3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
3IGYB 3BDGA 5L0KA 4B56A 5AJ9A 5HRTA 2IFYA 3IDDA 5K4PA 5DLTA 2VQRA 4KAYA 4CXKA 4UPIA 1O99A 1ZEDA 2GA3A 1FSUA 3WBHA 2ZKTA 4LR8A 4CXSA 1Y7AA 1KH4A 1K7HA 2W5QA 1HDHA 4UPLA 1ZEFA 3NKOA 5L0EA 2IUCA 4FDIA 1ED9A 1KH7A 3M8ZA 3MK0A 3M8WA 5KXAA 1EJJA 4N7TA 4YR1A 1KH9A 5EGEA 3UN3A 4LRDA 2ANHA 1N2LA 4UORA 3WAVA 5INHA 1URAA 5L0BA 1SHQA 4KJDA 1N2KA 1AJCA 2QZUA 5LIAA 1SHNA 4GTWA 3IGZB 1KHKA 3NVLA 4UOPA 3TWZA 3UN2A 1KHNA 1Y6VA 5EGHA 2IUCB 1KHLA 1AJBA 2XR9A 4NWXA 5LQQA 1EQJA 4ZG9A 3BDHA 3B5QA 4FDJA 1ALJA 3CMRA 5DLVA 2W5WA 5C66A 2W8DA 4UPHA 1EW8A 4LR2A 4LRAA 4NWJA 4KM4A 1ELZA 3DYCA 3BDGB 3WAXA 3T02A 2GSNA 5GRRA 2W5VA 3DPCA 1ANIA 3NKQA 1KHJA 1E33P 3MK1A 3Q3QA 3ED4A 4UPKA 1P49A 2GSUA 1ZEBA 5LRMA 4ZG6A 3LXQA 4LR7A 3T00A 3NKNA 3M7VA 1AUKA 1EI6A 1ELXA 2W5RA 3TX0A 2D1GA 4LRFA 1ALHA 1ED8A 1HJKA 4MHXA 1ALKA 2GSOA 2W5XA 5GOVA 3UNYA 4LR9A 4UOOA 5LRNA 2RH6A 4CYRA 4KAVA 4QAXA 3TG0A 1O98A 1E3CP 2G9YA 3MK2A 3NKRA 1AJAA 3UN5A 1AJDA 1B8JA 3E2DA 3NKPA 4MY4A 3SZYA 1EW9A 1EW2A 3WAWA 3WAYA 5DLWA 4LREA 2XRGA 4MIVA 5IJQA 4KJGA 1ELYA 3M8YA 4CXUA 1ANJA 1E2SP 1HQAA 3OT9A 4CYSA 4ZG7A 3SZZA 2W5TA 3A52A 4GTXA 1ALIA 2X98A 4LRCA 2W5SA 3T01A 5IJSA 3UO0A 3NKMA 3BDFA 2W8SA 4LQYA 1KH5A 1E1ZP 2GLQA 4TN0A 1URBA 4GTYA 5TJ3A 4LRBA 3KD8A 4ZGAA 4GTZA
chains in the Genus database with same CATH superfamily
4NLGA 1QJHA 2GAHC 3I82A 5A6WA 5K9FA 1RT4A 4URGA 3M9NB 4DG1A 1NK9A 2YX4A 3KOAA 2IFYA 5DZ6A 2GGPB 3IR7B 2GIRA 9RUBA 1F5CA 2E1MC 1HBNB 3QSIA 2VQRA 4GKKJ 2WVDA 4RPFA 1RWOB 2E7VA 2R7RA 4Y2CA 3VGSA 2XM3A 3QJLA 2GA3A 2QLXA 2XMUA 1PIEA 4PR6A 2QEXS 1WI8A 2VG7B 3R5GA 4CQ1A 2UVWA 4DPYA 4EZ9A 3V6DB 5L46A 1NLKL 5ETRA 2OGUA 4OX9J 3D5MA 2JHEA 4O44B 3UW1A 1NKCA 3C46A 4P2FA 2CPXA 3GYXB 4LBHA 2ZC4A 4ATNA 2YH0A 4LVOP 3TZZA 3ZTRA 1Y3JA 2IM0A 2EKNA 2XG8A 3QQCD 4PQUA 1RWNB 1DLOB 3IR5B 5DZ7A 3JSMB 3PW0A 1B4SA 2HBZB 1T11A 3MPYA 5AE3A 2MKHA 4N5SA 2BR0A 1FA0A 3BB5A 3CSKA 1VJQA 5HI7A 4F0HA 2LECA 4PG8A 4ZHRB 2AJ4A 3W66A 4UORA 1JX4A 3IRXA 4WXWA 4ED8A 3LH2S 2OP5A 3LGHA 3MPUB 3BH7B 4YY3F 4X64F 1U47A 1N5QA 3I96A 4HDGA 3PYDA 1H2VZ 5HN0A 2V4QA 5KFFA 2XCAA 1S1XA 1HPZA 1K1SA 2HS4A 2QV6A 2RRBA 1TP7A 2UUWA 3I55S 3AXKA 3M1VA 2VZ9A 1NH8A 2IDEA 4KGVB 1SKWA 3MMCB 3GYNA 3OV7A 1DRZA 1URNA 2RSQA 4FDJA 3D0IE 2RDIA 1FT8A 2HW3A 1PAUB 2MHNA 1Q8LA 1CJKB 1TUGB 4YR0A 4QBUA 3UCUP 3CJ8A 3N6LA 5KTQA 4CH0S 4HR2A 2NZ4A 2LDIA 5L9NA 2NYHA 2MJUA 2HFSA 2VG6A 2N4DA 3EXCX 3X1LB 2AP6A 4PRFA 1GH8A 4GMKA 4P2MA 3T02A 2GSNA 3V4IB 2JEFA 4NLSA 2BKOA 2OEKA 4Y00A 4CO5A 4EUVA 1Q7YT 1KTVA 4CT8A 4DU8A 4O3NA 3TUPA 4KY3A 4L3KA 2M9KA 2FY1A 1H7WA 2CVEA 4K4VA 4PAAA 1KHWA 1OYDA 3M8PA 2AHOB 3W63A 2X51A 2ZNYA 6AT1B 1VQOS 1HNZF 1KDNA 1U7LA 2B4VA 4X64J 1X0PA 3D0GE 4J9LA 1XBWA 2IA6A 3RGIA 1IR0A 2JSXA 3DLBA 1B7YB 1NHUA 3DLEB 2AJ0A 3ITHB 1DLOA 2N3LA 2JLGA 1WWHA 2L48A 4M5DA 3RJMB 1M5VC 3TX0A 1H3DA 2XTJP 3HP6A 1W26A 2FLOA 2AGOA 4EMDA 4B3RF 1FXLA 1WC4A 3PNIA 1JXEA 5KFYA 1LXJA 3H25A 1NHVA 3ETOA 3O6QA 4UOOA 3F56A 5B0DA 5E3AA 1KLMB 3FQLA 2I5JB 3B8HA 4M63A 2DR7A 2C28A 2H65B 4CYRA 4HACB 5IWAF 2R7OA 4A8QA 2F8EX 2J6TA 4KQZA 2OJ3A 1I6JA 2APOA 1DBDA 3HKZD 3HLUA 1FHTA 4IYQA 3NKPA 3NEKA 1EW9A 4FKXA 4O44A 3WAWA 1QY7A 3KLFA 1SV5B 1RAIB 2FJAB 3IC1A 4IH7A 1CC7A 1EZZB 2B8PA 5J2MB 2RF2A 5BXIA 1E2SP 4LF6J 3MF5A 1NAQA 4IQXA 8ATCB 5IM0A 5IT0A 5ETKA 4NLWA 1JLFA 1KHVA 1IBCB 4J9MA 1WUUA 6FDRA 2VPZB 2D3O1 3VQTA 1SI9A 3AFGA 4O3PA 2B4UA 2W8SA 4IFVB 2RU9A 1BY9A 4M5GA 3BDEA 1URBA 1RTJA 2G2YA 1RDRA 1ROFA 1SPBP 3FEXB 3MR2A 4BC9A 4FF4A 2BJ9A 3LP1B 1RUSA 3GSDA 4I69A 2P2CB 3B54A 3W8PA 1ACMB 4B56A 5I3PA 3BSCA 5HRTA 2IA0A 2Z57B 3MWBA 2VKZG 2AF6A 2XMWA 3QT6A 1UVMA 4DR7J 2HAIA 1H2TZ 4LR8A 2WONB 3L4BC 2VBWA 4LIRA 4EZ6A 3Q8YA 1KH4A 1C1CB 3PIOQ 1QVGR 3AXMA 3R5CA 1NJIT 3OR2A 4KO0B 4JV2A 4WK1A 1G2EA 5KFRA 3E2EA 4R0JA 1VC6A 1Y7PA 4C8YA 5KXAA 1FF2A 1N6QB 3KLGA 1T03A 2I5JA 2EI5A 4A8MP 1FD2A 2QT7A 3L7OA 3VVTA 3G8TA 1VFJA 1JKHA 2QLBB 3B78A 1N5SA 5CYMA 4DSFA 3PW2A 1RK8A 2IYGA 4QYZK 1Y00A 2ROPA 4XAKA 3JSMA 3RB4A 2LKZA 4M5LA 1KQSR 1RJJA 1D09B 2GIQA 2WBMA 3U02A 4CLFA 2VODA 1LWEA 1RBOB 2XQCA 1XC9A 4WYWA 2JNJA 2H51B 1HWKA 1VK3A 4CLSA 3G8SA 2IUCB 1VQ7S 3PJXA 1QAYA 5L1IA 2BMBA 2DR6A 3ISNC 2O67A 2ZBIA 3ISZA 5A8KB 4KYZA 4DR5F 4DSJA 4M5JA 1T9UA 2ZOGA 3C6UB 2FYXA 4MFBA 2XY6A 5A8WA 3C15A 3UDLA 1YRXA 5F9LA 1BC6A 2KDOA 3EGWB 3PYGA 4FF1A 4QU7A 2D3ZA 1YJVA 1OY6A 4DG1B 4KB7A 3R7SB 5H9EK 3JQJA 1UVNA 2B3TB 4O4RA 4FXWA 1TV6B 4U67Q 2CPDA 4IG3B 4F4ZA 4WTOB 1JLCB 1LW0A 2OPSA 2OPQA 3NG8A 4IR1A 1ZOTA 1T7PA 1RLCL 3H5UA 1IBLJ 5KT3A 2Q66A 3GWCA 3TUIC 2R8GA 3LP0B 1F9HA 2LP4A 3KDNA 2HK2A 5HROB 2PT0A 1Z2LA 3OD2A 2W2QP 2MKKA 2RQKA 2I6WA 5CHCB 5G0RA 3HVAA 1QSLA 3IBFB 1NK4A 4DF8A 4ZIVA 2HQIA 4WBFA 1UZDA 4DR6J 4MHXA 1KR4A 5L8RC 3NAIA 1MWQA 1RADB 1UW4A 2QG9B 1R6VA 1UKUA 2RHSB 3MMBB 2CA9A 1JLAA 3FFIB 4LR9A 1NDCA 4X65J 5DLFA 2XNQA 4E2FB 4DQRA 3N28A 3H0PA 1FRHA 1S48A 3ENVA 3DOLA 3PHEA 3OLBA 3GFZA 4J9RA 1T05A 2Z0GA 4MKYA 4LJMA 1SL1A 1I1GA 1F60B 3CJQA 2A0FB 2HRYA 3HD2A 3T1AA 1G3OA 2F4FA 2UV8A 3HO1A 2XEXA 2CRLA 2CDQA 1BQMA 4H4KA 4ES2A 1KD1T 3LWMA 2BJDA 4C48A 2RDDA 2BYCA 1BQXA 1YWXA 3DRRB 4RBTA 4LF4F 2HNZA 4KV8A 4ZLPA 3G9CA 4CLZA 2QC3A 7AT1B 1PJ5A 2UUBF 2W5TA 4P2SA 1VK8A 4QWDA 4JB8B 4V1Ak 2CJQA 2MKCA 4Q8FA 4QIGA 3GIRA 3Q2TC 1UWBB 4QIEA 4B17A 5GAEU 1TK8A 4H4KC 4H4MB 1WDTA 1U1LA 2P9CA 4NZ6A 3ONQA 4TN0A 5A8WB 3AJDA 3I5AA 3HT0A 1MLAA 2MZTA 1NU4A 3B4DA 3DDNA 5HANA 5GAHU 2R2TA 2HVZA 4RBVA 2CQ2A 1GK8A 1Q4RA 2BKPA 2PEHA 3OUYA 1OSCA 2CPJA 2IVFB 4ZPDA 2PI5A 4LQ3A 2FVSA 3ZZPA 3HVWA 1N34F 2IPOB 3DI6B 4HVZA 1URRA 2E7XA 1RBLA 1O99A 5FDLA 2VASA 2P8IA 1S4FA 5ETQA 4Z2XA 3QSYB 5I3UA 1RXOB 3DLKA 4YMEA 1YTYA 1MROB 5H9FJ 3KNAA 2P5VA 2NR0A 2CIMA 3CIMA 1S1UB 2J76E 2J8AA 1U48A 2CWKA 5A0YA 4CO3A 4DV1F 1B0PA 3T5JA 4F0MA 2NLWA 3M2RA 3W64A 2W2PP 2W9BA 3WZ0A 2AEFA 3MPWA 2W9BB 3BBFA 4QYZJ 3JQMA 3EJMA 4X4RA 1FNOA 2WB1D 4Y3CA 2JFDA 5DG9A 3QGPA 5KFVA 2V67A 2FVCA 2V4JA 3QFWA 3MCNA 2V9KA 2UXDJ 4HI2A 2ZOFA 3CCSS 3FZBA 2FZKB 1NRKA 1UEKA 3QFHA 4AE5A 3J81Y 4ZVGA 2VICA 5J2NA 2AQ4A 1T3NA 3SSRA 3BO4A 4NXMF 4GKJF 3CIZA 3NVLA 1Y6VA 4IR9A 3FRZA 2IJNA 3QAUA 1KHLA 5ETLA 3GIMA 1QE1B 4CLLA 3SI8A 2AJ2A 3KYLA 2FLPA 5HP1B 4ZG9A 4A8KA 2NSCA 1RWMB 2YPYA 4OZJA 1U45A 2NXEA 2VBYA 3DRPB 3MM6A 1HHQA 1M5KC 5C66A 2YWWA 3KUGA 2ZH6A 5KFIA 3OSPA 1HHSA 2IFXA 3LAMA 3NS5A 5J1EB 1FTCA 1QM9A 1RACB 4TVAB 5D78A 5H9EJ 2IRYA 2GQCA 4CDIA 4X4UA 3N5FA 4HYKA 1NB7A 1UJ4A 1OQ3A 4RJVA 4CH1A 3O8WA 2E1PA 2B9YA 4TYAA 2BQUA 2HHSA 5KG2A 1PKUA 1VBKA 1YG0A 3T41A 1BGXT 1PGZA 3AOCA 2V2QA 3M2UA 1CS4A 4ES1A 3QRPA 3ED4A 4PWDA 3Q3QA 3DDIA 5K8NA 5F8NA 5AXNA 3POTB 3UWTA 2B7BB 1F5AA 3Q2SC 4KBIA 4ZCKA 3WX8A 3H5XA 4QU6A 2DNYA 5KT4A 3R8YA 2RVJA 2XS2A 4I64A 3BR8A 3GILA 1FD8A 5GMEA 3FEYB 3DM2A 4XPEA 2MLXA 4OLOA 2AZ3A 2CNNB 3D3CJ 3L7PA 5HQ8A 3E3XA 5FLXU 3CCMS 3IWLA 1VQ4S 5HQMA 1RQ0A 3G82B 1VDHA 1D9AA 1FE4A 2GV1A 4LRFA 4OYXA 3MFHA 2WOMB 1GTHA 4JI1J 4M1KA 4J37A 1RP5A 1U0HA 2W9AA 1HIYA 2J9CA 2W5XA 4CLPA 1Q0NA 5E33A 1DQAA 4NOHA 3BKTA 4URSA 3SFUA 4DV6J 2BZ2A 3DHXA 1EIYB 4RZRA 2RHQB 2YX7A 3LANA 5KFAA 3MMBA 3TUZC 1Q82T 1J5EJ 3KLHB 2G9YA 5GAGU 1EAYC 2F3JA 1QUVA 1FRKA 2XZTB 2J5AA 4PWUA 2QMWA 3M9OB 1PC5A 3M8RA 4JYAJ 4DL3A 1WC0A 2DCUB 5IJQA 2ZKUA 2ACYA 5D4PA 1WACA 3AD7C 4EI2A 1N5YA 2PIIA 1R7IA 3PRVA 3MGJA 4QOTA 1OJ4A 1RHQB 1WC5A 3M32B 2W9CA 4GTXA 1TAQA 3ENWA 3CUNA 2YNGB 3GV8B 1JLQA 2FVRA 1PJ7A 1SUQA 4TKTA 1XERA 3KJVA 1NH7A 4E0DA 2RRNA 2ZM6J 4NLXA 4ZP8A 4YN3B 2GLQA 2HBYB 3M32A 1WI6A 3CDAA 3JYTA 1KC8T 1T95A 3OTBA 1TKTB 2QJ3A 4NLQA 3OBIA 4J9VA 1TFWA 4K2XA 3C3LA 4NCBA 2B5JB 2MKSA 2DXEA 3H7HB 2JL9A 3Q86A 4ECTA 3OL8A 1XNQF 2NUHA 3SYZA 2YX1A 3MUMP 4PG4A 4WCEQ 1YX2A 1YRTA 3D67A 1YBTA 4KGMA 3FCWA 3P5BP 4XDCA 5B0FA 4F4XA 2UUAJ 2BE2B 4AYBD 4CP5A 3D2WA 2FZGB 4TNOA 2CPEA 3LW5C 5C24A 4EYHB 1PYSB 5LXRA 3Q22A 1PILA 3NCRA 2Y0SD 4U95A 4FDFA 3UE2A 3M8ZA 4J9UE 4CH7A 2LA6A 2CZVC 2LXFA 3ITHA 1ULRA 3O2IA 2CJYB 2ZWOA 5DDQC 2RUSA 3S1TA 5DETA 2D9PA 3PACA 4O23A 5H1SV 1SL0A 2J0QD 3TJAA 5KG7A 3V6DA 3T9ZA 1VHFA 3TJ9A 1URAA 3KLGB 3DLEA 1T03B 2YY3A 2G1HA 1SHQA 3TNVA 4I2PA 3ZTOA 3MCSA 4DU7A 3PJ9A 2OMLA 1R0AB 1C1BA 1N2KA 2GAGC 2Q3PA 4WFBQ 5J2PB 3BBBA 2PDAA 1LK5A 1XMOJ 1QAIA 1X4AA 1Y5LB 2MQLA 4NZ0A 1WF2A 4RNHA 3P4UB 2HVHA 2XR9A 3OFFA 1FFGB 1EKSA 1S6OA 2K1RB 3NRBA 3PYFA 2O1PA 4ED3A 5FJ4A 5CYQB 2FGCA 2BM0A 3HZEA 4UZCA 5BYRA 1RT7B 2N4CA 2PD1A 3NWRA 4ZLLA 4LR2A 2QYCA 2X1GA 2E44A 1KQKA 2QRRA 2Z2YB 1X60A 2J7WA 3ZZOA 1VRTB 3ZZRA 4YDDB 3LP1A 1IR2A 1GX6A 2VBXA 3BF4A 4N47A 1RTJB 1BWEA 1V9OA 1HQEA 1S59A 2IVMA 4RUAA 1U1PA 6FD1A 1CULB 3AA9A 3JAMU 3E01A 5F8IA 1XJWB 3VWSA 2M8DB 3MUVP 1RHUB 2HQGA 4OHVA 4P6QA 4PPDA 3KG1A 2AW0A 1HLWA 3BYPA 3I5CA 2XSJA 2Z4PA 2YKPA 3NGDA 3KK2A 5JMNA 2FHJA 4KH1B 5T7LB 4RO0A 4NI2B 4O0IA 4UF4A 5GVQA 2F9JA 2HFNA 3SIPB 2F63A 4DR1J 2BQ3A 4IUFA 3W62A 4K0KJ 5KFQA 2NS1B 3GJRB 3N6NA 5J1PA 3LGNA 1YBAA 4I4BA 3IFEA 4C3LA 3NKYA 1GMWA 3PEJA 3W5XA 2C42A 4FXVA 3KG4A 2MZRA 3GE9A 2UVVA 4D3GA 1U0HB 4KKOA 3W9HA 1R43A 3MK2A 5HJYA 3F0NA 1VRUB 2WOMA 2X1BA 4HDHA 3CC7S 2G0IA 1MN7A 3PW7A 3U1NA 3QT7A 3Q8PB 3TEGA 4ZPWR 3FKBA 3MR3A 2HHUA 5BJRA 1ANJA 3NAHA 1TL1A 1B7FA 2YNIA 4NYOA 1VQMS 1P1LA 2WSFC 4YR3A 3CJKA 2Y8YA 4G3IA 1IR1A 1FO1A 4EEYA 1AA1B 2ZM6F 2RS2A 3L7UA 2W5SA 3QGHA 1UL3A 3AB2B 4IDKB 1HMVB 3KJVB 2ZZNA 2XZWA 2MSTA 1P6TA 4QR1A 2DNPA 2HFZA 2HFVA 3HSDA 1JLQB 1Q16B 2K2PA 2OELA 2ZVSA 3JYTB 3EPGA 2EEYA 2ZH1A 4C4WA 3T01A 1NHKL 2MZSA 3DHWC 5GAHI 4UOGA 1HQUB 1HWJA 5DLGA 1WSRA 3CD5A 2B9XA 1S6PB 1RCOB 2VG6B 3MMCA 2HHHJ 4OV1A 1S77D 1W2IA 2B4OA 2UUAF 4OYZA 4F3MA 3RR7A 3I0SA 3VGVA 1TL3B 3AODA 2XMJA 2L3MA 3PO5A 3J7A1 4OX9F 5F8LA 1TR0A 1X9MA 2DEIA 1FRMA 3DOKB 4DSKA 1P9QC 1RWVB 3BEGB 2LXIA 4PG6A 4UPLA 3MAAB 4HEA9 3TZYA 3KHHA 2R7WA 4DV0F 3RB0A 4YOEA 5F8JA 1KH7A 5HMZA 9ATCB 2JJ4D 1FJEB 2DNGA 1RISA 4PPZA 3BGUA 4CO1A 2BE7D 4MIBA 2MXYA 1KH9A 3M2RB 3A3PB 1UETA 4NMXA 1SJ4P 2SXLA 3OTEA 2CQ1A 4DXLA 2Y1RI 4OHWA 2R8IA 3H40A 2AEJA 2DXFA 1AZSA 1JNZB 3FSYA 1IBKJ 5B09A 1FRJA 1FRLA 3NNHA 4QJVA 1EJ7L 1PC4A 4WP8A 4NLVA 3RZAA 4CO4A 3H5YA 5HQLA 3CPWR 4TLRA 4J9KA 2WVEA 1WF0A 3AD9C 3JS9A 2XS5A 2OTLS 4KJDA 2BW2A 2VF3A 3NOGA 4DUYJ 1HWUA 3DFEA 3Q24A 4K5RA 4UOPA 2OH2A 2WVFA 2Z8QA 3CNQP 3OR1A 4F02A 1FVSA 2XZDB 4OMFG 2J6UA 5LSRA 2BKNA 3MM7B 3VR1A 2K3IA 1U1NA 1HNZJ 4DV2F 3R1HA 2HHPA 3A3NB 5KFUA 4HL9A 3P96A 5LMUJ 3V81B 2VHGA 3PX4A 4PXEA 1EW8A 1D3WA 3K58A 1OMSA 4X4TA 4ZVSB 4DQIA 3GCXP 1IKVA 1GMVA 2G9OA 3I4HX 2B5JA 4J91A 3MPDA 2WW4A 4K7QA 3RTVA 1XK8A 1JXVA 1H72C 1LXNA 3IBWA 4CIOA 3VAHA 2HWTA 2M0GB 2GJFA 1KFSA 3HVRA 3GR0A 1FFSB 5I4MA 1YZ7A 2IBOA 1E33P 1MNEA 2DNRA 2VBZA 4J9OA 2RAQA 4A8WA 3CCQS 1CJVB 2L9NA 4IKAA 1VYAA 1WG1A 2ZVIA 4I7FA 5ETNA 5L1JA 4HI1A 1I5OB 4M8LA 2DT9A 3MHYA 1FJ7A 2YWGA 2YKNB 4KE5A 4ZPTR 4OJ3A 4F50A 2AYBA 1NZAA 3M7VA 2VJUA 2P6SA 3FBEA 1FI4A 2HMIB 3MXHP 1RAFB 3KWMA 3NBPB 4W98A 5HBMA 3EICA 1KTQA 1RTHB 4O4GA 4OX6A 4WIQA 4G1QA 3RUBL 4U7CA 2YKAA 1MMNA 5M2PA 3RRGA 4PQAA 4WWSA 2CQ4A 3CCUS 1X4HA 