3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
1KH9A 1KHLA 1URBA 4KAYA 1HQAA 4CYSA 4LRDA 4ZG6A 4ZGAA 2G9YA 1AUKA 3Q3QA 3SZYA 2W5RA 2GA3A 3UN5A 3SZZA 3NKQA 4YR1A 5LRNA 2QZUA 1AJDA 4LQYA 1EI6A 5L0EA 3OT9A 5TJ3A 1KH5A 4QAXA 5GRRA 1EW2A 3NKNA 5K4PA 1HDHA 4GTZA 4ZG9A 4LR7A 4MY4A 4UPIA 4LRAA 4KJDA 5IJSA 4UOPA 4UPHA 1E33P 1ZEDA 1FSUA 5L0BA 1ANJA 1O98A 1EW9A 4GTYA 4MHXA 1ELXA 5DLTA 3WAWA 5LIAA 1ELYA 3BDHA 3WBHA 4LR8A 2XR9A 1B8JA 1ZEFA 4TN0A 1KHJA 4LRBA 5INHA 3NVLA 2X98A 4ZG7A 3M8WA 3UN2A 1N2KA 4UORA 4LR9A 2IUCB 1ELZA 3BDGB 1KHNA 1O99A 2IUCA 1AJCA 1ED8A 3BDFA 3BDGA 5LQQA 1ZEBA 5C66A 1KH4A 1Y7AA 1N2LA 3IGZB 2GLQA 3WAYA 2W5SA 4LRFA 3NKOA 4GTWA 1ALHA 2RH6A 3TWZA 4CXUA 3MK2A 4GTXA 4CYRA 2ZKTA 1AJAA 3NKRA 3B5QA 2W5VA 3E2DA 3ED4A 3TG0A 5AJ9A 5IJQA 3CMRA 1AJBA 2W8DA 3UO0A 4UPLA 2D1GA 1E1ZP 5GOVA 4LREA 4KAVA 3NKMA 4UPKA 1E3CP 1ALKA 3KD8A 3M8ZA 3T00A 3MK1A 4CXKA 2W8SA 1URAA 4CXSA 2GSNA 5LRMA 5DLVA 4FDIA 3UNYA 1HJKA 5HRTA 2W5WA 1E2SP 3IGYB 1K7HA 3TX0A 4KM4A 4NWXA 1SHQA 1Y6VA 4LR2A 2VQRA 3WAVA 2W5XA 1SHNA 2W5TA 3MK0A 3A52A 5KXAA 1KHKA 1EQJA 2IFYA 3IDDA 4NWJA 3T02A 5DLWA 4UOOA 1KH7A 2ANHA 3T01A 4B56A 1ANIA 4LRCA 1ALJA 5L0KA 5EGEA 4KJGA 3UN3A 3M8YA 4N7TA 1ED9A 2XRGA 3WAXA 4MIVA 2GSOA 3DYCA 3DPCA 2GSUA 1EW8A 1P49A 3LXQA 1EJJA 4FDJA 1ALIA 2W5QA 5EGHA 3M7VA 3NKPA
chains in the Genus database with same CATH superfamily
1FRKA 5EWFA 2UUBJ 3PW4A 2AJ0A 2VA3A 2NUHA 4OHYA 4YFUA 2WHOA 3M4XA 1WNEA 3H4BA 3OR2A 4ZP7A 2L08A 4TY8B 2B4UA 4GTYA 3HK2A 4H4MB 1TV6B 1SBRA 2HZAA 3BSOA 3Q2TC 3UVJA 1FNXH 1V3ZA 2R4FA 5B0EA 1DRZA 2HWHA 5AE1A 4U7CA 2WRMA 3QJPA 4ES1A 1OSDA 2D1CA 2UVWA 2GMJA 2B4PA 3U27A 2NQPA 3ZZTA 3GFYA 4F25A 