3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
4CXUA 1B8JA 4NWXA 4LRAA 5INHA 3SZZA 1ELYA 1ELXA 1AJCA 4LRBA 1KH5A 1URBA 2W5VA 2W5WA 3ED4A 3T02A 2ZKTA 1ED8A 1EW8A 3MK2A 4LR8A 4KAYA 3DPCA 5DLTA 3BDFA 2IFYA 1AJBA 1Y7AA 4KAVA 1E3CP 3TG0A 4ZGAA 3WAXA 5DLWA 1N2KA 5DLVA 4N7TA 1KHNA 2X98A 3IDDA 1ANJA 3TWZA 1ALKA 5AJ9A 2W8DA 1KHLA 1URAA 1EI6A 3BDHA 4B56A 1HJKA 4LREA 5TJ3A 5C66A 3OT9A 2XR9A 4KM4A 5IJQA 4LR7A 5L0BA 1ALJA 1AJDA 3Q3QA 4KJGA 3WAYA 1SHQA 3KD8A 5GOVA 3M8YA 5L0KA 5HRTA 3BDGB 4ZG6A 2W5TA 5GRRA 4LR9A 4YR1A 4FDIA 1ELZA 5IJSA 1HDHA 3LXQA 4FDJA 5LIAA 1AUKA 1E33P 4CYSA 4CXKA 5K4PA 3UN2A 2D1GA 4CXSA 3NKPA 1EJJA 4MHXA 2IUCB 2G9YA 1O98A 4UPIA 3M7VA 2VQRA 2W5RA 1EW9A 3B5QA 4TN0A 3UNYA 3SZYA 1KHKA 5LQQA 3UO0A 4UOPA 3NKMA 3MK1A 2GSNA 1ANIA 4UPLA 3NVLA 1P49A 3NKRA 4UORA 3M8ZA 3TX0A 1E2SP 4UPKA 1ALIA 3A52A 1ED9A 4ZG7A 3NKQA 3UN3A 1KH7A 4LR2A 1KH4A 5KXAA 4CYRA 1K7HA 3UN5A 1SHNA 1HQAA 3IGZB 4GTWA 3DYCA 3M8WA 2W5XA 1ZEFA 3WBHA 4ZG9A 1EW2A 5LRNA 1FSUA 5EGEA 3T00A 1ZEBA 2ANHA 3NKOA 5LRMA 1O99A 2QZUA 2IUCA 5L0EA 4GTXA 2GA3A 2W5QA 1KH9A 4LRDA 4GTZA 1Y6VA 3IGYB 2W8SA 4MY4A 4UOOA 2RH6A 4QAXA 1N2LA 4UPHA 3NKNA 4LQYA 3BDGA 1AJAA 2GSUA 1ZEDA 1KHJA 2XRGA 1ALHA 3MK0A 4MIVA 4KJDA 3T01A 5EGHA 1EQJA 2GLQA 3E2DA 3WAWA 2GSOA 4LRFA 4LRCA 3WAVA 2W5SA 1E1ZP 4GTYA 3CMRA 4NWJA
chains in the Genus database with same CATH superfamily
1T9VA 2EC2A 2Z56B 3CT9A 3SYZA 4K4UA 2HQ3A 3E51A 2NQPA 2GIFA 2QT7A 4MH8A 1RSCA 4ZP8A 1JLBB 5KFVA 4B3MF 2RKIB 5CABA 2V34A 3R7BB 3DN9A 3DLBA 2W5VA 5HAOA 2W5WA 2G1DA 2ASJA 3V81A 2HRTA 1LKZA 1OYEA 1LK7A 3MM9A 4TU7A 1FDNA 2VQFJ 1VQLS 4LMZA 4LR8A 3L95X 1VQ6S 1F60B 3BBCA 5C25B 2EFQA 1NM2A 2HNDA 1WKLA 3H98A 1NK6A 1S77D 4GVLA 4OYZA 1AJBA 2DGSA 1M5OC 3FBBA 1E3CP 3MM5A 2Y8WA 4X2BA 4OJ1A 4J9KA 2Q43A 3IDDA 4OJHA 2UV8A 4KKOB 4PYAA 3MURP 3BBFA 4J9VA 1PGZA 1JKHA 4DZ6A 5ADZA 1WC3A 1XK8A 1WG5A 3CO0P 4DF8A 1C0UB 1SQEA 4CTAA 2C3UA 1ALJA 4KJGA 1AYEA 1W26A 2QL7B 4KKOA 2HHTA 3R7SB 3O6QA 2HZVA 1F5BA 3FVYA 4FVMA 3L7UA 1ZM9A 5CH7B 4IH6A 3DPCA 1KNZA 4UOCA 4YHHJ 4FBUA 4OYPA 2OEMA 1Y4ZB 4DQPA 1PCAA 4MKVA 4PUOA 1RP5A 4ZCMA 3PG9A 3D0GE 2CQHA 1FRHA 2L48A 3KWMA 2HVEA 3L4BC 4K8RA 4ZCKA 1KR4A 2XLJA 1RT4B 2R7SA 2JLGA 1Q16B 2D1GA 2VHGA 2DJWA 2AU0A 4JI2J 3R5BA 1PAUB 4DCOB 4QU7A 1S1WA 2OD4A 3Q8UA 2R2TA 1R31A 3C15B 3D1QA 3UNYA 1JLGA 2AX0A 2J8AA 4ANDA 3OXGA 1SUQA 4BCAA 3CCMS 1KONA 4O44B 5KFDA 4QCLA 5D8HB 2DGTA 5GMEA 1REGX 5ITHA 4Z7YA 2VIHA 1UWBA 3FQKA 1JLEB 3RB4A 1NK4A 1YBTA 2OPRA 5T41A 2N82B 4AD6A 2E5JA 3C14B 5B0BA 4QWCA 1HQ2A 4UOHA 3HD2A 5J2MA 2CWKA 1QSLA 3W2WA 2CJYB 1HD0A 4LR2A 3K59A 2ZDPA 1SHNA 5HQ8A 4USKA 3LAKA 1Q81T 1S0VA 1ZEFA 2DNGA 3WBHA 2IRUA 1TAQA 1JXVA 2ZWPA 1C1CA 4ID8A 1RAIB 4X62J 4FYDA 4WZQA 2OFHX 5KFRA 2CPXA 5H9EK 1CS4B 1AB8A 1H2UX 2HNZA 2XG8A 2KM8C 4GKJF 2AJFE 2FQQB 2CZVC 2M88A 4M95A 2CQPA 4M63A 4IUFA 4ZVQB 1R8HA 3EZ5A 5DM7Q 4ZVOB 4NCGA 4OHZA 2XHWA 1K0TA 1VJWA 1Z2LA 3AT1B 3W5ZA 4BLGA 4ECVA 1SL1A 3BSOA 3PYGA 3TW0A 1N2LA 4MY4A 4TLRA 5FLXU 1PAEX 2CNLB 3KHLA 4L6V3 3JSYA 2QMUB 5IM0B 1M5HA 4RL1A 2VQEF 1RTJA 4DBQA 2XSJB 1QUPA 3GPAA 4H4KC 3MR3A 2VL1A 3NCRA 4W98A 3GV8B 3K5NA 4WFBQ 1T9YA 4MK7A 3UDLA 4WBFA 1MU2B 3CCRS 3IAM9 4XIUA 3MD1A 4YOEA 3WAVA 5FDLA 2IA6A 3W65A 5KT7A 5HN0A 2OH2A 1EAYC 1LQ9A 4GC6A 3PFEA 4OYXA 3HVRA 3N5BA 5F8NA 5EUHA 4C4WA 1JLFA 2I1RA 4NOHA 5INHA 1YZ6A 3NY0A 3JQMA 2ZVSA 5LSOA 2HNYA 3H4BA 2ACMA 1G4CA 1WEYA 3H2UB 1Q5YA 1FJEB 3C46A 1N33J 1WHXA 3UI3A 1JJCB 1X4AA 3QGGA 4J7CA 4PXEA 2YNFB 2FIUA 2ZBQA 2D3ZA 2IMOA 2WRMA 3M2RA 3AA9A 3M8QB 3PEJA 4CO0A 5BYSA 4J90A 1QTNB 3MHYA 2DVIA 1JK9B 2N4DA 3GQCA 2E9RX 4DU8A 2OTJS 5DDOC 4DZDA 4HEA9 2VFUA 5ETPA 1D09B 4UUXA 2CQ0A 1U49A 2ZITA 3T9ZA 1DTTB 2FHJD 4Q43A 2GVDA 4QWDA 3I0RB 2E7XA 3QFHA 1WOOA 2HRUA 1WD6A 1S4EA 2QL9B 3NNCA 4DLGA 3FDSA 3M30A 3MEEA 3FBFA 1R0BG 3QIPB 4J9NA 3V4IA 4AQYF 1Q79A 3QFWA 3M2UA 4ETXA 4NLOA 4RW7A 4U9RA 3ZNUA 1AJDA 3F44A 5BR8F 5ETRA 1I5OB 1N0UA 1VQ7S 1I3OB 3U1NA 5J2NB 2XS2A 5L38A 4KJIA 3AJ1A 1XBWA 3FEZA 1UETA 4ZVEA 2WOMA 1IKVA 3DNCA 5DDRC 1ZM3A 3AD9C 3CCJS 2W2PP 1Z1ZA 3K8VA 4LF6F 4Q2MA 4ZA1A 1S10A 4CCHA 5D3GA 4O3OA 2DO0A 1FK9A 4XDCA 3MCNA 2J9DE 3GILA 2YPYA 4NZ6A 1L3VA 4O4RA 1WKJA 4I2PA 2GCFA 3NKMA 2W8LA 5IC4B 4WCEQ 3GIJA 4K4YA 2IY5B 5K4PA 4ZCLA 2ADBA 1VMBA 3HHDA 4W4MA 5D6GA 4G3IA 1HQUA 4OIXA 4X4QA 3HHEA 4K4SA 3MPVA 1M5PC 2WVFA 2JL9A 2R7OA 3CCZA 1FXLA 4PPZA 2FVSA 1FX2A 4FXVA 4KHMA 5M2UA 2MQPA 1IBMJ 4XDDA 1LOUA 1DAXA 2FHJA 4KY3A 3T1AA 1SVDA 2OELA 3LF0A 4N76A 1S7HA 2JFDA 5M2RA 2ZOFA 4DI6A 2BW2A 1VIXA 3BBBA 3OLAA 1VBYA 2VUGA 4HH0A 1BMQB 1TKTA 1TL1B 1PBUA 2OPRB 4NE9C 4YMEA 2AYGA 1JKHB 5F8GA 5KG4A 4CYRA 2N7YA 4DR6F 2GNKA 1FJCA 2OD6A 3W2WB 5KG3A 5I3UB 3R5AA 2YNGB 3BYRA 4IQMA 3MUVP 4ED7A 3CJ0A 1VRTB 2V8PA 4IKAA 1RWNB 2QG9B 4QR2A 1IN0A 3PKMA 4Q0BB 1FI4A 4IFYA 4OX7A 4I7FA 2B6AA 2NPIA 2OMLA 3D68A 3D7SB 3Q86A 3Q8YA 3VAJA 3J7YI 4WIQA 5F41A 2IBOA 2W5QA 4RNNA 5BJRA 5DJBA 1VC5A 1KH9A 2YWFA 4PQUB 1XMBA 1EKRA 2VB6A 3RB0A 1T9UA 2LVWA 5HLFB 1NJIT 1N8RT 4LF7J 4QAXA 5IQ6A 1BC6A 3CCWA 2EFGA 5A76A 2R3VA 3HSDA 1VQPS 2YH1A 5L1LA 1VDHA 1OPIA 2L3MA 2K7KA 2ACYA 3HO1A 3CPWR 2MLYA 3GMGA 2GW8A 3M2VB 1A9NB 4F36A 3M8SA 3LGHA 2QE5A 2COLA 2RDDA 3EGWB 5HROA 3HDSA 1APSA 4JOUA 1CQNA 1R3NA 3IM9A 1D9DA 4LF5F 2CWXA 4KFBA 3SDEA 2C2DA 2FYXA 1HBOB 4K0KJ 3MMBB 1NDCA 4RNHA 3O2IA 2VH7A 2KFYA 1MN9A 4C3LA 1UPMB 4CLYA 2F4VF 2ZHOA 2OJ3A 3MOJB 2MDAA 3RUBL 2CPFA 1NRKA 3OD2A 2WW8A 3Q0AA 4AL5A 3MAAA 4KHPF 3TO8A 1LW2A 1SXLA 4WK1A 1JLCA 1U1PA 2JJ4D 4E2FB 4W90B 1VBZA 1IBLF 4U95A 3RBEA 1L3TA 1RWMB 4NI2A 4N8OA 2EBGA 2W4PA 4NXMF 2J0SD 4KAYA 3F73A 4LBIA 3PO5A 2ZNYA 1ZH5A 4RWXA 1U6ZA 3ZTRA 4ED2A 1Y7AA 1SQGA 2IJFA 3PYEA 3CCQS 2LMIA 2XHCA 1MROB 3MEKA 5DLVA 1VBXA 4TN2A 4B3OA 1I94F 4K0KF 4C48A 2KJWA 4IH7A 1AZSB 3MMCB 4PWWA 6FD1A 3M9OB 1XMOF 2VODA 3PRDA 2QV6A 2I5JB 3US5A 1UTAA 2BJ3A 2Q1LA 3F41A 3M8PA 1UEUA 2E1RA 4FXWA 4C3KA 2R7UA 3TZXA 5KFFA 2CQIA 3PKYA 1VOMA 4PPDA 3KLVA 1F1BB 3D5MA 2FB0A 2J0WA 1JNZB 5T7LB 4C9DA 2EK6A 4B3SJ 1IM4A 2CNKB 5MLCV 2HHVA 2C1EB 1U0HB 1ZM2A 2V5HG 2CPZA 4TXSA 5ETTA 1HNVA 5FD1A 5F3ZA 4DV7F 4JI4J 2QL5B 2MJUA 3DOKB 3MR5A 4JI5F 3ZTPA 3U1MA 3QNWB 4DQIA 1URNA 2Y8YA 3I5BA 4L72B 4DXLA 2BANA 5I3QA 2LQ8A 3CTRA 4GKKF 4C2MA 4J9RA 4LFBF 3UN2A 3I82A 1EKSA 1V3ZA 1YJWS 2IUCB 5GAEI 3HJVA 3P45B 4B9NA 5HJYA 2AMCB 1SCJB 2VBYA 3FK4A 2VQRA 2KFNA 1H0HB 1CLFA 5KTQA 3UVJA 2DR5A 1ZZFA 3BH7B 3GSDA 3OL6A 3H40A 3TR5A 2GJIA 2WCXA 4DU7A 5A8WA 3RBZA 5KFNA 4K4WA 4YP3A 1ZZNA 4PWDA 4UORA 2MKHA 2C3MA 1HNIB 4DV3J 2EEYA 1EARA 1NJWA 1TL5A 3QRQA 4K5SA 1JJHA 2NUUG 1RB0A 3AD7C 3M05A 3UN3A 3KG4A 4KIAA 4V19J 4DX5A 5DLGA 1N34J 4LQ9A 1KH4A 3TQEA 1HYSA 4MK9A 2QN6B 3EVMA 4NLQA 4DMZA 3J7Z5 2ZJPQ 1E6YB 2GVZB 2R42A 4JV0A 1RWKB 2C2KB 2W5XA 2AF6A 3M1VA 3CCES 4FF2A 4DV2J 1U02A 2E44A 2OI2A 3GG0A 4M5HA 1MLAA 1SB6A 5LJ3Y 1TZ0A 2ZH7A 3GZ7A 1EHWA 1NK7A 1C4AA 1OWXA 5LRMA 4FXDA 2BW7A 4M94A 3TVKA 2H9ZA 3OSNA 4DV6J 1AW0A 1KLMA 3EWGA 4RPFA 1PKUA 4PXDA 1RU2A 3BGRB 1FE4A 5DZ7A 4OI1A 1SJFA 4C0OC 1U1KA 4JI3F 1LXJA 1OQ6A 1J5OB 4NLWA 2V9WA 5IV3A 4G1QB 4S0MA 2FVQA 5LXYA 1T05B 4YB1P 2HVHA 2XMMA 3MDFA 3JAMU 4X66F 1ALHA 2M70A 3HT0A 2B4OA 3PRVA 1X4FA 4FP9A 1UVKA 1FCAA 3MECB 3MTKA 1VQ4S 4Q8FA 3E01B 1S99A 3ZTQA 3MF5A 3UWTA 3IRXB 4LF8F 2EPIA 2MHNA 4A8YA 5E2QA 4P75A 1AFIA 2QSWA 2H1YA 3SCLE 3NL0A 2NUHA 3QT5A 3GV7B 4OI0A 1AT1B 2IJRA 3A4TA 3QJJA 5A8RA 3UR0A 2VG6B 1VQKS 1TVRA 4C8MA 5LT5A 4QWAA 2BE9B 3T02A 1U2FA 2HQDA 2ZKTA 4DV1J 3GR0A 5EN1A 4IOBA 4TKTA 1N5TA 1T9XA 2AGOA 3MK2A 3RBDA 1NPKA 1XNQF 2YQ3A 3UCGA 4K4XA 2Y1JA 3GG1A 3S8SA 4QWEA 1LV5A 4C98A 5DLTA 2UXCJ 1RTIA 3VZIA 3POTA 1FKOA 2GIQA 3H0PA 1FNMA 4OYWA 1SJ3P 1SKWA 1NHKL 2B6AB 3QT7A 4OHVA 3RJMB 3QJLA 1NBEB 4DDFA 1KHNA 1NB7A 1RTDA 1UVMA 1F2HA 2CXEA 3S7RA 2WVEA 2HFVA 4PQAA 4EBEA 4PQUA 3BDHA 1P6TA 4QR1A 3R2DJ 3OT9A 2GS8A 4AXJA 2PFDA 2V63A 2R2UA 3OR2A 2IDLA 5CCLA 3QBCA 1HW9A 1H2TZ 4OMFG 2R8JA 4DR5J 4JP8A 4IRDA 2HVZA 3V6HA 1SC1B 1C1BB 2RD5C 4ZJLA 1LNQA 2AHOB 2DNZA 2OLWA 2RF2A 1BQXA 2R4FA 1RA7A 1WEZA 2F4VJ 5E7OB 4TU8A 3OL7A 3B82A 3SCKE 1KBRA 1Y00A 2D7SA 1WSVA 5KG6A 3V5RA 3KLIB 1TK8A 1NMEB 3VCDA 3RR8A 1RAFB 2DNKA 3P6YC 3G8TA 5GRRA 1WELA 4EFAC 1DQAA 3HFZB 4OHXA 3V6DA 2RRAA 4USWA 1VQ5S 3DLJA 3CNQP 2YWWA 1F3FA 3RB6A 2Y9HA 4B3SF 1RT1A 1PYSB 1WF2A 2ROGA 4DCJB 2AIRB 1DBDA 1NHVA 3DM2B 1T8EA 2UUBF 2HAIA 3KLHA 3OPKA 1VI7A 1HBMA 2DKOB 3M4XA 3IFEA 4RW7B 1KWMA 1XEZA 2QTWA 2HPUA 2K8GA 3CJ8A 4DL0C 3H5XA 4R5PB 4P7TA 3HX9A 2LYVA 3VGUA 5DDPC 1H7WA 3D6FB 4UOPA 4QIFA 2IJNA 1UAWA 2WB1D 2E1MC 3NKYA 3RG6A 3E2EA 2Z2LA 2AYMA 4HI2A 3K57A 1I94J 4KO0A 1VQ8S 3SV4A 2IM2A 3VAKA 2KZZA 4F2SA 1S9EA 3DRRA 4C7QA 2GAGC 1Y3KA 3QLHB 1N36J 2HNYB 4ZHRA 2OUGA 2VBXA 4ILRA 3EGZA 4GRSA 3ADAC 5BYQA 4UPKA 2ZBPA 2NPFA 2RUSA 4EU0A 2VONA 3NKQA 4ED8A 1VR6A 4I64A 1S9EB 3DRRB 5C42A 2V8HA 2MZQA 3IG1B 4KE5A 3DYCA 3L09A 1ZBTA 2KT3A 5DO2A 4ZG9A 2NXUA 4UF4A 1QVFR 3MPWA 3TP2A 1DTTA 2M5YA 3IBFB 1WNEA 2NXCA 4ZN1A 2AX1A 2DEIA 2XZWA 2RDJA 2VJUA 3JXOA 1JLBA 2Z57B 5LXRA 1U1NA 2R7XA 5L0EA 4WU3A 5KFAA 4ZLPA 3SQOP 4Z37A 5IWAJ 1XN9A 3M8RA 1YDLA 3I96A 3BJYA 4HTIA 4B08A 4AL7A 4M5NA 4P52A 2ZOGA 2YKMA 1T9TA 1N5QA 1U1OA 1YLXA 1SL2A 2XZTB 4NLPA 2ALYB 3P5BP 1UFLA 4RX6A 1AJCA 1ZAXA 4WP8A 5CHCB 4IG3A 4QU6A 4KT0C 4PABA 4IRKA 4OYIA 4RW8B 3DLEA 2XLIA 2H3EB 5CYQB 2KM8B 3OSPA 3IR5B 3OV7A 3DHWC 4DSFA 1EQJA 4DR7J 2F40A 3MUMP 3CJ4A 4ZPTR 2CG4A 1LK5A 4NLYA 3W2VA 4LRCA 5HI7A 4LUBA 3TZWA 3MCOA 4IFYB 3ET6B 5A8WB 2CQ1A 4WFXA 5G4DA 4WFNQ 2RH3A 4I0WA 3BQ1A 3KJFB 3LO3A 1KVJA 1RWOB 2OSRA 1TUWA 2RQCA 1DFDA 4KPYA 2WB4A 1LWFA 2KYXA 2XMKA 3I55S 2XMJA 3HSJA 1V5IB 4TNOA 2OAUA 3DGPA 2LEBA 5I4MA 1RBAA 2J76E 1WTBA 2KZMA 2WZ1A 3P49B 2ZJRQ 2BZ2A 1ED8A 2NYHA 2QLBB 2BOAA 1Y5NB 2KB2A 2CNNB 2NYIA 2RHSB 2X51A 3D4JA 3F0NA 1Q4RA 3DXBA 1X5OA 3W63A 3EMTA 4HH1A 4JI6J 4NA2A 1OS5A 3U27A 4B17A 2UUCJ 1BE4A 4B9UA 3JB9k 3FRYA 3N4WA 3T5LA 2UUAF 3W3SA 3WX4A 3IGNA 5K8OA 2OPQA 3PYFA 5DLFA 3Q2TC 1UFKA 2HVDA 4B56A 4LF5J 4L73A 2HHWA 3GJTB 2BMBA 3AQOA 2G2YA 4DR2F 1Y5IB 4LR7A 1URAA 1FRMA 4URSA 4CO2A 2ZH8A 4PAAA 4MTPA 5DRKA 5J2PB 1LEOA 3DOLB 1J5EF 3WAYA 3BO2A 4U8VA 4OJ3A 1XNRJ 2B9WA 1F6TA 2ZOMA 3C14A 2YNIB 2BQUA 3FMBA 2VOPA 3AD8C 4KHRA 1UEKA 1FRXA 1X4CA 1Z4UA 2WSEC 2XSFA 1LWCB 1RGVA 3BF4A 4WIIA 2KHDA 3M8YA 2DBBA 2ZBIA 3ZZ0A 3HSZA 2PN6A 2PI5A 5L0KA 4ZPWR 3C6TB 3GV5B 4X4SA 1REVA 2CJXB 2XO7A 1KSPA 1XR7A 1UFWA 1R8BA 2W8KA 2G2OA 2G2ZA 2P9GA 4H4OA 3I9V9 4U96A 1KKHA 1NKCA 1FDBA 5CAAA 2DR8A 1LWCA 1RT2B 2QJ3A 4EWTA 3G82A 2HQGA 3SMZA 1SJ4P 2ZZNA 4P2SA 5IFMA 5JVHQ 4WTYA 3MEDA 5T14A 2YWHA 3M7VA 3NOCA 4ILMA 1NUEA 2OP5A 1WUUA 2YQ0A 3AJ2A 9RUBA 3MMBA 5A2QY 2V0NA 4K59A 3ZZZA 1Q53A 3UR3C 1ANIA 2V68A 4KGZB 3O3LA 2VG5B 3TZYA 3Q23A 2EBEA 1NJYA 2JDJA 2FLPA 2RSQA 5ETLA 4F67A 5DGAA 4IYQA 1SUQB 2FY1A 2UVVA 2HS4A 3KNGA 4KSEB 1UJ6A 4LSNB 2DHXA 1TU0B 3G2XA 5LL6d 1ALIA 3A52A 2VFTA 3HHLD 3KG1A 2BE7D 1RT6B 4J91A 1SI9A 1UWBB 4ZVUB 4ZIVA 3QZ7A 3UD4P 2FHOB 1HQAA 1JLQA 1UWAA 2CJBA 4OV6A 3AAWB 4RW4B 2X3GA 3BV8A 4DV5F 1CQMA 3TEGA 5K20B 