3DDKA 2WRMA 5GMKa 2M5YA 2V8PA 4LFCJ 3CDUA 3J81j 3SCJE 1SIWB 3K5OA 1SC6A 3BN7A 1M0SA 5T14A 3DLKB 1YK9A 2DIUA 1HNXF 2E9RX 1ICEB 5HROA 1FVQA 2V50A 3NKRA 3GP9A 2OI2A 1RTIA 2MKIA 4F3OA 4IG0A 2HZCA 4I2QA 3QJPA 1DTTB 4RNNA 3DGPB 2ZE2B 3D6MB 4ES3A 2LEAA 1VOMA 2XULA 2UZAA 2VKRA 2FVQA 4DZDA 1FKPB 4KHPF 2A6MA 1MN9A 3TA1A 1W2BR 5HMYA 4C3KA 1NUEA 5C5JA 1WORA 1S9GB 4IH6A 1WC6A 4PYDA 3ZNUA 2XSFA 1KVIA 1X31C 2GMJA 3D1HA 4ED1A 3TAPA 2G2ZA 1O5JA 1M5OC 1FRIA 3HSJA 1T3OA 1IBMJ 3RAXA 3BR9A 4U96A 1XMQF 2DPIA 2E29A 2G2OA 1IWAA 2YTCA 4R25A 5D4OA 4ECUA 1S0NA 3MZIA 3CD6S 3H4DA 3HI9A 2ZD1B 4FP9A 3C15B 2ZHBA 3OQ2A 2B4PA 4K4YA 4QWAA 2ASJA 3C6UA 4MFBB 5E2QA 5LM7E 1NK8A 1HNIB 3DU6A 5HMWA 2OLWA 4FN5A 3CTRA 1HNXJ 3FQKA 4QW8A 3WIUA 4OYPA 1X4BA 3RYLA 1L3UA 3AOAA 2HLTA 1G4CA 4TY8A 2O66A 1MMLA 2BJ1A 1TVRB 3EE3A 4LSNB 5D0EA 4C8KA 2JC0A 5JJBA 1XTZA 1WELA 3S6EA 3JAMY 2C2NA 4HHUA 2QZ8A 3I0RA 3MTJA 3CJ4A 2ADCA 1Y11A 4M5DB 1FX2A 3VZIA 1O8BA 3GCWP 1NK7A 1FEHA 1QAXA 4MKAA 3S01A 3G8QA 4X4OA 1HBUB 5HVGA 3OL7A 3D1OA 5HO4A 2X3GA 1LWXA 2GW8A 2WVCA 3IS9B 4C6AA 5F3ZA 1N48A 3ELHA 1RTHA 4O4GB 1R27B 2Q6BA 2ILYA 5C2GA 4Y6IA 3SSQA 5T7LA 4AD6A 1CC8A 2WONA 3G87A 2CKWA 5HK4A 1CG2A 2H9ZA 1R8BA 5C7PA 3CCTA 2DBBA 1WG4A 3UN2A 4JI0F 3FVYA 4DCJB 1KHNA 5E5NA 5KFXA 3ETMA 4Q5VA 4DQQA 2ALYB 2MY8A 4DX6A 5LQQA 2YKQA 2CNLB 3PV8A 3CMRA 1XEZA 3PFEA 2W2NP 4WU2A 4U7UD 3UDCA 2C3PA 1IKYA 2WK4A 1SL2A 1U24A 1I94J 1NEEA 1N0UA 4YS2A 2JEJA 4CM2A 3KG0A 5C42B 2AU0A 4I1TA 5EDWA 1I3OB 3O44A 4KR0B 5DQHA 2BX6A 3ZZ0A 4IRDA 2OO4A 3MEEA 4DR6F 3V5RA 4K5SA 2KFZA 1RT1A 2JX2A 3WC0A 5GRRA 1RU1A 3ZZZA 1D8YA 3OXFA 1CPZA 1ANIA 2NXCA 1VQPS 1NNDA 1WD6A 2M7SA 1GNKA 1OO0B 4LBIA 4IFVA 3RU0A 3THPA 5GAEI 4L75A 4Y2KA 5L39A 1KKHA 1M5PC 3QRRA 2Q43A 4JUZA 3FBFA 4M5MA 2VPXB 5CYJA 2ZZMA 3US5A 3NNCA 2WCXA 1ZEBA 3SBMA 4ZG6A 2C1EB 4ZIWA 3V6HA 5ETOA 1NK6A 1AFJA 2ROGA 4X4QA 2B6AA 2RRAA 1SCJB 2ADBA 1S0VA 2I8EA 1HBOA 3LP2B 4RW6A 4B9VA 2KHCA 4ZVRB 4EO8A 2UU9J 2GO8A 4LFCF 2KRBA 4ICLA 2DHAA 1Q53A 3E51A 2ZH2A 4DPXA 2JVRA 1ALKA 4KTQA 1HARA 2DGWA 4EFAC 1FWLA 2GX8A 3H90A 2AEMA 2QFJA 1UPMB 1CSJA 1ITPA 1Y3KA 2EK6A 1LV5A 1RA7A 3CB4A 3CMAS 1ZAXA 2BVZA 2C3UA 4A47A 4NPOA 2VQEF 2GMLA 4LF6F 3K8VA 1EW2A 3BREA 5K14B 3DLGA 2QMUB 1HWIA 3FDSA 2WB4A 4NI2A 4P71A 3W2WA 3MCOA 4CCHA 4EBCA 3L95X 1S9EA 1IVZA 4CM0A 2FB0A 4QQBA 5FD1A 5KOXA 2E5LF 1V3SA 3Q83A 1RT1B 4LRCA 4WJBA 4WU3A 2WHOA 3WHIA 3QMQA 2G0CA 3JSBA 1BXNA 1N52B 1IUJA 1U6FA 4NL5A 4ALZA 1SUQB 1AUDA 4MY4A 2QGFB 4NA3A 1RT7A 4P52A 5F8MA 2BANB 3UDEA 1JK9B 2FIUA 3BGOP 4NLRA 2XGPA 4B3OB 1FNMA 1M5HA 1FXDA 2RMLA 2XBPA 3OL9A 3IXQA 3KXDA 4RKUC 2EFOA 3QBCA 2YWEA 1NDKA 1P8GA 2ZBPA 3CCZA 2BUNA 4ILRA 4A8XA 4I68A 3K7RA 4XDDA 5CYQA 3Q8SB 3SV4A 2ZKTA 1ZETA 1RYRA 2HQDA 2C2MB 2DNQA 3ET6B 1HL6A 1CEZA 2CPFA 4HTIA 2R2RA 3DU5A 3N6MA 1C0TB 3KUEA 4QPTA 4RW4B 4PYAA 4U8VA 1M1KT 4RL1A 4FDIA 4JBCA 1FCAA 4QCLA 1J5OB 3H2VE 4DV7F 2R8KA 2IMWP 5J1NA 3NCQA 5A8RB 3QLHA 4X66F 5A8RA 4JI5J 3LQVA 2XYHB 4YB1P 2IDLA 3NS7B 2R2SA 2B6AB 1C4AA 2M8HA 1VQ5S 1PBAA 4X66J 1UW9A 2XMTA 3FNNA 2BQRA 1F5BA 1K73T 2HEKA 5LJ5Y 4YFUA 2MJNA 4JV0A 3W65A 2R7SA 3B82A 1F3VA 4WYLA 3VAJA 1ZZNA 3CWJA 1REGX 4X62J 4OLPA 3AH6A 1NBEB 2ZEJA 4MMOA 1J5EF 2F9DA 1X5SA 5IXUA 2QYGA 3BYRA 2MKYA 2RU3A 4X62F 3B5QA 3D6TB 2XB2D 3DRXA 5L1LA 1R3NA 1T02A 3SDEA 2ZHAA 5L1KA 4J90A 3A8IA 3NS6A 4DUTA 2R9LA 1F9EB 3TA0A 5IT4A 1XNRF 1BD6A 4GC7A 3PW5A 2PFDA 3RAQA 3MEEB 4OV6A 1YJWS 3W2VB 4ILMA 1ELZA 1Q79A 2KM8C 5KT5A 3I56S 3VAMA 1NKEA 4JI3F 4DV7J 3BGFA 5IC4B 5IS2A 1SH3A 4WFNQ 1VQLS 4V19J 2MQ8A 5I42B 3HX9A 1X5TA 4OI1A 1Q78A 3QNWB 1U2RA 3LPYA 3LUYA 2R2UA 3BM7A 4RX6A 1LQ9A 1NPKA 3RBDA 2FHMA 1WC1A 3R5JB 1N34J 3MAQA 1HPZB 3Q8RB 2VL1A 3KHGA 1TMJA 5M2RA 2W4PA 4MAKA 2FC9A 4S0MA 4I6YA 2KN4A 5KOWA 2XWXA 3J7Z5 4C0BA 2EFPA 3A8KA 2HHHF 4LF9J 1B70B 2DRDA 3TI0A 4G1QB 5EX3A 2M2BA 4WP9A 1RHJB 4OZ3A 1S1WA 4QIVA 3CW2C 3ZNJ1 5FLXY 3HHEA 4DPWA 3F73A 1UMJA 1Z4UA 5E3QA 4TYBA 1O98A 2HNDA 3DM2B 1YLXA 2AGQA 1Z1ZA 2Q79A 3E2DA 2FPHX 2EFNA 1Q8IA 1UCNA 2V8HA 3SZYA 2BOPA 4LF1A 2DHHA 4N8OA 2GGPA 1B64A 4MIVA 1HQ2A 4DS4A 2VFRA 4KJGA 1JLEA 3M8YA 1KBRA 2WZ1A 3R6LB 2KL8A 3OTCA 2D9OA 2JEIA 2DEJA 5KG4A 1X4DA 2DHXA 2Z2LA 2DNLA 2ZBQA 2RE1A 1HI1A 4CYUB 2QLJB 1UVLA 5IZHA 2HZVA 4K4XA 1YVFA 4C11A 4Q0BB 3MM9B 1NSAA 1A7GE 1S9GA 1IBKF 3BDPA 1UFWA 2FHJD 1FJGJ 5J1EA 2DGTA 2XYGB 2LQJA 2DB1A 3KD8A 2VFSA 4HHHA 3NNAA 2HNZB 2B56A 2ABYA 1S57A 3D4JA 5IOLA 2CPZA 1YJ9S 1XMOF 4TU8A 1KRPA 3IGYB 3UCGA 4DS5A 3CCVS 4LF7J 2K7JA 4NLPA 2MQPA 2E7WA 1GMWD 2M4MA 2YNGA 3P6YC 3C19A 4Q2MA 4OYAA 4CXKA 4LFAF 3PG9A 1CJKA 4OZ2A 5D0HA 5BR8J 1ZEDA 2PA3A 3KLIA 1TL7B 4QZVB 4NLTA 1SJQA 1UVKA 2LLZA 4QWCA 4HHJA 1AT1B 2GA7A 4BWJA 1WSVA 1LEOA 3DYAA 3G2XA 2Y1IA 3H4BA 4DX7A 1DY3A 3VQSA 3RB3A 1GXLA 2H5JB 2KJVA 4CWBA 3BJYA 4CRJA 2HBQB 2IAJB 1NJZA 2VQFF 3NBPA 1JLGA 2HGMA 2ZUAA 2XMKA 2ZFHA 4DX5A 3MUTP 2L9WA 3PY8A 2HWHA 4ZPAA 2I0XA 1VIXA 3CJTA 5A0YB 5AE2A 3HDSA 4OYMA 4B08A 2KO1A 2HFUA 2WTFA 5IT9U 4OI2A 2VJVA 1NXIA 4ZP9A 3G82A 4OX7A 3AT1B 3KMSA 1JLGB 2UUTA 1VC5A 3KMQA 4A8OA 4LMZA 1OY8A 2BJ7A 3IMQJ 3D6HB 4K59A 4RR5A 2B43A 3AOBA 5KFTA 3EDQB 4USWA 1SHNA 4ZVHA 4GTWA 3ZZYA 4H4OB 1ZA2B 3AQPA 5D0GA 3H98A 1WJ9A 3AJ1A 1YBUA 3TZWA 1KQGB 1U1MA 5E7OB 2HVEA 3BDHA 4AQYF 2OEJA 1MG7A 4F26A 2DNNA 1VCTA 4HKQA 5KFNA 3DOMA 4DV3F 3QGIA 2HWIA 2UVRA 4C8LA 2AJQA 4PUOB 4NCGA 3IN5A 1UAWA 2EKYA 1U1RA 1LNQA 2B0GA 5ADZA 2CQ0A 1KLNA 3KLEB 2V6AA 4K0KF 2HS3A 3M4XA 2D3UA 5LOQA 1P27B 3BDGB 4M5NA 3CJKB 3FRYA 5A2QU 1J2VA 3JSYA 3NKQA 4ZCLA 1TELA 3CJ3A 3G86A 1SB6A 5KFMA 2FJXA 2PN6A 2QLFB 1U1KA 1UWBA 1QE1A 2GSUA 4P10A 1RAAB 3T5HA 3OR1B 4P9SA 4M5HA 1NKBA 2FVPA 3IM9A 2K06A 4ETXA 2GJIA 1AUKA 2YNHB 5EWGA 2RDJA 2BDPA 3D3BJ 3PTWA 1WTFA 1REVB 3ULHA 3MR6A 2PO4A 4LVNP 3QIPB 4ZPVR 1ED8A 4MIWA 3R2CJ 2HHVA 1C2PA 1L3VA 1YSJA 1K9MT 3BSOA 2CPIA 2KB2A 4KHMA 4WFZA 3HPOA 5LMUF 4JI4F 1C0TA 2PGCA 1HD1A 4B9SA 1H2UX 2D1CA 3DOKA 3QT8A 4U9RA 3PYEA 3DLHA 2OSQA 3M6UA 3BN4A 3I6PA 2RH6A 4ELTA 3IWXA 1TL7A 1LWCB 4DJBA 2XI2A 2ASYA 1Q95G 1O51A 1B8JA 2QX0A 1N33J 1T0TV 1RTZA 3CC2S 2D69A 3K57A 5HLFB 4NRTA 1UJ6A 2FGOA 1ELYA 2D3OR 1H98A 2DK2A 2NXNA 5G0RB 3G6XA 4USMA 3EGVA 1HQAA 3IP0A 4ZP6A 4M5KA 3BGRB 3LP0A 1ALIA 3WIVA 5D3GA 4K4ZA 3RBZA 1K0TA 3VTIA 3ZZTA 4DR2F 2NPIA 4URQU 3W2VA 5D6GA 4MK9A 4IDKA 1WDDA 2HQ3A 3D6FB 4DFKA 2DISA 1IKWA 4Z7YA 3HHLD 1EETB 4QIFA 4C3MA 2OHDA 5ETMA 5J2QB 4NA1A 2GVZA 2YNFB 1Q81T 2VV5A 3CE8A 3HULA 4GC6A 2V0NA 5D4LA 1CBKA 4B3RJ 2HVIA 4MYUA 3JB9k 1S99A 2O5DA 1TL4A 3KHRA 4Q0BA 5B0BA 1ZH5A 3T6JA 3MD1A 1VQ9S 3FUYA 2GHPA 3GFHA 3GIJA 3SFGA 2CJBA 1E6YA 3DMJB 2H5EA 2NPFA 2YNIB 4IO9Q 2RF2B 4FVCA 4DPUA 2VONA 3UPFA 3OW2R 1RLDA 1O0PA 3HSZA 5D8HB 2NUUG 3L09A 1RT5B 2GQQA 2OMOA 2EPIA 2XI3A 4JI8F 5CD4A 1VQYA 2QA4S 1AROP 1ED9A 2IUCA 3JTPA 3SMZA 4TQRA 2C3YA 4ECZA 1LWEB 2JWNA 3SXLA 1TUVA 1S1TA 5K8OA 2P6TA 1UFKA 5K8PA 3M9MB 4DR3J 5KFKA 3ZTSA 1N54B 3EPIA 2ZH5A 1HBOB 1S1WB 3LP2A 2Y3YA 4RW6B 4AXJA 3TVKA 2DD8S 2IRUA 2KI2A 3K5PA 2VPYB 4OI3A 4OZ5A 1SJ3P 2MTLA 5ETSA 4NE9C 3PX6A 5INHA 5IT9Y 1CULA 5TJ3A 1GXUA 5DM7Q 1H74A 5L0BA 3QLHB 5DG7A 2IAJA 2RUGA 2EWHA 4RWXA 4LQ9A 5A76A 2QZUA 4HT5A 4F36A 3KK2B 1GAOA 2WSCC 3PRBA 4LF2A 1N8RT 4C8OA 2DR8A 3IGNA 3KJFB 1PSDA 2XWYA 1S72S 1DAXA 2CG8A 5KFJA 1WOSA 2RKIB 1ALJA 1AB8A 2J9DE 1LW0B 2OPSB 3OFHA 4Q2LA 5DLVA 2L08A 5LRMA 1VBYA 2KTQA 2W8DA 2GMHA 3LGMA 1YJRA 2YKMB 3DRYA 1VI7A 4OYBA 4J9QA 4GO7X 1DHMA 1WHXA 1S7HA 2K1RA 3TAMB 3G6YA 2FJVA 3CD0A 1T8EA 3ILJA 4ZA1A 4DL6A 2NYIA 4A4JA 4NMLA 3TP2A 2DGQA 4ZJOA 1PYTA 2OFHX 4B9LA 1Q86T 3VF0B 4Z7CA 3EGNA 1D9DA 2XHCA 4UPKA 1WEXA 1NJYA 5A8KA 3M30B 5K20B 3P45B 4TY9A 5KFGA 1AW0A 4B02A 5AJ9A 1YI2S 3CJ2A 1ZAWA 1CJTA 7FDRA 4K2JA 1LW2B 3M2VA 4FYDA 2DH9A 4KGZB 1RSCA 2HKEA 1LOUA 1FK9A 2LQBA 1TUWA 2LQ9A 3CDBA 4A48A 4R5PB 2YBVA 3EMTA 2ERRA 3B4MA 3MM8A 1IBMF 1NMEB 2VOOA 4I6WA 1J5OA 4DI6A 1XQIA 3DGVA 4LSLA 1GQEA 5HMXA 5KG5A 2NREA 4ERDA 3RBEA 1HR0J 2H48B 2LVWA 5E41A 1F2GA 3RRHA 5EX0A 2D7SA 3HJFA 1V5IB 4CO2A 2U1AA 1UA1A 4Q8EA 2AT1B 4QAXA 5B0CA 4ZGAA 3H5SA 1JQGA 1X4FA 2ZJRQ 4B3MJ 1GTEA 3PO4A 2G0JA 2C2DA 3T3FA 3HZGA 1S9FA 1HBNA 2IM2A 4OZ0A 4H54A 4AL5A 3MEGB 5M2UA 1KP6A 3POTA 4YP3A 1HQEB 1X4GA 3TR5A 2RB7A 1IWGA 3HFKA 2RQMA 3OT9A 1ZTWA 2AMCB 2MLZA 3HK2A 4EBDA 1LK7A 2Y0BB 2X7IA 3OVSA 3WX4A 2FQQB 1FDBA 1YJUA 3BKFA 3C66A 2F4VJ 2IRXA 4DUZF 1EHWA 1Q1KA 2D41A 2HVDA 2YWHA 3CJSA 2FY8A 4NEZA 3TAMA 8RUCA 1UEVA 1XMQJ 2YKMA 3OXLA 1RAHB 4QR0A 1QAJA 1M5SA 1ZTTA 2Z2ZA 2I9SA 3DRPA 3MM6B 1SBRA 3NLCA 4DR5J 3HMJG 1UZHA 4GTZA 4FXDA 3LA0A 3ZTQA 5IC6B 4W92B 1KNZA 4ZVQB 3MCMA 2N82B 5C42A 4Y34A 4KAYA 2W9CB 2XCPA 3QYYA 4UY8T 4O3RA 5AT1B 4DMZA 3CT9A 1VJWA 1WEZA 2J6SA 3R9LA 4RWWA 3J81U 1RHKB 3SV3A 3TANA 3GTYX 2M70A 4KGXB 1HBMA 2DY9A 3FSXA 1K7HA 1HDHA 3M1VB 4FBUA 2HFOA 2Y1LB 5LSOA 1L3SA 2YQ3A 2OIHA 2G4BA 1GXTA 1LFPA 3A12A 5T41A 5EGYA 4JI3J 2FD2A 3FCHA 4RUCA 3J7ZT 1FJGF 1TKDA 3QWUA 1Y4ZB 3TARA 4J9NA 1RWXB 2FHKA 3GR1A 1HNWJ 2KT2A 4B9NA 1WHWA 2CDRB 2OFGX 4YB5A 2I2YA 1K44A 2DGUA 3FSIA 4USJC 2KJWA 4DUZJ 1HBUA 4NYZA 2HQCA 2QL7B 2LU2A 3FEZA 3TUJC 3WAVA 2XO7A 2AX0A 1S49A 2BE2A 2LQ8A 3D7SB 1U09A 5SZTA 3IG1A 1GEHA 4KPYA 1HWLA 1PBUA 3EGZA 5BYQA 2KFNA 2AV5A 3PVXA 2YXLA 1HD0A 2DNKA 3EM1A 4JP8A 2IM3A 2ZBRA 4TN2A 3H59A 3VGTA 2V2ZA 2VG7A 2IM1A 3OVAA 2P9EA 2BJEA 3G6ES 1R8CA 1WKJA 2KT5A 2R8HA 4F7VA 1TKZA 3AQOA 3GYGA 2KXNB 4FYXB 1IKYB 1CJUA 1MMDA 2LMIA 5DRKA 4WK3A 1NSQA 3RW7A 4DBQA 1HNVB 1HI8A 4ID5B 1TL5A 4RLEA 2FUG9 3M6VA 4OYIA 1UJ5A 4NCGB 4DZ6A 2PI4A 4KH0B 1EARA 2V69A 2BW7A 5K8MA 1M90T 2BANA 4ZDNA 3SEOA 3W9IA 3DLLQ 1WNEA 4DR4J 2KHDA 3QIDA 2DGOA 1FKPA 3G96A 1EETA 2MKJA 3HKWA 1U8SA 2L41A 4ZPBA 4EK2A 3Q8QB 2BM1A 2QSFA 2OPRA 5E3RA 1S0MA 2ZE2A 2KG0A 3VZHA 4BC7A 4JI2F 4WKYA 2LA4A 1JMTA 2W01A 4CTAB 3G4SS 1UA0A 3U1LA 3BPDA 3NGKA 5CCLA 3V6JA 3KK1B 1HR0F 2DH8A 2MZ1A 4RW7B 1DJ0A 1E6VB 1QDUB 1SXLA 2VFVA 3TQ1A 4TXSA 1UVIA 4USVA 1ZM9A 1KS2A 1SC4B 3EVWA 2W7OA 5JVGQ 3H8YA 1VS3A 1LWCA 4G1PA 3UNYA 3PR4A 2P9GA 5KFEA 2DXDA 2EVZA 3TOQA 2M88A 4E98A 4YEAA 4OZNA 3P3DA 2CPHA 5FIIA 5AE1A 1MW7A 3GIIA 2R8JA 1HNIA 1DURA 4MIAA 1S1UA 4USIA 3UN5A 4EGLA 3BQ1A 1CQMA 4B3TJ 4KHPJ 1TVRA 3DI6A 5ETPA 2HQFA 1REVA 2LU1A 1C0UB 3DNCA 4DPOA 1WOPA 3EWGA 2E5LJ 1D1UA 4DR4F 3C6TB 2R7TA 1H7XA 4A8SA 4O3SA 4KHRA 3R3TA 1TQLA 2V63A 2J9EA 2DGVA 1WC3A 2BABA 2R7QA 3NKNA 3C14A 4MKBA 2YVSA 2A2DA 3NGRA 3OFGA 4ID5A 4X84A 2KZZA 1V3ZA 4P72A 3BQ0A 4DV1J 2ROEA 4FYYB 5DS7A 4LRBA 2MMYA 5KFZA 2KG1A 1YRUA 3A13A 1G7CB 3BS9A 3KLEA 2KXHA 3BDGA 4ECWA 4YB7A 4W4MA 1DTTA 4BLGA 5CA5A 2MZJA 4ELVA 2XLKA 2UXBJ 3K5MA 5DLTA 3DC2A 3Q0AA 3MM5A 4QR2A 4NRUA 3WBHA 2DIVA 4KV8B 3IBCB 2MGZB 2E5HA 1JWWA 1N5TA 1F1BB 2WVBA 1RB0A 3MTKA 5AJ3F 5F41A 4AT1B 3PR5B 1MU2B 3UCZP 1Y5IB 2HHXA 2VDHA 3UI3A 2CADA 5L0EA 3KKFA 1TKXB 4ZITA 1HNWF 2E1RA 4DQPA 1RKJA 4R8UB 1HFEL 1SH0A 4MKVA 4OI4A 4OZLA 4JI6F 4CLYA 4D3HA 1R0CB 4DV5J 1A9NB 1ZPWX 3ZZUA 2GC8A 2GFFA 4ZVPB 3UN3A 3TZXA 2ZH9A 2HGLA 2E5IA 2HS0A 2UU9F 4FBTA 4RNFA 4C97A 3CDWA 2C3MA 2GCFA 2CZ4A 1SKUB 4P75A 1CJVA 3VAGA 2UUBJ 4BCAA 