2XS2A 5LJ3Y 1LWCA 4K4WA 3IR6B 4ZIVA 2YWKA 1HMVA 4P7TA 2ZBPA 3FFIA 3W63A 1JX4A 1FA0A 1RT6A 3EGVA 5DLWA 3B4DA 4OZJA 4OQJA 1RBAA 3FQLA 2GSOA 1WDDA 2K7KA 3PW2A 4L72B 3LALA 1PJ7A 2CKWA 4ZGAA 4JI6J 4DUYF 2ZH8A 3GSDA 5A0YA 1YITS 1N34J 1D0EA 1TAQA 1XMBA 3DMJB 3NKNA 2CPJA 2LEAA 2EFPA 3D1HA 3NP5A 1FNOA 1XR7A 1QVGR 4CO5A 3GIMA 4HHUA 2E5JA 5ETRA 4L6V3 2CDRB 1HD0A 1REVA 4M5DB 4NCGB 2AEMA 3BO3A 2EI5A 4X4NA 2V8PA 2HVDA 5L9XA 2XI3A 2ZHBA 2MSSA 4RW6A 1SJQA 4CLTA 1EP4B 5GVQA 1R8AA 3K5NA 2FHJD 4DSFA 5HATA 2GSNA 4NCAA 1SV5B 3FRYA 5IM0B 3IR5B 2LXUA 4ZKAA 2W5TA 3KHHA 4J5OA 3IRXB 5LM7E 2HHTA 4J9KA 3PRBA 1HHSA 5FDLA 1HIYA 3EUNA 2GQ2A 4I1TA 3MWBA 5GADI 3VQSA 4GVLA 3QYYA 4HKQA 1MROA 2XZDB 2B4VA 1NZAA 2GW8A 2PO4A 4LRDA 4FNIA 3GV8B 1U1NA 4NLYA 4KSEB 2W8LA 1X9SA 3LPEA 2HEKA 2HWIA 5AXMA 4IO9Q 1TMMA 5KFMA 4WXWA 2PA8D 2N4DA 2CJBA 4F4AA 1MN7A 3M8RA 2OSRA 2P6TA 5HVGA 4CZCA 4QR2A 1J5OA 4NZ7A 3QGGA 1TP7A 4HHJA 4LR9A 1RGVA 2UV8G 3AXKA 1S59A 3TP2A 5K14B 4NRUA 1RTDA 3RBXA 2HW3A 3VVTA 1NO8A 4FS2A 2WONB 1UTAA 3VWSA 2J9EA 5D3GB 1TKZB 5BYQA 4PPZA 4QOTA 5F0WA 5KFDA 1JKHA 1LXNA 2F8EX 3IDDA 1BHNA 1SJFA 2ANHA 4PXEA 2VQFJ 3KLHB 3OFEA 4OI0A 3K17A 4USVA 4I6WA 4DCOB 2I5JA 4LF6J 1W26A 4ZG6A 3PFOA 5HBMB 2JFKA 2YQ3A 1UWBB 3MFHA 4CYSA 4MKYA 2W5RA 1CS4A 3OXFA 2X1GA 4D3HA 3OFFA 2CPDA 2CNOB 2RS2A 1SL2A 1XERA 4Q0BA 3VZHA 1X31C 4G1QA 1AW0A 4LF5F 3TAPA 4EZ6A 2M4MA 4JI7F 1FDBA 2MDAA 2NR0A 4QR0A 4F3QA 2E9TA 3CJ4A 3IC1A 4UORA 3KK1B 3CC4S 4QZVB 1KQKA 4DSKA 1Y7AA 4WU3A 3HSJA 3SDEA 1F5CA 4AD6A 1ZA1B 1RISA 2Z2ZA 3BBCA 2B3TB 3U1LA 1JQGA 1WACA 5HLFB 3NWRA 1YKWA 2E5HA 2D3ZA 4KB7A 2YPZA 3V81A 2W9BB 1S48A 5C25B 2KN4A 2CQPA 2OH2A 4M5MA 5DZ6A 1YQHA 1RTZA 