2UP1A 3T5HA 3TVYA 4F0MA 1F3VA 5GMKa 3LANA 1HWIA 1S1TA 4NZ0A 3G8SA 1U8WA 2YX1A 2V50A 5F8MA 4EO6A 1NZAA 1ZETA 4Q7AA 3C2PA 3PTWA 3THTA 1C0TA 5KT6A 4XO0A 4LF9F 5HBMA 2V67A 1E6VB 1CJUB 3HCXA 5HO4A 5K14A 3CJ3A 2E1AA 2JLFA 3I6PA 2FZKB 2E5GA 3DM2A 3WX8A 4ED1A 2P5VA 1DLOA 2ZBRA 3N01A 3TARA 4C0HA 3IS9B 2DNHA 4C0BA 3FJ2A 2B8PA 2DXEA 2Z2YB 4WFZA 4ELVA 3J7ZT 3MK0A 2DR6A 4BWJA 1NXIA 3TAMA 2GMJA 5HBMB 4X4PA 3DMJA 3HHLB 2ASDA 1YI2S 5B08A 2GQQA 3NBPA 4YY3J 3NWGA 5F9NA 2CPYA 3AFGA 1D9FA 1CG2A 1DLOB 4ZMMA 1PJ6A 1RAJA 2ATCB 3M6XA 3PW0A 1R0CB 1T95A 4YR3A 1RHKB 5KFSA 3HHLA 3SZZA 3GYXB 3CD5A 3MPUB 2FVPA 4KV8B 1EETA 1UEVA 1A6LA 2ZH1A 3CSKA 4M5KA 1KH5A 4WP3A 1MWZA 4DUYF 2BQRA 3VGSA 4WFYA 2GHVC 2VZ9A 1IM6A 2DEJA 3M6UA 1YVFA 1KFDA 1MMDA 2EFOA 3NOGA 4ZP7A 4I2PB 2Y3YA 3G6VA 4IRCA 2Q79A 3A3PB 4FYWB 5LMNF 2R2RA 3GIRA 2RQMA 2W01A 3OUYB 2AEFA 2KVQE 3DLKB 2H48B 4LFCF 4C8YA 5J2QB 1HBUA 1TKZB 2XMAA 2QFJA 5KG7A 3LPEA 1YJNS 2EKYA 5F3TA 4X64J 4QW8A 2MSSA 3CDWA 3K5PA 4C8ZA 3M1VB 2XB2D 2ZDOA 3C6UB 1ZAWA 3D3CJ 4ICLB 4PG7A 3T41A 2NS1B 2ZVIA 2MZ1A 5AE2A 5LMNJ 1FEEA 5KT4A 3LWLA 1GTHA 2UUCF 2J0XA 4PG8A 2VU5A 4RBUA 4EI2A 2W24A 1GMWD 1QAYA 3H7HB 5E41A 1R43A 3HVTA 3NG8A 1KTQA 4C8OA 1LFPA 1N32F 1PBAA 2UUWA 4N47A 1S6PB 3MGJA 4KRWA 1G2EA 4FYXB 2IPOB 2QLJB 3B78A 2MQOA 4JI0F 4RR5A 3G96A 2FC9A 4I6YA 4QZVB 1B3TA 4NXMJ 1LWEA 4UZCA 3VV2B 3IWLA 4EBDA 1FHTA 1HDHA 4DV1F 2C2MB 1Q82T 3AOBA 1TUVA 2HBZB 2V2QA 3HJFA 3RRGA 4QPTA 1S5ZA 2XYHB 4OI2A 3VZHA 4NEYA 2HHXA 4LF8J 2V69A 2MB0B 3ELHA 2QEXS 1RZMA 1RABB 4C11A 4CLFA 1XQIA 4FVCA 3HK2A 4X4NA 4KC5A 1S7IA 2CQ4A 4C6AA 4ENOA 3CJTA 2O67A 4JI6F 4OYMA 7FDRA 5KFWA 1Q1KA 5F0UA 3WC0A 2C22A 1UVLA 5C2GA 3CJQA 3MK1A 3W60A 2P8IA 3HFVA 1VQOS 4HTJA 4C11B 1EI6A 2CA9A 3W5XA 2VA3A 5D0EA 3D1OA 2MGZA 2X3DA 4J37A 1OMSA 2HWIA 3C66A 3J81U 3F56A 2FJBB 2H5IB 2OPQB 3CD7A 1BWEA 1SV5A 1X8DA 1XTZA 2QYCA 2P6TA 4ZP6A 3L7OA 1WWHA 4QQBA 1RHRB 2E9ZA 1RTHB 1R0AA 2Q6CA 3IGZB 1JLFB 4FS1A 2J7UA 1KDNA 3GWCA 3I5AA 4ID5A 3H5YA 3OXLA 1UPPA 1N0VC 1EW2A 5MAOA 1CJVB 5D4LA 2BACA 3GYNA 3PW2A 1FVQA 4PR6A 4ECSA 5IJQA 2UUBJ 3IGVA 4J9UE 5KOWA 5CQGA 2FGCA 1BGXT 1HW8A 3M2RB 2RRBA 1HBNB 3DRPB 1JQGA 4RBVA 4EBCA 1F9HA 2GHWA 4ZOSA 4B9VA 2LCWA 4P72A 3MM7A 2ATLA 1S1XB 2HNZB 1F5CA 3S6EA 1RISA 2OGUA 3IM8A 3ILLA 1FD8A 2AJQA 4OZ1A 3VHQA 2OO4A 2KFZA 1VJQA 1JIHA 2LA6A 2WBRA 4LJMA 4F04B 4RNOA 2XM3A 1K1QA 5C24A 4DG1A 3UNGC 1U26A 3CCTA 2XCPA 2EI5A 3EXYA 3FKBA 4KGMA 4ZVFA 3T6JA 7FD1A 3PR4A 5L1KA 4K2JA 3RAXA 3THPA 3VWSA 1MNEA 4Y2IA 1HQEA 5M2PA 1B99A 5ETOA 4CQ1A 5HLFA 3O5TB 2XYPB 4DR1F 2DH7A 3MOZA 2C42A 3N6MA 1VRUA 2V2VA 3ISND 2UXDF 3G6YA 5A6WA 4NMXA 4JI8J 4CM0A 3NS5A 3M8PB 1K44A 5DGBA 4DPOA 4GTYA 2ZM6J 2HBRB 2Z2MA 1MSWD 5T7LA 1PG5B 1RT1B 4DEZA 1HNWF 3I4PA 2KYZA 3M32A 3NNHA 2IBKA 3PIPQ 1ICEB 3TJ8A 4F7VA 3A1YG 4YHHF 4EZ9A 2UXDJ 3CULA 3HVWA 3P3DA 4MAKA 4B3TF 1RI7A 3KNAA 1HLWA 2KI2A 3HSGA 5B0AA 1KS2A 1EW8A 3OTDA 4HHHA 4RW6B 3QGHA 4A48A 3ICLA 3MFHA 3TAPA 1H7XA 4LSZB 1CULA 4X84A 5GADU 3PR5B 1CVJA 2R8KA 1HNWJ 3TUJC 4P2XA 3BEGB 4J9QA 1XMQF 3ZXWA 1I6JA 1HD1A 3RW7A 1FE0A 4J9SA 2CQ3A 1RHQB 2UU9J 4CRJA 2B9YA 3PM9A 5I3PA 2XO6A 2M0GB 2ROPA 5KFCA 1U6FA 5AJ3F 3CMAS 3BGUA 3I9ZA 2DB1A 3Q89A 3EPIA 3LP0A 2GAHC 3PHEA 5SUHA 3IG1A 7AT1B 2LXIA 1MROA 3TNVA 3SXLA 3VGVA 5C25A 1PILA 3R3TA 4LQ3A 1T02A 4A8WA 1G1XA 3X1LB 2KN4A 1WF0A 4FYYB 1FESA 1PC5A 4HACB 3MM5B 1MWQA 3C15A 2FJAB 2PE8A 3N0VA 2ABYA 1OO0B 5KFGA 3TEHB 8RUCA 1AUDA 1TL4A 2YWEA 5AE3A 2BEFA 2B3TB 3QWUA 4P7VA 2J6UA 4Q0BA 3PW7A 2JRSA 2DRBA 5KFIA 1BY9A 3ISNC 2HFNA 4RW8A 5CZXA 1C0UA 4U67Q 4DSKA 2HZCA 4F25A 4CYSA 3BM7A 3DC2A 1TL7B 3IAS9 3NKPA 5HP1B 3A3OB 4I67A 2XYGB 4JB8B 1MW7A 4IO1A 3T19A 4CP5A 4QIGA 4TN0A 1HPZA 1NNDA 3DHXA 5C5JA 1FF2A 3C19A 4WU2A 4DV4J 1SC4B 1VK8A 2JEIA 2VQEJ 4ECRA 1P49A 5F8HA 2ZH4A 2RU9A 4ED6A 3ENWA 1WI8A 2RKIA 3PACA 1XNRF 3CDUA 4UOFA 4WKRA 1L3UA 2M9KA 2F8EX 2PO4A 2GMHA 2VKRA 4NZ7A 4XPCA 3V81B 1S0OA 1AUSL 1HBOA 2MPUA 4F4XA 3HF5A 4X4VA 3C6UA 4Y00A 4ZN3A 2DH8A 1K7HA 3G86A 4CLKA 4IOCQ 1OY9A 3R2CJ 1RXOB 4FZVA 4FBTA 2CQGA 5K5MA 2LU2A 1XMOJ 1JLGB 3EXCX 3I5CA 2E5LF 5I3UA 2YX7A 4HI1A 3ZZPA 4O4GA 2VDIA 1ZTWA 2N7CA 2HFOA 4IDKA 2W9BB 2VG6A 2QGFB 3MTJA 3GIKA 2HGNA 5EGYA 3SCIE 3GFZA 4C8LA 3CCLS 1MU2A 2VG7A 2ZH3A 4CH0S 3FC9A 2V4JA 4I4BA 2MYFA 2K1RA 3G4SS 4USIA 4TQSA 1S97A 4M5GA 2K7JA 4JV1A 2XNRA 4K4VA 4ZP9A 3NKNA 2OHDA 4EZ6A 3CEDA 2GSUA 1YZ7A 1FKOB 2B8QA 3AXKA 4CLSA 3IC1A 4DG1B 5C24B 3OVBA 4USVA 4Y28C 4MIVA 4KJDA 3WQPA 1Q95G 5EGHA 2FPHX 4RUBA 2XS7A 2KXFA 2EXUA 1TFWA 1B64A 1B7FA 2FLOA 5A8KA 2PA8D 1TUGB 1RK8A 4CDIA 4DQQA 1YWXA 3EVWA 1SC6A 2LKZA 3L7PA 3G82B 2QA2A 1X0FA 3V6KA 4JI7F 4ETZA 1SH2A 2GV1A 5F8JA 1FNXH 4USMA 1C0TB 2J9DA 2R7TA 5IV4A 2BJ8A 3BN7A 4F4WA 3TA1A 2HYIB 2K06A 4ZPAA 2KG1A 4F2RA 1ULRA 1RAGB 1WDDA 4DV3F 2F8MA 1TR0A 5JUMA 2IA0A 5AXMA 5D4NA 3TUIC 1QE1B 4DL2A 1U4BA 2DHAA 3AXMA 2AD9A 2XLKA 1LFWA 4GVBB 4FF4A 2JNJA 2VG5A 3BDFA 2LP4A 2N4CA 1WOPA 3FQLA 2QA1A 4Z2XA 3KLFA 3KK3B 3DRPA 2CADA 2U1AA 4YS2A 2QYGA 2ZC4A 4OFZA 3J7YU 2LQ5A 1DARA 1MN7A 1GK8A 3H90A 4FDFA 4X4TA 2HHHJ 1JB0C 5D15A 2MKKA 4YY3F 2ASLA 1KHLA 4LFCJ 5DLWA 3BREA 3IP0A 3AY0A 3SQGB 4QBUA 3OTCA 4YDDB 2OIHA 5L1IA 4ED5A 2X7IA 2IHR1 4RUCA 2HIQA 4KM4A 1VRQC 2O3DA 3BGOP 3UD5A 1VGYA 3Q3QA 1R6YA 3P5TL 4JI8F 4YB6A 5IWAF 1OYDA 1RUSA 2B9EA 2A1BA 3MMAB 4NL5A 3WC2A 1HQUB 1HQEB 1SC3B 4WFAQ 3OTOJ 3PXGa 2H65B 3IWNC 5EWEA 1TMMA 3AB2B 3W62A 2GVZA 5DZ6A 3TAQA 2M8DB 3DLHA 3EZUA 4CLPA 2NR0A 5GOVA 1TV6A 1U25A 3R9LA 2SXLA 4X66J 3DOMB 4CO3A 4Q45A 1BLUA 1GQEA 2V2ZA 3M30B 1R89A 2MZRA 1H73A 2WW4A 2XTJP 1C1BA 1WC1A 1D0EA 3DOKA 4DWIA 3QIDA 3N5FA 1RHJB 3FCVA 2RQKA 3OFHA 2Z30B 4P6QA 2WONA 3I56S 1RT3B 2CNOB 5KG0A 1PJ5A 3M2UB 3DOMA 4M5DA 1TMJA 4F02A 4A8FA 2EFPA 3QO9A 4KB7A 4R25A 4EEYA 1HA1A 1J5OA 4IFVB 1XMQJ 1TKXA 2EVZA 1KHKA 4KR0B 3UO0A 3HVTB 1TK5A 1LW0A 1MMNA 4JBCA 2E7VA 2AT1B 3FSYA 3KK2B 1EJ7L 3Q8QB 1HBMB 2DXDA 4R0EA 3T9NA 2GZOA 2HRYA 1O0PA 4IG3B 2HMIA 2IRXA 1NK8A 4ES3A 1CJTB 3MEGB 2AJ1A 2L41A 1FVSA 5KT5A 4ER8A 3CIZA 2YNFA 2FJDB 4ZLLA 1CJKA 1ITPA 2YH0A 3FBCA 2AV5A 4NRTA 3VGTA 2N3OA 4X4UA 3UN5A 2VBZA 4UQGA 5L39A 4WWSA 2W9CA 4I2QB 1S1VA 1EQMA 5DG9A 3CCUS 5B0GA 1RAEB 2HK2A 3CWJA 5LM7E 1X5PA 2VJVA 2VF3A 1UMJA 5DDQC 3NNAA 1JLAB 1UW9A 3CJ5A 2DNOA 3DLKA 4MIWA 5KFUA 2EG1A 4C8KA 2CJQA 2RS8A 2IRYA 2HGLA 5B0FA 1G7CB 4CO5A 2W9BA 1K1SA 2UUTA 3TUPA 4OLPA 1RWXB 1S1WB 3CB4A 5JMNA 2VBWA 4WYWA 3HHKA 2LLZA 2IMWP 2RAQA 3ENVA 3GTYX 3BQ0A 3HVAA 2XRGA 4ECQA 4O44A 4YN3B 2FVCA 5H9EJ 2RJZA 3CD0A 1HWLA 5CCMA 2HQCA 3A8JA 5D0GA 4DLEA 3QRPA 3NCQA 1HPZB 2M2BA 5CYJA 4YB7A 3HHNB 2Z2ZA 1FJ7A 2DISA 2ZFHA 3WAWA 2QA4S 1HFEL 2IFXA 1U47A 2A6MA 2RQ4A 2HIYA 1RCXB 2MLZA 3QQCD 3AODA 2L9WA 4KGXB 4GO5X 1NSQA 3I32A 4UW2A 3EYZA 1ELOA 2HZAA 3DYAB 4G65A 2L9NA 1X5SA 3EM1A 2HG4A 4FPIA 3T1HJ 4B3OB 3MXHP 1BQNB 3EJMA 3KLIA 4NLRA 4EMDA 2RMLA 4DS4A 3L3CA 4JI5J 1I1GA 5SZTA 2CQBA 2CJAA 4NX9A 1G6BA 5A8RB 1HNZJ 2JWNA 1MWYA 2D41A 3KDOA 2A6OA 2ZE2B 3H5UA 4KH1B 4H4MB 3N28A 2K2PA 1YJ9S 1S49A 3H42A 1KLNA 1AFJA 4O4GB 4ZIWA 3JS9A 2IFYA 5LSRA 3T1YJ 3BZQA 4CWBA 2DK2A 3DRYA 3MUTP 3D67A 4N7TA 1ZA2B 1B4SA 1XR6A 1N6QA 2DD8S 4RW9B 3CMQA 1VHIA 1ALKA 4PWUA 2BKNA 1S1UB 2QC3A 3JSRA 1ZPVA 4TU9A 1M5KC 4CYUB 2Y0SD 3MPDA 4MK8A 4I1TA 4UQTA 1P8GA 1VBKA 4CLTA 1NH7A 2ZH2A 1I51B 3FCHA 4RW9A 4DPTA 3PDNA 4ALZA 2BR0A 2H51B 2UVUA 2IDEA 4M1KA 1N36F 1CPZA 1KQSR 3W66A 4X4OA 2DCUB 2ZM6F 4UPHA 4ED3A 4JV5J 2RF2B 5HRTA 4ZG6A 2W5TA 5KG5A 4LFBJ 3A8EA 4LR9A 5IJSA 4FDIA 4PZVA 2BJDA 4B3TJ 3M8QA 2R8GA 1HWJA 4JYAJ 3W8PA 4FDJA 3D6TB 3CMES 3K8WA 2RNEA 5A6PA 3MAHA 4PG4A 3HZEA 1KFSA 1N54B 1T0TV 2EFVA 4DSLA 3KLEB 4JV5F 2WONB 1REVB 2D1CA 2H4YB 3EX7B 1P9QC 3I0SB 1WC5A 2R9LA 1U1QA 2WVCA 3R6GB 1F9EB 2Y1RI 2G1HA 2ZKUA 4PXCA 3NWRA 2DGXA 4YDXA 3W1YC 4WYLA 2DPJA 1WEXA 2ALZA 3KK3A 2FJXA 2P6SA 1S9GA 2K3KA 4PYDA 4I69A 2R8IA 2HGMA 4ZG7A 3P4UB 5LSLA 4Q5VA 5E3PA 1KHWA 1AXQA 1VLYA 2CDRB 4KGVB 3KJQB 2VKZG 2YKNB 4KQZA 5J1NA 5FDLB 3UE2A 4P74A 4DPUA 2BJEA 3B6BA 2FY8A 4OX8A 4CNYA 2B4VA 3KJVB 2C3PA 1CULB 5CYMB 1D9AA 3MMAA 4AYBD 4KTQA 2XC9A 2G0IA 3G87A 2R2SA 2V4RA 2HFUA 2XWXA 4HDGA 4X4RA 2HAFA 3DLGB 5A0YA 2HW3A 4GTXA 4F0HA 3KMSA 2HS3A 2IAJA 4U8YA 1YBAA 2KTQA 4GTZA 3SBMA 3RRKA 3JTPA 1O51A 3J81Y 4NYOA 4K50A 2NZCA 3JQKA 1SQFA 4OHYA 4LQYA 3NEKA 4P9SA 1AJAA 1TQLA 4QIVA 1S72S 3T5KA 1KHJA 1RT3A 3O44A 3KKFA 3TVZA 1IBCB 3G6ES 3LH2S 4GO7X 2G4BA 1H98A 4F3MA 4HYKA 4IFVA 2GX8A 3LALA 2YWGA 5IXUA 3R5GA 3VAIA 2JEFA 1IR2A 2GA7A 1URRA 4NLDA 4LRFA 5CYQA 1IWGA 4EO8A 2ERRA 2M7SA 3GJQB 2WAQD 3PX4A 4I6WA 1E1ZP 3I87A 1D8ZA 1RHUB 3JQJA 3W2VB 1A7GE 2YNIA 3LQVA 4F26A 4DR2J 3PW5A 2J6TA 4ZS6A 2JFKA 3V4MA 2QZ8A 1XR5A 2VV5A 3LTOA 3W61A 2GMLA 3IXQA 4NLTA 5F8IA 3ZC4A 1UA1A 1Q8LA 4LF1A 3ILOA 4Y2AA 2F8HA 2B4UA 4W92B 1ELXA 5F9LA 2AJ2A 4NA1A 1QTMA 4LSLB 1RWPB 2PA3A 2APOA 3W64A 1NO8A 4NYZA 1XC9A 3U02A 4CI0B 3WDOA 1RLDA 2DGQA 4DR4J 1PIEA 1DURA 3PHTA 4LFAJ 5BR8J 3R1HA 2QSFA 3NS6A 2H5EA 2CQCA 3LGMA 3Q83A 3WAXA 1KRPA 1YJTA 2BUNA 3G9CA 4DHVA 3Q8SB 2GO8A 3LA0A 5KFMA 5KT3A 1IKYA 3MI7X 2E66A 1DTQA 2YKQA 4ATNA 3OJSA 4WE1B 5ETSA 1K8AT 4DPYA 1CSJA 2W9CB 3DGVA 3WIUA 3V6DB 4IR1A 2HKEA 2J7KA 3NLCA 1S57A 2AJ0A 1KQGB 3OUYA 4FKXA 4LT6A 5J2MB 2MKCA 3ZO7A 3SZ2A 1TL3A 3NAIA 4L74A 4QOTA 8ATCB 3UD3P 2DH9A 2UVRA 1IXKA 1NLKL 4ECXA 3OTOF 1T9WA 4KGKA 4EK2A 2CUYA 3P8BB 5GMDA 1LW2B 2GFFA 5E3QA 2V9KA 1TELA 5ETQA 3CJKB 3TJAA 3V2UC 2F5GA 1IJFB 1DHMA 1HWUA 4O0NA 1ZOTA 2G0JA 3NP5A 4MJKA 4ZHRB 1AUKA 4HLBA 4CXKA 3LGNA 3CC4S 1HBNA 1PYOB 2FHMA 2QX0A 3N79A 4G1PA 2LU1A 3GE9A 4ITSA 2GIRA 4N8NA 4OZ2A 3IRWP 3LWMA 1P9YA 1N5SA 1TFYA 1Y6VA 1JJ2R 2W5RA 3B5QA 1TK0A 2ZE2A 1FNOA 4OX9J 3VAHA 3S1TA 3IR7B 3DCAA 3D2WA 4NRUA 2VPXB 3OHAA 1RYSA 3NKRA 2DR7A 1H3DA 4A46A 4DR1J 3Q8VA 1PO6A 2Y0BB 2UZAA 3DMJB 2RT3A 2W4CA 3H59A 2HNDB 4NXNJ 2NZ4A 3E8OA 2VDHA 1E2SP 1IBKJ 3NCPA 5E0OA 2FHKA 3BQ2A 4ZJOA 1RLCL 2BYCA 1XJWB 4CT8A 3SEOA 2YKOA 5KXAA 2X1FA 5BXIA 2PGCA 2X1GA 2LDIA 2MQQA 1WHYA 2ILZA 3LOUA 2PMZD 2RIJA 3ULHA 4BBYA 4X64F 4DR3J 1QUVA 1JWWA 3K7RA 3EGNA 3FGVA 4NLXA 1V9OA 3P96A 5D78A 4X65F 4N5SA 3KLGB 4DFPA 1RTDB 3LUYA 2C2RA 1RJJA 1WSRA 2HSEB 3FSXA 4M5JA 2V6AA 3HKZD 4KO0B 4UT4A 3A12A 1S1TB 1JLCB 2AEJA 5D4PA 4AL6A 4ECTA 2F3JA 3H5SA 4LRDA 1N56A 5EWGA 4WJBA 4F8RA 2CYYA 1WI6A 3KMQA 4RW6A 2W8SA 1N32J 4DQSA 3IGYB 1M1HA 2XMTA 4PUOB 1IKWB 3RZAA 1X7VA 3PRBA 1ZEDA 1Q86T 4WZMA 1CJUA 4QYRA 2XY5A 1EIYB 3QIPA 1TKTB 2YQ1A 1FKPA 1OQ3A 3DDIA 4F3QA 1IVZA 5KFKA 3MM9B 3CD6S 3HPOA 3MCSA 5KFLA 2D9OA 4DR5F 3BR9A 1YRUA 1BQMA 2PT0A 2CAJA 1VQMS 1NZ8A 3HZGA 1Q8IA 2F7VA 2AYBA 2QO3A 3HI9A 1NHUA 3D0IE 5E3RA 1YJ7A 4NWJA 1B8JA 4N77A 1RT5B 4LRAA 2Q66A 1ZS6A 2V8DA 3MFIA 3A3NB 1YJVA 4DX8H 1TKXB 3BKFA 3QAUA 4M5DB 4DV4F 3QO9B 3RGIA 3T1HF 1GH8A 4U6PA 3RAQA 3FEXB 3ZFVA 4AE5A 1QDUB 3DU5A 2AQ4A 4RBTA 4V1Ak 4M8LA 1FRKA 2PSZA 2W2QP 3IWXA 3QLHA 4JUZA 4NPOA 2F4FA 3VVTA 4CLZA 3BGRA 1CJTA 3K2YA 2Z4PA 3ONQA 3R5DA 3D66A 3X3UA 2GGPA 1U24A 3ENQA 2B7BB 4WKYA 4RZRA 3PIOQ 2VQFF 1V3RA 3UDEA 1CJKB 3K5MA 4ZGAA 2CZ9A 3GB0A 1GEHA 1UZDA 