;  4M5G A;  3C14 B;  4ECR A;  3O6Q A;  2FGC A;  5IFM A;  2PDA A;  3T41 A;  1WC0 A;  1YK9 A;  2J8S A;  4FF2 A;  3N79 A;  1HNZ J;  1AFJ A;  2KDO A;  3CF5 Q;  4I6W A;  3BSO A;  4CXS A;  3F44 A;  2ZZT A;  3W60 A;  3GIM A;  3MR5 A;  5EGH A;  1TL5 A;  2BKN A;  3NGR A;  1RTH B;  4OYA A;  4BWJ A;  1H2V Z;  2J9C A;  1KDN A;  3G96 A;  2AF6 A;  2KT3 A;  3PVX A;  3HJF A;  4C3M A;  1M90 T;  2EG1 A;  4DX7 A;  1FD8 A;  2ZE2 A;  4Y2K A;  2I5J B;  3BDF A;  2XUL A;  4QIF A;  5EDW A;  3OFH A;  2ZC4 A;  1RXO B;  4OLP A;  4B3S J;  4NI2 B;  5I3U B;  1HLW A;  2MKS A;  2X51 A;  3GPA A;  2J6U A;  1HHT P;  4EU0 A;  1UET A;  2AKW B;  3T01 A;  5CH7 B;  2DGX A;  2VC0 A;  4C0H A;  1S1U A;  4TYB A;  2FLL A;  2D9P A;  2VQE J;  1AFI A;  5M2U A;  1HR0 F;  2OIH A;  1EIY B;  4MY4 A;  5H9E J;  2DIV A;  2ZWO A;  2GAH C;  2HMI A;  5CYQ A;  4A8M P;  4UUW A;  1AJC A;  1SUQ B;  3EGN A;  1CC7 A;  1RB0 A;  1Y00 A;  1Q78 A;  3AA8 A;  3PW2 A;  4WCE Q;  2V34 A;  1ZPV A;  2KL8 A;  2ASL A;  1FWP A;  2CNO B;  4YR0 A;  1RTD A;  4DG1 A;  5RUB A;  1WEY A;  4J9P A;  1FFW B;  3CCL S;  3MEG B;  2GVD A;  4NL5 A;  4DV5 F;  2RHS B;  5B0G A;  1WTB A;  2CNK B;  2P6S A;  5IXU A;  3J7Y I;  2ZWP A;  1QD1 A;  2GIF A;  1I94 J;  3H5U A;  1X4B A;  3S8S A;  2CQC A;  3KOA A;  2AZ3 A;  1E2S P;  4CP5 A;  1D8Z A;  1NU4 A;  4OL8 A;  4O3S A;  3CSK A;  2JHE A;  4ZVU B;  5B0C A;  2LYV A;  3BV8 A;  2QMU B;  4YR2 A;  4M5M A;  1PC5 A;  5LRN A;  4MKV A;  3H98 A;  3VR1 A;  1TL1 A;  2FVS A;  2UXB F;  3K5O A;  1N5T A;  5K9F A;  4P2S A;  2LQB A;  4U8V A;  1J5E F;  1U1P A;  1UEU A;  5AE1 A;  4AE5 A;  4OX6 A;  1S6Q A;  1M5P C;  5KFK A;  5KT5 A;  4ELV A;  1QSL A;  1TL7 A;  1T03 A;  2QZU A;  5HQL A;  1S72 S;  3A8K A;  4WYW A;  2VFV A;  4PUO A;  2ASD A;  1F1B B;  2DT9 A;  3HF5 A;  3R6L B;  9ATC B;  4Q44 A;  5KT6 A;  1NZA A;  1RT2 B;  4G6V B;  1KON A;  3CJ5 A;  3DI6 B;  4KR0 B;  1PYS B;  4Y2I A;  4A8Q A;  2WVB A;  4ZHR A;  2HQI A;  3FCH A;  4OX9 J;  4KPC A;  3ETM A;  4F67 A;  4FF1 A;  2PEH A;  3H2L A;  2NCK L;  2R7U A;  1RA6 A;  1BWV A;  3EUN A;  4C0B A;  4AT1 B;  1Q7Y T;  4IFY A;  3CJK B;  2IIH A;  3UN3 A;  2RHQ B;  4BC9 A;  2PMZ D;  1VGY A;  3VAH A;  2KJV A;  1WOP A;  1N0U A;  1QSY A;  1CUL A;  1FNO A;  2BQU A;  1YRU A;  1TVR A;  1NPR A;  4AQY F;  1D9F A;  2V8H A;  5IQ6 A;  1JLC B;  3GFX A;  4M5L A;  2OPR B;  2YKN A;  3SCJ E;  2V4J A;  3QZ7 A;  5KTQ A;  4DSF A;  5BYS A;  2OEL A;  1QTM A;  4NXM F;  4P2M A;  2OH2 A;  4X62 F;  2VA2 A;  2ZBP A;  2LFV A;  4DX5 A;  1PJ7 A;  2E5L F;  1SHN A;  2BOA A;  1QAY A;  2Z0G A;  3JTN A;  2G9Y A;  1HPZ B;  2GO8 A;  3CCM S;  2ZM6 F;  2RJZ A;  4IFV B;  2QL9 B;  1YJ9 S;  2W7O A;  2DK2 A;  4OV1 A;  4ZPW R;  1B0V A;  2G2O A;  2ALY B;  3J81 j;  2BRL A;  4X64 J;  3K5M A;  3JSY A;  3MDF A;  1JLB B;  4ZLP A;  2J76 E;  2B9X A;  3VAL A;  2GQC A;  4ANC A;  3PX0 A;  5I4M A;  2KFY A;  4ED6 A;  4YB6 A;  3O44 A;  2CQ0 A;  3EMT A;  3DGP A;  4O23 A;  1FRX A;  1JNZ B;  2R8J A;  3KNG A;  1RLC L;  4J37 A;  3M8Q A;  4DN0 A;  5CCL A;  4NXN J;  4IRD A;  5AJ9 A;  2CZ9 A;  2RS8 A;  3RBX A;  4NX9 A;  4C9D A;  2KHD A;  4N47 A;  2NXE A;  2OP5 A;  2YNI B;  4FNH A;  2Z4P A;  2J7K A;  3Q2T C;  2DIT A;  4MKB A;  3UD3 P;  3UDC A;  3DRR B;  3ZNU A;  2GGP B;  5CHC B;  2O5D A;  2HHT A;  1OJ4 A;  3FMW A;  1QUV A;  1SPB P;  1S1T B;  4CZC A;  2N4C A;  3WAV A;  5KFA A;  2DGV A;  3I5C A;  2B6A A;  2H1Y A;  3KLV A;  2ZJQ Q;  3AHP A;  4B9U A;  1X7V A;  1VQY A;  4EZ6 A;  2DNY A;  3TNV A;  3HSG A;  4FBT A;  1HBO B;  5L9N A;  1RJJ A;  3BKU A;  4NCG A;  2W7A A;  3MOJ B;  4LF4 F;  4W90 B;  3EXC X;  1S9G A;  5EWG A;  2M70 A;  1VRU B;  3ZZ0 A;  4LFC F;  3CO9 A;  1VQP S;  5D4P A;  2ACY A;  4JI5 F;  1HNI A;  2M0G B;  4CQ1 A;  2MKK A;  3CNQ P;  1CPZ A;  5IT9 U;  2L9D A;  