2HIYA 3MAQA 4B9SA 1VHFA 3DOLB 7AT1B 2HBRB 1RUSA 3EXCX 3BGRA 2KDOA 1VS3A 3SYZA 2V69A 1JLCB 1C4AA 1AB8A 3J7A1 2V4JB 1N36F 3W9HA 1XNRJ 2J9DE 2K8GA 3FGVA 1LW0A 1OYDA 2KM8C 2F4VJ 3ILLA 4ZVTB 2EKYA 4AL5A 5IT9U 2GV1A 3KXDA 1SL0A 4AQYF 4DQQA 3JSBA 2W2MP 3ENWA 2VOOA 3N9UC 5E3RA 4FBUA 4RUHA 1M1GA 4OJ3A 3GPAA 3CDBA 2GFFA 3AA9A 3QZ7A 1CEZA 3KD8A 2YKQA 3RR7A 4X66J 1QSYA 2BEFA 2AKWB 4R8UB 3MM5B 4FPIA 2YKMB 1O5JA 1OPIA 4RNNA 2OPRB 1WOSA 3DLKB 4PQUB 1UP1A 1H73A 2R7RA 1K8AT 3AOCA 2XO7A 5DDPC 1HNIB 1Y3JA 3MEGA 1IKXB 3B54A 4C8NA 2PA3A 2W8KA 2I0XA 2V5HG 3RYLA 4IH5A 1DARA 3GCXP 4ID5A 2MKIA 1TMJA 2LQBA 2XO6A 3G8SA 2JEGA 5IS2A 2KVIA 1PYOB 1HWIA 1V6HA 3OHBA 4OV6A 3GFZA 2IM0A 9ATCB 4M1KA 4EZ9A 4CXKA 4I7FA 1X4BA 3GFHA 3GSIA 2XGQA 2LQ5A 3CCQS 1T95A 4ECUA 1AA1B 2XZWA 2RHQB 2KL8A 1VOMA 1U6BA 2ILYA 3M8YA 4U6PA 2BZ2A 2CPZA 2E5IA 4J91A 1RB0A 4I68A 2Z56B 3BYRA 3D1OA 3Q23A 1L3TA 2CQ2A 2HAIA 4M5JA 2XMJA 5ETOA 4G6VB 2C2ZB 2AJFE 2PEHA 2AGPA 1BQMB 1KTQA 4O44B 1QTNB 3BQ0A 1FFWB 2VG6A 1WOOA 3VHQA 2ZZMA 4YB6A 4WFAQ 3OTEA 2L9WA 2HHXA 4TLRA 2VFUA 1Q16B 3EPIA 3TRGA 1LWEB 3RB6A 1QAYA 3UD4P 3TYTA 1RAEB 5KFTA 1SVDA 4I56A 5MLCV 1UVIA 2XB2D 2E1AA 5ETQA 1IQTA 4LF4J 4Y28C 4NLUA 5GADU 2RF2B 3CDAA 3N01A 1DLOB 2BE2A 3D0IE 4CO3A 4LIRA 4X62F 3MMAA 4ZN1A 2WB1D 2XMUA 3JAMY 4QWAA 1U6ZA 3PR5B 4RW7B 2LVWA 2JVRA 2HNZB 3KK2A 1M5SA 4P52A 2ZH1A 3P5TL 1JJHA 1JLEB 3DNCA 2CZVC 1TK0A 2GJ2A 5JXSA 2KRBA 3UR0A 1LWFB 3LGNA 1XBWA 5HVFA 4CLFA 2B9WA 2WCXA 1F5AA 2IC3A 4YR3A 3T1AA 3DHXA 2O1PA 4PYAA 3LP2B 4N41A 5F8GA 3I5AA 3KJQB 2BM0A 2GHWA 1FVSA 2LFVA 2HWTA 5C24A 3FMBA 4ETXA 5E5NA 1UFKA 4WBFA 2ZDOA 3QRQA 1T9TA 4PUOA 1AJBA 3UO0A 5HAOA 4JI4J 2JDJA 2XYGB 4KHPF 4UPKA 