4G1QA 1Q7YT 1HNXF 1N2KA 1UVIA 2X98A 2G9OA 2MQNA 2QLFB 3DYAA 5HL7Q 1F2GA 2ZHAA 1NKBA 1RTZA 1VLOA 1HHSA 1S1VB 2V8VA 1HJKA 1IKYB 4TY9A 3PVXA 3CGIA 4LFAF 4CNZA 4WTOB 4DV0J 3EGVA 2A0FB 1VISA 2XI3A 3FMWA 2AEMA 1JLAA 1RQ0A 2LFVA 4FNHA 3TX8A 5F8LA 1S9FA 1W25A 2FLNA 5CD4H 4B9LA 4I56A 1RBLA 2VPYB 5E33A 5C7PA 4IO9Q 1S0NA 3GSIA 4NLSA 5KFQA 5D0HA 2Y1IA 3SSQA 3ZZRA 3J7AN 4L76A 2ZD1B 3IA0A 3SCJE 4YUDA 4DSEA 1HYSB 1U48A 2PFFB 3DRSB 5A2QU 1S6PA 4DV0F 2A18A 2I0XA 3GP9A 2DNLA 2HWHA 4CM2A 3W9HA 5J1EB 3OL8A 3C8YA 3HD1A 2DIUA 4CH7A 1S79A 3CVKA 2W2MP 4ZJQA 2NREA 3LXQA 4WXOA 3CJKA 1FO1A 1E33P 5IZHA 3FNNA 3CC2S 2HQIA 3J7A1 4HDHA 2DNMA 1Y3JA 1EJJA 1NH8A 1FJGF 2F9DA 5E5NA 4ZVTB 3CIMA 2GHPA 4CLUA 5GAEU 4JI7J 1AZSA 1O6XA 2C3OA 1WOSA 3MMCA 2HEKA 2DT9A 6FDRA 4YB5A 2W7OA 2DGUA 2NXJA 2OKQA 3EPGA 2MZJA 5G0RA 2BJ9A 3BPDA 3W5YA 3VALA 1K0VA 1BQNA 1CS4A 2HHSA 4OZJA 3SSRA 1RT4A 2KO1A 4KYZA 4NCGB 3TX0A 2ZZMA 1YSJA 3GIIA 3R27A 1YHQS 1YBUA 4Q2LA 3PX0A 1WC0A 3I0RA 3NAHA 3OW2R 1HNVB 1NU4A 2KRRA 2QLWA 3IRXA 4Q8EA 1RT7A 4GTWA 1OSCA 3M8WA 4U7CA 3PCOB 1GT8A 3GCXP 2HHHF 1SIZA 3OHBA 5LRNA 1K73T 1IKXA 4DJBA 3PV8A 3T00A 1ZAVA 3SSSA 4FKYA 2J0QD 1ZEBA 2JC0A 2QZUA 5H9FJ 2IUCA 4TY8B 1N34F 1NSKL 3HHLC 3OQ2A 4LF9J 1VQSA 4P73A 3IN5A 2D69A 2HLUA 4NCAA 5DM6Q 4DR3F 3LPYA 1O5JA 2B56A 2MQ8A 3MZIA 1QE1A 2UV8G 4HT5A 4NLVA 4DR7F 1F0XA 4IH5A 4UOOA 3KUHA 3FZ2A 2CDQA 3G6XA 3CUNA 4DR6J 3NXZA 5L9XA 3BDEA 3GFHA 3PNIA 3KFWX 1EZZB 2MEWA 3FUYA 3KLFB 3CF5Q 1IKWA 2LXFA 3R97A 2CG8A 2RB7A 3B8HA 3CCSS 1JXEA 1UW4A 2JOQA 2Z58B 3BO4A 5L9NA 3D6HB 2GSOA 4OX6A 4UOGA 3NS7B 1FEHA 2CQDA 3CJSA 4USTA 5GAHU 2W5SA 4F3OA 3G8QA 2MKSA 4EYIB 1XNQJ 2C2NA 1IWAA 3VR1A 2IAJB 1ZYQA 3I4HX 2IC3A 4B9SA 4CXUA 1VHFA 4K5RA 4TQRA 3H4DA 2VA2A 5IM0A 4JI1F 1W7WA 4X62F 1ELYA 4OV1A 1L3SA 4LRBA 1JJ4A 2PEBA 2CPEA 3BPSP 3KTQA 4JV2A 2YPZA 2Z0GA 1S0MA 1KQKA 1KOOA 1FXRA 1S6OA 2AP6A 4MYTA 4A8SA 1GXUA 3TQ1A 4CO4A 1BUXA 1HWKA 2F63A 3KLGA 5ETKA 2ZUGA 2M3DA 2DY1A 4AUKA 1NB2A 2B9XA 2GJFA 3KLHB 4KAVA 2FTRA 1C2PA 3CW2C 2BM1A 1FRLA 4G6VB 2E9TA 3FFIA 3MECA 3TWZA 4DL7A 2FJWA 1GX5A 1LWEB 4DL3A 4CTAB 2EWHA 3PFOA 4L75A 5LJ5Y 4K2XA 1EETB 4OHWA 4FS2A 1OY6A 3R7NB 4ILLA 2ZEJA 4OYBA 3TA0A 5JXSA 5GAGU 2BQ3A 1NKEA 1GXLA 1S6UA 3IR6B 2MY7A 1P27B 3JYTB 4H54A 4F4AA 5JVGQ 1FKPB 2XMWA 4JI0J 4RNMA 5CXTA 3KD8A 4WP9A 1B0VA 2IYGA 4MT1A 4OZ0A 1NJZA 2C2ZB 1R8AA 1QSSA 5H1SV 2ASYA 5IT9Y 2M52A 3QPIA 4ECZA 5HROB 2BXJA 3W7BA 5D0RA 2A2DA 3WBZA 4KHPJ 3OR1B 1TL1A 4U7UK 1TKZA 4YR1A 4EYHB 4DX7A 1DTQB 3JSMB 4O23A 3KG0A 4P10A 2HFSA 2DR9A 4DN0A 4R8UB 3ZZTA 2W2NP 4ICLA 4MHXA 1NK0A 4Y2MA 1VQNS 3T6BA 1GMUA 3S01A 3W9JA 2C2OB 1VRTA 4D3HA 3JSMA 3L9ZA 5IS2A 2VD3A 1T3OA 3LP2A 1OJ4A 3VQTA 5HMZA 5HSPA 2HK3A 5EX3A 2AW0A 3JAMY 3D54A 3OR2B 1GAOA 4OX9F 2QMWA 1QAJA 2HVIA 4Y2CA 3KYLA 3RR7A 2U2FA 4QIEA 2MSTA 4PRFA 4RKUC 5DQIA 3BKTA 3CDEA 4YR2A 4FPRA 3CO9A 4AXIA 3VVUA 4LF6J 1NK9A 1WTFA 1KH7A 2JHEA 3QYYA 1QY7A 3OXFA 4IQXA 1AA1B 4J9MA 1SPBP 1T05A 4USJC 1O98A 2OSQA 2OFGX 3M2VA 2AGQA 2FUG9 3GFXA 1N5YB 2KXNB 4JI4F 1FSUA 4ED0A 4DSJA 3QZ8A 2I9SA 1BXNA 2FD2A 3CE8A 3PW4A 3NKOA 1PC4A 3UPFA 2WVBA 4B3MJ 2IM1A 4AT1B 1UJ5A 1R7IA 3T3FA 1M90T 1YG0A 4FYVB 4P71A 1RT2A 2CJKA 2BV3A 2DGWA 2MQMA 4O0IA 1DY3A 1JMTA 1RYRA 3ZZYA 4RU2A 4O3QA 2ZNZA 3GLJA 2C2EA 2VG7B 2RH6A 3ENAA 4YR0A 3BDGA 4USUA 2FDNA 4NA3A 1NJXA 4M5IA 1ZPWX 1YK9A 2KHCA 1IBMF 1FTCA 1KTVA 1RTHA 2D9PA 3BKUA 2JC1A 4MIBA 4RLEA 4XK8C 5HVFA 3IO1A 4D3GA 5D3GB 1IBKF 5AT1B 4EGLA 1HL6A 1NCLA 1TP7A 3J80Y 4DUZJ 1QVGR 3G71S 4DF4A 2DRAA 1CJVA 2DNYA 4JI3J 4OZNA 3OL9A 2LA4A 2HHUA 3E2DA 3GJRB 3MM7B 5AJ3J 3PEHA 2LEAA 1DQ8A 1SJRA 1K47A 2LDYA 3NMAA 2XWYA 2DTJA 3NGKA 3QMQA 4ZVSB 4CLLA 3PX6A 3CMRA 2LQ9A 5KFZA 3HMJG 1WHVA 4WK3A 1GTEA 1LWXA 2Z8QA 4QWBA 3DI6B 4X65J 3TOQA 2ZH9A 1CEZA 4NWXA 2XEXA 5K8PA 1ZTTA 2DHHA 2HHQA 2PMHA 5D4OA 1SBRA 3R5JB 4DV2F 1ZM4A 4HR2A 3OFEA 2ZBCA 2YXLA 2VFVA 1Y9OA 3BN4A 3OTBA 3TYTA 2K3IA 4J5OA 1Q78A 3CDAA 1X60A 3ITHA 4OZ5A 5K9FA 1MMLA 5DS7A 4DX6A 3T5JA 2ZH5A 3O1LA 3AHPA 2XY7A 2BJ1A 1PJ7A 2BA9A 2NCKL 1XIQA 2J9CA 4L3KA 3TRGA 2J6SA 1Q7LB 1U0HA 2GJ2A 2XI2A 2B51A 2CIMA 3MEEB 3QSIA 3V4IB 3KXDA 4DQRA 2RU3A 3K89A 1T7PA 5I42A 2DXFA 3R8YA 1R0AB 2H4WB 3BH6B 3ZZUA 1KD1T 5C66A 1RTJB 2EG2A 1RCOB 2H5JB 3FBEA 1R8PA 2AYEA 2MZSA 2YBVA 4HT7A 2PC6A 4PG6A 3ZTOA 1Q0NA 1W2IA 4F0KA 4ZCIA 3D28A 1X31C 1HR0J 2UXCF 2XBPA 2PD1A 1J27A 2WOMB 1YRXA 3DU6A 1S9GB 4B3RJ 2KL8A 2WK4A 3OBIA 4ZVRB 2KDOA 3UVJB 2UXBF 4ZVHA 1X4EA 1FERA 2AWZA 2HLTA 3SIPB 1WKKA 3FSIA 2OEJA 5IOLA 2DPIA 2V8GA 4PWDB 1TAUA 2O5DA 1T11A 2RRNA 2ZUAA 3N6LA 4Z7CA 5GVQA 4IG0B 4GC7A 2YVSA 3A13A 3FRZA 1UL3A 3Q8PB 3BS9A 4QYZK 3H2VE 1X9MA 1YX2A 4PXBA 3IBWA 1IBLJ 4NLGA 2UXBJ 2E5LJ 4NCBA 1CBKA 1BD6A 1UP1A 2NXEA 1FWKA 4ZDNA 5KAKA 3OFGA 4LF4F 1G3OA 1HNXJ 4TVAB 3VF0B 2RE1A 2KVIA 3DKDA 4DL6A 1HI1A 2JZ5A 5RUBA 3VAGA 1RAHB 1SH0A 2DNRA 2DYAA 2GVDB 3Q8RB 1FJGJ 4ES2A 3K0JA 2XNQA 3R5CA 4O3PA 1K9MT 3UCUP 4CT9A 2W1BA 3MAQA 2FJEB 3EZOA 1GMVA 2B7CB 2XCAA 1HNZF 1FRJA 5IC6B 4ERDA 1JNRB 2OPPB 1JXLA 2WVDA 1WC4A 3C3LA 1O8BA 4DS5A 3PJ9A 2CVIA 4OLOA 2BKOA 3SFUA 3QAEA 1WACA 2I38A 2VC0A 4C3MA 4ZITA 1VFJA 1SKUB 1WC6A 4A47A 1M5VC 5KFTA 1HMVB 3K5OA 4NEZA 4U7UD 1D1UA 3NGTA 2GGPB 2YKAA 3FCWA 4L3NA 2KKHA 4B9TA 4O3RA 4QYZJ 3E01A 3NGRA 4GKKJ 3JYTA 5EGEA 1FK9B 3AQPA 1N5YA 2YKNA 3BGLA 4ZPCA 1VIOA 1FWLA 5U47A 2VFSA 3SFGA 3QJPA 3VAFA 5AXKA 2VC1A 2YX4A 4Y0FA 2KU7A 3GFYA 3OR1A 4DV6F 2ADCA 2Q6BA 1UVNA 2RUGA 1UZHA 1OPZA 4LBPA 4RWWA 3DLGA 5A0YB 2XY6A 2MKIA 1X4DA 1RAOA 1WF1A 3CJ2A 1UCNA 2QRRA 1NPPA 2J5AA 5B0DA 2RS2A 1WG4A 2D3O1 1FKAF 3T01A 4JYAF 1GMWA 1RKIA 2GO9A 4KFBB 3SDEB 3Q24A 4MMOA 3BGFA 3GU0A 4N56A 1U45A 1KLMB 4R5PA 2L08A 3EUNA 4RW4A 4JI2F 4ES1A 5KFBA 4TY8A 2XQCA 2QFIA 1Y10A 5AXLA 4FN5A 3ETOA 5HJXA 2MKYA 2J8SA 1TL7A 1GFWB 4BWMA 1EP4B 1HI8A 2V4JB 3AB4B 2J7WA 3KK1B 4BS2A 3RTVA 2YNHA 3ISZA 3QGIA 3EDRB 1D3WA 4R0JA 2AZ1A 3UW1A 1R27B 2BE2A 5B09A 4H4KA 3OTEA 1OY8A 1M1GA 4JI1J 2RHQB 1FT8A 2BVZA 5KG2A 4ZPBA 4I7FB 1XERA 5G0RB 4LF7F 1RA6A 2HQFA 3VQSA 3K5LA 2GQ2A 1VK3A 2D74B 2MHEA 4K7QA 3VTIA 1NDPA 5C42B 4P2MA 3KLEA 1VS3A 4LVOP 4F4ZA 5AXNA 2ZJQQ 2FLLA 1HARA 1P1LA 1RHMB 2BDPA 2B4PA 3TG0A 3BR8A 2FZGB 2XMVA 1R6VA 4KBIA 1S6QA 5HQMA 2R7VA 1ANJA 2BABA 5J2NA 1R8CA 1QJHA 1ROFA 2M8HA 2ZZTA 1KQFB 4O3NA 4DCPB 2FGOA 4NLUA 3WZ0A 5I42B 3KJNB 4MKBA 1M5SA 1Q8BA 1RT7B 2XMUA 2BJ7A 2OPSB 3UQSA 3ZNJ1 4E8UA 4QW9A 4E98A 1KVKA 1X4HA 3MPYA 4LSNA 3B4MA 1HIYA 2GQCA 5BYRA 2G13A 3NGDA 2JEGA 4OI3A 1IKXB 3PJXA 4DFMA 3KUGA 2EW9A 4QR0A 5C2CA 4KAIA 3RYLA 3LP1B 5DG8A 1NAQA 3E3XA 5TJ3A 3A8KA 5AE1A 1Y7PA 3PO4A 5KOXA 2J9EA 3EVOA 1LW0B 3QT8A 4A4JA 1GXTA 2E29A 4ECWA 3MM8A 2FZCB 2V4QA 4PKDB 4C8NA 1U8SA 5CZVA 3FFIB 2CFXA 2YTCA 4Y6IA 4IG0A 2I2YA 4IOAQ 3VAMA 4J9OA 2MMYA 4XPEA 4PEOA 3N6NA 2GC8A 4B9MA 4PG5A 2XULA 4F4KA 2JX2A 3JTNA 4CXSA 1A0OB 2G9YA 2PI4A 4OI4A 1IQTA 1XWLA 3DFEA 4RUHA 3PY8A 3HXMA 1FFWB 2CPIA 5KFOA 2EK1A 1HHTP 3SZYA 5LQQA 3KOAA 1N88A 1TV6B 3ITHB 4I2QA 2ZH6A 4OJGA 1HNIA 5THWA 5L8RC 2OEKA 5K8MA 4DOZA 4FF1A 1M0SA 2CVEA 1B7YB 2FJVA 2CPHA 2W7AA 2MY8A 4Y34A 4MKYA 4HHJA 3LP0B 5FLXY 1NDLA 1YGYA 1NEEA 2DNQA 1HR0F 4UUWA 4ECUA 1ED9A 4RU9A 2LQBA 2OPPA 4DV7J 1B0PA 1E6YA 1ACMB 2OMOA 4MYUA 1QSYA 4A8KA 3CCVS 1SJQA 1W2BR 2YKMB 1KHVA 1BQMB 1UA0A 1CC7A 5DQGA 4M5LA 3QSYB 2EFNA 1N52B 2BRLA 1OIAA 2IVFB 5IT0A 3PJWA 1RT5A 4A8XA 1RWUA 1U0SA 2BRKA 2F65A 1FDDA 3H2LA 2MKJA 3GJSB 3KUEA 2HHPA 1Q5VA 1F5AA 4LSLA 1NSAA 3M32B 3KJVA 1O99A 2B5JB 2VPZB 3M6WA 2NSCA 3MM6A 5HANA 1IR0A 4UY85 3N9UC 1TKDA 3MEGA 2HWTA 2PDAA 4ZLNA 5KT2A 3DDNA 4FNIA 5KFHA 2LECA 4M5MA 3T1YF 3RB3A 3DGPB 3QATA 2B5JA 2KXHA 3DRXA 3MM6B 2V94A 3TI0A 4ELUA 1LWFB 3AOCA 4DUTA 3HP6A 3M6VA 2NSBA 4ZVGA 1KEKA 1KOHA 1L3KA 5ETNA 4K4TA 3V6JA 4BC9A 4EUVA 2IVYA 2I8EA 2PIIA 2R7WA 3DLLQ 4O3SA 1V6HA 2KG0A 1RACB 1YJUA 3ETMA 4RJVA 2DY9A 4K4ZA 4TYBA 3CDBA 5EHHA 1KC8T 2DIVA 3ZTSA 4XAKA 4XTTA 5ETVA 2YWKA 3TJ9A 3R1LA 1B0TA 2ILYA 2O01C 2C28A 3ED4A 1DJ0A 4OQJA 4NASA 1Q8KA 2R8HA 1S59A 3NMRA 1UKUA 1WG1A 2HBQB 4IDKB 3UFCX 3QT6A 3CXCR 1S76D 2DNPA 3DDKA 1YRTA 3I31A 2WBMA 2IVMA 3LP2B 4MIAA 3RRHA 1RKJA 1VCTA 1C1CB 4LBHA 3TA2A 3RAMA 4USHA 1EB0A 4AFFA 4HHUA 1QM9A 1C4CA 2CKWA 4QIWD 3W9IA 2MXYA 4LVNP 3BSNA 5HP1A 2JEJA 2ZC3A 1T03B 2VOOA 3HT3A 1WDTA 2DCLA 3MWBA 3U1LA 4DL5A 5AJ9A 2RDIA 1V3SA 1S48A 1X4GA 2POKA 3BSCA 3C6TA 4LREA 3UDCA 4FF3A 1P1TA 3RU0A 1QLNA 2Q3PA 4Y3CA 2EKNA 5HK4A 3BB5A 3DXSX 2MGZB 2BOPA 5L0BA 2CJ9A 5DQHA 1PYTA 4NYPA 2D3UA 3GCWP 3HLUA 4H4MA 1X4BA 4WXWA 3W8GA 2E1PA 6AT1B 1BHNA 4RO0A 5E3CA 2UU9F 1FA0A 1YJRA 2F9JA 2XSJA 1RAAB 4A8MP 4LIWA 4NWBA 2P2CB 4J9PA 3QGPA 1X5TA 2DGOA 3LP1A 3GONA 3NGSA 3BDGB 1HHQA 2DRDA 2JVRA 1RDRA 1S1UA 4MFBA 2FVRA 1CC8A 1SH3A 3NRBA 3D0HE 4DL4A 2QLXA 2W25A 1IUJA 2YNHB 4OZ3A 1MG7A 2BX6A 1U09A 2ZD1A 4MKAA 5LMUJ 5IT9U 2MTLA 4CH1A 1IQZA 4LF4J 4GVBA 1RT6A 2VASA 1FDAA 2WSCC 4QJVA 1RTIB 4MFBB 1VC0A 4IR9A 5DETA 1L5UA 1EW9A 5EDWA 4KV8A 4LIRA 1U2CA 4DPXA 2BM0A 2K1RB 4ZK7M 3MMJA 1T94A 4HKQA 2IM3A 3FZBA 1VQ9S 2X1AA 3IBCB 4CZCA 1YITS 5DG7A 1J2VA 1FWPA 4CIOA 5KFPA 2DHGA 5D77A 4V19X 3DI6A 1QAIA 1VRUB 3HKWA 3EICA 5L1JA 1E6VA 4DFKA 4B3RF 2R7QA 1TTHB 3MEDB 2A3JA 5J2QA 4E0DA 3LW5C 1PSDA 4DPWA 2D3OR 2B43A 1X0PA 4LF2A 4TLQA 3ILIA 3QWPA 3QRRA 1KN6A 3O8WA 5E3AA 5JJBA 3GYGA 3TAMB 3B54A 4DN9A 3OVAA 3M9NB 2W4DA 2ZWOA 5B7WA 3I0SA 1U1LA 2IC3B 3MR6A 2HS0A 4Y65A 3UDVA 4ZPVR 3OLBA 2H54B 1VYAA 3AJDA 4CO1A 1FX4A 2E7WA 2F1FA 3A8IA 2O1PA 2GA3A 2CQ2A 2OTLS 4GMKA 1N33F 4ZVPB 1RADB 1IKVB 1YIJS 2WSFC 3C16A 2KT5A 2W2OP 1S4FA 2DITA 2MLXA 2G0CA 3MD3A 4UTGA 1IR1A 2DGVA 4QPXA 4BC7A 1Z2ZA 4YFUA 1N48A 1JLQB 5IT4A 1FTRA 3CC7S 4WPAA 5KFYA 2QIFA 2HFZA 2ROEA 2W9AA 1AROP 3K17A 2E5HA 1FRIA 2NXNA 3B4DA 3EDQB 3KK2A 1HMVA 3NGUA 4HVZA 4P2FA 5K8NA 4B02A 2KRBA 2CPJA 4TYAA 2VICA 1B70B 4DSIA 2M4MA 2YY3A 4I68A 5HMWA 1F9FA 2HMIB 5CYMA 3SQGA 1N5VA 2CZ4A 3TZZA 1SL0A 4UY8T 2MJNA 2EC0A 1S12A 2GLQA 2AJ4A 1D8YA 2VPWB 3AOAA 2VFRA 4OYAA 4DV5J 1TVRB 5H9FK 1DZ5A 3K58A 3JSBA 2YKPA 1EQ0A 2WHOA 4A8OA 1WHWA 1U1MA 3KHRA 2HBYB 4ANCA 2BKPA 4ANEA 4F50A 3EE3A 3J81j 2DNNA 8AT1B 3BDPA 1URBA 3POTB 2JSXA 2A2CA 3D6MB 5KFXA 4C97A 1SV5B 3ILJA 2BBEA 2I6WA 2YNGA 1Y11A 3HULA 1RBOB 1V5VA 5HVHA 2AGPA 3KDNA 4OZLA 5KG1A 1TL3B 3OVSA 2W7PA 2LEPA 3RBXA 2IYIA 1JLEA 4R8UA 2XGQA 3HM9A 2IIHA 1DQ9A 4DUZF 3AH6A 3R6LB 1SIWB 2JH3A 5EX0A 4AQYJ 4OI6A 1NSPA 4A8QA 5J1PA 1H72C 1QAXA 2MQLA 5CD4A 1T03A 2LQJA 3DLEB 2W8DA 2WTFA 9ATCB 2C3YA 2XR9A 2O66A 3DOLA 1H6KX 5ETMA 4ECYA 2FC8A 3H8YA 5HATA 3WIVA 2XS5A 4N41A 1FFGB 2LXUA 3WHIA 4ZKAA 3OFFA 3ZZOA 1X9WA 1YQHA 2P9CA 1SHQA 1X9SA 3IMQJ 1DRZA 5FJ4A 5KFEA 1Y0HA 2XZDB 1HI0P 1KP6A 2V2KA 1HBUB 3FEYB 4DUYJ 2N3LA 4YEAA 2IM0A 4F4YA 1BWVA 4H4OB 5HVGA 4WE1A 5EWFA 2A10A 2KT2A 3HFKA 1SKSA 4CLWA 1ELZA 2RVJA 3DRSA 3GIMA 1WORA 5LIAA 5J1EA 1H2VZ 4YQWA 2Y1LB 1H38A 2UUAJ 1H74A 5F0WA 4ZLJA 5GADI 4OL8A 1RWVB 2PMWA 5CA5A 4UPIA 1OSDA 1RU1A 2CPDA 3D3BJ 1FFSB 4NI2B 4URGA 3BYPA 4ID5B 2R7RA 1FXDA 2PEHA 2ZHBA 1EP4A 3KK1A 2GSNA 3BSAA 5GAHI 3BO3A 5GAGI 5B0CA 4URQU 3PZPA 4BDPA 4NXNF 5B0EA 1KVIA 3NVLA 4UPLA 3SI8A 4OYOA 3M8ZA 3PYDA 4ELTA 1NK5A 2BE2B 4NMLA 1U2RA 5A8KB 2L9DA 4WF9Q 4RNFA 4Y2KA 5J2PA 4RUAA 1RE1B 1S1XA 3D9BA 1LXNA 1QD1A 5FIIA 1N4LA 1UVJA 4ED4A 5IQQA 3OJUA 1GX6A 2UVWA 1U6BA 5HQLA 2I5JA 5HMYA 4GKJJ 1UJ4A 3M9MB 1NDKA 4HL9A 4KH0B 4ZPDA 2XGPA 2QMXA 2QA4G 3THVA 2E1CA 1SJ1A 2DHSA 3TUZC 1IJEB 5L46A 3UCZP 1VC6A 4PCQA 3SV3A 2MZTA 1M1KT 1S6QB 1U7LA 2ANHA 2P9EA 1ZA1B 3H25A 1FD2A 2B0GA 2CRLA 1VQYA 2JVOA 2KJVA 5LOQA 4UZBA 4HACA 4DR4F 5LMUF 3LAMA 5K14B 1J5EJ 2AKWB 4I6AA 2NLWA 2JLEA 3JTOA 3C16B 3GR1A 3MAAB 3KHGA 3IS9A 3TANA 2OPSA 3Q2SC 4BHQA 1T3NA 4KPCA 3AA8A 1EX8A 3D1HA 2X1BA 3ET6A 3H20A 3MR7A 3KHHA 4Q44A 2BANB 3U7JA 3NBPB 3MCMA 1NPRA 1Y5LB 3J80U 1YTYA 1N6QB 3CJRA 4J9LA 1RWWB 1HKAA 3MM8B 3Q22A 3RW6A 2RILA 5KFJA 2KH9A 1JX4A 2E5IA 3MR2A 2HURA 2AZ3A 4G1IA 4CYUA 5HMXA 1GNKA 4DFJA 1U1RA 1SKRA 2DO4A 1YKWA 1WJ9A