4JI2 J;  3LF0 A;  2I9S A;  2K06 A;  4G1Q A;  4TN0 A;  2UP1 A;  2UUA F;  3RB6 A;  1RAA B;  5LXY A;  1YTY A;  4KB7 A;  2OLW A;  3CMQ A;  2E7X A;  3TAM B;  1HI8 A;  2JC0 A;  3G82 B;  1UJ4 A;  2CPF A;  3IGN A;  1OS5 A;  4NLY A;  1N2K A;  2F1F A;  5AXN A;  1KWM A;  1VQ5 S;  5B08 A;  4X4T A;  2M8D B;  3LGH A;  3UR0 A;  1DRZ A;  2XSJ B;  1T9V A;  1WI6 A;  1KTV A;  2EC2 A;  2VU5 A;  4PXC A;  1ACM B;  3R2D J;  5E3R A;  4K4X A;  1OSC A;  3QQC D;  5K5M A;  2W2O P;  4TVA B;  4E8U A;  1RAG B;  4YN3 B;  2C3O A;  2JWN A;  4ECT A;  5K8M A;  5IJQ A;  2QO3 A;  4C3L A;  1R0A A;  4OYZ A;  2X98 A;  2RH3 A;  1RWO B;  2X1B A;  4KGV B;  4DV7 J;  4NZ0 A;  2HHH F;  5IZH A;  2LDY A;  3KLG B;  2CA9 A;  3AB2 B;  4LF9 F;  4U95 A;  4PXE A;  3FZB A;  3VGU A;  3BBB A;  2HQC A;  1F9H A;  1OY6 A;  2MDA A;  2VKR A;  4LIR A;  4M63 A;  1W7W A;  1NHK L;  1UTA A;  4OFZ A;  1IJF B;  1N5S A;  1SC1 B;  2C3U A;  1NK6 A;  3MMJ A;  4OZ0 A;  3I87 A;  4WBF A;  3C2P A;  3DMJ A;  3D67 A;  2BE7 D;  1ZA2 B;  2W25 A;  3CCQ S;  7AT1 B;  4CTA B;  2VC1 A;  3NAH A;  3TQ1 A;  4KGZ B;  1HNZ F;  2WK4 A;  3DLH A;  1VOM A;  2YKQ A;  4UTG A;  1SJF A;  2D69 A;  1BGX T;  4NYO A;  3UE2 A;  3IN5 A;  1E6Y B;  5I42 B;  4CWB A;  1R43 A;  2IM0 A;  2FJX A;  4K4Z A;  2HBQ B;  1MW7 A;  2P9C A;  1VQO S;  3GJT B;  3JYT A;  2HFO A;  4ILL A;  4CM2 A;  4GVB B;  2I38 A;  2VIC A;  4N77 A;  1IBC B;  3D0I E;  1K9M T;  1HNV B;  1BQM B;  2DNR A;  2YWG A;  2VIH A;  4TNO A;  2LVW A;  3T9N A;  1F0X A;  1ITP A;  2D1G A;  3TAP A;  1I5O B;  1V9O A;  3ILO A;  2VQE F;  4Y2C A;  4AFF A;  3PJX A;  2LQ5 A;  3SSQ A;  1D9D A;  2CPZ A;  2GO9 A;  1HYS B;  4YY3 J;  1LOU A;  4B9N A;  1E6V A;  2AQ4 A;  4HI1 A;  4LFA F;  4UOF A;  2XMJ A;  1X8D A;  2A6M A;  3IS9 A;  3LGM A;  2HZV A;  2R2U A;  2ZD1 B;  3H5Y A;  4YEA A;  1EW8 A;  4J9M A;  1JLG B;  4Q0B A;  2WON A;  3BDE A;  1IKY B;  3MZI A;  2FJD B;  3MK1 A;  4LSZ B;  2VHG A;  2AW0 A;  3NNC A;  2AGO A;  1C0U A;  1Q7L B;  1KTQ A;  3ENV A;  2J0W A;  3LP2 B;  1AZS B;  1DTQ A;  2FHM A;  3US5 A;  2HHW A;  4ZVS B;  1CJV B;  1ZZN A;  2A6O A;  4UOP A;  3MOZ A;  1C4C A;  3EWG A;  3FFI B;  2KT2 A;  4WTY A;  4XTT A;  1U0S A;  4HEA 9;  5HRO B;  2Y1I A;  3F41 A;  4RO0 A;  1KLM A;  1IWA A;  1TKX B;  3H20 A;  4UPK A;  3KHG A;  4DL0 C;  2NLW A;  4HH0 A;  2V50 A;  4P7V A;  1UVM A;  3T5J A;  4UOH A;  1SXL A;  1RU1 A;  4XDD A;  4DCO B;  5EHH A;  3IBW A;  5KFH A;  4I4B A;  1UPM B;  3J7A 1;  3WAX A;  2VDI A;  1RAF B;  4WTO B;  2ZH4 A;  1O6X A;  4C4W A;  1Z2Z A;  3PYD A;  2X3D A;  1WD6 A;  2NXU A;  4UY8 5;  1RAH B;  4PG5 A;  2RDJ A;  3L7O A;  1TV6 B;  2YX4 A;  4C8L A;  4QR0 A;  2MZT A;  5F8I A;  5GAE I;  2DH9 A;  4TY8 A;  1FFS B;  1SKS A;  3OL6 A;  5JXS A;  2PE8 A;  4YB5 A;  4ZVH A;  4UPI A;  5EGY A;  1VS3 A;  1JB0 C;  1JLE A;  1GXU A;  2XGQ A;  1FO1 A;  1X31 C;  1TKD A;  4DUT A;  1U6B A;  3KHR A;  1FKA F;  1V3R A;  4GVL A;  3T9Z A;  3QAU A;  3FJ2 A;  3LQV A;  2JRS A;  4UPL A;  2RAQ A;  2MZS A;  1RWM B;  4KH1 B;  3IWN C;  3SV4 A;  4LVN P;  7FD1 A;  2ADC A;  1D1U A;  4J9Q A;  2KM8 C;  1VIX A;  1X9S A;  4OLO A;  3Q83 A;  2Q6C A;  5KFX A;  2E5I A;  2C2D A;  4R0E A;  1N48 A;  4RW9 B;  4ZJL A;  3C15 A;  4QR1 A;  4KC5 A;  1L5U A;  1TAQ A;  2M3D A;  4QYZ J;  3NWR A;  3DGV A;  1TKZ A;  4JYA J;  1HWU A;  5DQH A;  2RRA A;  4B9L A;  2E1M C;  3BEG B;  4ETZ A;  4ZKA A;  3W66 A;  1U0H B;  2B43 A;  5ETR A;  1W25 A;  2GML A;  2ZHB A;  3VAJ A;  2QIF A;  3IR7 B;  4DQS A;  5LSL A;  4PQU B;  3MF5 A;  2HHV A;  4OJ1 A;  2MQM A;  4M5N A;  1JWW A;  1T95 A;  4YHH J;  2EK1 A;  3F0N A;  3FNN A;  2UZA A;  1R27 B;  4DL7 A;  1VK3 A;  2HWH A;  4H4M B;  1D8Y A;  3RYL A;  3OXF A;  1U4B A;  3OHA A;  2MLZ A;  4ZLL A;  1RT3 B;  3MED B;  3FKB A;  4MKA A;  2CPJ A;  5DM7 Q;  1I1G A;  