1WF1A 3CD6S 2MZ1A 3C8YA 5KOWA 2KT2A 1S1UA 3OL9A 2AEFA 5D0RA 1FKOA 1S1TB 1RJJA 3D6TB 2HQ3A 1F3VA 4WTOB 1QSSA 4PXBA 4NMXA 5H1SV 1P49A 2FJXA 5HMYA 3JTOA 3DI6B 5KFSA 1ELOA 1QUPA 3R3TA 3T9ZA 3O8WA 4C8LA 5F8IA 2GGPB 3C14B 5HMWA 1BQNB 1YWXA 5DDOC 1RHUB 3EVWA 2BXJA 2VB6A 1IBCB 2VIHA 2E5LJ 1SQFA 2M7SA 2ZUGA 4C3KA 2MKYA 2W01A 3UQSA 4ZLNA 5CXTA 2AD9A 4DR2J 1OY8A 1N33F 1SL1A 2ZZTA 3W2WB 1IBLJ 1X4HA 3O44A 4O3NA 3OV7A 4YB5A 4B9NA 2UVRA 2AU0A 1RA7A 4J37A 2AMCB 4B3OB 4UOCA 2V67A 4U95A 3M6UA 3CCLS 2QA1A 2MLYA 1U8SA 3T1YF 2HFVA 4ZPAA 3DLGA 1SHQA 3A3OB 2VH7A 3TAMA 2LECA 1SXLA 1KQSR 5HVHA 5KT7A 4GO7X 4IYQA 2Z30B 2KYZA 3P6YC 5L0KA 1M1KT 2ZBRA 4WFXA 3BR9A 2FHJA 4MIVA 3TUIC 2W7AA 3ZTPA 2W9AA 3CF5Q 2J7WA 1QJHA 4XDDA 4OV1A 1KLNA 1REGX 3CCUS 5J2PB 3G9CA 3DOKA 3C16A 2V4RA 4KO0B 1J27A 3UVJB 5A2QU 1KR4A 4DPYA 1PCAA 4OLPA 2M52A 3JSMA 2E5GA 1ICEB 4TN0A 4XDCA 3RU0A 3OTBA 3QSIA 3HP6A 4KPCA 5J2NA 4HI2A 3PV8A 2V2VA 5K8OA 5LMUJ 4L3NA 2RQ4A 2QMUB 4DX8H 5ETLA 1VQ5S 4WPAA 1SI9A 1CJTB 4XAKA 3CJ8A 3JS9A 2BV3A 2XQCA 1F9EB 3Q8VA 1KH7A 3R5GA 5GMKa 4B56A 2VJUA 4NRTA 2DIUA 1E6VB 5J1NA 1NRKA 2WVDA 1WG5A 1TKXB 2UVVA 2MHEA 4B9VA 3KLIB 3W8PA 4ZJLA 4WTYA 2LEPA 2CJKA 2IMOA 4EEYA 3IM8A 4DUZJ 1IJFB 4H4OA 1YBUA 1RT5A 2NUUG 2HHSA 3ZZ0A 4UPIA 2PI4A 1Q8BA 1FSUA 2B6AA 2CG4A 2I6WA 4RZRA 1D9FA 3TQ1A 3HHEA 2YX7A 4DPWA 4HTJA 4EUVA 1VQPS 5HP1A 3KLFB 3MHYA 4ZJOA 3FRZA 4JI1J 4P2MA 1KWMA 3PJ9A 1I6JA 4OYOA 1Y7PA 4ERDA 5AXNA 1P6TA 2BKPA 2VFRA 1OO0B 5GMDA 2QL5B 3FQKA 3KJVB 3IWXA 4DPOA 2VJVA 3M2RB 3DCAA 1K7HA 4F2RA 3J81Y 2FLPA 3TARA 1BWVA 4F3MA 4XPCA 1HHTP 2XZTB 4PCQA 3RG6A 4DDFA 3Q8YA 3BGUA 5LMNF 3ZZUA 3CGIA 5CYQA 3EICA 2CPIA 2KFNA 3DGVA 1VC0A 1EARA 