3KTQA 2V34A 5I3UB 2V9WA 3I0RB 1GX5A 2RIJA 1X5PA 1SJFA 3J7YI 2YKNA 3J7YU 4AL6A 4N41A 5F0WA 4YHHJ 1FERA 1FWKA 4LSNA 4AUKA 1V3RA 5F0UA 1Q8BA 1AJBA 2FJWA 4USKA 3CO0P 2UP1A 3CMES 1KOHA 2HSEB 4MTPA 2MQQA 2J0SD 3X3UA 1NB2A 1FJCA 1CQNA 1FWPA 2HRTA 3FMWA 3HT3A 1YQHA 2GJ2A 1SQFA 1SH2A 3NGSA 1K8AT 3WC2A 1AXQA 4P7TA 1RT2B 3GV5B 2C22A 1JJ4A 2YQ1A 3MM9A 2KM8B 4N56A 4NCAA 5JXSA 2R3VA 2XY7A 5J2PA 1CJUB 3B6BA 2W5VA 3V81A 4YR2A 1T9XA 4ED4A 3GFYA 1KHJA 4JI2J 4UOHA 3DRRA 4DFMA 4LF4J 3AY0A 1HMVA 3C14B 3LALA 2EC2A 2FJBB 4W90B 3ILOA 4QIWD 3BSAA 3GMGA 5C25B 3QZ7A 1NPPA 1TL1B 3LTOA 4FYVB 3PHTA 4LFAJ 1ZA1B 2ACMA 2E5JA 1FTRA 2FDNA 3H42A 3ZXWA 4Q44A 3K0JA 2W5RA 1V6HA 4DLEA 1TTHB 4NZ7A 5F8GA 5THWA 2B9WA 3TVYA 5B7WA 1HJKA 1S1VB 1T9VA 2W4DA 3M6WA 2MQMA 5CXTA 2VG5B 1PJ6A 3MAAA 4X4SA 1EP4B 2CXEA 3PKYA 4JV5J 4FVMA 3BKUA 5KG0A 2XHWA 3MEKA 2ATLA 4QPXA 3EDRB 2ZOMA 4K4WA 2NXJA 3ET6A 2R7VA 1BWVA 3TG0A 2B8QA 1LW2A 2CWXA 2DO4A 3K17A 3M2VB 2IBKA 1AJDA 4KRWA 1GMUA 1X8DA 2JRSA 2HURA 2DJWA 4G65A 2VB6A 3E01B 3VHQA 5KFCA 4OQJA 3UFCX 4EYIB 4LF7F 5HBMB 1C1CA 4Q7AA 3UVJA 4UQGA 4CXUA 4CYSA 3W9JA 3T1HJ 2XSJB 3SZZA 2ZZTA 2GNKA 2H4WB 1Y0HA 3AAWB 4IG3A 3TX8A 2YWFA 1SQGA 2A1BA 2CNOB 2PMHA 1NDPA 3J80U 2AIRB 2B51A 2HRUA 1RT3B 1VR6A 4F67A 3DLJA 3WBZA 5DQGA 4CLUA 2UUCJ 3BDFA 4RBUA 2EW9A 4NXNJ 2MZQA 3S8SA 5RUBA 1Q5VA 2F65A 3SQGB 3MAHA 2Q6CA 2CQBA 3KDOA 1S9EB 3P8BB 2C2EA 4ZPCA 3MECA 3VV2B 4NWBA 3LOUA 3RG6A 3ADAC 2ZJQQ 4DV3J 2QE5A 2AYGA 1SV5A 4KPCA 2VA3A 2RS8A 3QPIA 4NXMJ 4GKJJ 3GFXA 3O3LA 1APSA 1S6QA 1CLFA 4UPIA 4HLBA 4J5OA 1I51B 2L9DA 3PXGa 5IM0B 4Q43A 1R0AA 2QFIA 5E0OA 3MM7A 2LEBA 3L9ZA 3PJWA 1H38A 4R0EA 2XS7A 2CNKB 4ZHRA 4IRKA 4FF3A 3IR6B 2VQFJ 3D0HE 4UY85 1QSYA 2IC3A 3MK0A 1P9YA 4DHVA 2R7XA 4ZN3A 3ENAA 4Y65A 1R31A 1IN0A 3MM8B 2XMVA 3MMAB 4YR1A 3TRGA 1RYSA 1X0FA 2DPJA 2ZUGA 3BV8A 2CAJA 3AJ2A 2LXUA 3BZQA 3Q8VA 5HJXA 4C8MA 3ICLA 3PCOB 4RW4A 2FZCB 4ED7A 3W8GA 4ICLB 3PW4A 4FS2A 1W25A 1O6XA 1RBAA 2EBEA 5C24B 2UUCF 1FNXH 1WKKA 3M05A 3FGVA 3R5BA 1K0VA 2UVUA 1RAOA 4K4UA 2CQGA 4YY3J 3OR2B 1SIZA 4KO0A 3JQKA 3KUHA 4RUHA 2DY1A 2C2KB 3JTNA 3R97A 1EX8A 3EVOA 3DRSA 1L5UA 4UZBA 1N33F 5HVFA 4F2SA 2DHSA 3MECB 4C7QA 4C0HA 3C2PA 1EQ0A 1FXRA 1N5VA 5SUHA 2JLFA 3UDVA 4DEZA 2W2MP 4N8NA 5KG1A 5LXYA 3SQGA 4BBYA 1S6QB 1UEUA 1WOOA 4FKYA 2V2KA 4JOUA 4USHA 4IFYB 5EUHA 2JDJA 3EX7B 2FJEB 3JTOA 4NWJA 1HKAA 2MSSA 2MY7A 3MDFA 3FMBA 4ANDA 2YPZA 2BEFA 3ILIA 4IH5A 2CQIA 2FJDB 3FC9A 1WHVA 3DXBA 4I2PB 4AFFA 3SDEB 2U2FA 2PFFB 1IM4A 2Q1LA 3I5BA 2ZDPA 3LO3A 3QGGA 3W2WB 2AX1A 1L3TA 1S7IA 2GVDA 2EFQA 2V4JB 1JLFB 3NGUA 5E3CA 4F4WA 1XNQJ 3BPSP 3FCVA 3N79A 5G4DA 2F5GA 1D8ZA 4TU7A 2HNYB 5BR8F 5J2MA 4LF9F 1EI6A 1OPZA 2DR5A 1KLMA 2Z2MA 4RUBA 3GJTB 3KLVA 1FDDA 3KLFB 1ALHA 2D74B 5KFPA 2W25A 4KFBA 2XMAA 4USTA 1ZM4A 3R7BB 4ID8A 4GVLA 2ZC3A 2J0WA 1RWKB 4AL7A 1KVKA 1YJTA 2AKWB 2F8HA 2KKHA 5LRNA 1U1QA 3GONA 1Z2ZA 4L72B 3THVA 2PEBA 1EP4A 2IC3B 4OJ1A 3K5NA 3AB4B 3BSNA 4DL2A 1HI0P 3F44A 1F6TA 5IV3A 4OHYA 5A6PA 4A8YA 3W7BA 5DLWA 4TY8B 3LPEA 3HM9A 4C0OC 4NLYA 1PO6A 5HL7Q 2HIQA 3K8WA 4ZG7A 3BO2A 4UOFA 1VBZA 3N0VA 1S6UA 2Z56B 3GG1A 2DCLA 5D0RA 2FHOB 4C98A 2V2VA 4LIWA 3AA8A 1VLOA 1UVJA 4MH8A 2O01C 2RJZA 2DTJA 1XMBA 1Q8KA 3M6XA 3M8QA 5HATA 3T19A 3TJ8A 4PCQA 4CNYA 2LDYA 2ZH8A 5LMNJ 4ED6A 3NKMA 2HHWA 1H73A 2EFGA 3C16B 3OXGA 4KAIA 5KG3A 4UOCA 2ZH7A 3BGRA 4AQYJ 2CG4A 4IRCA 3MR7A 2GVZB 1FDNA 2YNFA 4FYWB 4XK8C 2PMZD 3TO8A 4DR3F 1N56A 1G1XA 4OYWA 4WTYA 2RKIA 2VC1A 2YKOA 1FKAF 5L0KA 2GIFA 4DWIA 4UQTA 1L3KA 5GAGI 1MWYA 4ZK7M 5K4PA 4KJIA 3CD7A 4FPIA 1UWAA 2GS8A 1UTAA 4H4OA 3IWNC 4O0NA 4P74A 3UNGC 3NP5A 1NJWA 1KN6A 2HGNA 3HHLC 4OX8A 1MWZA 3W1YC 4L74A 5DQIA 4F4AA 3DGPA 5ITHA 5HP1A 2W5QA 1ZEFA 5EWFA 3N9UC 4X4PA 1FEEA 2ATCB 3HXMA 2Z30B 3Q23A 1TFYA 1C1BB 2VDIA 4UW2A 1X5OA 2Z58B 3M8WA 1NM2A 1NPRA 1NJXA 4ELUA 2CZ9A 4IO1A 3N5BA 2F1FA 4ITSA 4NX9A 5F9NA 3KK1A 1NCLA 1Q7LB 4PZVA 5C25A 2AD9A 3CULA 1RKIA 3G71S 4DR1F 1LFWA 1BHNA 2KYXA 1TKXA 2KVQE 2QIFA 4XTTA 3I31A 3UD4P 1KVJA 4ED0A 3JSRA 3QIPA 3TA2A 4F0KA 4PWWA 3OLAA 2XGQA 2W7PA 2AJFE 3GIKA 2AGPA 2BRKA 1PCAA 1JLCA 3GSIA 3QAEA 4DX8H 3TAQA 4DV0J 3QZ8A 4ED2A 5L9XA 1CVJA 4WP3A 4PG5A 4WPAA 1RT5A 1WG5A 3QO9B 4ZS6A 4ZVOB 1YIJS 1X9WA 4MK7A 4WE1A 1RWUA 1MROA 2QA4G 2DNZA 2IJFA 1H6KX 3I9V9 2KU7A 3HHDA 1HNVA 4RW8A 1P1TA 4ZCMA 3CXCR 4F8RA 2W5WA 1SQEA 1S10A 1FE0A 1JNRB 3RAMA 1X9SA 2R4FA 2V8GA 4ZOSA 2CJAA 1TAUA 4LRAA 1ZAVA 3SCIE 1RT4B 4ZN1A 1OIAA 3RW6A 3A3OB 3S7RA 2E9ZA 1IQTA 4CYUA 3WAXA 5D3GB 2HG4A 1U0SA 1M1HA 3R1LA 3KFWX 3IAM9 3U27A 3DPCA 5DGAA 3CJRA 4ANEA 3CO9A 2MQOA 2A2CA 4F4KA 3MK1A 2MLYA 1OYEA 2WW8A 1IKWB 3IG1B 3QATA 4PG7A 5L38A 4B3SF 1QVFR 3MD3A 1JLEB 1GT8A 2VPWB 2ALZA 3V6KA 4B3MF 1JLBA 1RT6B 3K2YA 4I2QB 4MYTA 4Q45A 1YHQS 4LF8F 2UXCF 5B0AA 2DKOB 3HJVA 1TMMA 2GHWA 1DTQA 4LR7A 2HLUA 3J7AN 4X4NA 2HHQA 1JIHA 3RBXA 4DSEA 1IBLF 4JI0J 3DOLB 5HSPA 4GVBA 2RNEA 5KFBA 3KJNB 2BE9B 1KSPA 4GO5X 5D4NA 3NMAA 1VBXA 2IMOA 3UD3P 1S4EA 2ZHOA 3GLJA 4L6V3 5KFDA 1SJRA 4JI8J 1WEYA 4ECYA 3PX0A 1SJ1A 1U8WA 4PXDA 1VQ6S 1VHIA 5AXMA 2MYFA 2MGZA 3LWLA 2ZH3A 2K7KA 2I38A 4X65F 2HMIA 2WSEC 4CT9A 4YQWA 2BOAA 4CLWA 3MOZA 1FFWB 3VCDA 2MPUA 1BMQB 3DYAB 4FF2A 4DV2J 2XRGA 1QTNB 5KFOA 3OJUA 1ZPVA 1S6PA 3R27A 2ZWPA 3IM8A 2V4RA 2AWZA 3R6GB 4G1IA 1F9FA 2OSRA 3EVMA 4OZ1A 1J27A 2C2OB 3I0SB 3TVZA 2ZD1A 4DUYF 2X98A 2E9TA 4WKRA 1YGYA 3HF5A 2J9DA 4OFZA 5KFWA 1JB0C 3U1MA 1HA1A 4NASA 4NLUA 3KK3B 2OPQB 2PC6A 4U6PA 1CS4B 5C2CA 4DSLA 2HAFA 3I32A 3ILLA 3QWPA 1QD1A 4OL8A 2XO6A 1S76D 1ZM3A 2ILZA 4EO6A 7FD1A 1A6LA 2F40A 2W24A 1WF1A 5CD4H 1M1GA 3BO3A 1VQKS 2E1CA 4FPRA 1I94F 4JI7F 1B99A 5LJ3Y 1BLUA 2M52A 3QO9A 5HAOA 4YUDA 3CCES 1RWPB 1S97A 2XYPB 4PUOA 2DNOA 2V94A 4QYRA 4F25A 2NXUA 4YB6A 4MJKA 2CJ9A 1VMBA 2HK3A 2W2OP 2ZJPQ 1FSUA 3HHKA 3MI7X 1T05B 3K59A 1U4BA 1TK0A 2V5HG 4HTJA 1EKRA 4FZVA 4OYOA 4DSIA 1VQSA 2JLEA 3FFIA 4ILLA 1RAJA 4EU0A 4IOBA 3QJJA 1QTMA 5KFLA 2QN6B 5DO2A 3R7NB 2ASLA 3NL0A 4ENOA 1UP1A 4N77A 2HHTA 1ZZFA 5IWAJ 4LSZB 2LEPA 5CQGA 2VOPA 3NOCA 3FJ2A 4IOCQ 2JEGA 2XNRA 3FK4A 1K47A 1KONA 1FX4A 1U02A 3FZ2A 4R5PA 4LRDA 2QMXA 3G6VA 5JVHQ 1RU2A 2RH3A 4NA2A 1S12A 5LMNF 3UR0A 3EZUA 3CC4S 4GKKF 5AXKA 2VIHA 3CEDA 4UUWA 3M30A 3V4MA 3CCLS 1N36J 1VRQC 2HNYA 2B7CB 2IIHA 2VU5A 4ANCA 2IJRA 3IGZB 1N36F 3I9ZA 1ZYQA 3PEHA 1QSSA 1BE4A 5D77A 5KT7A 1BQNA 3UD5A 4B3TF 2VQEJ 3MR5A 4P73A 3HHLA 1VISA 4WIIA 3OTOJ 1VLYA 1HQUA 2DRAA 3GG0A 5B08A 4DL4A 4E8UA 4QWBA 3A8JA 1HHTP 2V68A 5EWEA 4K4TA 2OD6A 2V8DA 1KEKA 2GQ2A 1B3TA 4UUXA 1IM6A 2BJ3A 4ZCIA 3DRSB 3CCRS 3PZPA 4JI6J 3W3SA 3DYCA 3IA0A 4I6AA 4IFYA 4DDFA 4OHZA 3VALA 3W5ZA 1U1OA 2E1AA 3T5KA 4M5IA 1RTDB 2CUYA 4OJGA 4FS1A 4B9UA 3THTA 5EN1A 2H1YA 2MQNA 1JJCB 4Y2MA 3KHLA 4J9SA 2UXCJ 3VGUA 3DXSX 2EK1A 4BHQA 2VFTA 4C11B 3SCKE 4NLOA 4BWMA 2FLNA 1B0VA 2BA9A 2QA1A 4C8ZA 1RHMB 3DCAA 1VRUA 2DH7A 4PEOA 5KAKA 5DDRC 4EBEA 4ER8A 4KKOB 1OSDA 5IQQA 4DFJA 1JKHB 2J8SA 2HNDB 2UXBF 5E3PA 4F3QA 4QWEA 3MFIA 4O3OA 1N6QA 3RRKA 1BQMB 2JFKA 4LBPA 3SQOP 2XY5A 1NDLA 1U6ZA 1RWWB 5AXLA 4WFXA 3M8SA 1R8HA 3HCXA 2GSOA 3D66A 1IXKA 1XNRJ 4J9PA 2BXJA 3NCPA 4HACA 5DJBA 3OL6A 2J0XA 2W4CA 3MMAA 4X2BA 3ZO7A 3MEDB 5IQ6A 4B9MA 2ZDOA 1D0EA 2IYIA 4DCOB 5AJ3J 4DR7F 1E6YB 4EWTA 1N0VC 2DHGA 4KFBB 1IQZA 2G13A 3FBCA 3GPAA 1CJTB 3ENQA 3OTDA 4LSLB 4ZP7A 4CZCA 1E6VA 4DF4A 2N3OA 2NQPA 2VA2A 4ETZA 1HBMB 2V8VA 3CMQA 4CO0A 1HW8A 2BV3A 3MMJA 1TKTA 4JYAF 4B3SJ 4XO0A 5B0EA 1T9YA 3CCWA 4ZVFA 3ZTPA 4LF5J 1TL3A 3UQSA 3A52A 2EXUA 3D9BA 3PIPQ 1VRTA 1NO8A 3AD8C 2QSWA 2ZH4A 1SKSA 3R2DJ 1N4LA 5IJSA 4WXOA 1R89A 4RW9A 1F3FA 3WQPA 3VAFA 3T1YF 4OHXA 3PRDA 4KIAA 3HVTB 5BYSA 4NYPA 1U2FA 1EB0A 3HVTA 4HT7A 5B0GA 3VVUA 1VIOA 3C16A 3CDEA 3EXYA 1FDAA 3BH6B 3V4IA 1FRXA 3UVJB 2FLLA 1RE1B 4YHHF 2H5IB 3EUNA 3UR3C 4RU9A 2K3KA 4NEYA 4AXIA 3FBBA 2EG1A 3OHBA 3RB6A 3IDDA 5K14A 2HBRB 1YITS 2BJ8A 2Y8WA 5IV4A 2GO9A 1ZS6A 5EHHA 5DM6Q 4CXSA 2C2ZB 4ZJQA 1Y7AA 1RAEB 5HVHA 2CQPA 1T9TA 4HH0A 1N5YB 1QLNA 3MEGA 3BGLA 3OHAA 3VAIA 3NKOA 1U26A 2N7YA 4DV5F 1S1XB 5H9FK 2BACA 3N4WA 4Y0FA 2A18A 3HFVA 4KT0C 1EJJA 5KT6A 1SKRA 4N7TA 1F2HA 1PAEX 1XR6A 2YQ0A 4ZLJA 3GJQB 4ZLNA 3OJSA 2YNHA 3MOJB 1ZBTA 1FK9B 2YH1A 3RR8A 4PQUB 5EGEA 2CQDA 3CJ5A 4MK8A 5CYMB 5I3QA 2NZCA 2ANHA 3AHPA 1FESA 3A8EA 4RNMA 2KFYA 3BBCA 1N2LA 4ECQA 3SSSA 3EZ5A 1KFDA 3SCLE 5KFSA 4CLTA 3PKMA 2Y1JA 1DFDA 1SC1B 4ZJLA 5A2QY 3M2UB 2KYZA 1Q5YA 1RZMA 2R42A 2J7UA 2OKQA 4M95A 1R8PA 1X4CA 1KHKA 4JI7J 3F41A 4KGKA 3TWZA 1VQ8S 3NXZA 3Q89A 3QT5A 1A0OB 4K4SA 2LFVA 5CZVA 3HHNB 5EGHA 2EC0A 4NWXA 2OAUA 2POKA 1R8AA 4ECRA 1LKZA 2RILA 2YWKA 4PWDB 3I87A 2X1FA 4O3QA 4DL0C 1Y9OA 3NY0A 2HIYA 4Y2AA 3MURP 1DQ9A 4PABA 2F4VF 4CI0B 5K5MA 4RW9B 3HHLB 1R0BG 3O5TB 2QTWA 4KM4A 2E66A 2IY5B 1YJ7A 2OD4A 3TQEA 1MSWD 2JOQA 2DO0A 3NGTA 2CQHA 5CAAA 8AT1B 4Y2IA 5J2QA 4NXNF 5DDPC 4ZKAA 3A1YG 3GU0A 3GJSB 1RT3A 2O3DA 1SVDA 3Q8UA 3DLGB 1RTIB 2B9EA 2VC0A 3OFEA 4DPTA 3J80Y 4OJHA 4WZMA 1NZ8A 2CVIA 5ETVA 3CVKA 4OIXA 4DQSA 4XIUA 3P5TL 2VH7A 1G6BA 1ELXA 2VFUA 1YJNS 1AUSL 1D9FA 2QA2A 4ZVUB 1UPPA 2QL9B 4DN0A 4DFPA 2UXDF 3IS9A 5CH7B 1RI7A 1FKOB 3TW0A 1S1VA 4ZVTB 2ASDA 2C2RA 1LWFA 1AYEA 2PA8D 3OTOF 2MEWA 3GV7B 3MEDA 4G6VB 2AYEA 1S1TB 1OS5A 4F4YA 1PG5B 4R8UA 3W5YA 1E3CP 4JI5F 2CJXB 2F7VA 2VUGA 3MM5B 2DYAA 2CFXA 1RHRB 2BRLA 2PMWA 2DITA 1C4CA 3T1HF 3IO1A 4LREA 2HPUA 5MAOA 4LF5F 2M3DA 2GZOA 4PXBA 1V5VA 4ED5A 1U49A 2H4YB 5F3TA 4ZMMA 4A46A 4B9TA 3DMJA 1T94A 2JH3A 2OPPA 4PXCA 1F0XA 2WAQD 1WTBA 3LF0A 4FNIA 3T1YJ 3KK3A 4H4MA 3M8PB 1RCXB 1NK0A 1KWMA 1XR5A 3OVBA 2JC1A 1K1QA 1AFIA 1IJEB 4L76A 2JVOA 3D68A 1E1ZP 1XIQA 1H0HB 2OPPB 1PYOB 3I4PA 3D1QA 4FNHA 3PDNA 3K89A 1TZ0A 1RTDA 3C6TA 5DGBA 1OWXA 3H20A 2R7UA 4QW9A 4OI0A 4WE1B 4JI1F 1BQNB 3CF5Q 5KT2A 1VC0A 2KRRA 1RT2A 1DARA 2KH9A 1T9WA 3V2UC 4CNZA 3LAKA 2J7KA 3DOMB 5D15A 1HW9A 1S5ZA 3W61A 3EYZA 2NSBA 2W7AA 3H2UB 1B0TA 4DOZA 1N32F 1RABB 2CPYA 3NWGA 2PE8A 1BUXA 4YDXA 2DRBA 2X1AA 1N32J 4F2RA 5CCMA 4JI4J 1ELOA 4L73A 4NLDA 5JUMA 4I56A 1R6YA 1FKOA 4TLQA 2QO3A 2G1DA 3GZ7A 4Z37A 3KLHA 3JXOA 3BQ2A 1TK5A 1DQ8A 2EG2A 4C2MA 4WZQA 2ZITA 4WFYA 4A8FA 2E5GA 4XPCA 1VQNS 2Y9HA 4M94A 2ZBCA 4DR2J 3EZOA 2BBEA 4DCPB 4LT6A 3IRXB 5GADI 1GFWB 2XLIA 2DR9A 4X4VA 2VG5A 1ZM2A 2C3OA 4P7VA 3PFOA 1YDLA 2NCKL 4IQMA 4LF8J 1MU2A 1W7WA 2KXFA 2A3JA 2PSZA 2W1BA 3W60A 4DL5A 4ECSA 3O1LA 1NK5A 1NSKL 4GVBB 3HSGA 2KT3A 3KNGA 4TQSA 3KLIB 5KFHA 2DGXA 1AJCA 1KQFB 5LIAA 2LCWA 4J7CA 2X3DA 5KG6A 2CQ3A 2IHR1 1TV6A 3OPKA 2W8KA 5ETTA 4UTGA 1U25A 1U2CA 3CJ0A 3CCJS 2ZNZA 4I7FB 3QRQA 5LL6d 4DN9A 4USUA 1IKXA 4ECVA 1EQJA 2CYYA 3A4TA 2HZAA 3D54A 3OSNA 4DL7A 2RD5C 2VD3A 1OPIA 1XWLA 5CABA 3SZ2A 1DZ5A 4BDPA 4JV1A 5FDLB 1TU0B 1Y10A 4UT4A 4UPHA 4DLGA 4GRSA 4DV6F 4V19X 1WHYA 2H54B 1S79A 1U6BA 4I67A 4WFAQ 1YZ6A 1IKXB 3PM9A 2MDAA 2FTRA 3U7JA 1RAGB 5DDOC 3GB0A 3DN9A 5CZXA 1KOOA 5MLCV 4N76A 4KC5A 4LQYA 1TKZB 1XR7A 1Y5NB 2DNMA 2RQCA 1RA6A 3CGIA 4PKDB 3L3CA 2KZMA 2LYVA 3R5AA 4I0WA 4RW8B 1HYSB 1C0UA 1VGYA 2WBRA 2RQ4A 4F04B 1P49A 2MB0B 2K8GA 3HFZB 2XC9A 2CJKA 1AZSB 2COLA 4IG0B 5GADU 3ZC4A 3DKDA 5IFMA 3LXQA 4Y28C 1XN9A 3T00A 3T5LA 2DGSA 4K50A 1JJHA 1IJFB 2EFVA 3N01A 4CLKA 1N88A 2H3EB 2I1RA 1RGVA 2OUGA 4MT1A 4U8YA 5J2NB 2N7CA 2HYIB 2QLWA 5HLFA 2A10A 4B3OA 4JV5F 1SC3B 2D1GA 3P49B 2CQCA 1EQMA 2DNHA 3HD1A 3NMRA 3IRWP 4TU9A 2EBGA 4DV4F 3IGVA 3T9NA 2FC8A 4RU2A 1OY9A 4ZVEA 5GOVA 5LT5A 1X7VA 4DV4J 2KVIA 4L3NA 2A6OA 3K5LA 4IOAQ 1JXLA 4KAVA 1JLAB 2DVIA 1LWFB 2AJ1A 1DTQB 3VAKA 1X4EA 3MPVA 3T6BA 3WDOA 4CTAA 4KSEB 1AJAA 3IAS9 3WAYA 1WKLA 5GMDA 1YKWA 2GVDB 3H2LA 2XLJA 1JLBB 1RT6A 2UV8G 3C8YA 4P2XA 2OTJS 2MHEA 4RW7A 1NSPA 1OQ6A 2OPRB 4LFBJ 2LQ5A 3TEHB 5DG8A 4ECXA 2QL5B 2XMMA 3R5DA 2W8LA 3ZFVA 4RNOA 4LFBF 2AYMA 4HH1A 2JZ5A 4K8RA 3ISND 4LUBA 2OEMA 5U47A 4U7UK 1QUPA 5F8HA 4C9DA 1JJ2R 2IVYA 3GQCA 3D28A 3UO0A 4OI6A 3M8QB 1IKVB 3E8OA 5LSLA 1HYSA 3TYTA 3OUYB 1KH5A 3KJQB 1UFLA 2AZ1A 2RT3A 5I42A 4BS2A 4WF9Q 4GTYA 2F8MA 2GHVC 4C8NA 1S0OA