2IHR 1;  2RF2 A;  4X64 F;  3IAS 9;  4TXS A;  4KT0 C;  3K17 A;  4IO1 A;  2K1R A;  1BY9 A;  2UUC J;  1NXI A;  2JH3 A;  3OTD A;  4NML A;  1WEZ A;  2IA0 A;  3KK1 A;  1OYD A;  5ETP A;  3X1L B;  5I3P A;  5LOQ A;  1SC6 A;  4BHQ A;  1O5J A;  5IQQ A;  3OLB A;  4ED5 A;  3FMB A;  3K89 A;  4DR1 J;  4DU7 A;  3EDR B;  2V2K A;  2UVR A;  2OPP A;  2DR8 A;  2HFU A;  4RW7 A;  1E3C P;  4YDX A;  4KHR A;  2CJQ A;  1IM6 A;  2DNO A;  1B8J A;  1DUR A;  4ITS A;  4D3H A;  1GMV A;  4RBT A;  4DPU A;  4J7C A;  1FI4 A;  1N32 J;  1X4H A;  2B0G A;  4KJD A;  3R7S B;  2OMO A;  2BKP A;  1XR6 A;  1ZET A;  2OPS A;  2XZD B;  3V4I B;  1KVK A;  2JC1 A;  3T1Y J;  1DZ5 A;  5HMW A;  5G0R A;  4K4W A;  1HIY A;  3K5L A;  1OQ6 A;  1YJR A;  2BM0 A;  3K7R A;  4QIE A;  3MEE B;  4LF5 J;  2UUW A;  2IRU A;  1U48 A;  4FKY A;  1NBE B;  3G6X A;  2YWF A;  4DR2 F;  4WFN Q;  1SVD A;  2HS4 A;  1X5T A;  4OHX A;  3NNA A;  5L1K A;  5C2G A;  2ZHO A;  3MPV A;  1EKS A;  3MM8 A;  3KHH A;  3AB4 B;  3OTE A;  1P1L A;  4JI2 F;  1B4S A;  4WP9 A;  3AH6 A;  1SJ1 A;  1LWE B;  5B0E A;  1SCJ B;  1ZAV A;  3H8Y A;  3OTO J;  3CCR S;  4QR2 A;  1NK8 A;  3H4B A;  4RW6 B;  3SIP B;  1LXJ A;  2R7V A;  3WIU A;  1F2G A;  1XJW B;  4F2R A;  5DS7 A;  4GC6 A;  2GIQ A;  4QU6 A;  1NME B;  4DR5 J;  3AJD A;  4DV3 J;  4CNY A;  2IVM A;  4KAV A;  1YBA A;  4U7C A;  3HM9 A;  1NSA A;  2YNF B;  4LMZ A;  1JJ2 R;  1AUS L;  3EPI A;  4B3O B;  3LP1 B;  3CD6 S;  2W2M P;  4DV7 F;  3J80 Y;  4I69 A;  4DCP B;  4RLE A;  4KQZ A;  5C24 B;  5HSP A;  4ZPA A;  3KLH A;  2RKI A;  2VG6 B;  5HN0 A;  4URQ U;  4ENO A;  2AHO B;  4A8Y A;  2HBZ B;  4HHU A;  1KH5 A;  4EZ9 A;  1B3T A;  1HNX F;  3M30 B;  4RUH A;  3IG1 B;  1RHM B;  4TKT A;  5HVF A;  5AJ3 F;  2YBV A;  5FDL B;  3HHL A;  2F8M A;  3UW1 A;  4I67 A;  3MTJ A;  2E29 A;  1F5B A;  3A8E A;  1LKZ A;  3IP0 A;  3SCK E;  3RUB L;  2WOM A;  4O3R A;  3P8B B;  1U1R A;  1CJT A;  2GMH A;  3D1O A;  2XMK A;  3G6Y A;  1QLN A;  3N9U C;  3R8Y A;  4F50 A;  4FYY B;  4LRA A;  2HRT A;  3HVT A;  2DO0 A;  1VIS A;  2QX0 A;  3MM7 A;  4N5S A;  4F4W A;  5C7P A;  3D6H B;  3EGV A;  1IKV B;  4U96 A;  3TYT A;  5E33 A;  5MLC V;  2GNK A;  3M1V A;  4MMO A;  1I3O B;  3ED4 A;  2VG5 A;  1C1C B;  4KPY A;  3H42 A;  2G1D A;  3CJT A;  3EVO A;  1CQN A;  2PMW A;  3PYE A;  2YNH B;  1N33 J;  1S6P A;  3VTI A;  4YY3 F;  2CNL B;  3ISN D;  3RR7 A;  5GME A;  3UVJ B;  3CC4 S;  5GMD A;  4B3R J;  5GAE U;  1ZAX A;  5DLV A;  3K2Y A;  2ZKU A;  3UWT A;  3AFG A;  1RT7 B;  4RU9 A;  2E44 A;  3QT6 A;  3ZZT A;  2FJE B;  1DBD A;  2O67 A;  2W24 A;  4JBC A;  4MYU A;  4ECZ A;  2FVP A;  3GON A;  4P9S A;  3PXG a;  4ANE A;  3DLK B;  4RW8 B;  4P72 A;  3R27 A;  3CMA S;  4HVZ A;  2GX8 A;  4J9O A;  1B99 A;  1UVL A;  4QIG A;  2C2E A;  4ZCI A;  2CYY A;  2O66 A;  1VBX A;  2VPX B;  3Q8U A;  1KNZ A;  2AYM A;  3QID A;  1H7W A;  5IC4 B;  3MAA A;  2F4V J;  4ID5 A;  2X7I A;  1RYR A;  5ETL A;  1YDL A;  1NDL A;  4USJ C;  2C28 A;  2AGP A;  1U02 A;  2FHO B;  2IDE A;  4FKX A;  3M6V A;  1FJ7 A;  4BBY A;  2IJN A;  2YPY A;  1QAJ A;  4PWU A;  4F36 A;  5EX0 A;  3CT9 A;  4TN2 A;  3D6M B;  2G2Z A;  1WI8 A;  5A2Q U;  1WKK A;  2Q3P A;  1SJR A;  1XK8 A;  3PG9 A;  4EO8 A;  2V8V A;  1WEX A;  2BBE A;  5BXI A;  5L1J A;  4UF4 A;  3QPI A;  2XY5 A;  5JVG Q;  1NCL A;  2A18 A;  2EFO A;  4RNN A;  5HP1 B;  2KJW A;  3HDS A;  2AJ4 A;  1MN9 A;  4M5D A;  1ICE B;  4CYS A;  1U09 A;  5L1I A;  4FP9 A;  3PRD A;  5E3Q A;  3H40 A;  1S9E B;  2R8K A;  1CJK B;  4L73 A;  5DZ6 A;  2VFS A;  3BR8 A;  2D3O R;  1TEL A;  4X4Q A;  4LF7 J;  1LWF B;  4KGK A;  3NOC A;  3KLF B;  1BQN B;  3KG1 A;  2CJA A;  3IO1 A;  4ZDN A;  3HVW A;  4LBP A;  2IY5 B;  3NGU A;  4WII A;  1RT6 B;  3GSI A;  4ED0 A;  3GMG A;  5KFY A;  3EZO A;  2HQF A;  1RAI B;  1S5Z A;  2AWZ A;  5KFC A;  4KE5 