chains in the Genus database with same CATH topology
4CXUA 1B8JA 4NWXA 4LRAA 5INHA 3SZZA 1ELYA 1ELXA 1AJCA 4LRBA 1KH5A 1URBA 2W5VA 2W5WA 3ED4A 3T02A 2ZKTA 1ED8A 1EW8A 3MK2A 4LR8A 4KAYA 3DPCA 5DLTA 3BDFA 2IFYA 1AJBA 1Y7AA 4KAVA 1E3CP 3TG0A 4ZGAA 3WAXA 5DLWA 1N2KA 5DLVA 4N7TA 1KHNA 2X98A 3IDDA 1ANJA 3TWZA 1ALKA 5AJ9A 2W8DA 1KHLA 1URAA 1EI6A 3BDHA 4B56A 1HJKA 4LREA 5TJ3A 5C66A 3OT9A 2XR9A 4KM4A 5IJQA 4LR7A 5L0BA 1ALJA 1AJDA 3Q3QA 4KJGA 3WAYA 1SHQA 3KD8A 5GOVA 3M8YA 5L0KA 5HRTA 3BDGB 4ZG6A 2W5TA 5GRRA 4LR9A 4YR1A 4FDIA 1ELZA 5IJSA 1HDHA 3LXQA 4FDJA 5LIAA 1AUKA 1E33P 4CYSA 4CXKA 5K4PA 3UN2A 2D1GA 4CXSA 3NKPA 1EJJA 4MHXA 2IUCB 2G9YA 1O98A 4UPIA 3M7VA 2VQRA 2W5RA 1EW9A 3B5QA 4TN0A 3UNYA 3SZYA 1KHKA 5LQQA 3UO0A 4UOPA 3NKMA 3MK1A 2GSNA 1ANIA 4UPLA 3NVLA 1P49A 3NKRA 4UORA 3M8ZA 3TX0A 1E2SP 4UPKA 1ALIA 3A52A 1ED9A 4ZG7A 3NKQA 3UN3A 1KH7A 4LR2A 1KH4A 5KXAA 4CYRA 1K7HA 3UN5A 1SHNA 1HQAA 3IGZB 4GTWA 3DYCA 3M8WA 2W5XA 1ZEFA 3WBHA 4ZG9A 1EW2A 5LRNA 1FSUA 5EGEA 3T00A 1ZEBA 2ANHA 3NKOA 5LRMA 1O99A 2QZUA 2IUCA 5L0EA 4GTXA 2GA3A 2W5QA 1KH9A 4LRDA 4GTZA 1Y6VA 3IGYB 2W8SA 4MY4A 4UOOA 2RH6A 4QAXA 1N2LA 4UPHA 3NKNA 4LQYA 3BDGA 1AJAA 2GSUA 1ZEDA 1KHJA 2XRGA 1ALHA 3MK0A 4MIVA 4KJDA 3T01A 5EGHA 1EQJA 2GLQA 3E2DA 3WAWA 2GSOA 4LRFA 4LRCA 3WAVA 2W5SA 1E1ZP 4GTYA 3CMRA 4NWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXU A;  1B8J A;  4NWX A;  4LRA A;  5INH A;  3SZZ A;  1ELY A;  1ELX A;  1AJC A;  4LRB A;  1KH5 A;  1URB A;  2W5V A;  2W5W A;  3ED4 A;  3T02 A;  2ZKT A;  1ED8 A;  1EW8 A;  3MK2 A;  4LR8 A;  4KAY A;  3DPC A;  5DLT A;  3BDF A;  2IFY A;  1AJB A;  1Y7A A;  4KAV A;  1E3C P;  3TG0 A;  4ZGA A;  3WAX A;  5DLW A;  1N2K A;  5DLV A;  4N7T A;  1KHN A;  2X98 A;  3IDD A;  1ANJ A;  3TWZ A;  1ALK A;  5AJ9 A;  2W8D A;  1KHL A;  1URA A;  1EI6 A;  3BDH A;  4B56 A;  1HJK A;  4LRE A;  5TJ3 A;  5C66 A;  3OT9 A;  2XR9 A;  4KM4 A;  5IJQ A;  4LR7 A;  5L0B A;  1ALJ A;  1AJD A;  3Q3Q A;  4KJG A;  3WAY A;  1SHQ A;  3KD8 A;  5GOV A;  3M8Y A;  5L0K A;  5HRT A;  3BDG B;  4ZG6 A;  2W5T A;  5GRR A;  4LR9 A;  4YR1 A;  4FDI A;  1ELZ A;  5IJS A;  1HDH A;  3LXQ A;  4FDJ A;  5LIA A;  1AUK A;  1E33 P;  4CYS A;  4CXK A;  5K4P A;  3UN2 A;  2D1G A;  4CXS A;  3NKP A;  1EJJ A;  4MHX A;  2IUC B;  2G9Y A;  1O98 A;  4UPI A;  3M7V A;  2VQR A;  2W5R A;  1EW9 A;  3B5Q A;  4TN0 A;  3UNY A;  3SZY A;  1KHK A;  5LQQ A;  3UO0 A;  4UOP A;  3NKM A;  3MK1 A;  2GSN A;  1ANI A;  4UPL A;  3NVL A;  1P49 A;  3NKR A;  4UOR A;  3M8Z A;  3TX0 A;  1E2S P;  4UPK A;  1ALI A;  3A52 A;  1ED9 A;  4ZG7 A;  3NKQ A;  3UN3 A;  1KH7 A;  4LR2 A;  1KH4 A;  5KXA A;  4CYR A;  1K7H A;  3UN5 A;  1SHN A;  1HQA A;  3IGZ B;  4GTW A;  3DYC A;  3M8W A;  2W5X A;  1ZEF A;  3WBH A;  4ZG9 A;  1EW2 A;  5LRN A;  1FSU A;  5EGE A;  3T00 A;  1ZEB A;  2ANH A;  3NKO A;  5LRM A;  1O99 A;  2QZU A;  2IUC A;  5L0E A;  4GTX A;  2GA3 A;  2W5Q A;  1KH9 A;  4LRD A;  4GTZ A;  1Y6V A;  3IGY B;  2W8S A;  4MY4 A;  4UOO A;  2RH6 A;  4QAX A;  1N2L A;  4UPH A;  3NKN A;  4LQY A;  3BDG A;  1AJA A;  2GSU A;  1ZED A;  1KHJ A;  2XRG A;  1ALH A;  3MK0 A;  4MIV A;  4KJD A;  3T01 A;  5EGH A;  1EQJ A;  2GLQ A;  3E2D A;  3WAW A;  2GSO A;  4LRF A;  4LRC A;  3WAV A;  2W5S A;  1E1Z P;  4GTY A;  3CMR A;  4NWJ A; 
#chains in the Genus database with same CATH topology
 1T9V A;  2EC2 A;  2Z56 B;  3CT9 A;  3SYZ A;  4K4U A;  2HQ3 A;  3E51 A;  2NQP A;  2GIF A;  2QT7 A;  4MH8 A;  1RSC A;  4ZP8 A;  1JLB B;  5KFV A;  4B3M F;  2RKI B;  5CAB A;  2V34 A;  3R7B B;  3DN9 A;  3DLB A;  2W5V A;  5HAO A;  2W5W A;  2G1D A;  2ASJ A;  3V81 A;  2HRT A;  1LKZ A;  1OYE A;  1LK7 A;  3MM9 A;  4TU7 A;  1FDN A;  2VQF J;  1VQL S;  4LMZ A;  4LR8 A;  3L95 X;  1VQ6 S;  1F60 B;  3BBC A;  5C25 B;  2EFQ A;  1NM2 A;  2HND A;  1WKL A;  3H98 A;  1NK6 A;  1S77 D;  4GVL A;  4OYZ A;  1AJB A;  2DGS A;  1M5O C;  3FBB A;  1E3C P;  3MM5 A;  2Y8W A;  4X2B A;  4OJ1 A;  4J9K A;  2Q43 A;  3IDD A;  4OJH A;  2UV8 A;  4KKO B;  4PYA A;  3MUR P;  3BBF A;  4J9V A;  1PGZ A;  1JKH A;  4DZ6 A;  5ADZ A;  1WC3 A;  1XK8 A;  1WG5 A;  3CO0 P;  4DF8 A;  1C0U B;  1SQE A;  4CTA A;  2C3U A;  1ALJ A;  4KJG A;  1AYE A;  1W26 A;  2QL7 B;  4KKO A;  2HHT A;  3R7S B;  3O6Q A;  2HZV A;  1F5B A;  3FVY A;  4FVM A;  3L7U A;  1ZM9 A;  5CH7 B;  4IH6 A;  3DPC A;  1KNZ A;  4UOC A;  4YHH J;  4FBU A;  4OYP A;  2OEM A;  1Y4Z B;  4DQP A;  1PCA A;  4MKV A;  4PUO A;  1RP5 A;  4ZCM A;  3PG9 A;  3D0G E;  2CQH A;  1FRH A;  2L48 A;  3KWM A;  2HVE A;  3L4B C;  4K8R A;  4ZCK A;  1KR4 A;  2XLJ A;  1RT4 B;  2R7S A;  2JLG A;  1Q16 B;  2D1G A;  2VHG A;  2DJW A;  2AU0 A;  4JI2 J;  3R5B A;  1PAU B;  4DCO B;  4QU7 A;  1S1W A;  2OD4 A;  3Q8U A;  2R2T A;  1R31 A;  3C15 B;  3D1Q A;  3UNY A;  1JLG A;  2AX0 A;  2J8A A;  4AND A;  3OXG A;  1SUQ A;  4BCA A;  3CCM S;  1KON A;  4O44 B;  5KFD A;  4QCL A;  5D8H B;  2DGT A;  5GME A;  1REG X;  5ITH A;  4Z7Y A;  2VIH A;  1UWB A;  3FQK A;  1JLE B;  3RB4 A;  1NK4 A;  1YBT A;  2OPR A;  5T41 A;  2N82 B;  4AD6 A;  2E5J A;  3C14 B;  5B0B A;  4QWC A;  1HQ2 A;  4UOH A;  3HD2 A;  5J2M A;  2CWK A;  1QSL A;  3W2W A;  2CJY B;  1HD0 A;  4LR2 A;  3K59 A;  2ZDP A;  1SHN A;  5HQ8 A;  4USK A;  3LAK A;  1Q81 T;  1S0V A;  1ZEF A;  2DNG A;  3WBH A;  2IRU A;  1TAQ A;  1JXV A;  2ZWP A;  1C1C A;  4ID8 A;  1RAI B;  4X62 J;  4FYD A;  4WZQ A;  2OFH X;  5KFR A;  2CPX A;  5H9E K;  1CS4 B;  1AB8 A;  1H2U X;  2HNZ A;  2XG8 A;  2KM8 C;  4GKJ F;  2AJF E;  2FQQ B;  2CZV C;  2M88 A;  4M95 A;  2CQP A;  4M63 A;  4IUF A;  4ZVQ B;  1R8H A;  3EZ5 A;  5DM7 Q;  4ZVO B;  4NCG A;  4OHZ A;  2XHW A;  1K0T A;  1VJW A;  1Z2L A;  3AT1 B;  3W5Z A;  4BLG A;  4ECV A;  1SL1 A;  3BSO A;  3PYG A;  3TW0 A;  1N2L A;  4MY4 A;  4TLR A;  5FLX U;  1PAE X;  2CNL B;  3KHL A;  4L6V 3;  3JSY A;  2QMU B;  5IM0 B;  1M5H A;  4RL1 A;  2VQE F;  1RTJ A;  4DBQ A;  2XSJ B;  1QUP A;  3GPA A;  4H4K C;  3MR3 A;  2VL1 A;  3NCR A;  4W98 A;  3GV8 B;  3K5N A;  4WFB Q;  1T9Y A;  4MK7 A;  3UDL A;  4WBF A;  1MU2 B;  3CCR S;  3IAM 9;  4XIU A;  3MD1 A;  4YOE A;  3WAV A;  5FDL A;  2IA6 A;  3W65 A;  5KT7 A;  5HN0 A;  2OH2 A;  1EAY C;  1LQ9 A;  4GC6 A;  3PFE A;  4OYX A;  3HVR A;  3N5B A;  5F8N A;  5EUH A;  4C4W A;  1JLF A;  2I1R A;  4NOH A;  5INH A;  1YZ6 A;  3NY0 A;  3JQM A;  2ZVS A;  5LSO A;  2HNY A;  3H4B A;  2ACM A;  1G4C A;  1WEY A;  3H2U B;  1Q5Y A;  1FJE B;  3C46 A;  1N33 J;  1WHX A;  3UI3 A;  1JJC B;  1X4A A;  3QGG A;  4J7C A;  4PXE A;  2YNF B;  2FIU A;  2ZBQ A;  2D3Z A;  2IMO A;  2WRM A;  3M2R A;  3AA9 A;  3M8Q B;  3PEJ A;  4CO0 A;  5BYS A;  4J90 A;  1QTN B;  3MHY A;  2DVI A;  1JK9 B;  2N4D A;  3GQC A;  2E9R X;  4DU8 A;  2OTJ S;  5DDO C;  4DZD A;  4HEA 9;  2VFU A;  5ETP A;  1D09 B;  4UUX A;  2CQ0 A;  1U49 A;  2ZIT A;  3T9Z A;  1DTT B;  2FHJ D;  4Q43 A;  2GVD A;  4QWD A;  3I0R B;  2E7X A;  3QFH A;  1WOO A;  2HRU A;  1WD6 A;  1S4E A;  2QL9 B;  3NNC A;  4DLG A;  3FDS A;  3M30 A;  3MEE A;  3FBF A;  1R0B G;  3QIP B;  4J9N A;  3V4I A;  4AQY F;  1Q79 A;  3QFW A;  3M2U A;  4ETX A;  4NLO A;  4RW7 A;  4U9R A;  3ZNU A;  1AJD A;  3F44 A;  5BR8 F;  5ETR A;  1I5O B;  1N0U A;  1VQ7 S;  1I3O B;  3U1N A;  5J2N B;  2XS2 A;  5L38 A;  4KJI A;  3AJ1 A;  1XBW A;  3FEZ A;  1UET A;  4ZVE A;  2WOM A;  1IKV A;  3DNC A;  5DDR C;  1ZM3 A;  3AD9 C;  3CCJ S;  2W2P P;  1Z1Z A;  3K8V A;  4LF6 F;  4Q2M A;  4ZA1 A;  1S10 A;  4CCH A;  5D3G A;  4O3O A;  2DO0 A;  1FK9 A;  4XDC A;  3MCN A;  2J9D E;  3GIL A;  2YPY A;  4NZ6 A;  1L3V A;  4O4R A;  1WKJ A;  4I2P A;  2GCF A;  3NKM A;  2W8L A;  5IC4 B;  4WCE Q;  3GIJ A;  4K4Y A;  2IY5 B;  5K4P A;  4ZCL A;  2ADB A;  1VMB A;  3HHD A;  4W4M A;  5D6G A;  4G3I A;  1HQU A;  4OIX A;  4X4Q A;  3HHE A;  4K4S A;  3MPV A;  1M5P C;  2WVF A;  2JL9 A;  2R7O A;  3CCZ A;  1FXL A;  4PPZ A;  2FVS A;  1FX2 A;  4FXV A;  4KHM A;  5M2U A;  2MQP A;  1IBM J;  4XDD A;  1LOU A;  1DAX A;  2FHJ A;  4KY3 A;  3T1A A;  1SVD A;  2OEL A;  3LF0 A;  4N76 A;  1S7H A;  2JFD A;  5M2R A;  2ZOF A;  4DI6 A;  2BW2 A;  1VIX A;  3BBB A;  3OLA A;  1VBY A;  2VUG A;  4HH0 A;  1BMQ B;  1TKT A;  1TL1 B;  1PBU A;  2OPR B;  4NE9 C;  4YME A;  2AYG A;  1JKH B;  5F8G A;  5KG4 A;  4CYR A;  2N7Y A;  4DR6 F;  2GNK A;  1FJC A;  2OD6 A;  3W2W B;  5KG3 A;  5I3U B;  3R5A A;  2YNG B;  3BYR A;  4IQM A;  3MUV P;  4ED7 A;  3CJ0 A;  1VRT B;  2V8P A;  4IKA A;  1RWN B;  2QG9 B;  4QR2 A;  1IN0 A;  3PKM A;  4Q0B B;  1FI4 A;  4IFY A;  4OX7 A;  4I7F A;  2B6A A;  2NPI A;  2OML A;  3D68 A;  3D7S B;  3Q86 A;  3Q8Y A;  3VAJ A;  3J7Y I;  4WIQ A;  5F41 A;  2IBO A;  2W5Q A;  4RNN A;  5BJR A;  5DJB A;  1VC5 A;  1KH9 A;  2YWF A;  4PQU B;  1XMB A;  1EKR A;  2VB6 A;  3RB0 A;  1T9U A;  2LVW A;  5HLF B;  1NJI T;  1N8R T;  4LF7 J;  4QAX A;  5IQ6 A;  1BC6 A;  3CCW A;  2EFG A;  5A76 A;  2R3V A;  3HSD A;  1VQP S;  2YH1 A;  5L1L A;  1VDH A;  1OPI A;  2L3M A;  2K7K A;  2ACY A;  3HO1 A;  3CPW R;  2MLY A;  3GMG A;  2GW8 A;  3M2V B;  1A9N B;  4F36 A;  3M8S A;  3LGH A;  2QE5 A;  2COL A;  2RDD A;  3EGW B;  5HRO A;  3HDS A;  1APS A;  4JOU A;  1CQN A;  1R3N A;  3IM9 A;  1D9D A;  4LF5 F;  2CWX A;  4KFB A;  3SDE A;  2C2D A;  2FYX A;  1HBO B;  4K0K J;  3MMB B;  1NDC A;  4RNH A;  3O2I A;  2VH7 A;  2KFY A;  1MN9 A;  4C3L A;  1UPM B;  4CLY A;  2F4V F;  2ZHO A;  2OJ3 A;  3MOJ B;  2MDA A;  3RUB L;  2CPF A;  1NRK A;  3OD2 A;  2WW8 A;  3Q0A A;  4AL5 A;  3MAA A;  4KHP F;  3TO8 A;  1LW2 A;  1SXL A;  4WK1 A;  1JLC A;  1U1P A;  2JJ4 D;  4E2F B;  4W90 B;  1VBZ A;  1IBL F;  4U95 A;  3RBE A;  1L3T A;  1RWM B;  4NI2 A;  4N8O A;  2EBG A;  2W4P A;  4NXM F;  2J0S D;  4KAY A;  3F73 A;  4LBI A;  3PO5 A;  2ZNY A;  1ZH5 A;  4RWX A;  1U6Z A;  3ZTR A;  4ED2 A;  1Y7A A;  1SQG A;  2IJF A;  3PYE A;  3CCQ S;  2LMI A;  2XHC A;  1MRO B;  3MEK A;  5DLV A;  1VBX A;  4TN2 A;  4B3O A;  1I94 F;  4K0K F;  4C48 A;  2KJW A;  4IH7 A;  1AZS B;  3MMC B;  4PWW A;  6FD1 A;  3M9O B;  1XMO F;  2VOD A;  3PRD A;  2QV6 A;  2I5J B;  3US5 A;  1UTA A;  2BJ3 A;  2Q1L A;  3F41 A;  3M8P A;  1UEU A;  2E1R A;  4FXW A;  4C3K A;  