chains in the Genus database with same CATH topology
3IGYB 3BDGA 5L0KA 4B56A 5AJ9A 5HRTA 2IFYA 3IDDA 5K4PA 5DLTA 2VQRA 4KAYA 4CXKA 4UPIA 1O99A 1ZEDA 2GA3A 1FSUA 3WBHA 2ZKTA 4LR8A 4CXSA 1Y7AA 1KH4A 1K7HA 2W5QA 1HDHA 4UPLA 1ZEFA 3NKOA 5L0EA 2IUCA 4FDIA 1ED9A 1KH7A 3M8ZA 3MK0A 3M8WA 5KXAA 1EJJA 4N7TA 4YR1A 1KH9A 5EGEA 3UN3A 4LRDA 2ANHA 1N2LA 4UORA 3WAVA 5INHA 1URAA 5L0BA 1SHQA 4KJDA 1N2KA 1AJCA 2QZUA 5LIAA 1SHNA 4GTWA 3IGZB 1KHKA 3NVLA 4UOPA 3TWZA 3UN2A 1KHNA 1Y6VA 5EGHA 2IUCB 1KHLA 1AJBA 2XR9A 4NWXA 5LQQA 1EQJA 4ZG9A 3BDHA 3B5QA 4FDJA 1ALJA 3CMRA 5DLVA 2W5WA 5C66A 2W8DA 4UPHA 1EW8A 4LR2A 4LRAA 4NWJA 4KM4A 1ELZA 3DYCA 3BDGB 3WAXA 3T02A 2GSNA 5GRRA 2W5VA 3DPCA 1ANIA 3NKQA 1KHJA 1E33P 3MK1A 3Q3QA 3ED4A 4UPKA 1P49A 2GSUA 1ZEBA 5LRMA 4ZG6A 3LXQA 4LR7A 3T00A 3NKNA 3M7VA 1AUKA 1EI6A 1ELXA 2W5RA 3TX0A 2D1GA 4LRFA 1ALHA 1ED8A 1HJKA 4MHXA 1ALKA 2GSOA 2W5XA 5GOVA 3UNYA 4LR9A 4UOOA 5LRNA 2RH6A 4CYRA 4KAVA 4QAXA 3TG0A 1O98A 1E3CP 2G9YA 3MK2A 3NKRA 1AJAA 3UN5A 1AJDA 1B8JA 3E2DA 3NKPA 4MY4A 3SZYA 1EW9A 1EW2A 3WAWA 3WAYA 5DLWA 4LREA 2XRGA 4MIVA 5IJQA 4KJGA 1ELYA 3M8YA 4CXUA 1ANJA 1E2SP 1HQAA 3OT9A 4CYSA 4ZG7A 3SZZA 2W5TA 3A52A 4GTXA 1ALIA 2X98A 4LRCA 2W5SA 3T01A 5IJSA 3UO0A 3NKMA 3BDFA 2W8SA 4LQYA 1KH5A 1E1ZP 2GLQA 4TN0A 1URBA 4GTYA 5TJ3A 4LRBA 3KD8A 4ZGAA 4GTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGY B;  3BDG A;  5L0K A;  4B56 A;  5AJ9 A;  5HRT A;  2IFY A;  3IDD A;  5K4P A;  5DLT A;  2VQR A;  4KAY A;  4CXK A;  4UPI A;  1O99 A;  1ZED A;  2GA3 A;  1FSU A;  3WBH A;  2ZKT A;  4LR8 A;  4CXS A;  1Y7A A;  1KH4 A;  1K7H A;  2W5Q A;  1HDH A;  4UPL A;  1ZEF A;  3NKO A;  5L0E A;  2IUC A;  4FDI A;  1ED9 A;  1KH7 A;  3M8Z A;  3MK0 A;  3M8W A;  5KXA A;  1EJJ A;  4N7T A;  4YR1 A;  1KH9 A;  5EGE A;  3UN3 A;  4LRD A;  2ANH A;  1N2L A;  4UOR A;  3WAV A;  5INH A;  1URA A;  5L0B A;  1SHQ A;  4KJD A;  1N2K A;  1AJC A;  2QZU A;  5LIA A;  1SHN A;  4GTW A;  3IGZ B;  1KHK A;  3NVL A;  4UOP A;  3TWZ A;  3UN2 A;  1KHN A;  1Y6V A;  5EGH A;  2IUC B;  1KHL A;  1AJB A;  2XR9 A;  4NWX A;  5LQQ A;  1EQJ A;  4ZG9 A;  3BDH A;  3B5Q A;  4FDJ A;  1ALJ A;  3CMR A;  5DLV A;  2W5W A;  5C66 A;  2W8D A;  4UPH A;  1EW8 A;  4LR2 A;  4LRA A;  4NWJ A;  4KM4 A;  1ELZ A;  3DYC A;  3BDG B;  3WAX A;  3T02 A;  2GSN A;  5GRR A;  2W5V A;  3DPC A;  1ANI A;  3NKQ A;  1KHJ A;  1E33 P;  3MK1 A;  3Q3Q A;  3ED4 A;  4UPK A;  1P49 A;  2GSU A;  1ZEB A;  5LRM A;  4ZG6 A;  3LXQ A;  4LR7 A;  3T00 A;  3NKN A;  3M7V A;  1AUK A;  1EI6 A;  1ELX A;  2W5R A;  3TX0 A;  2D1G A;  4LRF A;  1ALH A;  1ED8 A;  1HJK A;  4MHX A;  1ALK A;  2GSO A;  2W5X A;  5GOV A;  3UNY A;  4LR9 A;  4UOO A;  5LRN A;  2RH6 A;  4CYR A;  4KAV A;  4QAX A;  3TG0 A;  1O98 A;  1E3C P;  2G9Y A;  3MK2 A;  3NKR A;  1AJA A;  3UN5 A;  1AJD A;  1B8J A;  3E2D A;  3NKP A;  4MY4 A;  3SZY A;  1EW9 A;  1EW2 A;  3WAW A;  3WAY A;  5DLW A;  4LRE A;  2XRG A;  4MIV A;  5IJQ A;  4KJG A;  1ELY A;  3M8Y A;  4CXU A;  1ANJ A;  1E2S P;  1HQA A;  3OT9 A;  4CYS A;  4ZG7 A;  3SZZ A;  2W5T A;  3A52 A;  4GTX A;  1ALI A;  2X98 A;  4LRC A;  2W5S A;  3T01 A;  5IJS A;  3UO0 A;  3NKM A;  3BDF A;  2W8S A;  4LQY A;  1KH5 A;  1E1Z P;  2GLQ A;  4TN0 A;  1URB A;  4GTY A;  5TJ3 A;  4LRB A;  3KD8 A;  4ZGA A;  4GTZ A; 
#chains in the Genus database with same CATH topology
 4NLG A;  1QJH A;  2GAH C;  3I82 A;  5A6W A;  5K9F A;  1RT4 A;  4URG A;  3M9N B;  4DG1 A;  1NK9 A;  2YX4 A;  3KOA A;  2IFY A;  5DZ6 A;  2GGP B;  3IR7 B;  2GIR A;  9RUB A;  1F5C A;  2E1M C;  1HBN B;  3QSI A;  2VQR A;  4GKK J;  2WVD A;  4RPF A;  1RWO B;  2E7V A;  2R7R A;  4Y2C A;  3VGS A;  2XM3 A;  3QJL A;  2GA3 A;  2QLX A;  2XMU A;  1PIE A;  4PR6 A;  2QEX S;  1WI8 A;  2VG7 B;  3R5G A;  4CQ1 A;  2UVW A;  4DPY A;  4EZ9 A;  3V6D B;  5L46 A;  1NLK L;  5ETR A;  2OGU A;  4OX9 J;  3D5M A;  2JHE A;  4O44 B;  3UW1 A;  1NKC A;  3C46 A;  4P2F A;  2CPX A;  3GYX B;  4LBH A;  2ZC4 A;  4ATN A;  2YH0 A;  4LVO P;  3TZZ A;  3ZTR A;  1Y3J A;  2IM0 A;  2EKN A;  2XG8 A;  3QQC D;  4PQU A;  1RWN B;  1DLO B;  3IR5 B;  5DZ7 A;  3JSM B;  3PW0 A;  1B4S A;  2HBZ B;  1T11 A;  3MPY A;  5AE3 A;  2MKH A;  4N5S A;  2BR0 A;  1FA0 A;  3BB5 A;  3CSK A;  1VJQ A;  5HI7 A;  4F0H A;  2LEC A;  4PG8 A;  4ZHR B;  2AJ4 A;  3W66 A;  4UOR A;  1JX4 A;  3IRX A;  4WXW A;  4ED8 A;  3LH2 S;  2OP5 A;  3LGH A;  3MPU B;  3BH7 B;  4YY3 F;  4X64 F;  1U47 A;  1N5Q A;  3I96 A;  4HDG A;  3PYD A;  1H2V Z;  5HN0 A;  2V4Q A;  5KFF A;  2XCA A;  1S1X A;  1HPZ A;  1K1S A;  2HS4 A;  2QV6 A;  2RRB A;  1TP7 A;  2UUW A;  3I55 S;  3AXK A;  3M1V A;  2VZ9 A;  1NH8 A;  2IDE A;  4KGV B;  1SKW A;  3MMC B;  3GYN A;  3OV7 A;  1DRZ A;  1URN A;  2RSQ A;  4FDJ A;  3D0I E;  2RDI A;  1FT8 A;  2HW3 A;  1PAU B;  2MHN A;  1Q8L A;  1CJK B;  1TUG B;  4YR0 A;  4QBU A;  3UCU P;  3CJ8 A;  3N6L A;  5KTQ A;  4CH0 S;  4HR2 A;  2NZ4 A;  2LDI A;  5L9N A;  2NYH A;  2MJU A;  2HFS A;  2VG6 A;  2N4D A;  3EXC X;  3X1L B;  2AP6 A;  4PRF A;  1GH8 A;  4GMK A;  4P2M A;  3T02 A;  2GSN A;  3V4I B;  2JEF A;  4NLS A;  2BKO A;  2OEK A;  4Y00 A;  4CO5 A;  4EUV A;  1Q7Y T;  1KTV A;  4CT8 A;  4DU8 A;  4O3N A;  3TUP A;  4KY3 A;  4L3K A;  2M9K A;  2FY1 A;  1H7W A;  2CVE A;  4K4V A;  4PAA A;  1KHW A;  1OYD A;  3M8P A;  2AHO B;  3W63 A;  2X51 A;  2ZNY A;  6AT1 B;  1VQO S;  1HNZ F;  1KDN A;  1U7L A;  2B4V A;  4X64 J;  1X0P A;  3D0G E;  4J9L A;  1XBW A;  2IA6 A;  3RGI A;  1IR0 A;  2JSX A;  3DLB A;  1B7Y B;  1NHU A;  3DLE B;  2AJ0 A;  3ITH B;  1DLO A;  2N3L A;  2JLG A;  1WWH A;  2L48 A;  4M5D A;  3RJM B;  1M5V C;  3TX0 A;  1H3D A;  2XTJ P;  3HP6 A;  1W26 A;  2FLO A;  2AGO A;  4EMD A;  4B3R F;  1FXL A;  1WC4 A;  3PNI A;  1JXE A;  5KFY A;  1LXJ A;  3H25 A;  1NHV A;  3ETO A;  3O6Q A;  4UOO A;  3F56 A;  5B0D A;  5E3A A;  1KLM B;  3FQL A;  2I5J B;  3B8H A;  4M63 A;  2DR7 A;  2C28 A;  2H65 B;  4CYR A;  4HAC B;  5IWA F;  2R7O A;  4A8Q A;  2F8E X;  2J6T A;  4KQZ A;  2OJ3 A;  1I6J A;  2APO A;  1DBD A;  3HKZ D;  3HLU A;  1FHT A;  4IYQ A;  3NKP A;  3NEK A;  1EW9 A;  4FKX A;  4O44 A;  3WAW A;  1QY7 A;  3KLF A;  1SV5 B;  1RAI B;  2FJA B;  3IC1 A;  4IH7 A;  1CC7 A;  1EZZ B;  2B8P A;  5J2M B;  2RF2 A;  5BXI A;  1E2S P;  4LF6 J;  3MF5 A;  1NAQ A;  4IQX A;  8ATC B;  5IM0 A;  5IT0 A;  5ETK A;  4NLW A;  1JLF A;  1KHV A;  1IBC B;  4J9M A;  1WUU A;  6FDR A;  2VPZ B;  2D3O 1;  3VQT A;  1SI9 A;  3AFG A;  4O3P A;  2B4U A;  2W8S A;  4IFV B;  2RU9 A;  1BY9 A;  4M5G A;  3BDE A;  1URB A;  1RTJ A;  2G2Y A;  1RDR A;  1ROF A;  1SPB P;  3FEX B;  3MR2 A;  4BC9 A;  4FF4 A;  2BJ9 A;  3LP1 B;  1RUS A;  3GSD A;  4I69 A;  2P2C B;  3B54 A;  3W8P A;  1ACM B;  4B56 A;  5I3P A;  3BSC A;  5HRT A;  2IA0 A;  2Z57 B;  3MWB A;  2VKZ G;  2AF6 A;  2XMW A;  3QT6 A;  1UVM A;  4DR7 J;  2HAI A;  1H2T Z;  4LR8 A;  2WON B;  3L4B C;  2VBW A;  4LIR A;  4EZ6 A;  3Q8Y A;  1KH4 A;  1C1C B;  3PIO Q;  1QVG R;  3AXM A;  3R5C A;  1NJI T;  3OR2 A;  4KO0 B;  4JV2 A;  4WK1 A;  1G2E A;  5KFR A;  3E2E A;  4R0J A;  1VC6 A;  1Y7P A;  4C8Y A;  5KXA A;  1FF2 A;  1N6Q B;  3KLG A;  1T03 A;  2I5J A;  2EI5 A;  4A8M P;  1FD2 A;  2QT7 A;  3L7O A;  3VVT A;  3G8T A;  1VFJ A;  1JKH A;  2QLB B;  3B78 A;  1N5S A;  5CYM A;  4DSF A;  3PW2 A;  1RK8 A;  2IYG A;  4QYZ K;  1Y00 A;  2ROP A;  4XAK A;  3JSM A;  3RB4 A;  2LKZ A;  4M5L A;  1KQS R;  1RJJ A;  1D09 B;  2GIQ A;  2WBM A;  3U02 A;  4CLF A;  2VOD A;  1LWE A;  1RBO B;  2XQC A;  1XC9 A;  4WYW A;  2JNJ A;  2H51 B;  1HWK A;  1VK3 A;  4CLS A;  3G8S A;  2IUC B;  1VQ7 S;  3PJX A;  1QAY A;  5L1I A;  2BMB A;  2DR6 A;  3ISN C;  2O67 A;  2ZBI A;  3ISZ A;  5A8K B;  4KYZ A;  4DR5 F;  4DSJ A;  4M5J A;  1T9U A;  2ZOG A;  3C6U B;  2FYX A;  4MFB A;  2XY6 A;  5A8W A;  3C15 A;  3UDL A;  1YRX A;  5F9L A;  1BC6 A;  2KDO A;  3EGW B;  3PYG A;  4FF1 A;  4QU7 A;  2D3Z A;  1YJV A;  1OY6 A;  4DG1 B;  4KB7 A;  3R7S B;  5H9E K;  3JQJ A;  1UVN A;  2B3T B;  4O4R A;  4FXW A;  1TV6 B;  4U67 Q;  2CPD A;  4IG3 B;  4F4Z A;  4WTO B;  1JLC B;  1LW0 A;  2OPS A;  2OPQ A;  3NG8 A;  4IR1 A;  1ZOT A;  1T7P A;  1RLC L;  3H5U A;  1IBL J;  5KT3 A;  2Q66 A;  3GWC A;  3TUI C;  2R8G A;  3LP0 B;  1F9H A;  2LP4 A;  3KDN A;  2HK2 A;  5HRO B;  2PT0 A;  1Z2L A;  3OD2 A;  2W2Q P;  2MKK A;  2RQK A;  2I6W A;  5CHC B;  5G0R A;  3HVA A;  1QSL A;  3IBF B;  1NK4 A;  4DF8 A;  4ZIV A;  2HQI A;  4WBF A;  1UZD A;  4DR6 J;  4MHX A;  1KR4 A;  5L8R C;  3NAI A;  1MWQ A;  1RAD B;  1UW4 A;  2QG9 B;  1R6V A;  1UKU A;  2RHS B;  3MMB B;  2CA9 A;  1JLA A;  3FFI B;  4LR9 A;  1NDC A;  4X65 J;  5DLF A;  2XNQ A;  4E2F B;  4DQR A;  3N28 A;  3H0P A;  1FRH A;  1S48 A;  3ENV A;  3DOL A;  3PHE A;  3OLB A;  3GFZ A;  4J9R A;  1T05 A;  2Z0G A;  4MKY A;  4LJM A;  1SL1 A;  1I1G A;  1F60 B;  3CJQ A;  2A0F B;  2HRY A;  3HD2 A;  3T1A A;  1G3O A;  2F4F A;  2UV8 A;  3HO1 A;  2XEX A;  2CRL A;  2CDQ A;  1BQM A;  4H4K A;  4ES2 A;  1KD1 T;  3LWM A;  2BJD A;  4C48 A;  2RDD A;  2BYC A;  1BQX A;  1YWX A;  3DRR B;  4RBT A;  4LF4 F;  2HNZ A;  4KV8 A;  4ZLP A;  3G9C A;  4CLZ A;  2QC3 A;  7AT1 B;  1PJ5 A;  2UUB F;  2W5T A;  4P2S A;  1VK8 A;  4QWD A;  4JB8 B;  4V1A k;  2CJQ A;  2MKC A;  4Q8F A;  4QIG A;  3GIR A;  3Q2T C;  1UWB B;  4QIE A;  4B17 A;  5GAE U;  1TK8 A;  4H4K C;  4H4M B;  1WDT A;  1U1L A;  2P9C A;  4NZ6 A;  3ONQ A;  4TN0 A;  5A8W B;  3AJD A;  3I5A A;  3HT0 A;  1MLA A;  2MZT A;  1NU4 A;  3B4D A;  3DDN A;  5HAN A;  5GAH U;  2R2T A;  2HVZ A;  4RBV A;  2CQ2 A;  1GK8 A;  1Q4R A;  2BKP A;  2PEH A;  3OUY A;  1OSC A;  2CPJ A;  2IVF B;  4ZPD A;  2PI5 A;  4LQ3 A;  2FVS A;  3ZZP A;  3HVW A;  1N34 F;  2IPO B;  3DI6 B;  4HVZ A;  1URR A;  2E7X A;  1RBL A;  1O99 A;  5FDL A;  2VAS A;  2P8I A;  1S4F A;  5ETQ A;  4Z2X A;  3QSY B;  5I3U A;  1RXO B;  3DLK A;  4YME A;  1YTY A;  1MRO B;  5H9F J;  3KNA A;  2P5V A;  2NR0 A;  2CIM A;  3CIM A;  1S1U B;  2J76 E;  2J8A A;  1U48 A;  2CWK A;  5A0Y A;  4CO3 A;  4DV1 F;  1B0P A;  3T5J A;  4F0M A;  2NLW A;  3M2R A;  3W64 A;  2W2P P;  2W9B A;  3WZ0 A;  2AEF A;  3MPW A;  2W9B B;  3BBF A;  4QYZ J;  3JQM A;  