A;  4JI6 J;  4ELU A;  1N5V A;  2X1F A;  1G2E A;  3M2U A;  3V81 A;  3GJS B;  2E1R A;  3LWL A;  1ZYQ A;  1KSP A;  3CVK A;  4X4S A;  3I55 S;  1VQS A;  5J1E A;  1BQX A;  4JYA F;  1Y5L B;  3DLL Q;  5C25 B;  2HLT A;  5J2M A;  2MY8 A;  2HNY B;  4LVO P;  1YZ6 A;  3C66 A;  3BSC A;  3LTO A;  4S0M A;  2GMJ A;  2V4Q A;  3HHL D;  3OBI A;  1T94 A;  4M94 A;  1FX4 A;  3R2C J;  3AOD A;  2BYC A;  3BJY A;  1S57 A;  1RTJ B;  3MM5 A;  2VFU A;  2JEJ A;  4EEY A;  1XMQ F;  4DS4 A;  4M5K A;  2PT0 A;  4ATN A;  3JSM B;  3CIM A;  1KQF B;  3PKM A;  4TQR A;  4LF8 F;  3M8P B;  2W5T A;  4IOC Q;  5F0W A;  3M4X A;  2EBG A;  2CUY A;  1LFP A;  1EW9 A;  1NK7 A;  3ZFV A;  4FYW B;  3C6T A;  3FBE A;  2GIR A;  1VHI A;  2YNG B;  2KXN B;  1U1N A;  4Q2M A;  2ZNY A;  4HAC A;  1VQ7 S;  2DEJ A;  2WBM A;  2L41 A;  2Y8W A;  3W9H A;  1ELX A;  5F9N A;  3I96 A;  2ZBC A;  3ISN C;  4QW9 A;  4R5P A;  4DPX A;  3AOB A;  1GAO A;  3T00 A;  3KWM A;  1ZBT A;  3ZTP A;  1HQ2 A;  1JIH A;  2YQ3 A;  1LW0 A;  4P2F A;  1D0E A;  2H54 B;  3QGI A;  2CIM A;  5IT4 A;  3CJQ A;  1WG4 A;  3V6J A;  1EJJ A;  1Y5N B;  4ZP7 A;  4ZLJ A;  4DR1 F;  3AQO A;  3OJU A;  4KM4 A;  1EHW A;  3M9O B;  3MM6 A;  4DL2 A;  3FSY A;  5L0K A;  1ZM4 A;  2G1H A;  3HJV A;  2DNN A;  1UEK A;  3PRV A;  1L3T A;  4GRS A;  2XMV A;  2DHA A;  3DM2 B;  2DHS A;  3A1Y G;  2ILZ A;  4GKJ J;  2RRB A;  5AXK A;  1UCN A;  4OYM A;  2EPI A;  3FBB A;  4GO7 X;  5T14 A;  3PIP Q;  3O8W A;  1K44 A;  4FBU A;  3T1Y F;  1FE0 A;  1YSJ A;  4ECU A;  3J7A N;  3OFF A;  3PO5 A;  3CD7 A;  5CA5 A;  1OY9 A;  5KG2 A;  5DDO C;  4LF5 F;  4A8K A;  3OJS A;  4BCA A;  3W1Y C;  4ZP9 A;  3MM9 A;  3SMZ A;  3ITH B;  4YQW A;  4HTJ A;  2RRN A;  3BBF A;  2C3M A;  1LEO A;  1RK8 A;  3UQS A;  1RAD B;  2IYI A;  4FYV B;  4G1P A;  3MTK A;  2HFS A;  2C2R A;  5LQQ A;  1TKT A;  3HD1 A;  1NB7 A;  2CQI A;  3LPY A;  1RDR A;  1RTI B;  4URS A;  5D8H B;  5F0U A;  2XTJ P;  2CRL A;  2RS2 A;  4ICL B;  3E01 B;  4RBU A;  2CJY B;  3OTO F;  2AJ2 A;  3OUY A;  4P7T A;  3HZE A;  5D6G A;  1NPK A;  1S1V A;  2XY7 A;  2YY3 A;  4ALZ A;  4HR2 A;  3GFZ A;  4H4K A;  2YKP A;  3Q86 A;  3VQT A;  4Y65 A;  3CUL A;  1RHQ B;  3Q24 A;  4KRW A;  3HVA A;  1U8W A;  4QIV A;  3B4D A;  4DV3 F;  3PX6 A;  3TJ8 A;  2FY8 A;  2O3D A;  3MEC A;  4WE1 A;  3J81 U;  2DGW A;  2VBX A;  4X4O A;  3WQP A;  4KHM A;  2WSE C;  1Q5Y A;  4ETX A;  3GV8 B;  2DJW A;  3WBH A;  1NDP A;  3M9M B;  3T1H J;  1FXR A;  4K2J A;  3MI7 X;  3QIP B;  5LMU F;  2H9Z A;  3ZC4 A;  4V19 J;  3RG6 A;  3W2W B;  1SKR A;  1KVI A;  3BGL A;  4CO1 A;  3D4J A;  3RAM A;  4LSN B;  3HMJ G;  1ED9 A;  4YP3 A;  1SHQ A;  1CSJ A;  2DNG A;  3ZTQ A;  1VDH A;  3HHL C;  5KT2 A;  4RL1 A;  3M8S A;  4LBI A;  3PEH A;  3R3T A;  1XIQ A;  1IKX A;  4NA1 A;  1HWI A;  4CYU A;  3SZY A;  3C6U A;  4L74 A;  2E7V A;  1VK8 A;  3X3U A;  3SSS A;  5HAN A;  9RUB A;  1VMB A;  2DKO B;  2W5R A;  3D1H A;  1VBZ A;  3WAW A;  2MPU A;  3OVS A;  3GV7 B;  3G8S A;  4LR7 A;  5CXT A;  3UD5 A;  3AJ2 A;  1FER A;  3G6V A;  5KG6 A;  3PCO B;  2BJ1 A;  3QRQ A;  2A2D A;  2ZE2 B;  1HNW J;  3FRY A;  4ES1 A;  1HQU A;  2XS7 A;  3TOQ A;  1RWK B;  4K4T A;  1E33 P;  2NUH A;  1QAX A;  1P6T A;  2N7Y A;  2KRB A;  3DOL A;  2QMW A;  1Y11 A;  1S1U B;  3AAW B;  1X4C A;  3BKT A;  3IBC B;  2JZ5 A;  4WXO A;  4O3O A;  4OYO A;  2RE1 A;  2ZH1 A;  3R1H A;  1ROF A;  5DZ7 A;  3ZZZ A;  2V68 A;  1KHK A;  2HMI B;  1DAX A;  2EXU A;  5CYQ B;  3BDP A;  4K5R A;  1DJ0 A;  5KFI A;  3NS5 A;  4HKQ A;  4A4J A;  5CYM A;  2UU9 J;  3MPU B;  3D0H E;  1RTD B;  4DG1 B;  4ZPT R;  3PO4 A;  3HT3 A;  3JSB A;  3CDU A;  3CGI A;  2GVD B;  2JEG A;  4C97 A;  3PW0 A;  2WHO A;  2XZW A;  4K5S A;  1MLA A;  4QPX A;  4U7U D;  1SQF A;  1X9W A;  5KG7 A;  4FYX B;  1FJG J;  5KFG A;  3RAQ A;  2WTF A;  4YB1 P;  1XMB A;  