2R7U A;  3TZX A;  5KFF A;  2CQI A;  3PKY A;  1VOM A;  4PPD A;  3KLV A;  1F1B B;  3D5M A;  2FB0 A;  2J0W A;  1JNZ B;  5T7L B;  4C9D A;  2EK6 A;  4B3S J;  1IM4 A;  2CNK B;  5MLC V;  2HHV A;  2C1E B;  1U0H B;  1ZM2 A;  2V5H G;  2CPZ A;  4TXS A;  5ETT A;  1HNV A;  5FD1 A;  5F3Z A;  4DV7 F;  4JI4 J;  2QL5 B;  2MJU A;  3DOK B;  3MR5 A;  4JI5 F;  3ZTP A;  3U1M A;  3QNW B;  4DQI A;  1URN A;  2Y8Y A;  3I5B A;  4L72 B;  4DXL A;  2BAN A;  5I3Q A;  2LQ8 A;  3CTR A;  4GKK F;  4C2M A;  4J9R A;  4LFB F;  3UN2 A;  3I82 A;  1EKS A;  1V3Z A;  1YJW S;  2IUC B;  5GAE I;  3HJV A;  3P45 B;  4B9N A;  5HJY A;  2AMC B;  1SCJ B;  2VBY A;  3FK4 A;  2VQR A;  2KFN A;  1H0H B;  1CLF A;  5KTQ A;  3UVJ A;  2DR5 A;  1ZZF A;  3BH7 B;  3GSD A;  3OL6 A;  3H40 A;  3TR5 A;  2GJI A;  2WCX A;  4DU7 A;  5A8W A;  3RBZ A;  5KFN A;  4K4W A;  4YP3 A;  1ZZN A;  4PWD A;  4UOR A;  2MKH A;  2C3M A;  1HNI B;  4DV3 J;  2EEY A;  1EAR A;  1NJW A;  1TL5 A;  3QRQ A;  4K5S A;  1JJH A;  2NUU G;  1RB0 A;  3AD7 C;  3M05 A;  3UN3 A;  3KG4 A;  4KIA A;  4V19 J;  4DX5 A;  5DLG A;  1N34 J;  4LQ9 A;  1KH4 A;  3TQE A;  1HYS A;  4MK9 A;  2QN6 B;  3EVM A;  4NLQ A;  4DMZ A;  3J7Z 5;  2ZJP Q;  1E6Y B;  2GVZ B;  2R42 A;  4JV0 A;  1RWK B;  2C2K B;  2W5X A;  2AF6 A;  3M1V A;  3CCE S;  4FF2 A;  4DV2 J;  1U02 A;  2E44 A;  2OI2 A;  3GG0 A;  4M5H A;  1MLA A;  1SB6 A;  5LJ3 Y;  1TZ0 A;  2ZH7 A;  3GZ7 A;  1EHW A;  1NK7 A;  1C4A A;  1OWX A;  5LRM A;  4FXD A;  2BW7 A;  4M94 A;  3TVK A;  2H9Z A;  3OSN A;  4DV6 J;  1AW0 A;  1KLM A;  3EWG A;  4RPF A;  1PKU A;  4PXD A;  1RU2 A;  3BGR B;  1FE4 A;  5DZ7 A;  4OI1 A;  1SJF A;  4C0O C;  1U1K A;  4JI3 F;  1LXJ A;  1OQ6 A;  1J5O B;  4NLW A;  2V9W A;  5IV3 A;  4G1Q B;  4S0M A;  2FVQ A;  5LXY A;  1T05 B;  4YB1 P;  2HVH A;  2XMM A;  3MDF A;  3JAM U;  4X66 F;  1ALH A;  2M70 A;  3HT0 A;  2B4O A;  3PRV A;  1X4F A;  4FP9 A;  1UVK A;  1FCA A;  3MEC B;  3MTK A;  1VQ4 S;  4Q8F A;  3E01 B;  1S99 A;  3ZTQ A;  3MF5 A;  3UWT A;  3IRX B;  4LF8 F;  2EPI A;  2MHN A;  4A8Y A;  5E2Q A;  4P75 A;  1AFI A;  2QSW A;  2H1Y A;  3SCL E;  3NL0 A;  2NUH A;  3QT5 A;  3GV7 B;  4OI0 A;  1AT1 B;  2IJR A;  3A4T A;  3QJJ A;  5A8R A;  3UR0 A;  2VG6 B;  1VQK S;  1TVR A;  4C8M A;  5LT5 A;  4QWA A;  2BE9 B;  3T02 A;  1U2F A;  2HQD A;  2ZKT A;  4DV1 J;  3GR0 A;  5EN1 A;  4IOB A;  4TKT A;  1N5T A;  1T9X A;  2AGO A;  3MK2 A;  3RBD A;  1NPK A;  1XNQ F;  2YQ3 A;  3UCG A;  4K4X A;  2Y1J A;  3GG1 A;  3S8S A;  4QWE A;  1LV5 A;  4C98 A;  5DLT A;  2UXC J;  1RTI A;  3VZI A;  3POT A;  1FKO A;  2GIQ A;  3H0P A;  1FNM A;  4OYW A;  1SJ3 P;  1SKW A;  1NHK L;  2B6A B;  3QT7 A;  4OHV A;  3RJM B;  3QJL A;  1NBE B;  4DDF A;  1KHN A;  1NB7 A;  1RTD A;  1UVM A;  1F2H A;  2CXE A;  3S7R A;  2WVE A;  2HFV A;  4PQA A;  4EBE A;  4PQU A;  3BDH A;  1P6T A;  4QR1 A;  3R2D J;  3OT9 A;  2GS8 A;  4AXJ A;  2PFD A;  2V63 A;  2R2U A;  3OR2 A;  2IDL A;  5CCL A;  3QBC A;  1HW9 A;  1H2T Z;  4OMF G;  2R8J A;  4DR5 J;  4JP8 A;  4IRD A;  2HVZ A;  3V6H A;  1SC1 B;  1C1B B;  2RD5 C;  4ZJL A;  1LNQ A;  2AHO B;  2DNZ A;  2OLW A;  2RF2 A;  1BQX A;  2R4F A;  1RA7 A;  1WEZ A;  2F4V J;  5E7O B;  4TU8 A;  3OL7 A;  3B82 A;  3SCK E;  1KBR A;  1Y00 A;  2D7S A;  1WSV A;  5KG6 A;  3V5R A;  3KLI B;  1TK8 A;  1NME B;  3VCD A;  3RR8 A;  1RAF B;  2DNK A;  3P6Y C;  3G8T A;  5GRR A;  1WEL A;  4EFA C;  1DQA A;  3HFZ B;  4OHX A;  3V6D A;  2RRA A;  4USW A;  1VQ5 S;  3DLJ A;  3CNQ P;  2YWW A;  1F3F A;  3RB6 A;  2Y9H A;  4B3S F;  1RT1 A;  1PYS B;  1WF2 A;  2ROG A;  4DCJ B;  2AIR B;  1DBD A;  1NHV A;  3DM2 B;  1T8E A;  2UUB F;  2HAI A;  3KLH A;  3OPK A;  1VI7 A;  1HBM A;  2DKO B;  3M4X A;  3IFE A;  4RW7 B;  1KWM A;  1XEZ A;  2QTW A;  2HPU A;  2K8G A;  3CJ8 A;  4DL0 C;  3H5X A;  4R5P B;  4P7T A;  3HX9 A;  2LYV A;  3VGU A;  5DDP C;  1H7W A;  3D6F B;  4UOP A;  4QIF A;  2IJN A;  1UAW A;  2WB1 D;  2E1M C;  3NKY A;  3RG6 A;  3E2E A;  2Z2L A;  2AYM A;  4HI2 A;  3K57 A;  1I94 J;  4KO0 A;  1VQ8 S;  3SV4 A;  2IM2 A;  3VAK A;  2KZZ A;  4F2S A;  1S9E A;  3DRR A;  4C7Q A;  2GAG C;  1Y3K A;  3QLH B;  1N36 J;  2HNY B;  4ZHR A;  2OUG A;  2VBX A;  4ILR A;  3EGZ A;  4GRS A;  3ADA C;  5BYQ A;  4UPK A;  2ZBP A;  2NPF A;  2RUS A;  4EU0 A;  2VON A;  3NKQ A;  4ED8 A;  1VR6 A;  4I64 A;  1S9E B;  3DRR B;  5C42 A;  2V8H A;  2MZQ A;  3IG1 B;  4KE5 A;  3DYC A;  3L09 A;  1ZBT A;  2KT3 A;  5DO2 A;  4ZG9 A;  2NXU A;  4UF4 A;  1QVF R;  3MPW A;  3TP2 A;  1DTT A;  2M5Y A;  3IBF B;  1WNE A;  2NXC A;  4ZN1 A;  2AX1 A;  2DEI A;  2XZW A;  2RDJ A;  2VJU A;  3JXO A;  1JLB A;  2Z57 B;  5LXR A;  1U1N A;  2R7X A;  5L0E A;  4WU3 A;  5KFA A;  4ZLP A;  3SQO P;  4Z37 A;  5IWA J;  1XN9 A;  3M8R A;  1YDL A;  3I96 A;  3BJY A;  4HTI A;  4B08 A;  4AL7 A;  4M5N A;  4P52 A;  2ZOG A;  2YKM A;  1T9T A;  1N5Q A;  1U1O A;  1YLX A;  1SL2 A;  2XZT B;  4NLP A;  2ALY B;  3P5B P;  1UFL A;  4RX6 A;  1AJC A;  1ZAX A;  4WP8 A;  5CHC B;  4IG3 A;  4QU6 A;  4KT0 C;  4PAB A;  4IRK A;  4OYI A;  4RW8 B;  3DLE A;  2XLI A;  2H3E B;  5CYQ B;  2KM8 B;  3OSP A;  3IR5 B;  3OV7 A;  3DHW C;  4DSF A;  1EQJ A;  4DR7 J;  2F40 A;  3MUM P;  3CJ4 A;  4ZPT R;  2CG4 A;  1LK5 A;  4NLY A;  3W2V A;  4LRC A;  5HI7 A;  4LUB A;  3TZW A;  3MCO A;  4IFY B;  3ET6 B;  5A8W B;  2CQ1 A;  4WFX A;  5G4D A;  4WFN Q;  2RH3 A;  4I0W A;  3BQ1 A;  3KJF B;  3LO3 A;  1KVJ A;  1RWO B;  2OSR A;  1TUW A;  2RQC A;  1DFD A;  4KPY A;  2WB4 A;  1LWF A;  2KYX A;  2XMK A;  3I55 S;  2XMJ A;  3HSJ A;  1V5I B;  4TNO A;  2OAU A;  3DGP A;  2LEB A;  5I4M A;  1RBA A;  2J76 E;  1WTB A;  2KZM A;  2WZ1 A;  3P49 B;  2ZJR Q;  2BZ2 A;  1ED8 A;  2NYH A;  2QLB B;  2BOA A;  1Y5N B;  2KB2 A;  2CNN B;  2NYI A;  2RHS B;  2X51 A;  3D4J A;  3F0N A;  1Q4R A;  3DXB A;  1X5O A;  3W63 A;  3EMT A;  4HH1 A;  4JI6 J;  4NA2 A;  1OS5 A;  3U27 A;  4B17 A;  2UUC J;  1BE4 A;  4B9U A;  3JB9 k;  3FRY A;  3N4W A;  3T5L A;  2UUA F;  3W3S A;  3WX4 A;  3IGN A;  5K8O A;  2OPQ A;  3PYF A;  5DLF A;  3Q2T C;  1UFK A;  2HVD A;  4B56 A;  4LF5 J;  4L73 A;  2HHW A;  3GJT B;  2BMB A;  3AQO A;  2G2Y A;  4DR2 F;  1Y5I B;  4LR7 A;  1URA A;  1FRM A;  4URS A;  4CO2 A;  2ZH8 A;  4PAA A;  4MTP A;  5DRK A;  5J2P B;  1LEO A;  3DOL B;  1J5E F;  3WAY A;  3BO2 A;  4U8V A;  4OJ3 A;  1XNR J;  2B9W A;  1F6T A;  2ZOM A;  3C14 A;  2YNI B;  2BQU A;  3FMB A;  2VOP A;  3AD8 C;  4KHR A;  1UEK A;  1FRX A;  1X4C A;  1Z4U A;  2WSE C;  2XSF A;  1LWC B;  1RGV A;  3BF4 A;  4WII A;  2KHD A;  3M8Y A;  2DBB A;  2ZBI A;  3ZZ0 A;  3HSZ A;  2PN6 A;  2PI5 A;  5L0K A;  4ZPW R;  3C6T B;  3GV5 B;  4X4S A;  1REV A;  2CJX B;  2XO7 A;  1KSP A;  1XR7 A;  1UFW A;  1R8B A;  2W8K A;  2G2O A;  2G2Z A;  2P9G A;  4H4O A;  3I9V 9;  4U96 A;  1KKH A;  1NKC A;  1FDB A;  5CAA A;  2DR8 A;  1LWC A;  1RT2 B;  2QJ3 A;  4EWT A;  3G82 A;  2HQG A;  3SMZ A;  1SJ4 P;  2ZZN A;  4P2S A;  5IFM A;  5JVH Q;  4WTY A;  3MED A;  5T14 A;  2YWH A;  3M7V A;  3NOC A;  4ILM A;  1NUE A;  2OP5 A;  1WUU A;  2YQ0 A;  3AJ2 A;  9RUB A;  3MMB A;  5A2Q Y;  2V0N A;  4K59 A;  3ZZZ A;  1Q53 A;  3UR3 C;  1ANI A;  2V68 A;  4KGZ B;  3O3L A;  2VG5 B;  3TZY A;  3Q23 A;  2EBE A;  1NJY A;  2JDJ A;  2FLP A;  2RSQ A;  5ETL A;  4F67 A;  5DGA A;  4IYQ A;  1SUQ B;  2FY1 A;  2UVV A;  2HS4 A;  3KNG A;  4KSE B;  1UJ6 A;  4LSN B;  2DHX A;  1TU0 B;  3G2X A;  5LL6 d;  1ALI A;  3A52 A;  2VFT A;  3HHL D;  3KG1 A;  2BE7 D;  1RT6 B;  4J91 A;  1SI9 A;  1UWB B;  4ZVU B;  4ZIV A;  3QZ7 A;  3UD4 P;  2FHO B;  1HQA A;  1JLQ A;  1UWA A;  2CJB A;  4OV6 A;  3AAW B;  4RW4 B;  2X3G A;  3BV8 A;  4DV5 F;  1CQM A;  3TEG A;  5K20 B;  2UP1 A;  3T5H A;  3TVY A;  4F0M A;  1F3V A;  5GMK a;  3LAN A;  1HWI A;  1S1T A;  4NZ0 A;  3G8S A;  1U8W A;  2YX1 A;  2V50 A;  5F8M A;  4EO6 A;  1NZA A;  1ZET A;  4Q7A A;  3C2P A;  3PTW A;  3THT A;  1C0T A;  5KT6 A;  4XO0 A;  4LF9 F;  5HBM A;  2V67 A;  1E6V B;  1CJU B;  3HCX A;  5HO4 A;  5K14 A;  3CJ3 A;  2E1A A;  2JLF A;  3I6P A;  2FZK B;  2E5G A;  3DM2 A;  3WX8 A;  4ED1 A;  2P5V A;  1DLO A;  2ZBR A;  3N01 A;  3TAR A;  4C0H A;  3IS9 B;  2DNH A;  4C0B A;  3FJ2 A;  2B8P A;  2DXE A;  2Z2Y B;  4WFZ A;  4ELV A;  3J7Z T;  3MK0 A;  2DR6 A;  4BWJ A;  1NXI A;  3TAM A;  2GMJ A;  5HBM B;  4X4P A;  3DMJ A;  3HHL B;  2ASD A;  1YI2 S;  5B08 A;  2GQQ A;  3NBP A;  4YY3 J;  3NWG A;  5F9N A;  2CPY A;  3AFG A;  1D9F A;  1CG2 A;  1DLO B;  4ZMM A;  1PJ6 A;  1RAJ A;  2ATC B;  3M6X A;  3PW0 A;  1R0C B;  1T95 A;  4YR3 A;  1RHK B;  5KFS A;  3HHL A;  3SZZ A;  3GYX B;  3CD5 A;  3MPU B;  2FVP A;  4KV8 B;  1EET A;  1UEV A;  1A6L A;  2ZH1 A;  3CSK A;  4M5K A;  1KH5 A;  4WP3 A;  1MWZ A;  4DUY F;  2BQR A;  3VGS A;  4WFY A;  2GHV C;  2VZ9 A;  1IM6 A;  2DEJ A;  3M6U A;  1YVF A;  1KFD A;  1MMD A;  2EFO A;  3NOG A;  4ZP7 A;  4I2P B;  2Y3Y A;  3G6V A;  4IRC A;  2Q79 A;  3A3P B;  4FYW B;  5LMN F;  2R2R A;  3GIR A;  2RQM A;  2W01 A;  3OUY B;  2AEF A;  2KVQ E;  3DLK B;  2H48 B;  4LFC F;  4C8Y A;  5J2Q B;  1HBU A;  1TKZ B;  2XMA A;  2QFJ A;  5KG7 A;  3LPE A;  1YJN S;  2EKY A;  5F3T A;  4X64 J;  4QW8 A;  2MSS A;  3CDW A;  3K5P A;  4C8Z A;  3M1V B;  2XB2 D;  2ZDO A;  3C6U B;  1ZAW A;  3D3C J;  4ICL B;  4PG7 A;  3T41 A;  2NS1 B;  2ZVI A;  2MZ1 A;  5AE2 A;  5LMN J;  1FEE A;  5KT4 A;  3LWL A;  1GTH A;  2UUC F;  2J0X A;  4PG8 A;  2VU5 A;  4RBU A;  4EI2 A;  2W24 A;  1GMW D;  1QAY A;  3H7H B;  5E41 A;  1R43 A;  3HVT A;  3NG8 A;  1KTQ A;  4C8O A;  1LFP A;  1N32 F;  1PBA A;  2UUW A;  4N47 A;  1S6P B;  3MGJ A;  4KRW A;  1G2E A;  4FYX B;  2IPO B;  2QLJ B;  3B78 A;  2MQO A;  4JI0 F;  4RR5 A;  3G96 A;  2FC9 A;  4I6Y A;  4QZV B;  1B3T A;  4NXM J;  1LWE A;  4UZC A;  3VV2 B;  3IWL A;  4EBD A;  1FHT A;  1HDH A;  4DV1 F;  2C2M B;  1Q82 T;  3AOB A;  1TUV A;  2HBZ B;  2V2Q A;  3HJF A;  3RRG A;  4QPT A;  1S5Z A;  2XYH B;  4OI2 A;  3VZH A;  4NEY A;  2HHX A;  4LF8 J;  2V69 A;  2MB0 B;  3ELH A;  2QEX S;  1RZM A;  1RAB B;  4C11 A;  4CLF A;  1XQI A;  4FVC A;  3HK2 A;  4X4N A;  4KC5 A;  1S7I A;  2CQ4 A;  4C6A A;  4ENO A;  3CJT A;  2O67 A;  4JI6 F;  4OYM A;  7FDR A;  5KFW A;  1Q1K A;  5F0U A;  3WC0 A;  2C22 A;  1UVL A;  5C2G A;  3CJQ A;  3MK1 A;  3W60 A;  2P8I A;  3HFV A;  1VQO S;  4HTJ A;  4C11 B;  1EI6 A;  2CA9 A;  3W5X A;  2VA3 A;  5D0E A;  3D1O A;  2MGZ A;  2X3D A;  4J37 A;  1OMS A;  2HWI A;  3C66 A;  3J81 U;  3F56 A;  2FJB B;  2H5I B;  2OPQ B;  3CD7 A;  1BWE A;  1SV5 A;  1X8D A;  1XTZ A;  2QYC A;  2P6T A;  4ZP6 A;  3L7O A;  1WWH A;  4QQB A;  1RHR B;  2E9Z A;  1RTH B;  1R0A A;  2Q6C A;  3IGZ B;  1JLF B;  4FS1 A;  2J7U A;  1KDN A;  3GWC A;  3I5A A;  4ID5 A;  3H5Y A;  3OXL A;  1UPP A;  1N0V C;  1EW2 A;  5MAO A;  1CJV B;  5D4L A;  2BAC A;  3GYN A;  3PW2 A;  1FVQ A;  4PR6 A;  4ECS A;  5IJQ A;  2UUB J;  3IGV A;  4J9U E;  5KOW A;  5CQG A;  2FGC A;  1BGX T;  1HW8 A;  3M2R B;  2RRB A;  1HBN B;  3DRP B;  1JQG A;  4RBV A;  4EBC A;  1F9H A;  2GHW A;  4ZOS A;  4B9V A;  2LCW A;  4P72 A;  3MM7 A;  