3EJM A;  4X4R A;  1FNO A;  2WB1 D;  4Y3C A;  2JFD A;  5DG9 A;  3QGP A;  5KFV A;  2V67 A;  2FVC A;  2V4J A;  3QFW A;  3MCN A;  2V9K A;  2UXD J;  4HI2 A;  2ZOF A;  3CCS S;  3FZB A;  2FZK B;  1NRK A;  1UEK A;  3QFH A;  4AE5 A;  3J81 Y;  4ZVG A;  2VIC A;  5J2N A;  2AQ4 A;  1T3N A;  3SSR A;  3BO4 A;  4NXM F;  4GKJ F;  3CIZ A;  3NVL A;  1Y6V A;  4IR9 A;  3FRZ A;  2IJN A;  3QAU A;  1KHL A;  5ETL A;  3GIM A;  1QE1 B;  4CLL A;  3SI8 A;  2AJ2 A;  3KYL A;  2FLP A;  5HP1 B;  4ZG9 A;  4A8K A;  2NSC A;  1RWM B;  2YPY A;  4OZJ A;  1U45 A;  2NXE A;  2VBY A;  3DRP B;  3MM6 A;  1HHQ A;  1M5K C;  5C66 A;  2YWW A;  3KUG A;  2ZH6 A;  5KFI A;  3OSP A;  1HHS A;  2IFX A;  3LAM A;  3NS5 A;  5J1E B;  1FTC A;  1QM9 A;  1RAC B;  4TVA B;  5D78 A;  5H9E J;  2IRY A;  2GQC A;  4CDI A;  4X4U A;  3N5F A;  4HYK A;  1NB7 A;  1UJ4 A;  1OQ3 A;  4RJV A;  4CH1 A;  3O8W A;  2E1P A;  2B9Y A;  4TYA A;  2BQU A;  2HHS A;  5KG2 A;  1PKU A;  1VBK A;  1YG0 A;  3T41 A;  1BGX T;  1PGZ A;  3AOC A;  2V2Q A;  3M2U A;  1CS4 A;  4ES1 A;  3QRP A;  3ED4 A;  4PWD A;  3Q3Q A;  3DDI A;  5K8N A;  5F8N A;  5AXN A;  3POT B;  3UWT A;  2B7B B;  1F5A A;  3Q2S C;  4KBI A;  4ZCK A;  3WX8 A;  3H5X A;  4QU6 A;  2DNY A;  5KT4 A;  3R8Y A;  2RVJ A;  2XS2 A;  4I64 A;  3BR8 A;  3GIL A;  1FD8 A;  5GME A;  3FEY B;  3DM2 A;  4XPE A;  2MLX A;  4OLO A;  2AZ3 A;  2CNN B;  3D3C J;  3L7P A;  5HQ8 A;  3E3X A;  5FLX U;  3CCM S;  3IWL A;  1VQ4 S;  5HQM A;  1RQ0 A;  3G82 B;  1VDH A;  1D9A A;  1FE4 A;  2GV1 A;  4LRF A;  4OYX A;  3MFH A;  2WOM B;  1GTH A;  4JI1 J;  4M1K A;  4J37 A;  1RP5 A;  1U0H A;  2W9A A;  1HIY A;  2J9C A;  2W5X A;  4CLP A;  1Q0N A;  5E33 A;  1DQA A;  4NOH A;  3BKT A;  4URS A;  3SFU A;  4DV6 J;  2BZ2 A;  3DHX A;  1EIY B;  4RZR A;  2RHQ B;  2YX7 A;  3LAN A;  5KFA A;  3MMB A;  3TUZ C;  1Q82 T;  1J5E J;  3KLH B;  2G9Y A;  5GAG U;  1EAY C;  2F3J A;  1QUV A;  1FRK A;  2XZT B;  2J5A A;  4PWU A;  2QMW A;  3M9O B;  1PC5 A;  3M8R A;  4JYA J;  4DL3 A;  1WC0 A;  2DCU B;  5IJQ A;  2ZKU A;  2ACY A;  5D4P A;  1WAC A;  3AD7 C;  4EI2 A;  1N5Y A;  2PII A;  1R7I A;  3PRV A;  3MGJ A;  4QOT A;  1OJ4 A;  1RHQ B;  1WC5 A;  3M32 B;  2W9C A;  4GTX A;  1TAQ A;  3ENW A;  3CUN A;  2YNG B;  3GV8 B;  1JLQ A;  2FVR A;  1PJ7 A;  1SUQ A;  4TKT A;  1XER A;  3KJV A;  1NH7 A;  4E0D A;  2RRN A;  2ZM6 J;  4NLX A;  4ZP8 A;  4YN3 B;  2GLQ A;  2HBY B;  3M32 A;  1WI6 A;  3CDA A;  3JYT A;  1KC8 T;  1T95 A;  3OTB A;  1TKT B;  2QJ3 A;  4NLQ A;  3OBI A;  4J9V A;  1TFW A;  4K2X A;  3C3L A;  4NCB A;  2B5J B;  2MKS A;  2DXE A;  3H7H B;  2JL9 A;  3Q86 A;  4ECT A;  3OL8 A;  1XNQ F;  2NUH A;  3SYZ A;  2YX1 A;  3MUM P;  4PG4 A;  4WCE Q;  1YX2 A;  1YRT A;  3D67 A;  1YBT A;  4KGM A;  3FCW A;  3P5B P;  4XDC A;  5B0F A;  4F4X A;  2UUA J;  2BE2 B;  4AYB D;  4CP5 A;  3D2W A;  2FZG B;  4TNO A;  2CPE A;  3LW5 C;  5C24 A;  4EYH B;  1PYS B;  5LXR A;  3Q22 A;  1PIL A;  3NCR A;  2Y0S D;  4U95 A;  4FDF A;  3UE2 A;  3M8Z A;  4J9U E;  4CH7 A;  2LA6 A;  2CZV C;  2LXF A;  3ITH A;  1ULR A;  3O2I A;  2CJY B;  2ZWO A;  5DDQ C;  2RUS A;  3S1T A;  5DET A;  2D9P A;  3PAC A;  4O23 A;  5H1S V;  1SL0 A;  2J0Q D;  3TJA A;  5KG7 A;  3V6D A;  3T9Z A;  1VHF A;  3TJ9 A;  1URA A;  3KLG B;  3DLE A;  1T03 B;  2YY3 A;  2G1H A;  1SHQ A;  3TNV A;  4I2P A;  3ZTO A;  3MCS A;  4DU7 A;  3PJ9 A;  2OML A;  1R0A B;  1C1B A;  1N2K A;  2GAG C;  2Q3P A;  4WFB Q;  5J2P B;  3BBB A;  2PDA A;  1LK5 A;  1XMO J;  1QAI A;  1X4A A;  1Y5L B;  2MQL A;  4NZ0 A;  1WF2 A;  4RNH A;  3P4U B;  2HVH A;  2XR9 A;  3OFF A;  1FFG B;  1EKS A;  1S6O A;  2K1R B;  3NRB A;  3PYF A;  2O1P A;  4ED3 A;  5FJ4 A;  5CYQ B;  2FGC A;  2BM0 A;  3HZE A;  4UZC A;  5BYR A;  1RT7 B;  2N4C A;  2PD1 A;  3NWR A;  4ZLL A;  4LR2 A;  2QYC A;  2X1G A;  2E44 A;  1KQK A;  2QRR A;  2Z2Y B;  1X60 A;  2J7W A;  3ZZO A;  1VRT B;  3ZZR A;  4YDD B;  3LP1 A;  1IR2 A;  1GX6 A;  2VBX A;  3BF4 A;  4N47 A;  1RTJ B;  1BWE A;  1V9O A;  1HQE A;  1S59 A;  2IVM A;  4RUA A;  1U1P A;  6FD1 A;  1CUL B;  3AA9 A;  3JAM U;  3E01 A;  5F8I A;  1XJW B;  3VWS A;  2M8D B;  3MUV P;  1RHU B;  2HQG A;  4OHV A;  4P6Q A;  4PPD A;  3KG1 A;  2AW0 A;  1HLW A;  3BYP A;  3I5C A;  2XSJ A;  2Z4P A;  2YKP A;  3NGD A;  3KK2 A;  5JMN A;  2FHJ A;  4KH1 B;  5T7L B;  4RO0 A;  4NI2 B;  4O0I A;  4UF4 A;  5GVQ A;  2F9J A;  2HFN A;  3SIP B;  2F63 A;  4DR1 J;  2BQ3 A;  4IUF A;  3W62 A;  4K0K J;  5KFQ A;  2NS1 B;  3GJR B;  3N6N A;  5J1P A;  3LGN A;  1YBA A;  4I4B A;  3IFE A;  4C3L A;  3NKY A;  1GMW A;  3PEJ A;  3W5X A;  2C42 A;  4FXV A;  3KG4 A;  2MZR A;  3GE9 A;  2UVV A;  4D3G A;  1U0H B;  4KKO A;  3W9H A;  1R43 A;  3MK2 A;  5HJY A;  3F0N A;  1VRU B;  2WOM A;  2X1B A;  4HDH A;  3CC7 S;  2G0I A;  1MN7 A;  3PW7 A;  3U1N A;  3QT7 A;  3Q8P B;  3TEG A;  4ZPW R;  3FKB A;  3MR3 A;  2HHU A;  5BJR A;  1ANJ A;  3NAH A;  1TL1 A;  1B7F A;  2YNI A;  4NYO A;  1VQM S;  1P1L A;  2WSF C;  4YR3 A;  3CJK A;  2Y8Y A;  4G3I A;  1IR1 A;  1FO1 A;  4EEY A;  1AA1 B;  2ZM6 F;  2RS2 A;  3L7U A;  2W5S A;  3QGH A;  1UL3 A;  3AB2 B;  4IDK B;  1HMV B;  3KJV B;  2ZZN A;  2XZW A;  2MST A;  1P6T A;  4QR1 A;  2DNP A;  2HFZ A;  2HFV A;  3HSD A;  1JLQ B;  1Q16 B;  2K2P A;  2OEL A;  2ZVS A;  3JYT B;  3EPG A;  2EEY A;  2ZH1 A;  4C4W A;  3T01 A;  1NHK L;  2MZS A;  3DHW C;  5GAH I;  4UOG A;  1HQU B;  1HWJ A;  5DLG A;  1WSR A;  3CD5 A;  2B9X A;  1S6P B;  1RCO B;  2VG6 B;  3MMC A;  2HHH J;  4OV1 A;  1S77 D;  1W2I A;  2B4O A;  2UUA F;  4OYZ A;  4F3M A;  3RR7 A;  3I0S A;  3VGV A;  1TL3 B;  3AOD A;  2XMJ A;  2L3M A;  3PO5 A;  3J7A 1;  4OX9 F;  5F8L A;  1TR0 A;  1X9M A;  2DEI A;  1FRM A;  3DOK B;  4DSK A;  1P9Q C;  1RWV B;  3BEG B;  2LXI A;  4PG6 A;  4UPL A;  3MAA B;  4HEA 9;  3TZY A;  3KHH A;  2R7W A;  4DV0 F;  3RB0 A;  4YOE A;  5F8J A;  1KH7 A;  5HMZ A;  9ATC B;  2JJ4 D;  1FJE B;  2DNG A;  1RIS A;  4PPZ A;  3BGU A;  4CO1 A;  2BE7 D;  4MIB A;  2MXY A;  1KH9 A;  3M2R B;  3A3P B;  1UET A;  4NMX A;  1SJ4 P;  2SXL A;  3OTE A;  2CQ1 A;  4DXL A;  2Y1R I;  4OHW A;  2R8I A;  3H40 A;  2AEJ A;  2DXF A;  1AZS A;  1JNZ B;  3FSY A;  1IBK J;  5B09 A;  1FRJ A;  1FRL A;  3NNH A;  4QJV A;  1EJ7 L;  1PC4 A;  4WP8 A;  4NLV A;  3RZA A;  4CO4 A;  3H5Y A;  5HQL A;  3CPW R;  4TLR A;  4J9K A;  2WVE A;  1WF0 A;  3AD9 C;  3JS9 A;  2XS5 A;  2OTL S;  4KJD A;  2BW2 A;  2VF3 A;  3NOG A;  4DUY J;  1HWU A;  3DFE A;  3Q24 A;  4K5R A;  4UOP A;  2OH2 A;  2WVF A;  2Z8Q A;  3CNQ P;  3OR1 A;  4F02 A;  1FVS A;  2XZD B;  4OMF G;  2J6U A;  5LSR A;  2BKN A;  3MM7 B;  3VR1 A;  2K3I A;  1U1N A;  1HNZ J;  4DV2 F;  3R1H A;  2HHP A;  3A3N B;  5KFU A;  4HL9 A;  3P96 A;  5LMU J;  3V81 B;  2VHG A;  3PX4 A;  4PXE A;  1EW8 A;  1D3W A;  3K58 A;  1OMS A;  4X4T A;  4ZVS B;  4DQI A;  3GCX P;  1IKV A;  1GMV A;  2G9O A;  3I4H X;  2B5J A;  4J91 A;  3MPD A;  2WW4 A;  4K7Q A;  3RTV A;  1XK8 A;  1JXV A;  1H72 C;  1LXN A;  3IBW A;  4CIO A;  3VAH A;  2HWT A;  2M0G B;  2GJF A;  1KFS A;  3HVR A;  3GR0 A;  1FFS B;  5I4M A;  1YZ7 A;  2IBO A;  1E33 P;  1MNE A;  2DNR A;  2VBZ A;  4J9O A;  2RAQ A;  4A8W A;  3CCQ S;  1CJV B;  2L9N A;  4IKA A;  1VYA A;  1WG1 A;  2ZVI A;  4I7F A;  5ETN A;  5L1J A;  4HI1 A;  1I5O B;  4M8L A;  2DT9 A;  3MHY A;  1FJ7 A;  2YWG A;  2YKN B;  4KE5 A;  4ZPT R;  4OJ3 A;  4F50 A;  2AYB A;  1NZA A;  3M7V A;  2VJU A;  2P6S A;  3FBE A;  1FI4 A;  2HMI B;  3MXH P;  1RAF B;  3KWM A;  3NBP B;  4W98 A;  5HBM A;  3EIC A;  1KTQ A;  1RTH B;  4O4G A;  4OX6 A;  4WIQ A;  4G1Q A;  3RUB L;  4U7C A;  2YKA A;  1MMN A;  5M2P A;  3RRG A;  4PQA A;  4WWS A;  2CQ4 A;  3CCU S;  1X4H A;  3DDK A;  2WRM A;  5GMK a;  2M5Y A;  2V8P A;  4LFC J;  3CDU A;  3J81 j;  3SCJ E;  1SIW B;  3K5O A;  1SC6 A;  3BN7 A;  1M0S A;  5T14 A;  3DLK B;  1YK9 A;  2DIU A;  1HNX F;  2E9R X;  1ICE B;  5HRO A;  1FVQ A;  2V50 A;  3NKR A;  3GP9 A;  2OI2 A;  1RTI A;  2MKI A;  4F3O A;  4IG0 A;  2HZC A;  4I2Q A;  3QJP A;  1DTT B;  4RNN A;  3DGP B;  2ZE2 B;  3D6M B;  4ES3 A;  2LEA A;  1VOM A;  2XUL A;  2UZA A;  2VKR A;  2FVQ A;  4DZD A;  1FKP B;  4KHP F;  2A6M A;  1MN9 A;  3TA1 A;  1W2B R;  5HMY A;  4C3K A;  1NUE A;  5C5J A;  1WOR A;  1S9G B;  4IH6 A;  1WC6 A;  4PYD A;  3ZNU A;  2XSF A;  1KVI A;  1X31 C;  2GMJ A;  3D1H A;  4ED1 A;  3TAP A;  2G2Z A;  1O5J A;  1M5O C;  1FRI A;  3HSJ A;  1T3O A;  1IBM J;  3RAX A;  3BR9 A;  4U96 A;  1XMQ F;  2DPI A;  2E29 A;  2G2O A;  1IWA A;  2YTC A;  4R25 A;  5D4O A;  4ECU A;  1S0N A;  3MZI A;  3CD6 S;  3H4D A;  3HI9 A;  2ZD1 B;  4FP9 A;  3C15 B;  2ZHB A;  3OQ2 A;  2B4P A;  4K4Y A;  4QWA A;  2ASJ A;  3C6U A;  4MFB B;  5E2Q A;  5LM7 E;  1NK8 A;  1HNI B;  3DU6 A;  5HMW A;  2OLW A;  4FN5 A;  3CTR A;  1HNX J;  3FQK A;  4QW8 A;  3WIU A;  4OYP A;  1X4B A;  3RYL A;  1L3U A;  3AOA A;  2HLT A;  1G4C A;  4TY8 A;  2O66 A;  1MML A;  2BJ1 A;  1TVR B;  3EE3 A;  4LSN B;  5D0E A;  4C8K A;  2JC0 A;  5JJB A;  1XTZ A;  1WEL A;  3S6E A;  3JAM Y;  2C2N A;  4HHU A;  2QZ8 A;  3I0R A;  3MTJ A;  3CJ4 A;  2ADC A;  1Y11 A;  4M5D B;  1FX2 A;  3VZI A;  1O8B A;  3GCW P;  1NK7 A;  1FEH A;  1QAX A;  4MKA A;  3S01 A;  3G8Q A;  4X4O A;  1HBU B;  5HVG A;  3OL7 A;  3D1O A;  5HO4 A;  2X3G A;  1LWX A;  2GW8 A;  2WVC A;  3IS9 B;  4C6A A;  5F3Z A;  1N48 A;  3ELH A;  1RTH A;  4O4G B;  1R27 B;  2Q6B A;  2ILY A;  5C2G A;  4Y6I A;  3SSQ A;  5T7L A;  4AD6 A;  1CC8 A;  2WON A;  3G87 A;  2CKW A;  5HK4 A;  1CG2 A;  2H9Z A;  1R8B A;  5C7P A;  3CCT A;  2DBB A;  1WG4 A;  3UN2 A;  4JI0 F;  3FVY A;  4DCJ B;  1KHN A;  5E5N A;  5KFX A;  3ETM A;  4Q5V A;  4DQQ A;  2ALY B;  2MY8 A;  4DX6 A;  5LQQ A;  2YKQ A;  2CNL B;  3PV8 A;  3CMR A;  1XEZ A;  3PFE A;  2W2N P;  4WU2 A;  4U7U D;  3UDC A;  2C3P A;  1IKY A;  2WK4 A;  1SL2 A;  1U24 A;  1I94 J;  1NEE A;  1N0U A;  4YS2 A;  2JEJ A;  4CM2 A;  3KG0 A;  5C42 B;  2AU0 A;  4I1T A;  5EDW A;  1I3O B;  3O44 A;  4KR0 B;  5DQH A;  2BX6 A;  3ZZ0 A;  4IRD A;  2OO4 A;  3MEE A;  4DR6 F;  3V5R A;  4K5S A;  2KFZ A;  1RT1 A;  2JX2 A;  3WC0 A;  5GRR A;  1RU1 A;  3ZZZ A;  1D8Y A;  3OXF A;  1CPZ A;  1ANI A;  2NXC A;  1VQP S;  1NND A;  1WD6 A;  2M7S A;  1GNK A;  1OO0 B;  4LBI A;  4IFV A;  3RU0 A;  3THP A;  5GAE I;  4L75 A;  4Y2K A;  5L39 A;  1KKH A;  1M5P C;  3QRR A;  2Q43 A;  4JUZ A;  3FBF A;  4M5M A;  2VPX B;  5CYJ A;  2ZZM A;  3US5 A;  3NNC A;  2WCX A;  1ZEB A;  3SBM A;  4ZG6 A;  2C1E B;  4ZIW A;  3V6H A;  5ETO A;  1NK6 A;  1AFJ A;  2ROG A;  4X4Q A;  2B6A A;  2RRA A;  1SCJ B;  2ADB A;  1S0V A;  2I8E A;  1HBO A;  3LP2 B;  4RW6 A;  4B9V A;  2KHC A;  4ZVR B;  4EO8 A;  2UU9 J;  2GO8 A;  4LFC F;  2KRB A;  4ICL A;  2DHA A;  1Q53 A;  3E51 A;  2ZH2 A;  4DPX A;  2JVR A;  1ALK A;  4KTQ A;  1HAR A;  2DGW A;  4EFA C;  1FWL A;  2GX8 A;  3H90 A;  2AEM A;  2QFJ A;  1UPM B;  1CSJ A;  1ITP A;  1Y3K A;  2EK6 A;  1LV5 A;  1RA7 A;  3CB4 A;  3CMA S;  1ZAX A;  2BVZ A;  2C3U A;  4A47 A;  4NPO A;  2VQE F;  2GML A;  4LF6 F;  3K8V A;  1EW2 A;  3BRE A;  5K14 B;  