1E1Z P;  2MYF A;  2XHW A;  3N28 A;  2RU3 A;  4OZ3 A;  2CDR B;  4ZCL A;  1MWZ A;  5T41 A;  4N56 A;  2ZUG A;  4NWX A;  4FDI A;  2OTL S;  2HSE B;  3K8V A;  1GXL A;  4R25 A;  3JS9 A;  4URG A;  3R5B A;  3D68 A;  3VAF A;  4CH0 S;  3DI6 A;  1AT1 B;  1NDK A;  3BM7 A;  2J7U A;  1NK0 A;  1YJW S;  2OFG X;  3QMQ A;  4CT8 A;  4LF7 F;  1S6Q B;  4USW A;  1TL7 B;  1T03 B;  4PUO B;  3TA2 A;  3EXY A;  3KDO A;  4FYD A;  4ZHR B;  1AJD A;  1S0O A;  2P2C B;  1YJN S;  3IXQ A;  3AXM A;  3HVR A;  4AYB D;  1D3W A;  4EI2 A;  1NLK L;  2E5G A;  1VLY A;  4JI6 F;  2MLX A;  3CJ4 A;  1EAR A;  1R8C A;  4NLS A;  4NLO A;  4IFY B;  1DAR A;  1LWC A;  4PPD A;  1JJC B;  2CJ9 A;  4V19 X;  5D3G A;  1ALK A;  1B64 A;  3UCG A;  3EDQ B;  5KXA A;  4NLU A;  5D15 A;  5HVH A;  3GIL A;  5A0Y B;  1TVR B;  1Q79 A;  3DRY A;  2QL7 B;  3U1N A;  1JKH A;  4F0K A;  2HVI A;  4YFU A;  4DUY F;  5KG0 A;  2YKN B;  5E7O B;  4N8O A;  2V4J B;  5A2Q Y;  4JV5 F;  4OHV A;  2DGS A;  1JNR B;  1S1W A;  4F0M A;  1R0C B;  3R97 A;  3IDD A;  3PY8 A;  1IBL J;  3D54 A;  3RBZ A;  3OL9 A;  3AY0 A;  3R7N B;  3GLJ A;  4O4R A;  3CD5 A;  4RUC A;  3V2U C;  1U1K A;  4O3P A;  2G13 A;  4NPO A;  2E1C A;  3R5J B;  4EBD A;  2MY7 A;  4MTP A;  2CKW A;  5KG4 A;  3EPG A;  2BW7 A;  3CXC R;  1IBM J;  4OI2 A;  4DBQ A;  1MSW D;  1L3S A;  1WKL A;  1H2U X;  2XMM A;  1X5S A;  2B8Q A;  2K3I A;  1WOO A;  1S76 D;  2DBB A;  3CDW A;  4J9U E;  3TUP A;  2CXE A;  5HMX A;  4IO9 Q;  4CT9 A;  2UXB J;  3WIV A;  5LL6 d;  4OI4 A;  1IM4 A;  1NK9 A;  5GAH I;  4ECY A;  4KHP J;  4EBC A;  4DR4 F;  1U24 A;  5IV4 A;  2HG4 A;  3DGP B;  4U9R A;  1WAC A;  4KGX B;  1Q8K A;  4PG4 A;  3LAK A;  1P9Q C;  3M8Q B;  1M1K T;  3QAT A;  5IT0 A;  2NUU G;  3IM8 A;  4KFB A;  1UFK A;  2OEM A;  2R7T A;  1G3O A;  4C0O C;  2YQ1 A;  3NGS A;  2XMA A;  1JLF A;  2H5I B;  4FZV A;  3HX9 A;  1P49 A;  2R8H A;  2OTJ S;  4DFJ A;  2VOP A;  5IOL A;  5F3Z A;  1ZZF A;  4W92 B;  3NL0 A;  4O4G A;  4JV2 A;  4UOC A;  3KLE A;  1JXL A;  1FRH A;  4KH0 B;  2W5S A;  4GKJ F;  1Y4Z B;  1R6V A;  1T9W A;  1MRO A;  3W3S A;  2VQF F;  2B6A B;  4I64 A;  3AQP A;  2ZJR Q;  2FZG B;  1PAU B;  4MYT A;  4RR5 A;  1DQ8 A;  3OL8 A;  2EFN A;  4LJM A;  1HBM A;  4CNZ A;  4A8W A;  2FJA B;  2Y1J A;  1KFS A;  3P5B P;  4JB8 B;  4CLZ A;  2ZDP A;  2LLZ A;  2XLK A;  3TJA A;  3B54 A;  4P2X A;  3TEG A;  4NCG B;  2D3O 1;  3DYC A;  1UFL A;  2DCU B;  5KFU A;  1TP7 A;  2XSJ A;  2XRG A;  4QOT A;  3I56 S;  4K0K F;  4PZV A;  4M5H A;  2CG8 A;  1DHM A;  1HNI B;  4FDJ A;  2XEX A;  3BH7 B;  1V5I B;  4MAK A;  3EE3 A;  1TAU A;  1OMS A;  2XNQ A;  2YWW A;  4Q2L A;  1Q95 G;  1RA7 A;  4G1Q B;  1QE1 A;  1GFW B;  4WFA Q;  3P96 A;  4TLR A;  1QJH A;  2K2P A;  3DRP A;  1P27 B;  3MPW A;  4H4K C;  3KG4 A;  4PG8 A;  4IRK A;  3OW2 R;  1HHQ A;  2D3U A;  4CH7 A;  1N5Y A;  3IGZ B;  1B7Y B;  2N4D A;  4ZG6 A;  3HHN B;  1FKP A;  1SH0 A;  1KHJ A;  1Z4U A;  1ZM2 A;  5IWA J;  4DL5 A;  1RLD A;  3FEX B;  1HW8 A;  1RHR B;  4ZJQ A;  2DB1 A;  2FY1 A;  5A6P A;  1RP5 A;  3DOM A;  5KFW A;  1HD1 A;  3KFW X;  2DNZ A;  4IRC A;  1R31 A;  2MZQ A;  4GC7 A;  5F8L A;  2CJB A;  4PYD A;  5DDR C;  4IKA A;  2RML A;  1M1G A;  4JI1 F;  4ZMM A;  1R0A B;  1Y6V A;  3D2W A;  2AX0 A;  3DC2 A;  4FVM A;  1X4D A;  1KH9 A;  3DLJ A;  3ZTO A;  4CTA A;  3WZ0 A;  1PBA A;  4I2Q B;  1SIW B;  1N34 J;  1S48 A;  3M2R A;  4NLV A;  1KQK A;  5KFE A;  1WKJ A;  3VVT A;  1O98 A;  2QN6 B;  2JDJ A;  1RUS A;  3W61 A;  3KHL A;  2DR6 A;  2DIS A;  3M05 A;  3IR6 B;  3NS6 A;  5I42 A;  1SJ4 P;  2BAB A;  4B3M J;  2DGT A;  4ED7 A;  3M6W A;  2AYE A;  3K8W A;  1Y5I B;  1U2R A;  3KMS A;  2Y3Y A;  1TU0 B;  2BV3 A;  3DMJ B;  1YJT A;  3TX8 A;  5L0B A;  1WUU A;  4Z2X A;  1KOO A;  1M5K C;  2GS8 A;  3DN9 A;  3TR5 A;  4LF4 J;  2D3Z A;  3FEY B;  5H9E K;  1GMU