2ATL A;  1S1X B;  2HNZ B;  1F5C A;  3S6E A;  1RIS A;  2OGU A;  3IM8 A;  3ILL A;  1FD8 A;  2AJQ A;  4OZ1 A;  3VHQ A;  2OO4 A;  2KFZ A;  1VJQ A;  1JIH A;  2LA6 A;  2WBR A;  4LJM A;  4F04 B;  4RNO A;  2XM3 A;  1K1Q A;  5C24 A;  4DG1 A;  3UNG C;  1U26 A;  3CCT A;  2XCP A;  2EI5 A;  3EXY A;  3FKB A;  4KGM A;  4ZVF A;  3T6J A;  7FD1 A;  3PR4 A;  5L1K A;  4K2J A;  3RAX A;  3THP A;  3VWS A;  1MNE A;  4Y2I A;  1HQE A;  5M2P A;  1B99 A;  5ETO A;  4CQ1 A;  5HLF A;  3O5T B;  2XYP B;  4DR1 F;  2DH7 A;  3MOZ A;  2C42 A;  3N6M A;  1VRU A;  2V2V A;  3ISN D;  2UXD F;  3G6Y A;  5A6W A;  4NMX A;  4JI8 J;  4CM0 A;  3NS5 A;  3M8P B;  1K44 A;  5DGB A;  4DPO A;  4GTY A;  2ZM6 J;  2HBR B;  2Z2M A;  1MSW D;  5T7L A;  1PG5 B;  1RT1 B;  4DEZ A;  1HNW F;  3I4P A;  2KYZ A;  3M32 A;  3NNH A;  2IBK A;  3PIP Q;  1ICE B;  3TJ8 A;  4F7V A;  3A1Y G;  4YHH F;  4EZ9 A;  2UXD J;  3CUL A;  3HVW A;  3P3D A;  4MAK A;  4B3T F;  1RI7 A;  3KNA A;  1HLW A;  2KI2 A;  3HSG A;  5B0A A;  1KS2 A;  1EW8 A;  3OTD A;  4HHH A;  4RW6 B;  3QGH A;  4A48 A;  3ICL A;  3MFH A;  3TAP A;  1H7X A;  4LSZ B;  1CUL A;  4X84 A;  5GAD U;  3PR5 B;  1CVJ A;  2R8K A;  1HNW J;  3TUJ C;  4P2X A;  3BEG B;  4J9Q A;  1XMQ F;  3ZXW A;  1I6J A;  1HD1 A;  3RW7 A;  1FE0 A;  4J9S A;  2CQ3 A;  1RHQ B;  2UU9 J;  4CRJ A;  2B9Y A;  3PM9 A;  5I3P A;  2XO6 A;  2M0G B;  2ROP A;  5KFC A;  1U6F A;  5AJ3 F;  3CMA S;  3BGU A;  3I9Z A;  2DB1 A;  3Q89 A;  3EPI A;  3LP0 A;  2GAH C;  3PHE A;  5SUH A;  3IG1 A;  7AT1 B;  2LXI A;  1MRO A;  3TNV A;  3SXL A;  3VGV A;  5C25 A;  1PIL A;  3R3T A;  4LQ3 A;  1T02 A;  4A8W A;  1G1X A;  3X1L B;  2KN4 A;  1WF0 A;  4FYY B;  1FES A;  1PC5 A;  4HAC B;  3MM5 B;  1MWQ A;  3C15 A;  2FJA B;  2PE8 A;  3N0V A;  2ABY A;  1OO0 B;  5KFG A;  3TEH B;  8RUC A;  1AUD A;  1TL4 A;  2YWE A;  5AE3 A;  2BEF A;  2B3T B;  3QWU A;  4P7V A;  2J6U A;  4Q0B A;  3PW7 A;  2JRS A;  2DRB A;  5KFI A;  1BY9 A;  3ISN C;  2HFN A;  4RW8 A;  5CZX A;  1C0U A;  4U67 Q;  4DSK A;  2HZC A;  4F25 A;  4CYS A;  3BM7 A;  3DC2 A;  1TL7 B;  3IAS 9;  3NKP A;  5HP1 B;  3A3O B;  4I67 A;  2XYG B;  4JB8 B;  1MW7 A;  4IO1 A;  3T19 A;  4CP5 A;  4QIG A;  4TN0 A;  1HPZ A;  1NND A;  3DHX A;  5C5J A;  1FF2 A;  3C19 A;  4WU2 A;  4DV4 J;  1SC4 B;  1VK8 A;  2JEI A;  2VQE J;  4ECR A;  1P49 A;  5F8H A;  2ZH4 A;  2RU9 A;  4ED6 A;  3ENW A;  1WI8 A;  2RKI A;  3PAC A;  1XNR F;  3CDU A;  4UOF A;  4WKR A;  1L3U A;  2M9K A;  2F8E X;  2PO4 A;  2GMH A;  2VKR A;  4NZ7 A;  4XPC A;  3V81 B;  1S0O A;  1AUS L;  1HBO A;  2MPU A;  4F4X A;  3HF5 A;  4X4V A;  3C6U A;  4Y00 A;  4ZN3 A;  2DH8 A;  1K7H A;  3G86 A;  4CLK A;  4IOC Q;  1OY9 A;  3R2C J;  1RXO B;  4FZV A;  4FBT A;  2CQG A;  5K5M A;  2LU2 A;  1XMO J;  1JLG B;  3EXC X;  3I5C A;  2E5L F;  5I3U A;  2YX7 A;  4HI1 A;  3ZZP A;  4O4G A;  2VDI A;  1ZTW A;  2N7C A;  2HFO A;  4IDK A;  2W9B B;  2VG6 A;  2QGF B;  3MTJ A;  3GIK A;  2HGN A;  5EGY A;  3SCI E;  3GFZ A;  4C8L A;  3CCL S;  1MU2 A;  2VG7 A;  2ZH3 A;  4CH0 S;  3FC9 A;  2V4J A;  4I4B A;  2MYF A;  2K1R A;  3G4S S;  4USI A;  4TQS A;  1S97 A;  4M5G A;  2K7J A;  4JV1 A;  2XNR A;  4K4V A;  4ZP9 A;  3NKN A;  2OHD A;  4EZ6 A;  3CED A;  2GSU A;  1YZ7 A;  1FKO B;  2B8Q A;  3AXK A;  4CLS A;  3IC1 A;  4DG1 B;  5C24 B;  3OVB A;  4USV A;  4Y28 C;  4MIV A;  4KJD A;  3WQP A;  1Q95 G;  5EGH A;  2FPH X;  4RUB A;  2XS7 A;  2KXF A;  2EXU A;  1TFW A;  1B64 A;  1B7F A;  2FLO A;  5A8K A;  2PA8 D;  1TUG B;  1RK8 A;  4CDI A;  4DQQ A;  1YWX A;  3EVW A;  1SC6 A;  2LKZ A;  3L7P A;  3G82 B;  2QA2 A;  1X0F A;  3V6K A;  4JI7 F;  4ETZ A;  1SH2 A;  2GV1 A;  5F8J A;  1FNX H;  4USM A;  1C0T B;  2J9D A;  2R7T A;  5IV4 A;  2BJ8 A;  3BN7 A;  4F4W A;  3TA1 A;  2HYI B;  2K06 A;  4ZPA A;  2KG1 A;  4F2R A;  1ULR A;  1RAG B;  1WDD A;  4DV3 F;  2F8M A;  1TR0 A;  5JUM A;  2IA0 A;  5AXM A;  5D4N A;  3TUI C;  1QE1 B;  4DL2 A;  1U4B A;  2DHA A;  3AXM A;  2AD9 A;  2XLK A;  1LFW A;  4GVB B;  4FF4 A;  2JNJ A;  2VG5 A;  3BDF A;  2LP4 A;  2N4C A;  1WOP A;  3FQL A;  2QA1 A;  4Z2X A;  3KLF A;  3KK3 B;  3DRP A;  2CAD A;  2U1A A;  4YS2 A;  2QYG A;  2ZC4 A;  4OFZ A;  3J7Y U;  2LQ5 A;  1DAR A;  1MN7 A;  1GK8 A;  3H90 A;  4FDF A;  4X4T A;  2HHH J;  1JB0 C;  5D15 A;  2MKK A;  4YY3 F;  2ASL A;  1KHL A;  4LFC J;  5DLW A;  3BRE A;  3IP0 A;  3AY0 A;  3SQG B;  4QBU A;  3OTC A;  4YDD B;  2OIH A;  5L1I A;  4ED5 A;  2X7I A;  2IHR 1;  4RUC A;  2HIQ A;  4KM4 A;  1VRQ C;  2O3D A;  3BGO P;  3UD5 A;  1VGY A;  3Q3Q A;  1R6Y A;  3P5T L;  4JI8 F;  4YB6 A;  5IWA F;  1OYD A;  1RUS A;  2B9E A;  2A1B A;  3MMA B;  4NL5 A;  3WC2 A;  1HQU B;  1HQE B;  1SC3 B;  4WFA Q;  3OTO J;  3PXG a;  2H65 B;  3IWN C;  5EWE A;  1TMM A;  3AB2 B;  3W62 A;  2GVZ A;  5DZ6 A;  3TAQ A;  2M8D B;  3DLH A;  3EZU A;  4CLP A;  2NR0 A;  5GOV A;  1TV6 A;  1U25 A;  3R9L A;  2SXL A;  4X66 J;  3DOM B;  4CO3 A;  4Q45 A;  1BLU A;  1GQE A;  2V2Z A;  3M30 B;  1R89 A;  2MZR A;  1H73 A;  2WW4 A;  2XTJ P;  1C1B A;  1WC1 A;  1D0E A;  3DOK A;  4DWI A;  3QID A;  3N5F A;  1RHJ B;  3FCV A;  2RQK A;  3OFH A;  2Z30 B;  4P6Q A;  2WON A;  3I56 S;  1RT3 B;  2CNO B;  5KG0 A;  1PJ5 A;  3M2U B;  3DOM A;  4M5D A;  1TMJ A;  4F02 A;  4A8F A;  2EFP A;  3QO9 A;  4KB7 A;  4R25 A;  4EEY A;  1HA1 A;  1J5O A;  4IFV B;  1XMQ J;  1TKX A;  2EVZ A;  1KHK A;  4KR0 B;  3UO0 A;  3HVT B;  1TK5 A;  1LW0 A;  1MMN A;  4JBC A;  2E7V A;  2AT1 B;  3FSY A;  3KK2 B;  1EJ7 L;  3Q8Q B;  1HBM B;  2DXD A;  4R0E A;  3T9N A;  2GZO A;  2HRY A;  1O0P A;  4IG3 B;  2HMI A;  2IRX A;  1NK8 A;  4ES3 A;  1CJT B;  3MEG B;  2AJ1 A;  2L41 A;  1FVS A;  5KT5 A;  4ER8 A;  3CIZ A;  2YNF A;  2FJD B;  4ZLL A;  1CJK A;  1ITP A;  2YH0 A;  3FBC A;  2AV5 A;  4NRT A;  3VGT A;  2N3O A;  4X4U A;  3UN5 A;  2VBZ A;  4UQG A;  5L39 A;  4WWS A;  2W9C A;  4I2Q B;  1S1V A;  1EQM A;  5DG9 A;  3CCU S;  5B0G A;  1RAE B;  2HK2 A;  3CWJ A;  5LM7 E;  1X5P A;  2VJV A;  2VF3 A;  1UMJ A;  5DDQ C;  3NNA A;  1JLA B;  1UW9 A;  3CJ5 A;  2DNO A;  3DLK A;  4MIW A;  5KFU A;  2EG1 A;  4C8K A;  2CJQ A;  2RS8 A;  2IRY A;  2HGL A;  5B0F A;  1G7C B;  4CO5 A;  2W9B A;  1K1S A;  2UUT A;  3TUP A;  4OLP A;  1RWX B;  1S1W B;  3CB4 A;  5JMN A;  2VBW A;  4WYW A;  3HHK A;  2LLZ A;  2IMW P;  2RAQ A;  3ENV A;  3GTY X;  3BQ0 A;  3HVA A;  2XRG A;  4ECQ A;  4O44 A;  4YN3 B;  2FVC A;  5H9E J;  2RJZ A;  3CD0 A;  1HWL A;  5CCM A;  2HQC A;  3A8J A;  5D0G A;  4DLE A;  3QRP A;  3NCQ A;  1HPZ B;  2M2B A;  5CYJ A;  4YB7 A;  3HHN B;  2Z2Z A;  1FJ7 A;  2DIS A;  2ZFH A;  3WAW A;  2QA4 S;  1HFE L;  2IFX A;  1U47 A;  2A6M A;  2RQ4 A;  2HIY A;  1RCX B;  2MLZ A;  3QQC D;  3AOD A;  2L9W A;  4KGX B;  4GO5 X;  1NSQ A;  3I32 A;  4UW2 A;  3EYZ A;  1ELO A;  2HZA A;  3DYA B;  4G65 A;  2L9N A;  1X5S A;  3EM1 A;  2HG4 A;  4FPI A;  3T1H J;  4B3O B;  3MXH P;  1BQN B;  3EJM A;  3KLI A;  4NLR A;  4EMD A;  2RML A;  4DS4 A;  3L3C A;  4JI5 J;  1I1G A;  5SZT A;  2CQB A;  2CJA A;  4NX9 A;  1G6B A;  5A8R B;  1HNZ J;  2JWN A;  1MWY A;  2D41 A;  3KDO A;  2A6O A;  2ZE2 B;  3H5U A;  4KH1 B;  4H4M B;  3N28 A;  2K2P A;  1YJ9 S;  1S49 A;  3H42 A;  1KLN A;  1AFJ A;  4O4G B;  4ZIW A;  3JS9 A;  2IFY A;  5LSR A;  3T1Y J;  3BZQ A;  4CWB A;  2DK2 A;  3DRY A;  3MUT P;  3D67 A;  4N7T A;  1ZA2 B;  1B4S A;  1XR6 A;  1N6Q A;  2DD8 S;  4RW9 B;  3CMQ A;  1VHI A;  1ALK A;  4PWU A;  2BKN A;  1S1U B;  2QC3 A;  3JSR A;  1ZPV A;  4TU9 A;  1M5K C;  4CYU B;  2Y0S D;  3MPD A;  4MK8 A;  4I1T A;  4UQT A;  1P8G A;  1VBK A;  4CLT A;  1NH7 A;  2ZH2 A;  1I51 B;  3FCH A;  4RW9 A;  4DPT A;  3PDN A;  4ALZ A;  2BR0 A;  2H51 B;  2UVU A;  2IDE A;  4M1K A;  1N36 F;  1CPZ A;  1KQS R;  3W66 A;  4X4O A;  2DCU B;  2ZM6 F;  4UPH A;  4ED3 A;  4JV5 J;  2RF2 B;  5HRT A;  4ZG6 A;  2W5T A;  5KG5 A;  4LFB J;  3A8E A;  4LR9 A;  5IJS A;  4FDI A;  4PZV A;  2BJD A;  4B3T J;  3M8Q A;  2R8G A;  1HWJ A;  4JYA J;  3W8P A;  4FDJ A;  3D6T B;  3CME S;  3K8W A;  2RNE A;  5A6P A;  3MAH A;  4PG4 A;  3HZE A;  1KFS A;  1N54 B;  1T0T V;  2EFV A;  4DSL A;  3KLE B;  4JV5 F;  2WON B;  1REV B;  2D1C A;  2H4Y B;  3EX7 B;  1P9Q C;  3I0S B;  1WC5 A;  2R9L A;  1U1Q A;  2WVC A;  3R6G B;  1F9E B;  2Y1R I;  2G1H A;  2ZKU A;  4PXC A;  3NWR A;  2DGX A;  4YDX A;  3W1Y C;  4WYL A;  2DPJ A;  1WEX A;  2ALZ A;  3KK3 A;  2FJX A;  2P6S A;  1S9G A;  2K3K A;  4PYD A;  4I69 A;  2R8I A;  2HGM A;  4ZG7 A;  3P4U B;  5LSL A;  4Q5V A;  5E3P A;  1KHW A;  1AXQ A;  1VLY A;  2CDR B;  4KGV B;  3KJQ B;  2VKZ G;  2YKN B;  4KQZ A;  5J1N A;  5FDL B;  3UE2 A;  4P74 A;  4DPU A;  2BJE A;  3B6B A;  2FY8 A;  4OX8 A;  4CNY A;  2B4V A;  3KJV B;  2C3P A;  1CUL B;  5CYM B;  1D9A A;  3MMA A;  4AYB D;  4KTQ A;  2XC9 A;  2G0I A;  3G87 A;  2R2S A;  2V4R A;  2HFU A;  2XWX A;  4HDG A;  4X4R A;  2HAF A;  3DLG B;  5A0Y A;  2HW3 A;  4GTX A;  4F0H A;  3KMS A;  2HS3 A;  2IAJ A;  4U8Y A;  1YBA A;  2KTQ A;  4GTZ A;  3SBM A;  3RRK A;  3JTP A;  1O51 A;  3J81 Y;  4NYO A;  4K50 A;  2NZC A;  3JQK A;  1SQF A;  4OHY A;  4LQY A;  3NEK A;  4P9S A;  1AJA A;  1TQL A;  4QIV A;  1S72 S;  3T5K A;  1KHJ A;  1RT3 A;  3O44 A;  3KKF A;  3TVZ A;  1IBC B;  3G6E S;  3LH2 S;  4GO7 X;  2G4B A;  1H98 A;  4F3M A;  4HYK A;  4IFV A;  2GX8 A;  3LAL A;  2YWG A;  5IXU A;  3R5G A;  3VAI A;  2JEF A;  1IR2 A;  2GA7 A;  1URR A;  4NLD A;  4LRF A;  5CYQ A;  1IWG A;  4EO8 A;  2ERR A;  2M7S A;  3GJQ B;  2WAQ D;  3PX4 A;  4I6W A;  1E1Z P;  3I87 A;  1D8Z A;  1RHU B;  3JQJ A;  3W2V B;  1A7G E;  2YNI A;  3LQV A;  4F26 A;  4DR2 J;  3PW5 A;  2J6T A;  4ZS6 A;  2JFK A;  3V4M A;  2QZ8 A;  1XR5 A;  2VV5 A;  3LTO A;  3W61 A;  2GML A;  3IXQ A;  4NLT A;  5F8I A;  3ZC4 A;  1UA1 A;  1Q8L A;  4LF1 A;  3ILO A;  4Y2A A;  2F8H A;  2B4U A;  4W92 B;  1ELX A;  5F9L A;  2AJ2 A;  4NA1 A;  1QTM A;  4LSL B;  1RWP B;  2PA3 A;  2APO A;  3W64 A;  1NO8 A;  4NYZ A;  1XC9 A;  3U02 A;  4CI0 B;  3WDO A;  1RLD A;  2DGQ A;  4DR4 J;  1PIE A;  1DUR A;  3PHT A;  4LFA J;  5BR8 J;  3R1H A;  2QSF A;  3NS6 A;  2H5E A;  2CQC A;  3LGM A;  3Q83 A;  3WAX A;  1KRP A;  1YJT A;  2BUN A;  3G9C A;  4DHV A;  3Q8S B;  2GO8 A;  3LA0 A;  5KFM A;  5KT3 A;  1IKY A;  3MI7 X;  2E66 A;  1DTQ A;  2YKQ A;  4ATN A;  3OJS A;  4WE1 B;  5ETS A;  1K8A T;  4DPY A;  1CSJ A;  2W9C B;  3DGV A;  3WIU A;  3V6D B;  4IR1 A;  2HKE A;  2J7K A;  3NLC A;  1S57 A;  2AJ0 A;  1KQG B;  3OUY A;  4FKX A;  4LT6 A;  5J2M B;  2MKC A;  3ZO7 A;  3SZ2 A;  1TL3 A;  3NAI A;  4L74 A;  4QOT A;  8ATC B;  3UD3 P;  2DH9 A;  2UVR A;  1IXK A;  1NLK L;  4ECX A;  3OTO F;  1T9W A;  4KGK A;  4EK2 A;  2CUY A;  3P8B B;  5GMD A;  1LW2 B;  2GFF A;  5E3Q A;  2V9K A;  1TEL A;  5ETQ A;  3CJK B;  3TJA A;  3V2U C;  2F5G A;  1IJF B;  1DHM A;  1HWU A;  4O0N A;  1ZOT A;  2G0J A;  3NP5 A;  4MJK A;  4ZHR B;  1AUK A;  4HLB A;  4CXK A;  3LGN A;  3CC4 S;  1HBN A;  1PYO B;  2FHM A;  2QX0 A;  3N79 A;  4G1P A;  2LU1 A;  3GE9 A;  4ITS A;  2GIR A;  4N8N A;  4OZ2 A;  3IRW P;  3LWM A;  1P9Y A;  1N5S A;  