3DLG A;  2QMU B;  1HWI A;  3FDS A;  2WB4 A;  4NI2 A;  4P71 A;  3W2W A;  3MCO A;  4CCH A;  4EBC A;  3L95 X;  1S9E A;  1IVZ A;  4CM0 A;  2FB0 A;  4QQB A;  5FD1 A;  5KOX A;  2E5L F;  1V3S A;  3Q83 A;  1RT1 B;  4LRC A;  4WJB A;  4WU3 A;  2WHO A;  3WHI A;  3QMQ A;  2G0C A;  3JSB A;  1BXN A;  1N52 B;  1IUJ A;  1U6F A;  4NL5 A;  4ALZ A;  1SUQ B;  1AUD A;  4MY4 A;  2QGF B;  4NA3 A;  1RT7 A;  4P52 A;  5F8M A;  2BAN B;  3UDE A;  1JK9 B;  2FIU A;  3BGO P;  4NLR A;  2XGP A;  4B3O B;  1FNM A;  1M5H A;  1FXD A;  2RML A;  2XBP A;  3OL9 A;  3IXQ A;  3KXD A;  4RKU C;  2EFO A;  3QBC A;  2YWE A;  1NDK A;  1P8G A;  2ZBP A;  3CCZ A;  2BUN A;  4ILR A;  4A8X A;  4I68 A;  3K7R A;  4XDD A;  5CYQ A;  3Q8S B;  3SV4 A;  2ZKT A;  1ZET A;  1RYR A;  2HQD A;  2C2M B;  2DNQ A;  3ET6 B;  1HL6 A;  1CEZ A;  2CPF A;  4HTI A;  2R2R A;  3DU5 A;  3N6M A;  1C0T B;  3KUE A;  4QPT A;  4RW4 B;  4PYA A;  4U8V A;  1M1K T;  4RL1 A;  4FDI A;  4JBC A;  1FCA A;  4QCL A;  1J5O B;  3H2V E;  4DV7 F;  2R8K A;  2IMW P;  5J1N A;  3NCQ A;  5A8R B;  3QLH A;  4X66 F;  5A8R A;  4JI5 J;  3LQV A;  2XYH B;  4YB1 P;  2IDL A;  3NS7 B;  2R2S A;  2B6A B;  1C4A A;  2M8H A;  1VQ5 S;  1PBA A;  4X66 J;  1UW9 A;  2XMT A;  3FNN A;  2BQR A;  1F5B A;  1K73 T;  2HEK A;  5LJ5 Y;  4YFU A;  2MJN A;  4JV0 A;  3W65 A;  2R7S A;  3B82 A;  1F3V A;  4WYL A;  3VAJ A;  1ZZN A;  3CWJ A;  1REG X;  4X62 J;  4OLP A;  3AH6 A;  1NBE B;  2ZEJ A;  4MMO A;  1J5E F;  2F9D A;  1X5S A;  5IXU A;  2QYG A;  3BYR A;  2MKY A;  2RU3 A;  4X62 F;  3B5Q A;  3D6T B;  2XB2 D;  3DRX A;  5L1L A;  1R3N A;  1T02 A;  3SDE A;  2ZHA A;  5L1K A;  4J90 A;  3A8I A;  3NS6 A;  4DUT A;  2R9L A;  1F9E B;  3TA0 A;  5IT4 A;  1XNR F;  1BD6 A;  4GC7 A;  3PW5 A;  2PFD A;  3RAQ A;  3MEE B;  4OV6 A;  1YJW S;  3W2V B;  4ILM A;  1ELZ A;  1Q79 A;  2KM8 C;  5KT5 A;  3I56 S;  3VAM A;  1NKE A;  4JI3 F;  4DV7 J;  3BGF A;  5IC4 B;  5IS2 A;  1SH3 A;  4WFN Q;  1VQL S;  4V19 J;  2MQ8 A;  5I42 B;  3HX9 A;  1X5T A;  4OI1 A;  1Q78 A;  3QNW B;  1U2R A;  3LPY A;  3LUY A;  2R2U A;  3BM7 A;  4RX6 A;  1LQ9 A;  1NPK A;  3RBD A;  2FHM A;  1WC1 A;  3R5J B;  1N34 J;  3MAQ A;  1HPZ B;  3Q8R B;  2VL1 A;  3KHG A;  1TMJ A;  5M2R A;  2W4P A;  4MAK A;  2FC9 A;  4S0M A;  4I6Y A;  2KN4 A;  5KOW A;  2XWX A;  3J7Z 5;  4C0B A;  2EFP A;  3A8K A;  2HHH F;  4LF9 J;  1B70 B;  2DRD A;  3TI0 A;  4G1Q B;  5EX3 A;  2M2B A;  4WP9 A;  1RHJ B;  4OZ3 A;  1S1W A;  4QIV A;  3CW2 C;  3ZNJ 1;  5FLX Y;  3HHE A;  4DPW A;  3F73 A;  1UMJ A;  1Z4U A;  5E3Q A;  4TYB A;  1O98 A;  2HND A;  3DM2 B;  1YLX A;  2AGQ A;  1Z1Z A;  2Q79 A;  3E2D A;  2FPH X;  2EFN A;  1Q8I A;  1UCN A;  2V8H A;  3SZY A;  2BOP A;  4LF1 A;  2DHH A;  4N8O A;  2GGP A;  1B64 A;  4MIV A;  1HQ2 A;  4DS4 A;  2VFR A;  4KJG A;  1JLE A;  3M8Y A;  1KBR A;  2WZ1 A;  3R6L B;  2KL8 A;  3OTC A;  2D9O A;  2JEI A;  2DEJ A;  5KG4 A;  1X4D A;  2DHX A;  2Z2L A;  2DNL A;  2ZBQ A;  2RE1 A;  1HI1 A;  4CYU B;  2QLJ B;  1UVL A;  5IZH A;  2HZV A;  4K4X A;  1YVF A;  4C11 A;  4Q0B B;  3MM9 B;  1NSA A;  1A7G E;  1S9G A;  1IBK F;  3BDP A;  1UFW A;  2FHJ D;  1FJG J;  5J1E A;  2DGT A;  2XYG B;  2LQJ A;  2DB1 A;  3KD8 A;  2VFS A;  4HHH A;  3NNA A;  2HNZ B;  2B56 A;  2ABY A;  1S57 A;  3D4J A;  5IOL A;  2CPZ A;  1YJ9 S;  1XMO F;  4TU8 A;  1KRP A;  3IGY B;  3UCG A;  4DS5 A;  3CCV S;  4LF7 J;  2K7J A;  4NLP A;  2MQP A;  2E7W A;  1GMW D;  2M4M A;  2YNG A;  3P6Y C;  3C19 A;  4Q2M A;  4OYA A;  4CXK A;  4LFA F;  3PG9 A;  1CJK A;  4OZ2 A;  5D0H A;  5BR8 J;  1ZED A;  2PA3 A;  3KLI A;  1TL7 B;  4QZV B;  4NLT A;  1SJQ A;  1UVK A;  2LLZ A;  4QWC A;  4HHJ A;  1AT1 B;  2GA7 A;  4BWJ A;  1WSV A;  1LEO A;  3DYA A;  3G2X A;  2Y1I A;  3H4B A;  4DX7 A;  1DY3 A;  3VQS A;  3RB3 A;  1GXL A;  2H5J B;  2KJV A;  4CWB A;  3BJY A;  4CRJ A;  2HBQ B;  2IAJ B;  1NJZ A;  2VQF F;  3NBP A;  1JLG A;  2HGM A;  2ZUA A;  2XMK A;  2ZFH A;  4DX5 A;  3MUT P;  2L9W A;  3PY8 A;  2HWH A;  4ZPA A;  2I0X A;  1VIX A;  3CJT A;  5A0Y B;  5AE2 A;  3HDS A;  4OYM A;  4B08 A;  2KO1 A;  2HFU A;  2WTF A;  5IT9 U;  4OI2 A;  2VJV A;  1NXI A;  4ZP9 A;  3G82 A;  4OX7 A;  3AT1 B;  3KMS A;  1JLG B;  2UUT A;  1VC5 A;  3KMQ A;  4A8O A;  4LMZ A;  1OY8 A;  2BJ7 A;  3IMQ J;  3D6H B;  4K59 A;  4RR5 A;  2B43 A;  3AOB A;  5KFT A;  3EDQ B;  4USW A;  1SHN A;  4ZVH A;  4GTW A;  3ZZY A;  4H4O B;  1ZA2 B;  3AQP A;  5D0G A;  3H98 A;  1WJ9 A;  3AJ1 A;  1YBU A;  3TZW A;  1KQG B;  1U1M A;  5E7O B;  2HVE A;  3BDH A;  4AQY F;  2OEJ A;  1MG7 A;  4F26 A;  2DNN A;  1VCT A;  4HKQ A;  5KFN A;  3DOM A;  4DV3 F;  3QGI A;  2HWI A;  2UVR A;  4C8L A;  2AJQ A;  4PUO B;  4NCG A;  3IN5 A;  1UAW A;  2EKY A;  1U1R A;  1LNQ A;  2B0G A;  5ADZ A;  2CQ0 A;  1KLN A;  3KLE B;  2V6A A;  4K0K F;  2HS3 A;  3M4X A;  2D3U A;  5LOQ A;  1P27 B;  3BDG B;  4M5N A;  3CJK B;  3FRY A;  5A2Q U;  1J2V A;  3JSY A;  3NKQ A;  4ZCL A;  1TEL A;  3CJ3 A;  3G86 A;  1SB6 A;  5KFM A;  2FJX A;  2PN6 A;  2QLF B;  1U1K A;  1UWB A;  1QE1 A;  2GSU A;  4P10 A;  1RAA B;  3T5H A;  3OR1 B;  4P9S A;  4M5H A;  1NKB A;  2FVP A;  3IM9 A;  2K06 A;  4ETX A;  2GJI A;  1AUK A;  2YNH B;  5EWG A;  2RDJ A;  2BDP A;  3D3B J;  3PTW A;  1WTF A;  1REV B;  3ULH A;  3MR6 A;  2PO4 A;  4LVN P;  3QIP B;  4ZPV R;  1ED8 A;  4MIW A;  3R2C J;  2HHV A;  1C2P A;  1L3V A;  1YSJ A;  1K9M T;  3BSO A;  2CPI A;  2KB2 A;  4KHM A;  4WFZ A;  3HPO A;  5LMU F;  4JI4 F;  1C0T A;  2PGC A;  1HD1 A;  4B9S A;  1H2U X;  2D1C A;  3DOK A;  3QT8 A;  4U9R A;  3PYE A;  3DLH A;  2OSQ A;  3M6U A;  3BN4 A;  3I6P A;  2RH6 A;  4ELT A;  3IWX A;  1TL7 A;  1LWC B;  4DJB A;  2XI2 A;  2ASY A;  1Q95 G;  1O51 A;  1B8J A;  2QX0 A;  1N33 J;  1T0T V;  1RTZ A;  3CC2 S;  2D69 A;  3K57 A;  5HLF B;  4NRT A;  1UJ6 A;  2FGO A;  1ELY A;  2D3O R;  1H98 A;  2DK2 A;  2NXN A;  5G0R B;  3G6X A;  4USM A;  3EGV A;  1HQA A;  3IP0 A;  4ZP6 A;  4M5K A;  3BGR B;  3LP0 A;  1ALI A;  3WIV A;  5D3G A;  4K4Z A;  3RBZ A;  1K0T A;  3VTI A;  3ZZT A;  4DR2 F;  2NPI A;  4URQ U;  3W2V A;  5D6G A;  4MK9 A;  4IDK A;  1WDD A;  2HQ3 A;  3D6F B;  4DFK A;  2DIS A;  1IKW A;  4Z7Y A;  3HHL D;  1EET B;  4QIF A;  4C3M A;  2OHD A;  5ETM A;  5J2Q B;  4NA1 A;  2GVZ A;  2YNF B;  1Q81 T;  2VV5 A;  3CE8 A;  3HUL A;  4GC6 A;  2V0N A;  5D4L A;  1CBK A;  4B3R J;  2HVI A;  4MYU A;  3JB9 k;  1S99 A;  2O5D A;  1TL4 A;  3KHR A;  4Q0B A;  5B0B A;  1ZH5 A;  3T6J A;  3MD1 A;  1VQ9 S;  3FUY A;  2GHP A;  3GFH A;  3GIJ A;  3SFG A;  2CJB A;  1E6Y A;  3DMJ B;  2H5E A;  2NPF A;  2YNI B;  4IO9 Q;  2RF2 B;  4FVC A;  4DPU A;  2VON A;  3UPF A;  3OW2 R;  1RLD A;  1O0P A;  3HSZ A;  5D8H B;  2NUU G;  3L09 A;  1RT5 B;  2GQQ A;  2OMO A;  2EPI A;  2XI3 A;  4JI8 F;  5CD4 A;  1VQY A;  2QA4 S;  1ARO P;  1ED9 A;  2IUC A;  3JTP A;  3SMZ A;  4TQR A;  2C3Y A;  4ECZ A;  1LWE B;  2JWN A;  3SXL A;  1TUV A;  1S1T A;  5K8O A;  2P6T A;  1UFK A;  5K8P A;  3M9M B;  4DR3 J;  5KFK A;  3ZTS A;  1N54 B;  3EPI A;  2ZH5 A;  1HBO B;  1S1W B;  3LP2 A;  2Y3Y A;  4RW6 B;  4AXJ A;  3TVK A;  2DD8 S;  2IRU A;  2KI2 A;  3K5P A;  2VPY B;  4OI3 A;  4OZ5 A;  1SJ3 P;  2MTL A;  5ETS A;  4NE9 C;  3PX6 A;  5INH A;  5IT9 Y;  1CUL A;  5TJ3 A;  1GXU A;  5DM7 Q;  1H74 A;  5L0B A;  3QLH B;  5DG7 A;  2IAJ A;  2RUG A;  2EWH A;  4RWX A;  4LQ9 A;  5A76 A;  2QZU A;  4HT5 A;  4F36 A;  3KK2 B;  1GAO A;  2WSC C;  3PRB A;  4LF2 A;  1N8R T;  4C8O A;  2DR8 A;  3IGN A;  3KJF B;  1PSD A;  2XWY A;  1S72 S;  1DAX A;  2CG8 A;  5KFJ A;  1WOS A;  2RKI B;  1ALJ A;  1AB8 A;  2J9D E;  1LW0 B;  2OPS B;  3OFH A;  4Q2L A;  5DLV A;  2L08 A;  5LRM A;  1VBY A;  2KTQ A;  2W8D A;  2GMH A;  3LGM A;  1YJR A;  2YKM B;  3DRY A;  1VI7 A;  4OYB A;  4J9Q A;  4GO7 X;  1DHM A;  1WHX A;  1S7H A;  2K1R A;  3TAM B;  3G6Y A;  2FJV A;  3CD0 A;  1T8E A;  3ILJ A;  4ZA1 A;  4DL6 A;  2NYI A;  4A4J A;  4NML A;  3TP2 A;  2DGQ A;  4ZJO A;  1PYT A;  2OFH X;  4B9L A;  1Q86 T;  3VF0 B;  4Z7C A;  3EGN A;  1D9D A;  2XHC A;  4UPK A;  1WEX A;  1NJY A;  5A8K A;  3M30 B;  5K20 B;  3P45 B;  4TY9 A;  5KFG A;  1AW0 A;  4B02 A;  5AJ9 A;  1YI2 S;  3CJ2 A;  1ZAW A;  1CJT A;  7FDR A;  4K2J A;  1LW2 B;  3M2V A;  4FYD A;  2DH9 A;  4KGZ B;  1RSC A;  2HKE A;  1LOU A;  1FK9 A;  2LQB A;  1TUW A;  2LQ9 A;  3CDB A;  4A48 A;  4R5P B;  2YBV A;  3EMT A;  2ERR A;  3B4M A;  3MM8 A;  1IBM F;  1NME B;  2VOO A;  4I6W A;  1J5O A;  4DI6 A;  1XQI A;  3DGV A;  4LSL A;  1GQE A;  5HMX A;  5KG5 A;  2NRE A;  4ERD A;  3RBE A;  1HR0 J;  2H48 B;  2LVW A;  5E41 A;  1F2G A;  3RRH A;  5EX0 A;  2D7S A;  3HJF A;  1V5I B;  4CO2 A;  2U1A A;  1UA1 A;  4Q8E A;  2AT1 B;  4QAX A;  5B0C A;  4ZGA A;  3H5S A;  1JQG A;  1X4F A;  2ZJR Q;  4B3M J;  1GTE A;  3PO4 A;  2G0J A;  2C2D A;  3T3F A;  3HZG A;  1S9F A;  1HBN A;  2IM2 A;  4OZ0 A;  4H54 A;  4AL5 A;  3MEG B;  5M2U A;  1KP6 A;  3POT A;  4YP3 A;  1HQE B;  1X4G A;  3TR5 A;  2RB7 A;  1IWG A;  3HFK A;  2RQM A;  3OT9 A;  1ZTW A;  2AMC B;  2MLZ A;  3HK2 A;  4EBD A;  1LK7 A;  2Y0B B;  2X7I A;  3OVS A;  3WX4 A;  2FQQ B;  1FDB A;  1YJU A;  3BKF A;  3C66 A;  2F4V J;  2IRX A;  4DUZ F;  1EHW A;  1Q1K A;  2D41 A;  2HVD A;  2YWH A;  3CJS A;  2FY8 A;  4NEZ A;  3TAM A;  8RUC A;  1UEV A;  1XMQ J;  2YKM A;  3OXL A;  1RAH B;  4QR0 A;  1QAJ A;  1M5S A;  1ZTT A;  2Z2Z A;  2I9S A;  3DRP A;  3MM6 B;  1SBR A;  3NLC A;  4DR5 J;  3HMJ G;  1UZH A;  4GTZ A;  4FXD A;  3LA0 A;  3ZTQ A;  5IC6 B;  4W92 B;  1KNZ A;  4ZVQ B;  3MCM A;  2N82 B;  5C42 A;  4Y34 A;  4KAY A;  2W9C B;  2XCP A;  3QYY A;  4UY8 T;  4O3R A;  5AT1 B;  4DMZ A;  3CT9 A;  1VJW A;  1WEZ A;  2J6S A;  3R9L A;  4RWW A;  3J81 U;  1RHK B;  3SV3 A;  3TAN A;  3GTY X;  2M70 A;  4KGX B;  1HBM A;  2DY9 A;  3FSX A;  1K7H A;  1HDH A;  3M1V B;  4FBU A;  2HFO A;  2Y1L B;  5LSO A;  1L3S A;  2YQ3 A;  2OIH A;  2G4B A;  1GXT A;  1LFP A;  3A12 A;  5T41 A;  5EGY A;  4JI3 J;  2FD2 A;  3FCH A;  4RUC A;  3J7Z T;  1FJG F;  1TKD A;  3QWU A;  1Y4Z B;  3TAR A;  4J9N A;  1RWX B;  2FHK A;  3GR1 A;  1HNW J;  2KT2 A;  4B9N A;  1WHW A;  2CDR B;  2OFG X;  4YB5 A;  2I2Y A;  1K44 A;  2DGU A;  3FSI A;  4USJ C;  2KJW A;  4DUZ J;  1HBU A;  4NYZ A;  2HQC A;  2QL7 B;  2LU2 A;  3FEZ A;  3TUJ C;  3WAV A;  2XO7 A;  2AX0 A;  1S49 A;  2BE2 A;  2LQ8 A;  3D7S B;  1U09 A;  5SZT A;  3IG1 A;  1GEH A;  4KPY A;  1HWL A;  1PBU A;  3EGZ A;  5BYQ A;  2KFN A;  2AV5 A;  3PVX A;  2YXL A;  1HD0 A;  2DNK A;  3EM1 A;  4JP8 A;  2IM3 A;  2ZBR A;  4TN2 A;  3H59 A;  3VGT A;  2V2Z A;  2VG7 A;  2IM1 A;  3OVA A;  2P9E A;  2BJE A;  3G6E S;  1R8C A;  1WKJ A;  2KT5 A;  2R8H A;  4F7V A;  1TKZ A;  3AQO A;  3GYG A;  2KXN B;  4FYX B;  1IKY B;  1CJU A;  1MMD A;  2LMI A;  5DRK A;  4WK3 A;  1NSQ A;  3RW7 A;  4DBQ A;  1HNV B;  1HI8 A;  4ID5 B;  1TL5 A;  4RLE A;  2FUG 9;  3M6V A;  4OYI A;  1UJ5 A;  4NCG B;  4DZ6 A;  2PI4 A;  4KH0 B;  1EAR A;  2V69 A;  2BW7 A;  5K8M A;  1M90 T;  2BAN A;  4ZDN A;  3SEO A;  3W9I A;  3DLL Q;  1WNE A;  4DR4 J;  2KHD A;  3QID A;  2DGO A;  