A;  4QAX A;  4FS2 A;  5FLX Y;  1K8A T;  3MCS A;  3G87 A;  5CZX A;  3EYZ A;  1KKH A;  4OYW A;  1FHT A;  1RWU A;  4HT5 A;  1OPZ A;  4USH A;  3JYT B;  2UUA J;  1HNW F;  1JK9 B;  3CCZ A;  1FNX H;  1RT4 A;  5KFQ A;  1AB8 A;  4K7Q A;  5EWF A;  1UZD A;  4IG0 A;  1YI2 S;  3H59 A;  3FCW A;  4YDD B;  2GSU A;  4GTW A;  2DO4 A;  3RRK A;  1M5H A;  1OWX A;  2HHQ A;  2XS2 A;  2ALZ A;  4OI0 A;  2QV6 A;  2DHG A;  1OPI A;  2XZT B;  1FDN A;  1WJ9 A;  1E6V B;  2DHH A;  1S77 D;  4IH5 A;  5KT7 A;  3IS9 B;  4GTY A;  2VBY A;  5MAO A;  5B0D A;  3VVU A;  1UVN A;  2HHU A;  5HJY A;  3I9V 9;  2JJ4 D;  2HHH J;  1V5V A;  2MQN A;  3CTR A;  3TA0 A;  4C7Q A;  1GEH A;  1LK5 A;  2AV5 A;  4Q0B B;  2W8D A;  2WON B;  3HFK A;  1G6B A;  1KVJ A;  3M8Z A;  3GR0 A;  3OR1 A;  4ERD A;  1C0U B;  1VQ8 S;  5LXR A;  2VUG A;  1KR4 A;  5EGE A;  1N6Q B;  1OIA A;  1DTQ B;  4DV1 J;  3HPO A;  8ATC B;  2AMC B;  4FXV A;  1SL0 A;  4L3K A;  4NLD A;  3K58 A;  3HFZ B;  1BWE A;  2A1B A;  3NEK A;  1Y3K A;  3EM1 A;  1VQN S;  2B9Y A;  2ZKT A;  1KLM B;  4ZIT A;  4MK7 A;  1H3D A;  4YR1 A;  2VON A;  4NWB A;  2FLP A;  2HAI A;  4Y2A A;  2HHX A;  4ILR A;  1TFY A;  5HMZ A;  4I56 A;  6FDR A;  1PYT A;  1U1O A;  1HQE A;  3UO0 A;  3D7S B;  1T0T V;  1RHK B;  3OT9 A;  1FDA A;  2F8H A;  2H65 B;  4CCH A;  3RTV A;  1C1B A;  4R8U A;  3D9B A;  2KG0 A;  3DLB A;  1G4C A;  1PO6 A;  3FSI A;  1WWH A;  5L8R C;  3EGZ A;  3P49 B;  4NRT A;  3QWP A;  1IJE B;  3WX4 A;  5K20 B;  1O51 A;  5DGB A;  4TY8 B;  2H5J B;  2JX2 A;  4LSL A;  5LSR A;  1VRT A;  5SUH A;  3H25 A;  1U47 A;  3FC9 A;  2LQJ A;  5IV3 A;  3GYX B;  5KFD A;  1REG X;  4F3O A;  1JLE B;  3B4M A;  1NO8 A;  3F73 A;  1XQI A;  3CMR A;  2WB1 D;  4WFB Q;  2XCA A;  2KI2 A;  4WFY A;  2RSQ A;  5D4L A;  2XYH B;  2KYX A;  2GJ2 A;  1PGZ A;  4OI6 A;  1ZOT A;  4LFA J;  1HQA A;  3LXQ A;  4KAI A;  4Q5V A;  3HFV A;  1B70 B;  2C2Z B;  2K3K A;  1K1S A;  4JOU A;  4PWD A;  2M7S A;  4QW8 A;  5GAH U;  4B9T A;  2VG7 A;  5T7L A;  3I32 A;  3L95 X;  3I82 A;  2GV1 A;  3SQG A;  3MXH P;  3D3B J;  5FD1 A;  3UR3 C;  5H9F K;  4ZOS A;  4YB7 A;  2V9W A;  3DNC A;  4ZVG A;  1KFD A;  4H54 A;  3SI8 A;  1VQK S;  3C15 B;  3BN4 A;  3OV7 A;  1VHF A;  1VBY A;  4LRC A;  4O0N A;  1Y9O A;  1TKZ B;  1RT5 A;  2P9E A;  5C42 A;  4F3M A;  3NMR A;  1CQM A;  1GXT A;  3AD8 C;  4FPR A;  4DQI A;  3QJP A;  3MHY A;  2VA3 A;  4PG7 A;  3M2V A;  2XB2 D;  2CPY A;  3DRX A;  3MFH A;  3JQK A;  4RNF A;  3K57 A;  4OQJ A;  2BVZ A;  1WDD A;  3VAI A;  5C2C A;  3NGD A;  3NG8 A;  1IBL F;  4XAK A;  2ILY A;  4CXU A;  1H74 A;  2Z30 B;  3WC2 A;  2MLY A;  4DXL A;  1S99 A;  4RNH A;  4RJV A;  2D9O A;  1EW2 A;  2DGQ A;  2RQ4 A;  3MFI A;  4WFX A;  2W5X A;  1A0O B;  4MIB A;  4MIW A;  1IBM F;  3I0S B;  3TG0 A;  2YPZ A;  4WP3 A;  4QZV B;  4YS2 A;  2RT3 A;  2RF2 B;  1UEV A;  3MR7 A;  2OPQ A;  3W8G A;  4KHP F;  1XC9 A;  2K1R B;  2BJ7 A;  3GQC A;  3BKF A;  1GTE A;  2LCW A;  1AA1 B;  4ER8 A;  2IRX A;  2G0J A;  1CS4 A;  2VF3 A;  1MU2 A;  2ZOM A;  4CM0 A;  3KK1 B;  1CVJ A;  3P5T L;  2ZBR A;  2BMB A;  4LF1 A;  1UPP A;  4YR3 A;  1VQL S;  3HKW A;  3G2X A;  2DRA A;  1SC3 B;  3IA0 A;  1KH4 A;  4OI1 A;  2GQQ A;  2Y1L B;  2MHN A;  3TUI C;  2QLJ B;  2UVW A;  3VAK A;  2B9W A;  2CQB A;  2MZR A;  2OPP B;  2MHE A;  2GHW A;  1N0V C;  3NOG A;  1U49 A;  2DD8 S;  3LW5 C;  3IGV A;  4U7U K;  5ETN A;  1RYS A;  2R7O A;  4NLP A;  4X65 J;  2IC3 A;  2BAN A;  2LXI A;  3UD4 P;  1R89 A;  1YKW A;  2LQ9 A;  2V2V A;  2CPD A;  2OPS B;  2GFF A;  2ROG A;  4IOA Q;  1JXE A;  1H98 A;  3VAM A;  2QSF A;  1A7G E;  3V5R A;  1YWX A;  2E1A A;  3DXB A;  5L9X A;  1KQG B;  5C66 A;  3ILJ A;  2UVU A;  4RW6 A;  1R8A A;  2P8I A;  4Q45 A;  3H90 A;  3IRW P;  1NM2 A;  1RKJ A;  1FCA A;  3MM8 B;  1P1T A;  4ZPD A;  3VGS A;  1T9U A;  5K14 A;  2PD1 