1TFY A;  1Y6V A;  1JJ2 R;  2W5R A;  3B5Q A;  1TK0 A;  2ZE2 A;  1FNO A;  4OX9 J;  3VAH A;  3S1T A;  3IR7 B;  3DCA A;  3D2W A;  4NRU A;  2VPX B;  3OHA A;  1RYS A;  3NKR A;  2DR7 A;  1H3D A;  4A46 A;  4DR1 J;  3Q8V A;  1PO6 A;  2Y0B B;  2UZA A;  3DMJ B;  2RT3 A;  2W4C A;  3H59 A;  2HND B;  4NXN J;  2NZ4 A;  3E8O A;  2VDH A;  1E2S P;  1IBK J;  3NCP A;  5E0O A;  2FHK A;  3BQ2 A;  4ZJO A;  1RLC L;  2BYC A;  1XJW B;  4CT8 A;  3SEO A;  2YKO A;  5KXA A;  2X1F A;  5BXI A;  2PGC A;  2X1G A;  2LDI A;  2MQQ A;  1WHY A;  2ILZ A;  3LOU A;  2PMZ D;  2RIJ A;  3ULH A;  4BBY A;  4X64 F;  4DR3 J;  1QUV A;  1JWW A;  3K7R A;  3EGN A;  3FGV A;  4NLX A;  1V9O A;  3P96 A;  5D78 A;  4X65 F;  4N5S A;  3KLG B;  4DFP A;  1RTD B;  3LUY A;  2C2R A;  1RJJ A;  1WSR A;  2HSE B;  3FSX A;  4M5J A;  2V6A A;  3HKZ D;  4KO0 B;  4UT4 A;  3A12 A;  1S1T B;  1JLC B;  2AEJ A;  5D4P A;  4AL6 A;  4ECT A;  2F3J A;  3H5S A;  4LRD A;  1N56 A;  5EWG A;  4WJB A;  4F8R A;  2CYY A;  1WI6 A;  3KMQ A;  4RW6 A;  2W8S A;  1N32 J;  4DQS A;  3IGY B;  1M1H A;  2XMT A;  4PUO B;  1IKW B;  3RZA A;  1X7V A;  3PRB A;  1ZED A;  1Q86 T;  4WZM A;  1CJU A;  4QYR A;  2XY5 A;  1EIY B;  3QIP A;  1TKT B;  2YQ1 A;  1FKP A;  1OQ3 A;  3DDI A;  4F3Q A;  1IVZ A;  5KFK A;  3MM9 B;  3CD6 S;  3HPO A;  3MCS A;  5KFL A;  2D9O A;  4DR5 F;  3BR9 A;  1YRU A;  1BQM A;  2PT0 A;  2CAJ A;  1VQM S;  1NZ8 A;  3HZG A;  1Q8I A;  2F7V A;  2AYB A;  2QO3 A;  3HI9 A;  1NHU A;  3D0I E;  5E3R A;  1YJ7 A;  4NWJ A;  1B8J A;  4N77 A;  1RT5 B;  4LRA A;  2Q66 A;  1ZS6 A;  2V8D A;  3MFI A;  3A3N B;  1YJV A;  4DX8 H;  1TKX B;  3BKF A;  3QAU A;  4M5D B;  4DV4 F;  3QO9 B;  3RGI A;  3T1H F;  1GH8 A;  4U6P A;  3RAQ A;  3FEX B;  3ZFV A;  4AE5 A;  1QDU B;  3DU5 A;  2AQ4 A;  4RBT A;  4V1A k;  4M8L A;  1FRK A;  2PSZ A;  2W2Q P;  3IWX A;  3QLH A;  4JUZ A;  4NPO A;  2F4F A;  3VVT A;  4CLZ A;  3BGR A;  1CJT A;  3K2Y A;  2Z4P A;  3ONQ A;  3R5D A;  3D66 A;  3X3U A;  2GGP A;  1U24 A;  3ENQ A;  2B7B B;  4WKY A;  4RZR A;  3PIO Q;  2VQF F;  1V3R A;  3UDE A;  1CJK B;  3K5M A;  4ZGA A;  2CZ9 A;  3GB0 A;  1GEH A;  1UZD A;  4G1Q A;  1Q7Y T;  1HNX F;  1N2K A;  1UVI A;  2X98 A;  2G9O A;  2MQN A;  2QLF B;  3DYA A;  5HL7 Q;  1F2G A;  2ZHA A;  1NKB A;  1RTZ A;  1VLO A;  1HHS A;  1S1V B;  2V8V A;  1HJK A;  1IKY B;  4TY9 A;  3PVX A;  3CGI A;  4LFA F;  4CNZ A;  4WTO B;  4DV0 J;  3EGV A;  2A0F B;  1VIS A;  2XI3 A;  3FMW A;  2AEM A;  1JLA A;  1RQ0 A;  2LFV A;  4FNH A;  3TX8 A;  5F8L A;  1S9F A;  1W25 A;  2FLN A;  5CD4 H;  4B9L A;  4I56 A;  1RBL A;  2VPY B;  5E33 A;  5C7P A;  4IO9 Q;  1S0N A;  3GSI A;  4NLS A;  5KFQ A;  5D0H A;  2Y1I A;  3SSQ A;  3ZZR A;  3J7A N;  4L76 A;  2ZD1 B;  3IA0 A;  3SCJ E;  4YUD A;  4DSE A;  1HYS B;  1U48 A;  2PFF B;  3DRS B;  5A2Q U;  1S6P A;  4DV0 F;  2A18 A;  2I0X A;  3GP9 A;  2DNL A;  2HWH A;  4CM2 A;  3W9H A;  5J1E B;  3OL8 A;  3C8Y A;  3HD1 A;  2DIU A;  4CH7 A;  1S79 A;  3CVK A;  2W2M P;  4ZJQ A;  2NRE A;  3LXQ A;  4WXO A;  3CJK A;  1FO1 A;  1E33 P;  5IZH A;  3FNN A;  3CC2 S;  2HQI A;  3J7A 1;  4HDH A;  2DNM A;  1Y3J A;  1EJJ A;  1NH8 A;  1FJG F;  2F9D A;  5E5N A;  4ZVT B;  3CIM A;  2GHP A;  4CLU A;  5GAE U;  4JI7 J;  1AZS A;  1O6X A;  2C3O A;  1WOS A;  3MMC A;  2HEK A;  2DT9 A;  6FDR A;  4YB5 A;  2W7O A;  2DGU A;  2NXJ A;  2OKQ A;  3EPG A;  2MZJ A;  5G0R A;  2BJ9 A;  3BPD A;  3W5Y A;  3VAL A;  1K0V A;  1BQN A;  1CS4 A;  2HHS A;  4OZJ A;  3SSR A;  1RT4 A;  2KO1 A;  4KYZ A;  4NCG B;  3TX0 A;  2ZZM A;  1YSJ A;  3GII A;  3R27 A;  1YHQ S;  1YBU A;  4Q2L A;  3PX0 A;  1WC0 A;  3I0R A;  3NAH A;  3OW2 R;  1HNV B;  1NU4 A;  2KRR A;  2QLW A;  3IRX A;  4Q8E A;  1RT7 A;  4GTW A;  1OSC A;  3M8W A;  4U7C A;  3PCO B;  1GT8 A;  3GCX P;  2HHH F;  1SIZ A;  3OHB A;  5LRN A;  1K73 T;  1IKX A;  4DJB A;  3PV8 A;  3T00 A;  1ZAV A;  3SSS A;  4FKY A;  2J0Q D;  1ZEB A;  2JC0 A;  2QZU A;  5H9F J;  2IUC A;  4TY8 B;  1N34 F;  1NSK L;  3HHL C;  3OQ2 A;  4LF9 J;  1VQS A;  4P73 A;  3IN5 A;  2D69 A;  2HLU A;  4NCA A;  5DM6 Q;  4DR3 F;  3LPY A;  1O5J A;  2B56 A;  2MQ8 A;  3MZI A;  1QE1 A;  2UV8 G;  4HT5 A;  4NLV A;  4DR7 F;  1F0X A;  4IH5 A;  4UOO A;  3KUH A;  3FZ2 A;  2CDQ A;  3G6X A;  3CUN A;  4DR6 J;  3NXZ A;  5L9X A;  3BDE A;  3GFH A;  3PNI A;  3KFW X;  1EZZ B;  2MEW A;  3FUY A;  3KLF B;  3CF5 Q;  1IKW A;  2LXF A;  3R97 A;  2CG8 A;  2RB7 A;  3B8H A;  3CCS S;  1JXE A;  1UW4 A;  2JOQ A;  2Z58 B;  3BO4 A;  5L9N A;  3D6H B;  2GSO A;  4OX6 A;  4UOG A;  3NS7 B;  1FEH A;  2CQD A;  3CJS A;  4UST A;  5GAH U;  2W5S A;  4F3O A;  3G8Q A;  2MKS A;  4EYI B;  1XNQ J;  2C2N A;  1IWA A;  3VR1 A;  2IAJ B;  1ZYQ A;  3I4H X;  2IC3 A;  4B9S A;  4CXU A;  1VHF A;  4K5R A;  4TQR A;  3H4D A;  2VA2 A;  5IM0 A;  4JI1 F;  1W7W A;  4X62 F;  1ELY A;  4OV1 A;  1L3S A;  4LRB A;  1JJ4 A;  2PEB A;  2CPE A;  3BPS P;  3KTQ A;  4JV2 A;  2YPZ A;  2Z0G A;  1S0M A;  1KQK A;  1KOO A;  1FXR A;  1S6O A;  2AP6 A;  4MYT A;  4A8S A;  1GXU A;  3TQ1 A;  4CO4 A;  1BUX A;  1HWK A;  2F63 A;  3KLG A;  5ETK A;  2ZUG A;  2M3D A;  2DY1 A;  4AUK A;  1NB2 A;  2B9X A;  2GJF A;  3KLH B;  4KAV A;  2FTR A;  1C2P A;  3CW2 C;  2BM1 A;  1FRL A;  4G6V B;  2E9T A;  3FFI A;  3MEC A;  3TWZ A;  4DL7 A;  2FJW A;  1GX5 A;  1LWE B;  4DL3 A;  4CTA B;  2EWH A;  3PFO A;  4L75 A;  5LJ5 Y;  4K2X A;  1EET B;  4OHW A;  4FS2 A;  1OY6 A;  3R7N B;  4ILL A;  2ZEJ A;  4OYB A;  3TA0 A;  5JXS A;  5GAG U;  2BQ3 A;  1NKE A;  1GXL A;  1S6U A;  3IR6 B;  2MY7 A;  1P27 B;  3JYT B;  4H54 A;  4F4A A;  5JVG Q;  1FKP B;  2XMW A;  4JI0 J;  4RNM A;  5CXT A;  3KD8 A;  4WP9 A;  1B0V A;  2IYG A;  4MT1 A;  4OZ0 A;  1NJZ A;  2C2Z B;  1R8A A;  1QSS A;  5H1S V;  2ASY A;  5IT9 Y;  2M52 A;  3QPI A;  4ECZ A;  5HRO B;  2BXJ A;  3W7B A;  5D0R A;  2A2D A;  3WBZ A;  4KHP J;  3OR1 B;  1TL1 A;  4U7U K;  1TKZ A;  4YR1 A;  4EYH B;  4DX7 A;  1DTQ B;  3JSM B;  4O23 A;  3KG0 A;  4P10 A;  2HFS A;  2DR9 A;  4DN0 A;  4R8U B;  3ZZT A;  2W2N P;  4ICL A;  4MHX A;  1NK0 A;  4Y2M A;  1VQN S;  3T6B A;  1GMU A;  3S01 A;  3W9J A;  2C2O B;  1VRT A;  4D3H A;  3JSM A;  3L9Z A;  5IS2 A;  2VD3 A;  1T3O A;  3LP2 A;  1OJ4 A;  3VQT A;  5HMZ A;  5HSP A;  2HK3 A;  5EX3 A;  2AW0 A;  3JAM Y;  3D54 A;  3OR2 B;  1GAO A;  4OX9 F;  2QMW A;  1QAJ A;  2HVI A;  4Y2C A;  3KYL A;  3RR7 A;  2U2F A;  4QIE A;  2MST A;  4PRF A;  4RKU C;  5DQI A;  3BKT A;  3CDE A;  4YR2 A;  4FPR A;  3CO9 A;  4AXI A;  3VVU A;  4LF6 J;  1NK9 A;  1WTF A;  1KH7 A;  2JHE A;  3QYY A;  1QY7 A;  3OXF A;  4IQX A;  1AA1 B;  4J9M A;  1SPB P;  1T05 A;  4USJ C;  1O98 A;  2OSQ A;  2OFG X;  3M2V A;  2AGQ A;  2FUG 9;  3GFX A;  1N5Y B;  2KXN B;  4JI4 F;  1FSU A;  4ED0 A;  4DSJ A;  3QZ8 A;  2I9S A;  1BXN A;  2FD2 A;  3CE8 A;  3PW4 A;  3NKO A;  1PC4 A;  3UPF A;  2WVB A;  4B3M J;  2IM1 A;  4AT1 B;  1UJ5 A;  1R7I A;  3T3F A;  1M90 T;  1YG0 A;  4FYV B;  4P71 A;  1RT2 A;  2CJK A;  2BV3 A;  2DGW A;  2MQM A;  4O0I A;  1DY3 A;  1JMT A;  1RYR A;  3ZZY A;  4RU2 A;  4O3Q A;  2ZNZ A;  3GLJ A;  2C2E A;  2VG7 B;  2RH6 A;  3ENA A;  4YR0 A;  3BDG A;  4USU A;  2FDN A;  4NA3 A;  1NJX A;  4M5I A;  1ZPW X;  1YK9 A;  2KHC A;  1IBM F;  1FTC A;  1KTV A;  1RTH A;  2D9P A;  3BKU A;  2JC1 A;  4MIB A;  4RLE A;  4XK8 C;  5HVF A;  3IO1 A;  4D3G A;  5D3G B;  1IBK F;  5AT1 B;  4EGL A;  1HL6 A;  1NCL A;  1TP7 A;  3J80 Y;  4DUZ J;  1QVG R;  3G71 S;  4DF4 A;  2DRA A;  1CJV A;  2DNY A;  4JI3 J;  4OZN A;  3OL9 A;  2LA4 A;  2HHU A;  3E2D A;  3GJR B;  3MM7 B;  5AJ3 J;  3PEH A;  2LEA A;  1DQ8 A;  1SJR A;  1K47 A;  2LDY A;  3NMA A;  2XWY A;  2DTJ A;  3NGK A;  3QMQ A;  4ZVS B;  4CLL A;  3PX6 A;  3CMR A;  2LQ9 A;  5KFZ A;  3HMJ G;  1WHV A;  4WK3 A;  1GTE A;  1LWX A;  2Z8Q A;  4QWB A;  3DI6 B;  4X65 J;  3TOQ A;  2ZH9 A;  1CEZ A;  4NWX A;  2XEX A;  5K8P A;  1ZTT A;  2DHH A;  2HHQ A;  2PMH A;  5D4O A;  1SBR A;  3R5J B;  4DV2 F;  1ZM4 A;  4HR2 A;  3OFE A;  2ZBC A;  2YXL A;  2VFV A;  1Y9O A;  3BN4 A;  3OTB A;  3TYT A;  2K3I A;  4J5O A;  1Q78 A;  3CDA A;  1X60 A;  3ITH A;  4OZ5 A;  5K9F A;  1MML A;  5DS7 A;  4DX6 A;  3T5J A;  2ZH5 A;  3O1L A;  3AHP A;  2XY7 A;  2BJ1 A;  1PJ7 A;  2BA9 A;  2NCK L;  1XIQ A;  2J9C A;  4L3K A;  3TRG A;  2J6S A;  1Q7L B;  1U0H A;  2GJ2 A;  2XI2 A;  2B51 A;  2CIM A;  3MEE B;  3QSI A;  3V4I B;  3KXD A;  4DQR A;  2RU3 A;  3K89 A;  1T7P A;  5I42 A;  2DXF A;  3R8Y A;  1R0A B;  2H4W B;  3BH6 B;  3ZZU A;  1KD1 T;  5C66 A;  1RTJ B;  2EG2 A;  1RCO B;  2H5J B;  3FBE A;  1R8P A;  2AYE A;  2MZS A;  2YBV A;  4HT7 A;  2PC6 A;  4PG6 A;  3ZTO A;  1Q0N A;  1W2I A;  4F0K A;  4ZCI A;  3D28 A;  1X31 C;  1HR0 J;  2UXC F;  2XBP A;  2PD1 A;  1J27 A;  2WOM B;  1YRX A;  3DU6 A;  1S9G B;  4B3R J;  2KL8 A;  2WK4 A;  3OBI A;  4ZVR B;  2KDO A;  3UVJ B;  2UXB F;  4ZVH A;  1X4E A;  1FER A;  2AWZ A;  2HLT A;  3SIP B;  1WKK A;  3FSI A;  2OEJ A;  5IOL A;  2DPI A;  2V8G A;  4PWD B;  1TAU A;  2O5D A;  1T11 A;  2RRN A;  2ZUA A;  3N6L A;  4Z7C A;  5GVQ A;  4IG0 B;  4GC7 A;  2YVS A;  3A13 A;  3FRZ A;  1UL3 A;  3Q8P B;  3BS9 A;  4QYZ K;  3H2V E;  1X9M A;  1YX2 A;  4PXB A;  3IBW A;  1IBL J;  4NLG A;  2UXB J;  2E5L J;  4NCB A;  1CBK A;  1BD6 A;  1UP1 A;  2NXE A;  1FWK A;  4ZDN A;  5KAK A;  3OFG A;  4LF4 F;  1G3O A;  1HNX J;  4TVA B;  3VF0 B;  2RE1 A;  2KVI A;  3DKD A;  4DL6 A;  1HI1 A;  2JZ5 A;  5RUB A;  3VAG A;  1RAH B;  1SH0 A;  2DNR A;  2DYA A;  2GVD B;  3Q8R B;  1FJG J;  4ES2 A;  3K0J A;  2XNQ A;  3R5C A;  4O3P A;  1K9M T;  3UCU P;  4CT9 A;  2W1B A;  3MAQ A;  2FJE B;  3EZO A;  1GMV A;  2B7C B;  2XCA A;  1HNZ F;  1FRJ A;  5IC6 B;  4ERD A;  1JNR B;  2OPP B;  1JXL A;  2WVD A;  1WC4 A;  3C3L A;  1O8B A;  4DS5 A;  3PJ9 A;  2CVI A;  4OLO A;  2BKO A;  3SFU A;  3QAE A;  1WAC A;  2I38 A;  2VC0 A;  4C3M A;  4ZIT A;  1VFJ A;  1SKU B;  1WC6 A;  4A47 A;  1M5V C;  5KFT A;  1HMV B;  3K5O A;  4NEZ A;  4U7U D;  1D1U A;  3NGT A;  2GGP B;  2YKA A;  3FCW A;  4L3N A;  2KKH A;  4B9T A;  4O3R A;  4QYZ J;  3E01 A;  3NGR A;  4GKK J;  3JYT A;  5EGE A;  1FK9 B;  3AQP A;  1N5Y A;  2YKN A;  3BGL A;  4ZPC A;  1VIO A;  1FWL A;  5U47 A;  2VFS A;  3SFG A;  3QJP A;  3VAF A;  5AXK A;  2VC1 A;  2YX4 A;  4Y0F A;  2KU7 A;  3GFY A;  3OR1 A;  4DV6 F;  2ADC A;  2Q6B A;  1UVN A;  2RUG A;  1UZH A;  1OPZ A;  4LBP A;  4RWW A;  3DLG A;  5A0Y B;  2XY6 A;  2MKI A;  1X4D A;  1RAO A;  1WF1 A;  3CJ2 A;  1UCN A;  2QRR A;  1NPP A;  2J5A A;  5B0D A;  2RS2 A;  1WG4 A;  2D3O 1;  1FKA F;  3T01 A;  4JYA F;  1GMW A;  1RKI A;  2GO9 A;  4KFB B;  3SDE B;  3Q24 A;  4MMO A;  3BGF A;  3GU0 A;  4N56 A;  1U45 A;  1KLM B;  4R5P A;  2L08 A;  3EUN A;  4RW4 A;  4JI2 F;  4ES1 A;  5KFB A;  4TY8 A;  2XQC A;  2QFI A;  1Y10 A;  5AXL A;  4FN5 A;  3ETO A;  5HJX A;  2MKY A;  2J8S A;  1TL7 A;  1GFW B;  4BWM A;  1EP4 B;  1HI8 A;  2V4J B;  3AB4 B;  2J7W A;  3KK1 B;  4BS2 A;  3RTV A;  2YNH A;  3ISZ A;  3QGI A;  3EDR B;  1D3W A;  4R0J A;  2AZ1 A;  3UW1 A;  1R27 B;  2BE2 A;  5B09 A;  