1FKP A;  3G96 A;  1EET A;  2MKJ A;  3HKW A;  1U8S A;  2L41 A;  4ZPB A;  4EK2 A;  3Q8Q B;  2BM1 A;  2QSF A;  2OPR A;  5E3R A;  1S0M A;  2ZE2 A;  2KG0 A;  3VZH A;  4BC7 A;  4JI2 F;  4WKY A;  2LA4 A;  1JMT A;  2W01 A;  4CTA B;  3G4S S;  1UA0 A;  3U1L A;  3BPD A;  3NGK A;  5CCL A;  3V6J A;  3KK1 B;  1HR0 F;  2DH8 A;  2MZ1 A;  4RW7 B;  1DJ0 A;  1E6V B;  1QDU B;  1SXL A;  2VFV A;  3TQ1 A;  4TXS A;  1UVI A;  4USV A;  1ZM9 A;  1KS2 A;  1SC4 B;  3EVW A;  2W7O A;  5JVG Q;  3H8Y A;  1VS3 A;  1LWC A;  4G1P A;  3UNY A;  3PR4 A;  2P9G A;  5KFE A;  2DXD A;  2EVZ A;  3TOQ A;  2M88 A;  4E98 A;  4YEA A;  4OZN A;  3P3D A;  2CPH A;  5FII A;  5AE1 A;  1MW7 A;  3GII A;  2R8J A;  1HNI A;  1DUR A;  4MIA A;  1S1U A;  4USI A;  3UN5 A;  4EGL A;  3BQ1 A;  1CQM A;  4B3T J;  4KHP J;  1TVR A;  3DI6 A;  5ETP A;  2HQF A;  1REV A;  2LU1 A;  1C0U B;  3DNC A;  4DPO A;  1WOP A;  3EWG A;  2E5L J;  1D1U A;  4DR4 F;  3C6T B;  2R7T A;  1H7X A;  4A8S A;  4O3S A;  4KHR A;  3R3T A;  1TQL A;  2V63 A;  2J9E A;  2DGV A;  1WC3 A;  2BAB A;  2R7Q A;  3NKN A;  3C14 A;  4MKB A;  2YVS A;  2A2D A;  3NGR A;  3OFG A;  4ID5 A;  4X84 A;  2KZZ A;  1V3Z A;  4P72 A;  3BQ0 A;  4DV1 J;  2ROE A;  4FYY B;  5DS7 A;  4LRB A;  2MMY A;  5KFZ A;  2KG1 A;  1YRU A;  3A13 A;  1G7C B;  3BS9 A;  3KLE A;  2KXH A;  3BDG A;  4ECW A;  4YB7 A;  4W4M A;  1DTT A;  4BLG A;  5CA5 A;  2MZJ A;  4ELV A;  2XLK A;  2UXB J;  3K5M A;  5DLT A;  3DC2 A;  3Q0A A;  3MM5 A;  4QR2 A;  4NRU A;  3WBH A;  2DIV A;  4KV8 B;  3IBC B;  2MGZ B;  2E5H A;  1JWW A;  1N5T A;  1F1B B;  2WVB A;  1RB0 A;  3MTK A;  5AJ3 F;  5F41 A;  4AT1 B;  3PR5 B;  1MU2 B;  3UCZ P;  1Y5I B;  2HHX A;  2VDH A;  3UI3 A;  2CAD A;  5L0E A;  3KKF A;  1TKX B;  4ZIT A;  1HNW F;  2E1R A;  4DQP A;  1RKJ A;  4R8U B;  1HFE L;  1SH0 A;  4MKV A;  4OI4 A;  4OZL A;  4JI6 F;  4CLY A;  4D3H A;  1R0C B;  4DV5 J;  1A9N B;  1ZPW X;  3ZZU A;  2GC8 A;  2GFF A;  4ZVP B;  3UN3 A;  3TZX A;  2ZH9 A;  2HGL A;  2E5I A;  2HS0 A;  2UU9 F;  4FBT A;  4RNF A;  4C97 A;  3CDW A;  2C3M A;  2GCF A;  2CZ4 A;  1SKU B;  4P75 A;  1CJV A;  3VAG A;  2UUB J;  4BCA A;  3KTQ A;  2V34 A;  5I3U B;  2V9W A;  3I0R B;  1GX5 A;  2RIJ A;  1X5P A;  1SJF A;  3J7Y I;  2YKN A;  3J7Y U;  4AL6 A;  4N41 A;  5F0W A;  4YHH J;  1FER A;  1FWK A;  4LSN A;  4AUK A;  1V3R A;  5F0U A;  1Q8B A;  1AJB A;  2FJW A;  4USK A;  3CO0 P;  2UP1 A;  3CME S;  1KOH A;  2HSE B;  4MTP A;  2MQQ A;  2J0S D;  3X3U A;  1NB2 A;  1FJC A;  1CQN A;  1FWP A;  2HRT A;  3FMW A;  3HT3 A;  1YQH A;  2GJ2 A;  1SQF A;  1SH2 A;  3NGS A;  1K8A T;  3WC2 A;  1AXQ A;  4P7T A;  1RT2 B;  3GV5 B;  2C22 A;  1JJ4 A;  2YQ1 A;  3MM9 A;  2KM8 B;  4N56 A;  4NCA A;  5JXS A;  2R3V A;  2XY7 A;  5J2P A;  1CJU B;  3B6B A;  2W5V A;  3V81 A;  4YR2 A;  1T9X A;  4ED4 A;  3GFY A;  1KHJ A;  4JI2 J;  4UOH A;  3DRR A;  4DFM A;  4LF4 J;  3AY0 A;  1HMV A;  3C14 B;  3LAL A;  2EC2 A;  2FJB B;  4W90 B;  3ILO A;  4QIW D;  3BSA A;  3GMG A;  5C25 B;  3QZ7 A;  1NPP A;  1TL1 B;  3LTO A;  4FYV B;  3PHT A;  4LFA J;  1ZA1 B;  2ACM A;  2E5J A;  1FTR A;  2FDN A;  3H42 A;  3ZXW A;  4Q44 A;  3K0J A;  2W5R A;  1V6H A;  4DLE A;  1TTH B;  4NZ7 A;  5F8G A;  5THW A;  2B9W A;  3TVY A;  5B7W A;  1HJK A;  1S1V B;  1T9V A;  2W4D A;  3M6W A;  2MQM A;  5CXT A;  2VG5 B;  1PJ6 A;  3MAA A;  4X4S A;  1EP4 B;  2CXE A;  3PKY A;  4JV5 J;  4FVM A;  3BKU A;  5KG0 A;  2XHW A;  3MEK A;  2ATL A;  4QPX A;  3EDR B;  2ZOM A;  4K4W A;  2NXJ A;  3ET6 A;  2R7V A;  1BWV A;  3TG0 A;  2B8Q A;  1LW2 A;  2CWX A;  2DO4 A;  3K17 A;  3M2V B;  2IBK A;  1AJD A;  4KRW A;  1GMU A;  1X8D A;  2JRS A;  2HUR A;  2DJW A;  4G65 A;  2VB6 A;  3E01 B;  3VHQ A;  5KFC A;  4OQJ A;  3UFC X;  4EYI B;  4LF7 F;  5HBM B;  1C1C A;  4Q7A A;  3UVJ A;  4UQG A;  4CXU A;  4CYS A;  3W9J A;  3T1H J;  2XSJ B;  3SZZ A;  2ZZT A;  2GNK A;  2H4W B;  1Y0H A;  3AAW B;  4IG3 A;  3TX8 A;  2YWF A;  1SQG A;  2A1B A;  2CNO B;  2PMH A;  1NDP A;  3J80 U;  2AIR B;  2B51 A;  2HRU A;  1RT3 B;  1VR6 A;  4F67 A;  3DLJ A;  3WBZ A;  5DQG A;  4CLU A;  2UUC J;  3BDF A;  4RBU A;  2EW9 A;  4NXN J;  2MZQ A;  3S8S A;  5RUB A;  1Q5V A;  2F65 A;  3SQG B;  3MAH A;  2Q6C A;  2CQB A;  3KDO A;  1S9E B;  3P8B B;  2C2E A;  4ZPC A;  3MEC A;  3VV2 B;  4NWB A;  3LOU A;  3RG6 A;  3ADA C;  2ZJQ Q;  4DV3 J;  2QE5 A;  2AYG A;  1SV5 A;  4KPC A;  2VA3 A;  2RS8 A;  3QPI A;  4NXM J;  4GKJ J;  3GFX A;  3O3L A;  1APS A;  1S6Q A;  1CLF A;  4UPI A;  4HLB A;  4J5O A;  1I51 B;  2L9D A;  3PXG a;  5IM0 B;  4Q43 A;  1R0A A;  2QFI A;  5E0O A;  3MM7 A;  2LEB A;  3L9Z A;  3PJW A;  1H38 A;  4R0E A;  2XS7 A;  2CNK B;  4ZHR A;  4IRK A;  4FF3 A;  3IR6 B;  2VQF J;  3D0H E;  4UY8 5;  1QSY A;  2IC3 A;  3MK0 A;  1P9Y A;  4DHV A;  2R7X A;  4ZN3 A;  3ENA A;  4Y65 A;  1R31 A;  1IN0 A;  3MM8 B;  2XMV A;  3MMA B;  4YR1 A;  3TRG A;  1RYS A;  1X0F A;  2DPJ A;  2ZUG A;  3BV8 A;  2CAJ A;  3AJ2 A;  2LXU A;  3BZQ A;  3Q8V A;  5HJX A;  4C8M A;  3ICL A;  3PCO B;  4RW4 A;  2FZC B;  4ED7 A;  3W8G A;  4ICL B;  3PW4 A;  4FS2 A;  1W25 A;  1O6X A;  1RBA A;  2EBE A;  5C24 B;  2UUC F;  1FNX H;  1WKK A;  3M05 A;  3FGV A;  3R5B A;  1K0V A;  2UVU A;  1RAO A;  4K4U A;  2CQG A;  4YY3 J;  3OR2 B;  1SIZ A;  4KO0 A;  3JQK A;  3KUH A;  4RUH A;  2DY1 A;  2C2K B;  3JTN A;  3R97 A;  1EX8 A;  3EVO A;  3DRS A;  1L5U A;  4UZB A;  1N33 F;  5HVF A;  4F2S A;  2DHS A;  3MEC B;  4C7Q A;  4C0H A;  3C2P A;  1EQ0 A;  1FXR A;  1N5V A;  5SUH A;  2JLF A;  3UDV A;  4DEZ A;  2W2M P;  4N8N A;  5KG1 A;  5LXY A;  3SQG A;  4BBY A;  1S6Q B;  1UEU A;  1WOO A;  4FKY A;  2V2K A;  4JOU A;  4USH A;  4IFY B;  5EUH A;  2JDJ A;  3EX7 B;  2FJE B;  3JTO A;  4NWJ A;  1HKA A;  2MSS A;  2MY7 A;  3MDF A;  3FMB A;  4AND A;  2YPZ A;  2BEF A;  3ILI A;  4IH5 A;  2CQI A;  2FJD B;  3FC9 A;  1WHV A;  3DXB A;  4I2P B;  4AFF A;  3SDE B;  2U2F A;  2PFF B;  1IM4 A;  2Q1L A;  3I5B A;  2ZDP A;  3LO3 A;  3QGG A;  3W2W B;  2AX1 A;  1L3T A;  1S7I A;  2GVD A;  2EFQ A;  2V4J B;  1JLF B;  3NGU A;  5E3C A;  4F4W A;  1XNQ J;  3BPS P;  3FCV A;  3N79 A;  5G4D A;  2F5G A;  1D8Z A;  4TU7 A;  2HNY B;  5BR8 F;  5J2M A;  4LF9 F;  1EI6 A;  1OPZ A;  2DR5 A;  1KLM A;  2Z2M A;  4RUB A;  3GJT B;  3KLV A;  1FDD A;  3KLF B;  1ALH A;  2D74 B;  5KFP A;  2W25 A;  4KFB A;  2XMA A;  4UST A;  1ZM4 A;  3R7B B;  4ID8 A;  4GVL A;  2ZC3 A;  2J0W A;  1RWK B;  4AL7 A;  1KVK A;  1YJT A;  2AKW B;  2F8H A;  2KKH A;  5LRN A;  1U1Q A;  3GON A;  1Z2Z A;  4L72 B;  3THV A;  2PEB A;  1EP4 A;  2IC3 B;  4OJ1 A;  3K5N A;  3AB4 B;  3BSN A;  4DL2 A;  1HI0 P;  3F44 A;  1F6T A;  5IV3 A;  4OHY A;  5A6P A;  4A8Y A;  3W7B A;  5DLW A;  4TY8 B;  3LPE A;  3HM9 A;  4C0O C;  4NLY A;  1PO6 A;  5HL7 Q;  2HIQ A;  3K8W A;  4ZG7 A;  3BO2 A;  4UOF A;  1VBZ A;  3N0V A;  1S6U A;  2Z56 B;  3GG1 A;  2DCL A;  5D0R A;  2FHO B;  4C98 A;  2V2V A;  4LIW A;  3AA8 A;  1VLO A;  1UVJ A;  4MH8 A;  2O01 C;  2RJZ A;  2DTJ A;  1XMB A;  1Q8K A;  3M6X A;  3M8Q A;  5HAT A;  3T19 A;  3TJ8 A;  4PCQ A;  4CNY A;  2LDY A;  2ZH8 A;  5LMN J;  4ED6 A;  3NKM A;  2HHW A;  1H73 A;  2EFG A;  3C16 B;  3OXG A;  4KAI A;  5KG3 A;  4UOC A;  2ZH7 A;  3BGR A;  4AQY J;  2CG4 A;  4IRC A;  3MR7 A;  2GVZ B;  1FDN A;  2YNF A;  4FYW B;  4XK8 C;  2PMZ D;  3TO8 A;  4DR3 F;  1N56 A;  1G1X A;  4OYW A;  4WTY A;  2RKI A;  2VC1 A;  2YKO A;  1FKA F;  5L0K A;  2GIF A;  4DWI A;  4UQT A;  1L3K A;  5GAG I;  1MWY A;  4ZK7 M;  5K4P A;  4KJI A;  3CD7 A;  4FPI A;  1UWA A;  2GS8 A;  1UTA A;  4H4O A;  3IWN C;  4O0N A;  4P74 A;  3UNG C;  3NP5 A;  1NJW A;  1KN6 A;  2HGN A;  3HHL C;  4OX8 A;  1MWZ A;  3W1Y C;  4L74 A;  5DQI A;  4F4A A;  3DGP A;  5ITH A;  5HP1 A;  2W5Q A;  1ZEF A;  5EWF A;  3N9U C;  4X4P A;  1FEE A;  2ATC B;  3HXM A;  2Z30 B;  3Q23 A;  1TFY A;  1C1B B;  2VDI A;  4UW2 A;  1X5O A;  2Z58 B;  3M8W A;  1NM2 A;  1NPR A;  1NJX A;  4ELU A;  2CZ9 A;  4IO1 A;  3N5B A;  2F1F A;  4ITS A;  4NX9 A;  5F9N A;  3KK1 A;  1NCL A;  1Q7L B;  4PZV A;  5C25 A;  2AD9 A;  3CUL A;  1RKI A;  3G71 S;  4DR1 F;  1LFW A;  1BHN A;  2KYX A;  1TKX A;  2KVQ E;  2QIF A;  4XTT A;  3I31 A;  3UD4 P;  1KVJ A;  4ED0 A;  3JSR A;  3QIP A;  3TA2 A;  4F0K A;  4PWW A;  3OLA A;  2XGQ A;  2W7P A;  2AJF E;  3GIK A;  2AGP A;  2BRK A;  1PCA A;  1JLC A;  3GSI A;  3QAE A;  4DX8 H;  3TAQ A;  4DV0 J;  3QZ8 A;  4ED2 A;  5L9X A;  1CVJ A;  4WP3 A;  4PG5 A;  4WPA A;  1RT5 A;  1WG5 A;  3QO9 B;  4ZS6 A;  4ZVO B;  1YIJ S;  1X9W A;  4MK7 A;  4WE1 A;  1RWU A;  1MRO A;  2QA4 G;  2DNZ A;  2IJF A;  1H6K X;  3I9V 9;  2KU7 A;  3HHD A;  1HNV A;  4RW8 A;  1P1T A;  4ZCM A;  3CXC R;  4F8R A;  2W5W A;  1SQE A;  1S10 A;  1FE0 A;  1JNR B;  3RAM A;  1X9S A;  2R4F A;  2V8G A;  4ZOS A;  2CJA A;  1TAU A;  4LRA A;  1ZAV A;  3SCI E;  1RT4 B;  4ZN1 A;  1OIA A;  3RW6 A;  3A3O B;  3S7R A;  2E9Z A;  1IQT A;  4CYU A;  3WAX A;  5D3G B;  2HG4 A;  1U0S A;  1M1H A;  3R1L A;  3KFW X;  3IAM 9;  3U27 A;  3DPC A;  5DGA A;  3CJR A;  4ANE A;  3CO9 A;  2MQO A;  2A2C A;  4F4K A;  3MK1 A;  2MLY A;  1OYE A;  2WW8 A;  1IKW B;  3IG1 B;  3QAT A;  4PG7 A;  5L38 A;  4B3S F;  1QVF R;  3MD3 A;  1JLE B;  1GT8 A;  2VPW B;  2ALZ A;  3V6K A;  4B3M F;  1JLB A;  1RT6 B;  3K2Y A;  4I2Q B;  4MYT A;  4Q45 A;  1YHQ S;  4LF8 F;  2UXC F;  5B0A A;  2DKO B;  3HJV A;  1TMM A;  2GHW A;  1DTQ A;  4LR7 A;  2HLU A;  3J7A N;  4X4N A;  2HHQ A;  1JIH A;  3RBX A;  4DSE A;  1IBL F;  4JI0 J;  3DOL B;  5HSP A;  4GVB A;  2RNE A;  5KFB A;  3KJN B;  2BE9 B;  1KSP A;  4GO5 X;  5D4N A;  3NMA A;  1VBX A;  2IMO A;  3UD3 P;  1S4E A;  2ZHO A;  3GLJ A;  4L6V 3;  5KFD A;  1SJR A;  4JI8 J;  1WEY A;  4ECY A;  3PX0 A;  1SJ1 A;  1U8W A;  4PXD A;  1VQ6 S;  1VHI A;  5AXM A;  2MYF A;  2MGZ A;  3LWL A;  2ZH3 A;  2K7K A;  2I38 A;  4X65 F;  2HMI A;  2WSE C;  4CT9 A;  4YQW A;  2BOA A;  4CLW A;  3MOZ A;  1FFW B;  3VCD A;  2MPU A;  1BMQ B;  3DYA B;  4FF2 A;  4DV2 J;  2XRG A;  1QTN B;  5KFO A;  3OJU A;  1ZPV A;  1S6P A;  3R27 A;  2ZWP A;  3IM8 A;  2V4R A;  2AWZ A;  3R6G B;  4G1I A;  1F9F A;  2OSR A;  3EVM A;  4OZ1 A;  1J27 A;  2C2O B;  3I0S B;  3TVZ A;  2ZD1 A;  4DUY F;  2X98 A;  2E9T A;  4WKR A;  1YGY A;  3HF5 A;  2J9D A;  4OFZ A;  5KFW A;  1JB0 C;  3U1M A;  1HA1 A;  4NAS A;  4NLU A;  3KK3 B;  2OPQ B;  2PC6 A;  4U6P A;  1CS4 B;  5C2C A;  4DSL A;  2HAF A;  3I32 A;  3ILL A;  3QWP A;  1QD1 A;  4OL8 A;  2XO6 A;  1S76 D;  1ZM3 A;  2ILZ A;  4EO6 A;  7FD1 A;  1A6L A;  2F40 A;  2W24 A;  1WF1 A;  5CD4 H;  1M1G A;  3BO3 A;  1VQK S;  2E1C A;  4FPR A;  1I94 F;  4JI7 F;  1B99 A;  5LJ3 Y;  1BLU A;  2M52 A;  3QO9 A;  5HAO A;  4YUD A;  3CCE S;  1RWP B;  1S97 A;  2XYP B;  4PUO A;  2DNO A;  2V94 A;  4QYR A;  4F25 A;  2NXU A;  4YB6 A;  4MJK A;  2CJ9 A;  1VMB A;  2HK3 A;  2W2O P;  2ZJP Q;  1FSU A;  3HHK A;  3MI7 X;  1T05 B;  3K59 A;  1U4B A;  1TK0 A;  2V5H G;  4HTJ A;  1EKR A;  4FZV A;  4OYO A;  4DSI A;  1VQS A;  2JLE A;  3FFI A;  4ILL A;  1RAJ A;  4EU0 A;  4IOB A;  3QJJ A;  1QTM A;  