A;  4KYZ A;  4G1I A;  2RQC A;  3VCD A;  4DF4 A;  3UDV A;  2QZ8 A;  3A3O B;  3LP1 A;  1EQM A;  5DM6 Q;  4DQQ A;  4M8L A;  2J0X A;  5IS2 A;  5HK4 A;  4H4O A;  2KYZ A;  4ED3 A;  2ATC B;  1PCA A;  4EWT A;  5IWA F;  4HYK A;  1NJW A;  2BDP A;  1WF2 A;  1MG7 A;  5E3P A;  2DH7 A;  2XI3 A;  1Q8I A;  3Q0A A;  4DOZ A;  1WOS A;  1YGY A;  2OGU A;  4DPY A;  1JJ4 A;  3QT5 A;  2FB0 A;  4NLT A;  1WSV A;  2WSF C;  3QO9 A;  1S7H A;  5J2P A;  2PII A;  4MFB A;  1QVF R;  1N34 F;  1SH3 A;  2CJK A;  4CDI A;  2C2M B;  1REV A;  4Y3C A;  3KLH B;  2RKI B;  2YX1 A;  1ANI A;  3LA0 A;  3GB0 A;  3RB3 A;  2M9K A;  3I4H X;  3J80 U;  2K8G A;  4B3M F;  2M2B A;  2VAS A;  1HMV A;  4CO5 A;  2HHS A;  2VFR A;  3CD0 A;  3QLH A;  3NRB A;  4Q43 A;  1VQ9 S;  2VPY B;  2NYI A;  1EET A;  2JEI A;  3HHL B;  2YKM A;  2ZH7 A;  5A8W A;  5KFJ A;  1D09 B;  3O2I A;  3M8W A;  2BQR A;  4BC7 A;  4DR2 J;  2QTW A;  1M0S A;  3ENQ A;  2WOM B;  5E2Q A;  2CQD A;  4IYQ A;  1CJT B;  5CAA A;  3PHE A;  4ELT A;  3DKD A;  3CW2 C;  1ANJ A;  1HI1 A;  3M32 A;  3HVT B;  1S1X A;  4KO0 A;  4B3T F;  1MN7 A;  4OX8 A;  2Q66 A;  2PSZ A;  3MM7 B;  1K47 A;  2C2N A;  3KJF B;  4WK3 A;  1LQ9 A;  2FDN A;  5M2P A;  4DPT A;  3RB0 A;  4DSJ A;  3QT7 A;  2LXU A;  3D0G E;  4IH6 A;  1SJQ A;  2LU2 A;  3M1V B;  3TX0 A;  1XTZ A;  2HVD A;  2VG5 B;  2V4R A;  5HQM A;  4M5I A;  1URN A;  2DNM A;  4I7F A;  5KFN A;  5J2N B;  3CCS S;  4N8N A;  3PFO A;  2ZBI A;  1EP4 A;  1S6P B;  3N6M A;  2WW8 A;  2H51 B;  3IRX B;  4Q8F A;  2KZM A;  3M8Y A;  1Q16 B;  2W4D A;  2ZBQ A;  3KG0 A;  1S6U A;  5LMN F;  3RW6 A;  3T6B A;  4ZP6 A;  5BR8 J;  1IR2 A;  2MZ1 A;  1FTR A;  2Y8Y A;  2PC6 A;  4X4R A;  3CWJ A;  3AD9 C;  1SL1 A;  2W5V A;  5CQG A;  1WC4 A;  4Y0F A;  4DV1 F;  3KUG A;  2XC9 A;  2CZV C;  4IDK A;  1Y3J A;  2HQ3 A;  2YWE A;  3QRP A;  3GII A;  4QQB A;  2W9C A;  1HNX J;  2N3O A;  4O0I A;  3MAA B;  4ID5 B;  1IN0 A;  4TU9 A;  2RB7 A;  4DZD A;  2IBK A;  3HKZ D;  4CLU A;  5AJ3 J;  3MK0 A;  1QM9 A;  5F3T A;  2FJV A;  4USV A;  2OKQ A;  1KP6 A;  3OFE A;  1LW2 B;  1CG2 A;  2IRY A;  2QE5 A;  3PV8 A;  2XLJ A;  1FDD A;  4UOR A;  4QWD A;  1U6Z A;  3S6E A;  3N6L A;  2BA9 A;  2PGC A;  2I1R A;  2EEY A;  4E2F B;  3ICL A;  2DNQ A;  3BQ2 A;  5E0O A;  3KNA A;  2IMO A;  2Q6B A;  4CH1 A;  4AL5 A;  3NKP A;  3BO2 A;  2VBZ A;  1UWB A;  3NCR A;  2R8I A;  1WNE A;  1X4F A;  2E1P A;  4M5D B;  3ZXW A;  5AXL A;  2YVS A;  1IVZ A;  5D0R A;  3M9N B;  4MIA A;  1F3V A;  4ZPV R;  4J9R A;  1NZ8 A;  3HSJ A;  3NP5 A;  3KLI A;  1T3N A;  3W7B A;  1XNR F;  3ZNJ 1;  4QYZ K;  3MPY A;  3OR2 A;  3SCL E;  1FWK A;  2E5J A;  3BN7 A;  5DLW A;  1WG1 A;  5EWE A;  2C22 A;  1Q8B A;  4HHJ A;  1O0P A;  4WKR A;  2XM3 A;  2OD4 A;  1ZAW A;  4DU8 A;  5AXM A;  3MR6 A;  1IKW A;  2PO4 A;  3W63 A;  2R2R A;  5K8O A;  2HND B;  4WFZ A;  2KB2 A;  2BJ8 A;  2B4P A;  1KBR A;  5LT5 A;  4L75 A;  3HHK A;  2E5H A;  3CDA A;  2AYB A;  3MMA B;  5ITH A;  4LRE A;  2BW2 A;  2R3V A;  1PIE A;  3H5S A;  3M2U B;  5E41 A;  3V81 B;  1WF1 A;  1H73 A;  1U7L A;  3CED A;  3HHD A;  1IUJ A;  4CO0 A;  1S4F A;  5J1E B;  3QBC A;  2QG9 B;  4DMZ A;  3QWU A;  4BDP A;  3UPF A;  5J2M B;  4DX6 A;  5LRM A;  3K0J A;  1R8B A;  4HI2 A;  3BO3 A;  4BLG A;  2B4V A;  1TL3 A;  4NLX A;  5CZV A;  4C2M A;  2J0S D;  1R7I A;  3SFU A;  3G86 A;  4WYL A;  3CPW R;  5L38 A;  3MM5 B;  2P5V A;  3PYF A;  6FD1 A;  2COL A;  3UCZ P;  4OHW A;  3NY0 A;  2W5W A;  3GFY A;  5KFF A;  1J27 A;  4WKY A;  4OIX A;  3G9C A;  3C8Y A;  4B9M A;  2KHC A;  1BMQ B;  1T05 A;  4LR2 A;  2DEI A;  3EX7 B;  6AT1 B;  3MMC A;  4DR3 J;  2GSO A;  5D0G A;  4P52 A;  3C6T B;  4RZR A;  3CDE A;  3Q8R B;  1HAR A;  3Q3Q A;  4I2P A;  4HAC B;  3UN2 A;  3RBD A;  2CPH A;  2DXE A;  4C8Z A;  2A3J A;  2AU0 A;  2W4P A;  1RWN B;  2O01 C;  3DXS X;  