4H4K A;  3OTE A;  1OY8 A;  1M1G A;  4JI1 J;  2RHQ B;  1FT8 A;  2BVZ A;  5KG2 A;  4ZPB A;  4I7F B;  1XER A;  5G0R B;  4LF7 F;  1RA6 A;  2HQF A;  3VQS A;  3K5L A;  2GQ2 A;  1VK3 A;  2D74 B;  2MHE A;  4K7Q A;  3VTI A;  1NDP A;  5C42 B;  4P2M A;  3KLE A;  1VS3 A;  4LVO P;  4F4Z A;  5AXN A;  2ZJQ Q;  2FLL A;  1HAR A;  1P1L A;  1RHM B;  2BDP A;  2B4P A;  3TG0 A;  3BR8 A;  2FZG B;  2XMV A;  1R6V A;  4KBI A;  1S6Q A;  5HQM A;  2R7V A;  1ANJ A;  2BAB A;  5J2N A;  1R8C A;  1QJH A;  1ROF A;  2M8H A;  2ZZT A;  1KQF B;  4O3N A;  4DCP B;  2FGO A;  4NLU A;  3WZ0 A;  5I42 B;  3KJN B;  4MKB A;  1M5S A;  1Q8B A;  1RT7 B;  2XMU A;  2BJ7 A;  2OPS B;  3UQS A;  3ZNJ 1;  4E8U A;  4QW9 A;  4E98 A;  1KVK A;  1X4H A;  3MPY A;  4LSN A;  3B4M A;  1HIY A;  2GQC A;  5BYR A;  2G13 A;  3NGD A;  2JEG A;  4OI3 A;  1IKX B;  3PJX A;  4DFM A;  3KUG A;  2EW9 A;  4QR0 A;  5C2C A;  4KAI A;  3RYL A;  3LP1 B;  5DG8 A;  1NAQ A;  3E3X A;  5TJ3 A;  3A8K A;  5AE1 A;  1Y7P A;  3PO4 A;  5KOX A;  2J9E A;  3EVO A;  1LW0 B;  3QT8 A;  4A4J A;  1GXT A;  2E29 A;  4ECW A;  3MM8 A;  2FZC B;  2V4Q A;  4PKD B;  4C8N A;  1U8S A;  5CZV A;  3FFI B;  2CFX A;  2YTC A;  4Y6I A;  4IG0 A;  2I2Y A;  4IOA Q;  3VAM A;  4J9O A;  2MMY A;  4XPE A;  4PEO A;  3N6N A;  2GC8 A;  4B9M A;  4PG5 A;  2XUL A;  4F4K A;  2JX2 A;  3JTN A;  4CXS A;  1A0O B;  2G9Y A;  2PI4 A;  4OI4 A;  1IQT A;  1XWL A;  3DFE A;  4RUH A;  3PY8 A;  3HXM A;  1FFW B;  2CPI A;  5KFO A;  2EK1 A;  1HHT P;  3SZY A;  5LQQ A;  3KOA A;  1N88 A;  1TV6 B;  3ITH B;  4I2Q A;  2ZH6 A;  4OJG A;  1HNI A;  5THW A;  5L8R C;  2OEK A;  5K8M A;  4DOZ A;  4FF1 A;  1M0S A;  2CVE A;  1B7Y B;  2FJV A;  2CPH A;  2W7A A;  2MY8 A;  4Y34 A;  4MKY A;  4HHJ A;  3LP0 B;  5FLX Y;  1NDL A;  1YGY A;  1NEE A;  2DNQ A;  1HR0 F;  4UUW A;  4ECU A;  1ED9 A;  4RU9 A;  2LQB A;  2OPP A;  4DV7 J;  1B0P A;  1E6Y A;  1ACM B;  2OMO A;  4MYU A;  1QSY A;  4A8K A;  3CCV S;  1SJQ A;  1W2B R;  2YKM B;  1KHV A;  1BQM B;  1UA0 A;  1CC7 A;  5DQG A;  4M5L A;  3QSY B;  2EFN A;  1N52 B;  2BRL A;  1OIA A;  2IVF B;  5IT0 A;  3PJW A;  1RT5 A;  4A8X A;  1RWU A;  1U0S A;  2BRK A;  2F65 A;  1FDD A;  3H2L A;  2MKJ A;  3GJS B;  3KUE A;  2HHP A;  1Q5V A;  1F5A A;  4LSL A;  1NSA A;  3M32 B;  3KJV A;  1O99 A;  2B5J B;  2VPZ B;  3M6W A;  2NSC A;  3MM6 A;  5HAN A;  1IR0 A;  4UY8 5;  3N9U C;  1TKD A;  3MEG A;  2HWT A;  2PDA A;  4ZLN A;  5KT2 A;  3DDN A;  4FNI A;  5KFH A;  2LEC A;  4M5M A;  3T1Y F;  3RB3 A;  3DGP B;  3QAT A;  2B5J A;  2KXH A;  3DRX A;  3MM6 B;  2V94 A;  3TI0 A;  4ELU A;  1LWF B;  3AOC A;  4DUT A;  3HP6 A;  3M6V A;  2NSB A;  4ZVG A;  1KEK A;  1KOH A;  1L3K A;  5ETN A;  4K4T A;  3V6J A;  4BC9 A;  4EUV A;  2IVY A;  2I8E A;  2PII A;  2R7W A;  3DLL Q;  4O3S A;  1V6H A;  2KG0 A;  1RAC B;  1YJU A;  3ETM A;  4RJV A;  2DY9 A;  4K4Z A;  4TYB A;  3CDB A;  5EHH A;  1KC8 T;  2DIV A;  3ZTS A;  4XAK A;  4XTT A;  5ETV A;  2YWK A;  3TJ9 A;  3R1L A;  1B0T A;  2ILY A;  2O01 C;  2C28 A;  3ED4 A;  1DJ0 A;  4OQJ A;  4NAS A;  1Q8K A;  2R8H A;  1S59 A;  3NMR A;  1UKU A;  1WG1 A;  2HBQ B;  4IDK B;  3UFC X;  3QT6 A;  3CXC R;  1S76 D;  2DNP A;  3DDK A;  1YRT A;  3I31 A;  2WBM A;  2IVM A;  3LP2 B;  4MIA A;  3RRH A;  1RKJ A;  1VCT A;  1C1C B;  4LBH A;  3TA2 A;  3RAM A;  4USH A;  1EB0 A;  4AFF A;  4HHU A;  1QM9 A;  1C4C A;  2CKW A;  4QIW D;  3W9I A;  2MXY A;  4LVN P;  3BSN A;  5HP1 A;  2JEJ A;  2ZC3 A;  1T03 B;  2VOO A;  3HT3 A;  1WDT A;  2DCL A;  3MWB A;  3U1L A;  4DL5 A;  5AJ9 A;  2RDI A;  1V3S A;  1S48 A;  1X4G A;  2POK A;  3BSC A;  3C6T A;  4LRE A;  3UDC A;  4FF3 A;  1P1T A;  3RU0 A;  1QLN A;  2Q3P A;  4Y3C A;  2EKN A;  5HK4 A;  3BB5 A;  3DXS X;  2MGZ B;  2BOP A;  5L0B A;  2CJ9 A;  5DQH A;  1PYT A;  4NYP A;  2D3U A;  3GCW P;  3HLU A;  4H4M A;  1X4B A;  4WXW A;  3W8G A;  2E1P A;  6AT1 B;  1BHN A;  4RO0 A;  5E3C A;  2UU9 F;  1FA0 A;  1YJR A;  2F9J A;  2XSJ A;  1RAA B;  4A8M P;  4LIW A;  4NWB A;  2P2C B;  4J9P A;  3QGP A;  1X5T A;  2DGO A;  3LP1 A;  3GON A;  3NGS A;  3BDG B;  1HHQ A;  2DRD A;  2JVR A;  1RDR A;  1S1U A;  4MFB A;  2FVR A;  1CC8 A;  1SH3 A;  3NRB A;  3D0H E;  4DL4 A;  2QLX A;  2W25 A;  1IUJ A;  2YNH B;  4OZ3 A;  1MG7 A;  2BX6 A;  1U09 A;  2ZD1 A;  4MKA A;  5LMU J;  5IT9 U;  2MTL A;  4CH1 A;  1IQZ A;  4LF4 J;  4GVB A;  1RT6 A;  2VAS A;  1FDA A;  2WSC C;  4QJV A;  1RTI B;  4MFB B;  1VC0 A;  4IR9 A;  5DET A;  1L5U A;  1EW9 A;  5EDW A;  4KV8 A;  4LIR A;  1U2C A;  4DPX A;  2BM0 A;  2K1R B;  4ZK7 M;  3MMJ A;  1T94 A;  4HKQ A;  2IM3 A;  3FZB A;  1VQ9 S;  2X1A A;  3IBC B;  4CZC A;  1YIT S;  5DG7 A;  1J2V A;  1FWP A;  4CIO A;  5KFP A;  2DHG A;  5D77 A;  4V19 X;  3DI6 A;  1QAI A;  1VRU B;  3HKW A;  3EIC A;  5L1J A;  1E6V A;  4DFK A;  4B3R F;  2R7Q A;  1TTH B;  3MED B;  2A3J A;  5J2Q A;  4E0D A;  3LW5 C;  1PSD A;  4DPW A;  2D3O R;  2B43 A;  1X0P A;  4LF2 A;  4TLQ A;  3ILI A;  3QWP A;  3QRR A;  1KN6 A;  3O8W A;  5E3A A;  5JJB A;  3GYG A;  3TAM B;  3B54 A;  4DN9 A;  3OVA A;  3M9N B;  2W4D A;  2ZWO A;  5B7W A;  3I0S A;  1U1L A;  2IC3 B;  3MR6 A;  2HS0 A;  4Y65 A;  3UDV A;  4ZPV R;  3OLB A;  2H54 B;  1VYA A;  3AJD A;  4CO1 A;  1FX4 A;  2E7W A;  2F1F A;  3A8I A;  2O1P A;  2GA3 A;  2CQ2 A;  2OTL S;  4GMK A;  1N33 F;  4ZVP B;  1RAD B;  1IKV B;  1YIJ S;  2WSF C;  3C16 A;  2KT5 A;  2W2O P;  1S4F A;  2DIT A;  2MLX A;  2G0C A;  3MD3 A;  4UTG A;  1IR1 A;  2DGV A;  4QPX A;  4BC7 A;  1Z2Z A;  4YFU A;  1N48 A;  1JLQ B;  5IT4 A;  1FTR A;  3CC7 S;  4WPA A;  5KFY A;  2QIF A;  2HFZ A;  2ROE A;  2W9A A;  1ARO P;  3K17 A;  2E5H A;  1FRI A;  2NXN A;  3B4D A;  3EDQ B;  3KK2 A;  1HMV A;  3NGU A;  4HVZ A;  4P2F A;  5K8N A;  4B02 A;  2KRB A;  2CPJ A;  4TYA A;  2VIC A;  1B70 B;  4DSI A;  2M4M A;  2YY3 A;  4I68 A;  5HMW A;  1F9F A;  2HMI B;  5CYM A;  3SQG A;  1N5V A;  2CZ4 A;  3TZZ A;  1SL0 A;  4UY8 T;  2MJN A;  2EC0 A;  1S12 A;  2GLQ A;  2AJ4 A;  1D8Y A;  2VPW B;  3AOA A;  2VFR A;  4OYA A;  4DV5 J;  1TVR B;  5H9F K;  1DZ5 A;  3K58 A;  3JSB A;  2YKP A;  1EQ0 A;  2WHO A;  4A8O A;  1WHW A;  1U1M A;  3KHR A;  2HBY B;  4ANC A;  2BKP A;  4ANE A;  4F50 A;  3EE3 A;  3J81 j;  2DNN A;  8AT1 B;  3BDP A;  1URB A;  3POT B;  2JSX A;  2A2C A;  3D6M B;  5KFX A;  4C97 A;  1SV5 B;  3ILJ A;  2BBE A;  2I6W A;  2YNG A;  1Y11 A;  3HUL A;  1RBO B;  1V5V A;  5HVH A;  2AGP A;  3KDN A;  4OZL A;  5KG1 A;  1TL3 B;  3OVS A;  2W7P A;  2LEP A;  3RBX A;  2IYI A;  1JLE A;  4R8U A;  2XGQ A;  3HM9 A;  2IIH A;  1DQ9 A;  4DUZ F;  3AH6 A;  3R6L B;  1SIW B;  2JH3 A;  5EX0 A;  4AQY J;  4OI6 A;  1NSP A;  4A8Q A;  5J1P A;  1H72 C;  1QAX A;  2MQL A;  5CD4 A;  1T03 A;  2LQJ A;  3DLE B;  2W8D A;  2WTF A;  9ATC B;  2C3Y A;  2XR9 A;  2O66 A;  3DOL A;  1H6K X;  5ETM A;  4ECY A;  2FC8 A;  3H8Y A;  5HAT A;  3WIV A;  2XS5 A;  4N41 A;  1FFG B;  2LXU A;  3WHI A;  4ZKA A;  3OFF A;  3ZZO A;  1X9W A;  1YQH A;  2P9C A;  1SHQ A;  1X9S A;  3IMQ J;  1DRZ A;  5FJ4 A;  5KFE A;  1Y0H A;  2XZD B;  1HI0 P;  1KP6 A;  2V2K A;  1HBU B;  3FEY B;  4DUY J;  2N3L A;  4YEA A;  2IM0 A;  4F4Y A;  1BWV A;  4H4O B;  5HVG A;  4WE1 A;  5EWF A;  2A10 A;  2KT2 A;  3HFK A;  1SKS A;  4CLW A;  1ELZ A;  2RVJ A;  3DRS A;  3GIM A;  1WOR A;  5LIA A;  5J1E A;  1H2V Z;  4YQW A;  2Y1L B;  1H38 A;  2UUA J;  1H74 A;  5F0W A;  4ZLJ A;  5GAD I;  4OL8 A;  1RWV B;  2PMW A;  5CA5 A;  4UPI A;  1OSD A;  1RU1 A;  2CPD A;  3D3B J;  1FFS B;  4NI2 B;  4URG A;  3BYP A;  4ID5 B;  2R7R A;  1FXD A;  2PEH A;  2ZHB A;  1EP4 A;  3KK1 A;  2GSN A;  3BSA A;  5GAH I;  3BO3 A;  5GAG I;  5B0C A;  4URQ U;  3PZP A;  4BDP A;  4NXN F;  5B0E A;  1KVI A;  3NVL A;  4UPL A;  3SI8 A;  4OYO A;  3M8Z A;  3PYD A;  4ELT A;  1NK5 A;  2BE2 B;  4NML A;  1U2R A;  5A8K B;  2L9D A;  4WF9 Q;  4RNF A;  4Y2K A;  5J2P A;  4RUA A;  1RE1 B;  1S1X A;  3D9B A;  1LXN A;  1QD1 A;  5FII A;  1N4L A;  1UVJ A;  4ED4 A;  5IQQ A;  3OJU A;  1GX6 A;  2UVW A;  1U6B A;  5HQL A;  2I5J A;  5HMY A;  4GKJ J;  1UJ4 A;  3M9M B;  1NDK A;  4HL9 A;  4KH0 B;  4ZPD A;  2XGP A;  2QMX A;  2QA4 G;  3THV A;  2E1C A;  1SJ1 A;  2DHS A;  3TUZ C;  1IJE B;  5L46 A;  3UCZ P;  1VC6 A;  4PCQ A;  3SV3 A;  2MZT A;  1M1K T;  1S6Q B;  1U7L A;  2ANH A;  2P9E A;  1ZA1 B;  3H25 A;  1FD2 A;  2B0G A;  2CRL A;  1VQY A;  2JVO A;  2KJV A;  5LOQ A;  4UZB A;  4HAC A;  4DR4 F;  5LMU F;  3LAM A;  5K14 B;  1J5E J;  2AKW B;  4I6A A;  2NLW A;  2JLE A;  3JTO A;  3C16 B;  3GR1 A;  3MAA B;  3KHG A;  3IS9 A;  3TAN A;  2OPS A;  3Q2S C;  4BHQ A;  1T3N A;  4KPC A;  3AA8 A;  1EX8 A;  3D1H A;  2X1B A;  3ET6 A;  3H20 A;  3MR7 A;  3KHH A;  4Q44 A;  2BAN B;  3U7J A;  3NBP B;  3MCM A;  1NPR A;  1Y5L B;  3J80 U;  1YTY A;  1N6Q B;  3CJR A;  4J9L A;  1RWW B;  1HKA A;  3MM8 B;  3Q22 A;  3RW6 A;  2RIL A;  5KFJ A;  2KH9 A;  1JX4 A;  2E5I A;  3MR2 A;  2HUR A;  2AZ3 A;  4G1I A;  4CYU A;  5HMX A;  1GNK A;  4DFJ A;  1U1R A;  1SKR A;  2DO4 A;  1YKW A;  1WJ9 A; 
#chains in the Genus database with same CATH homology
 4CXU A;  1B8J A;  4NWX A;  4LRA A;  5INH A;  3SZZ A;  1ELY A;  1ELX A;  1AJC A;  4LRB A;  1KH5 A;  1URB A;  2W5V A;  2W5W A;  3ED4 A;  3T02 A;  2ZKT A;  1ED8 A;  1EW8 A;  3MK2 A;  4LR8 A;  4KAY A;  3DPC A;  5DLT A;  3BDF A;  2IFY A;  1AJB A;  1Y7A A;  4KAV A;  1E3C P;  3TG0 A;  4ZGA A;  3WAX A;  5DLW A;  1N2K A;  5DLV A;  4N7T A;  1KHN A;  2X98 A;  3IDD A;  1ANJ A;  3TWZ A;  1ALK A;  5AJ9 A;  2W8D A;  1KHL A;  1URA A;  1EI6 A;  3BDH A;  4B56 A;  1HJK A;  4LRE A;  5TJ3 A;  5C66 A;  3OT9 A;  2XR9 A;  4KM4 A;  5IJQ A;  4LR7 A;  5L0B A;  1ALJ A;  1AJD A;  3Q3Q A;  4KJG A;  3WAY A;  1SHQ A;  3KD8 A;  5GOV A;  3M8Y A;  5L0K A;  5HRT A;  3BDG B;  4ZG6 A;  2W5T A;  5GRR A;  4LR9 A;  4YR1 A;  4FDI A;  1ELZ A;  5IJS A;  1HDH A;  3LXQ A;  4FDJ A;  5LIA A;  1AUK A;  1E33 P;  4CYS A;  4CXK A;  5K4P A;  3UN2 A;  2D1G A;  4CXS A;  3NKP A;  1EJJ A;  4MHX A;  2IUC B;  2G9Y A;  1O98 A;  4UPI A;  3M7V A;  2VQR A;  2W5R A;  1EW9 A;  3B5Q A;  4TN0 A;  3UNY A;  3SZY A;  1KHK A;  5LQQ A;  3UO0 A;  4UOP A;  3NKM A;  3MK1 A;  2GSN A;  1ANI A;  4UPL A;  3NVL A;  1P49 A;  3NKR A;  4UOR A;  3M8Z A;  3TX0 A;  1E2S P;  4UPK A;  1ALI A;  3A52 A;  1ED9 A;  4ZG7 A;  3NKQ A;  3UN3 A;  1KH7 A;  4LR2 A;  1KH4 A;  5KXA A;  4CYR A;  1K7H A;  3UN5 A;  1SHN A;  1HQA A;  3IGZ B;  4GTW A;  3DYC A;  3M8W A;  2W5X A;  1ZEF A;  3WBH A;  4ZG9 A;  1EW2 A;  5LRN A;  1FSU A;  5EGE A;  3T00 A;  1ZEB A;  2ANH A;  3NKO A;  5LRM A;  1O99 A;  2QZU A;  2IUC A;  5L0E A;  4GTX A;  2GA3 A;  2W5Q A;  1KH9 A;  4LRD A;  4GTZ A;  1Y6V A;  3IGY B;  2W8S A;  4MY4 A;  4UOO A;  2RH6 A;  4QAX A;  1N2L A;  4UPH A;  3NKN A;  4LQY A;  3BDG A;  1AJA A;  2GSU A;  1ZED A;  1KHJ A;  2XRG A;  1ALH A;  3MK0 A;  4MIV A;  4KJD A;  3T01 A;  5EGH A;  1EQJ A;  2GLQ A;  3E2D A;  3WAW A;  2GSO A;  4LRF A;  4LRC A;  3WAV A;  2W5S A;  1E1Z P;  4GTY A;  3CMR A;  4NWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...