5KFL A;  2QN6 B;  5DO2 A;  3R7N B;  2ASL A;  3NL0 A;  4ENO A;  1UP1 A;  4N77 A;  2HHT A;  1ZZF A;  5IWA J;  4LSZ B;  2LEP A;  5CQG A;  2VOP A;  3NOC A;  3FJ2 A;  4IOC Q;  2JEG A;  2XNR A;  3FK4 A;  1K47 A;  1KON A;  1FX4 A;  1U02 A;  3FZ2 A;  4R5P A;  4LRD A;  2QMX A;  3G6V A;  5JVH Q;  1RU2 A;  2RH3 A;  4NA2 A;  1S12 A;  5LMN F;  3UR0 A;  3EZU A;  3CC4 S;  4GKK F;  5AXK A;  2VIH A;  3CED A;  4UUW A;  3M30 A;  3V4M A;  3CCL S;  1N36 J;  1VRQ C;  2HNY A;  2B7C B;  2IIH A;  2VU5 A;  4ANC A;  2IJR A;  3IGZ B;  1N36 F;  3I9Z A;  1ZYQ A;  3PEH A;  1QSS A;  1BE4 A;  5D77 A;  5KT7 A;  1BQN A;  3UD5 A;  4B3T F;  2VQE J;  3MR5 A;  4P73 A;  3HHL A;  1VIS A;  4WII A;  3OTO J;  1VLY A;  1HQU A;  2DRA A;  3GG0 A;  5B08 A;  4DL4 A;  4E8U A;  4QWB A;  3A8J A;  1HHT P;  2V68 A;  5EWE A;  4K4T A;  2OD6 A;  2V8D A;  1KEK A;  2GQ2 A;  1B3T A;  4UUX A;  1IM6 A;  2BJ3 A;  4ZCI A;  3DRS B;  3CCR S;  3PZP A;  4JI6 J;  3W3S A;  3DYC A;  3IA0 A;  4I6A A;  4IFY A;  4DDF A;  4OHZ A;  3VAL A;  3W5Z A;  1U1O A;  2E1A A;  3T5K A;  4M5I A;  1RTD B;  2CUY A;  4OJG A;  4FS1 A;  4B9U A;  3THT A;  5EN1 A;  2H1Y A;  2MQN A;  1JJC B;  4Y2M A;  3KHL A;  4J9S A;  2UXC J;  3VGU A;  3DXS X;  2EK1 A;  4BHQ A;  2VFT A;  4C11 B;  3SCK E;  4NLO A;  4BWM A;  2FLN A;  1B0V A;  2BA9 A;  2QA1 A;  4C8Z A;  1RHM B;  3DCA A;  1VRU A;  2DH7 A;  4PEO A;  5KAK A;  5DDR C;  4EBE A;  4ER8 A;  4KKO B;  1OSD A;  5IQQ A;  4DFJ A;  1JKH B;  2J8S A;  2HND B;  2UXB F;  5E3P A;  4F3Q A;  4QWE A;  3MFI A;  4O3O A;  1N6Q A;  3RRK A;  1BQM B;  2JFK A;  4LBP A;  3SQO P;  2XY5 A;  1NDL A;  1U6Z A;  1RWW B;  5AXL A;  4WFX A;  3M8S A;  1R8H A;  3HCX A;  2GSO A;  3D66 A;  1IXK A;  1XNR J;  4J9P A;  2BXJ A;  3NCP A;  4HAC A;  5DJB A;  3OL6 A;  2J0X A;  2W4C A;  3MMA A;  4X2B A;  3ZO7 A;  3MED B;  5IQ6 A;  4B9M A;  2ZDO A;  1D0E A;  2IYI A;  4DCO B;  5AJ3 J;  4DR7 F;  1E6Y B;  4EWT A;  1N0V C;  2DHG A;  4KFB B;  1IQZ A;  2G13 A;  3FBC A;  3GPA A;  1CJT B;  3ENQ A;  3OTD A;  4LSL B;  4ZP7 A;  4CZC A;  1E6V A;  4DF4 A;  2N3O A;  2NQP A;  2VA2 A;  4ETZ A;  1HBM B;  2V8V A;  3CMQ A;  4CO0 A;  1HW8 A;  2BV3 A;  3MMJ A;  1TKT A;  4JYA F;  4B3S J;  4XO0 A;  5B0E A;  1T9Y A;  3CCW A;  4ZVF A;  3ZTP A;  4LF5 J;  1TL3 A;  3UQS A;  3A52 A;  2EXU A;  3D9B A;  3PIP Q;  1VRT A;  1NO8 A;  3AD8 C;  2QSW A;  2ZH4 A;  1SKS A;  3R2D J;  1N4L A;  5IJS A;  4WXO A;  1R89 A;  4RW9 A;  1F3F A;  3WQP A;  3VAF A;  3T1Y F;  4OHX A;  3PRD A;  4KIA A;  3HVT B;  5BYS A;  4NYP A;  1U2F A;  1EB0 A;  3HVT A;  4HT7 A;  5B0G A;  3VVU A;  1VIO A;  3C16 A;  3CDE A;  3EXY A;  1FDA A;  3BH6 B;  3V4I A;  1FRX A;  3UVJ B;  2FLL A;  1RE1 B;  4YHH F;  2H5I B;  3EUN A;  3UR3 C;  4RU9 A;  2K3K A;  4NEY A;  4AXI A;  3FBB A;  2EG1 A;  3OHB A;  3RB6 A;  3IDD A;  5K14 A;  2HBR B;  1YIT S;  2BJ8 A;  2Y8W A;  5IV4 A;  2GO9 A;  1ZS6 A;  5EHH A;  5DM6 Q;  4CXS A;  2C2Z B;  4ZJQ A;  1Y7A A;  1RAE B;  5HVH A;  2CQP A;  1T9T A;  4HH0 A;  1N5Y B;  1QLN A;  3MEG A;  3BGL A;  3OHA A;  3VAI A;  3NKO A;  1U26 A;  2N7Y A;  4DV5 F;  1S1X B;  5H9F K;  2BAC A;  3N4W A;  4Y0F A;  2A18 A;  3HFV A;  4KT0 C;  1EJJ A;  5KT6 A;  1SKR A;  4N7T A;  1F2H A;  1PAE X;  1XR6 A;  2YQ0 A;  4ZLJ A;  3GJQ B;  4ZLN A;  3OJS A;  2YNH A;  3MOJ B;  1ZBT A;  1FK9 B;  2YH1 A;  3RR8 A;  4PQU B;  5EGE A;  2CQD A;  3CJ5 A;  4MK8 A;  5CYM B;  5I3Q A;  2NZC A;  2ANH A;  3AHP A;  1FES A;  3A8E A;  4RNM A;  2KFY A;  3BBC A;  1N2L A;  4ECQ A;  3SSS A;  3EZ5 A;  1KFD A;  3SCL E;  5KFS A;  4CLT A;  3PKM A;  2Y1J A;  1DFD A;  1SC1 B;  4ZJL A;  5A2Q Y;  3M2U B;  2KYZ A;  1Q5Y A;  1RZM A;  2R42 A;  2J7U A;  2OKQ A;  4M95 A;  1R8P A;  1X4C A;  1KHK A;  4JI7 J;  3F41 A;  4KGK A;  3TWZ A;  1VQ8 S;  3NXZ A;  3Q89 A;  3QT5 A;  1A0O B;  4K4S A;  2LFV A;  5CZV A;  3HHN B;  5EGH A;  2EC0 A;  4NWX A;  2OAU A;  2POK A;  1R8A A;  4ECR A;  1LKZ A;  2RIL A;  2YWK A;  4PWD B;  3I87 A;  2X1F A;  4O3Q A;  4DL0 C;  1Y9O A;  3NY0 A;  2HIY A;  4Y2A A;  3MUR P;  1DQ9 A;  4PAB A;  2F4V F;  4CI0 B;  5K5M A;  4RW9 B;  3HHL B;  1R0B G;  3O5T B;  2QTW A;  4KM4 A;  2E66 A;  2IY5 B;  1YJ7 A;  2OD4 A;  3TQE A;  1MSW D;  2JOQ A;  2DO0 A;  3NGT A;  2CQH A;  5CAA A;  8AT1 B;  4Y2I A;  5J2Q A;  4NXN F;  5DDP C;  4ZKA A;  3A1Y G;  3GU0 A;  3GJS B;  1RT3 A;  2O3D A;  1SVD A;  3Q8U A;  3DLG B;  1RTI B;  2B9E A;  2VC0 A;  3OFE A;  4DPT A;  3J80 Y;  4OJH A;  4WZM A;  1NZ8 A;  2CVI A;  5ETV A;  3CVK A;  4OIX A;  4DQS A;  4XIU A;  3P5T L;  2VH7 A;  1G6B A;  1ELX A;  2VFU A;  1YJN S;  1AUS L;  1D9F A;  2QA2 A;  4ZVU B;  1UPP A;  2QL9 B;  4DN0 A;  4DFP A;  2UXD F;  3IS9 A;  5CH7 B;  1RI7 A;  1FKO B;  3TW0 A;  1S1V A;  4ZVT B;  2ASD A;  2C2R A;  1LWF A;  1AYE A;  2PA8 D;  3OTO F;  2MEW A;  3GV7 B;  3MED A;  4G6V B;  2AYE A;  1S1T B;  1OS5 A;  4F4Y A;  1PG5 B;  4R8U A;  3W5Y A;  1E3C P;  4JI5 F;  2CJX B;  2F7V A;  2VUG A;  3MM5 B;  2DYA A;  2CFX A;  1RHR B;  2BRL A;  2PMW A;  2DIT A;  1C4C A;  3T1H F;  3IO1 A;  4LRE A;  2HPU A;  5MAO A;  4LF5 F;  2M3D A;  2GZO A;  4PXB A;  1V5V A;  4ED5 A;  1U49 A;  2H4Y B;  5F3T A;  4ZMM A;  4A46 A;  4B9T A;  3DMJ A;  1T94 A;  2JH3 A;  2OPP A;  4PXC A;  1F0X A;  2WAQ D;  1WTB A;  3LF0 A;  4FNI A;  3T1Y J;  3KK3 A;  4H4M A;  3M8P B;  1RCX B;  1NK0 A;  1KWM A;  1XR5 A;  3OVB A;  2JC1 A;  1K1Q A;  1AFI A;  1IJE B;  4L76 A;  2JVO A;  3D68 A;  1E1Z P;  1XIQ A;  1H0H B;  2OPP B;  1PYO B;  3I4P A;  3D1Q A;  4FNH A;  3PDN A;  3K89 A;  1TZ0 A;  1RTD A;  3C6T A;  5DGB A;  1OWX A;  3H20 A;  2R7U A;  4QW9 A;  4OI0 A;  4WE1 B;  4JI1 F;  1BQN B;  3CF5 Q;  5KT2 A;  1VC0 A;  2KRR A;  1RT2 A;  1DAR A;  2KH9 A;  1T9W A;  3V2U C;  4CNZ A;  3LAK A;  2J7K A;  3DOM B;  5D15 A;  1HW9 A;  1S5Z A;  3W61 A;  3EYZ A;  2NSB A;  2W7A A;  3H2U B;  1B0T A;  4DOZ A;  1N32 F;  1RAB B;  2CPY A;  3NWG A;  2PE8 A;  1BUX A;  4YDX A;  2DRB A;  2X1A A;  1N32 J;  4F2R A;  5CCM A;  4JI4 J;  1ELO A;  4L73 A;  4NLD A;  5JUM A;  4I56 A;  1R6Y A;  1FKO A;  4TLQ A;  2QO3 A;  2G1D A;  3GZ7 A;  4Z37 A;  3KLH A;  3JXO A;  3BQ2 A;  1TK5 A;  1DQ8 A;  2EG2 A;  4C2M A;  4WZQ A;  2ZIT A;  4WFY A;  4A8F A;  2E5G A;  4XPC A;  1VQN S;  2Y9H A;  4M94 A;  2ZBC A;  4DR2 J;  3EZO A;  2BBE A;  4DCP B;  4LT6 A;  3IRX B;  5GAD I;  1GFW B;  2XLI A;  2DR9 A;  4X4V A;  2VG5 A;  1ZM2 A;  2C3O A;  4P7V A;  3PFO A;  1YDL A;  2NCK L;  4IQM A;  4LF8 J;  1MU2 A;  1W7W A;  2KXF A;  2A3J A;  2PSZ A;  2W1B A;  3W60 A;  4DL5 A;  4ECS A;  3O1L A;  1NK5 A;  1NSK L;  4GVB B;  3HSG A;  2KT3 A;  3KNG A;  4TQS A;  3KLI B;  5KFH A;  2DGX A;  1AJC A;  1KQF B;  5LIA A;  2LCW A;  4J7C A;  2X3D A;  5KG6 A;  2CQ3 A;  2IHR 1;  1TV6 A;  3OPK A;  2W8K A;  5ETT A;  4UTG A;  1U25 A;  1U2C A;  3CJ0 A;  3CCJ S;  2ZNZ A;  4I7F B;  3QRQ A;  5LL6 d;  4DN9 A;  4USU A;  1IKX A;  4ECV A;  1EQJ A;  2CYY A;  3A4T A;  2HZA A;  3D54 A;  3OSN A;  4DL7 A;  2RD5 C;  2VD3 A;  1OPI A;  1XWL A;  5CAB A;  3SZ2 A;  1DZ5 A;  4BDP A;  4JV1 A;  5FDL B;  1TU0 B;  1Y10 A;  4UT4 A;  4UPH A;  4DLG A;  4GRS A;  4DV6 F;  4V19 X;  1WHY A;  2H54 B;  1S79 A;  1U6B A;  4I67 A;  4WFA Q;  1YZ6 A;  1IKX B;  3PM9 A;  2MDA A;  2FTR A;  3U7J A;  1RAG B;  5DDO C;  3GB0 A;  3DN9 A;  5CZX A;  1KOO A;  5MLC V;  4N76 A;  4KC5 A;  4LQY A;  1TKZ B;  1XR7 A;  1Y5N B;  2DNM A;  2RQC A;  1RA6 A;  3CGI A;  4PKD B;  3L3C A;  2KZM A;  2LYV A;  3R5A A;  4I0W A;  4RW8 B;  1HYS B;  1C0U A;  1VGY A;  2WBR A;  2RQ4 A;  4F04 B;  1P49 A;  2MB0 B;  2K8G A;  3HFZ B;  2XC9 A;  2CJK A;  1AZS B;  2COL A;  4IG0 B;  5GAD U;  3ZC4 A;  3DKD A;  5IFM A;  3LXQ A;  4Y28 C;  1XN9 A;  3T00 A;  3T5L A;  2DGS A;  4K50 A;  1JJH A;  1IJF B;  2EFV A;  3N01 A;  4CLK A;  1N88 A;  2H3E B;  2I1R A;  1RGV A;  2OUG A;  4MT1 A;  4U8Y A;  5J2N B;  2N7C A;  2HYI B;  2QLW A;  5HLF A;  2A10 A;  4B3O A;  4JV5 F;  1SC3 B;  2D1G A;  3P49 B;  2CQC A;  1EQM A;  2DNH A;  3HD1 A;  3NMR A;  3IRW P;  4TU9 A;  2EBG A;  4DV4 F;  3IGV A;  3T9N A;  2FC8 A;  4RU2 A;  1OY9 A;  4ZVE A;  5GOV A;  5LT5 A;  1X7V A;  4DV4 J;  2KVI A;  4L3N A;  2A6O A;  3K5L A;  4IOA Q;  1JXL A;  4KAV A;  1JLA B;  2DVI A;  1LWF B;  2AJ1 A;  1DTQ B;  3VAK A;  1X4E A;  3MPV A;  3T6B A;  3WDO A;  4CTA A;  4KSE B;  1AJA A;  3IAS 9;  3WAY A;  1WKL A;  5GMD A;  1YKW A;  2GVD B;  3H2L A;  2XLJ A;  1JLB B;  1RT6 A;  2UV8 G;  3C8Y A;  4P2X A;  2OTJ S;  2MHE A;  4RW7 A;  1NSP A;  1OQ6 A;  2OPR B;  4LFB J;  2LQ5 A;  3TEH B;  5DG8 A;  4ECX A;  2QL5 B;  2XMM A;  3R5D A;  2W8L A;  3ZFV A;  4RNO A;  4LFB F;  2AYM A;  4HH1 A;  2JZ5 A;  4K8R A;  3ISN D;  4LUB A;  2OEM A;  5U47 A;  4U7U K;  1QUP A;  5F8H A;  4C9D A;  1JJ2 R;  2IVY A;  3GQC A;  3D28 A;  3UO0 A;  4OI6 A;  3M8Q B;  1IKV B;  3E8O A;  5LSL A;  1HYS A;  3TYT A;  3OUY B;  1KH5 A;  3KJQ B;  1UFL A;  2AZ1 A;  2RT3 A;  5I42 A;  4BS2 A;  4WF9 Q;  4GTY A;  2F8M A;  2GHV C;  4C8N A;  1S0O A; 
#chains in the Genus database with same CATH homology
 3IGY B;  3BDG A;  5L0K A;  4B56 A;  5AJ9 A;  5HRT A;  2IFY A;  3IDD A;  5K4P A;  5DLT A;  2VQR A;  4KAY A;  4CXK A;  4UPI A;  1O99 A;  1ZED A;  2GA3 A;  1FSU A;  3WBH A;  2ZKT A;  4LR8 A;  4CXS A;  1Y7A A;  1KH4 A;  1K7H A;  2W5Q A;  1HDH A;  4UPL A;  1ZEF A;  3NKO A;  5L0E A;  2IUC A;  4FDI A;  1ED9 A;  1KH7 A;  3M8Z A;  3MK0 A;  3M8W A;  5KXA A;  1EJJ A;  4N7T A;  4YR1 A;  1KH9 A;  5EGE A;  3UN3 A;  4LRD A;  2ANH A;  1N2L A;  4UOR A;  3WAV A;  5INH A;  1URA A;  5L0B A;  1SHQ A;  4KJD A;  1N2K A;  1AJC A;  2QZU A;  5LIA A;  1SHN A;  4GTW A;  3IGZ B;  1KHK A;  3NVL A;  4UOP A;  3TWZ A;  3UN2 A;  1KHN A;  1Y6V A;  5EGH A;  2IUC B;  1KHL A;  1AJB A;  2XR9 A;  4NWX A;  5LQQ A;  1EQJ A;  4ZG9 A;  3BDH A;  3B5Q A;  4FDJ A;  1ALJ A;  3CMR A;  5DLV A;  2W5W A;  5C66 A;  2W8D A;  4UPH A;  1EW8 A;  4LR2 A;  4LRA A;  4NWJ A;  4KM4 A;  1ELZ A;  3DYC A;  3BDG B;  3WAX A;  3T02 A;  2GSN A;  5GRR A;  2W5V A;  3DPC A;  1ANI A;  3NKQ A;  1KHJ A;  1E33 P;  3MK1 A;  3Q3Q A;  3ED4 A;  4UPK A;  1P49 A;  2GSU A;  1ZEB A;  5LRM A;  4ZG6 A;  3LXQ A;  4LR7 A;  3T00 A;  3NKN A;  3M7V A;  1AUK A;  1EI6 A;  1ELX A;  2W5R A;  3TX0 A;  2D1G A;  4LRF A;  1ALH A;  1ED8 A;  1HJK A;  4MHX A;  1ALK A;  2GSO A;  2W5X A;  5GOV A;  3UNY A;  4LR9 A;  4UOO A;  5LRN A;  2RH6 A;  4CYR A;  4KAV A;  4QAX A;  3TG0 A;  1O98 A;  1E3C P;  2G9Y A;  3MK2 A;  3NKR A;  1AJA A;  3UN5 A;  1AJD A;  1B8J A;  3E2D A;  3NKP A;  4MY4 A;  3SZY A;  1EW9 A;  1EW2 A;  3WAW A;  3WAY A;  5DLW A;  4LRE A;  2XRG A;  4MIV A;  5IJQ A;  4KJG A;  1ELY A;  3M8Y A;  4CXU A;  1ANJ A;  1E2S P;  1HQA A;  3OT9 A;  4CYS A;  4ZG7 A;  3SZZ A;  2W5T A;  3A52 A;  4GTX A;  1ALI A;  2X98 A;  4LRC A;  2W5S A;  3T01 A;  5IJS A;  3UO0 A;  3NKM A;  3BDF A;  2W8S A;  4LQY A;  1KH5 A;  1E1Z P;  2GLQ A;  4TN0 A;  1URB A;  4GTY A;  5TJ3 A;  4LRB A;  3KD8 A;  4ZGA A;  4GTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...