5HAO A;  4R5P B;  1NSQ A;  3SCI E;  1G1X A;  2HW3 A;  3SXL A;  1LW0 B;  3R9L A;  3R6G B;  3TZY A;  2I0X A;  4HLB A;  4O44 A;  5AT1 B;  3O3L A;  3SV3 A;  2ASJ A;  5E5N A;  1TL4 A;  3CJ3 A;  1I6J A;  3MM6 B;  5HBM B;  2ZOG A;  3FK4 A;  4Q8E A;  1S79 A;  4DFK A;  5DG7 A;  1TFW A;  4X65 F;  5B0A A;  1RTZ A;  4LRD A;  4OX7 A;  1HL6 A;  1EQJ A;  5L39 A;  2KH9 A;  2HFV A;  3MR2 A;  3M8R A;  1JLQ A;  3KXD A;  3HK2 A;  2ACM A;  3KJN B;  2J9D E;  2W2Q P;  2HRY A;  2GHP A;  2QYG A;  1PKU A;  2RH6 A;  3OTB A;  4K4V A;  4ECW A;  3KK3 A;  4LRF A;  1CC8 A;  2B4U A;  3DYA A;  3MM9 B;  2HNZ A;  2MKI A;  2NSB A;  3U02 A;  2HUR A;  2FC9 A;  2HZC A;  4DQR A;  5JUM A;  3SZ2 A;  2JL9 A;  2MTL A;  4I6Y A;  1XMQ J;  4ZN3 A;  3BGF A;  4LF8 J;  1TKT B;  3DPC A;  3U1L A;  4HDH A;  1KEK A;  4F3Q A;  3TWZ A;  2KZZ A;  1TR0 A;  1H2T Z;  5DG9 A;  3QZ8 A;  1WG5 A;  2B8P A;  4C8K A;  4N41 A;  3D1Q A;  5KOW A;  4UW2 A;  3I6P A;  3OUY B;  3OVA A;  1WC1 A;  2E9R X;  1FDB A;  3OHB A;  1SKU B;  4DSE A;  1R0B G;  1SV5 A;  2RIJ A;  1S1V B;  2I6W A;  4IG3 A;  5HJX A;  2X1G A;  4DL4 A;  1VYA A;  2W2P P;  2LP4 A;  3PR4 A;  4OZ5 A;  1FXD A;  2BE2 A;  2R7W A;  1FKO A;  3W2V A;  1RBA A;  3MMB A;  4P10 A;  2CNN B;  2ZZM A;  1Q81 T;  4USU A;  2RQM A;  3MEC B;  4WE1 B;  4DR6 J;  3DFE A;  1ZEF A;  2QA4 S;  4I68 A;  2UUB J;  3BBC A;  3Q22 A;  4NA3 A;  1EX8 A;  3CJ2 A;  3NCP A;  2FLN A;  2VJU A;  1CJU B;  5KAK A;  5GAG I;  1RT1 A;  3POT A;  2X1A A;  3D6T B;  3VZI A;  4UPH A;  1F6T A;  3CJS A;  2DRB A;  4KV8 A;  5HLF A;  2HGM A;  3PW5 A;  1X0P A;  4WJB A;  3SDE B;  3KK2 A;  1SC4 B;  3NBP A;  2YKO A;  1IKX B;  4EGL A;  2NPI A;  4X2B A;  4JI8 J;  4CYU B;  3QNW B;  1WHX A;  3C6U B;  2JVR A;  4LF2 A;  2XHC A;  2DXF A;  4CLY A;  2ZH8 A; 
#chains in the Genus database with same CATH homology
 2D1G A;  3NKM A;  2IUC B;  3MK0 A;  2VQR A;  2GSO A;  2W5T A;  1N2L A;  2W5R A;  3TX0 A;  5AJ9 A;  2IFY A;  4ZG7 A;  3WAW A;  3SZZ A;  3Q3Q A;  3B5Q A;  3IDD A;  3WAY A;  4UOO A;  1EW9 A;  4LRC A;  3UNY A;  1P49 A;  2IUC A;  4LR7 A;  3E2D A;  4GTY A;  4GTZ A;  4TN0 A;  3WAX A;  1ZEF A;  3IGY B;  3UN2 A;  1AJB A;  2RH6 A;  2GLQ A;  5L0B A;  4CXS A;  1ANI A;  1HJK A;  3NKR A;  3ED4 A;  4UOR A;  1KH4 A;  3BDG B;  3BDH A;  3IGZ B;  4LRF A;  2ANH A;  5DLT A;  4ZG6 A;  4LRE A;  5EGH A;  1ALH A;  4LR9 A;  1KHJ A;  1ELX A;  1SHN A;  2QZU A;  2GSN A;  2W5S A;  2W8D A;  1N2K A;  2W5Q A;  5GRR A;  3WBH A;  3BDG A;  1EW8 A;  3NVL A;  4B56 A;  3M8Z A;  4QAX A;  2G9Y A;  3MK2 A;  1ELZ A;  1ALJ A;  5HRT A;  3A52 A;  4KAY A;  4MIV A;  1AJD A;  1KH5 A;  3NKP A;  3M8Y A;  1KH7 A;  3T00 A;  3WAV A;  1EI6 A;  1AJA A;  5EGE A;  5L0E A;  4CXK A;  1URA A;  3BDF A;  3M7V A;  4CXU A;  1E1Z P;  3DPC A;  3MK1 A;  4ZGA A;  3UN5 A;  3CMR A;  4UPI A;  3M8W A;  4UPH A;  1E33 P;  1ED8 A;  1E3C P;  5DLV A;  2W8S A;  3TWZ A;  5GOV A;  1Y7A A;  1K7H A;  5LQQ A;  4N7T A;  3KD8 A;  4LRB A;  4LR8 A;  1ZEB A;  4LQY A;  1EW2 A;  1Y6V A;  4NWX A;  3T02 A;  5LRM A;  4KJG A;  4FDI A;  2GA3 A;  4MHX A;  1EJJ A;  1B8J A;  1E2S P;  1KH9 A;  1HQA A;  2XR9 A;  3LXQ A;  4GTX A;  1ED9 A;  2ZKT A;  2W5X A;  5IJQ A;  4CYS A;  2W5V A;  1HDH A;  1SHQ A;  3T01 A;  3DYC A;  1ELY A;  3NKO A;  5LIA A;  2X98 A;  4UOP A;  3TG0 A;  4KM4 A;  4NWJ A;  1ALK A;  4YR1 A;  1AUK A;  4UPL A;  5K4P A;  1O99 A;  1KHK A;  2XRG A;  1ANJ A;  2GSU A;  4KAV A;  4CYR A;  3UN3 A;  4KJD A;  4MY4 A;  5KXA A;  5TJ3 A;  5L0K A;  1ZED A;  5DLW A;  5IJS A;  3NKN A;  1O98 A;  4FDJ A;  3NKQ A;  2W5W A;  1URB A;  4GTW A;  4LRA A;  4LRD A;  3UO0 A;  4UPK A;  5C66 A;  5INH A;  1FSU A;  1AJC A;  5LRN A;  1KHL A;  3SZY A;  4ZG9 A;  3OT9 A;  1EQJ A;  1ALI A;  4LR2 A;  1KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...