4EBDA 1WG4A 2W5QA 4NASA 4USJC 1RABB 5T7LB 1RAGB 4YHHJ 3DKDA 2QEXS 3M8PA 1TELA 2NZ4A 1YGYA 2HRTA 3MMCA 2ZM6J 4URGA 1L3VA 4Z7YA 1N5VA 2ZH7A 4B3RF 2CQBA 4RWXA 1K47A 1U02A 1NK5A 4PWDA 2YNFB 1W7WA 5C42A 3WAWA 1NJYA 2NYIA 4UY85 5DETA 1NSPA 3IAS9 1FD8A 3CCVS 1C1BA 1SPBP 2YTCA 3Q2SC 1KS2A 3T1HF 3H5XA 2DY9A 4HH0A 1P1LA 4DQPA 2POKA 4EO8A 3HHDA 2H5EA 3O1LA 2W8SA 4YR2A 3MR7A 2I5JB 1NK7A 2Y1IA 2K3IA 1BGXT 1M1HA 2XWXA 3HPOA 1N32J 5DZ7A 1MU2A 1CS4B 5IZHA 4RNHA 3B8HA 5A8WA 2I9SA 4DPXA 5KFLA 1RTHA 1F2GA 4NI2B 2QE5A 4G1QB 5L9NA 1WG1A 3VF0B 4WFBQ 3GONA 4H4KA 5DQIA 5FIIA 1S9GB 3PR4A 1H6KX 2V9KA 3OJSA 3HSDA 3NRBA 1M0SA 1AJDA 5T41A 2C2DA 3RRGA 2CPFA 4XPEA 2V63A 3AJDA 1MLAA 1ANJA 5JUMA 1PKUA 2BVZA 3BDHA 1WF0A 2QFJA 1KVJA 1S1VA 3DXSX 1IBKJ 3CC7S 1BY9A 2Q6BA 4USIA 5HQLA 3N4WA 4LFCJ 4UPLA 2KZZA 5JVGQ 4R5PB 2Y9HA 4X4UA 2D3OR 2KKHA 2LDIA 4DPUA 1A6LA 1ZAXA 2HBZB 4DL2A 2FGCA 1I94F 3WAVA 3PZPA 5E41A 1UEUA 4RR5A 1NH7A 3I0RA 3K5OA 4ZPCA 3R8YA 4O3SA 1UPPA 1NSAA 3A13A 1JLQA 1U2FA 3NS7B 1PIEA 3ENQA 2G9OA 1K1QA 2IMWP 3DDIA 2DH7A 1S0NA 4DV2J 5AJ3J 4FF3A 3RW7A 3CCSS 4LJMA 1T05A 4OLOA 2P8IA 3S01A 5K9FA 3R6LB 4OHWA 5BR8F 4DR1F 3BQ1A 3EWGA 4URSA 2C2MB 3MTKA 4DR7F 4E2FB 1ZS6A 1SJ4P 2JVOA 2B9XA 4I0WA 3PRVA 5B0BA 4KQZA 2UUWA 2K3KA 3TO8A 2HS0A 1QAXA 3ENVA 1QLNA 1HNVB 4M63A 2VF3A 3B5QA 2E1CA 2OELA 2E1PA 3QIPB 1KLMB 3MM6A 4DSJA 4ILMA 2YNGA 4X4RA 4JI5F 4GKKJ 1NSKL 1ALKA 3RJMB 2XULA 5FLXY 1GXTA 5J2QA 3QT8A 2CFXA 2RILA 3KG0A 3DLJA 4LF7F 2WAQD 5HI7A 1KQFB 5J1EB 1N5QA 3PEHA 4MYUA 2UUAF 3IM9A 2AV5A 4ID5B 2VG7B 2APOA 1UETA 1U6FA 4Y2CA 4NMLA 2Q43A 1X5TA 3ZXWA 5RUBA 2N4CA 4IG0B 3WBHA 4DV1J 2K06A 3HJFA 3AXMA 3CB4A 4AL7A 2VKZG 1SKWA 4IFVB 4F67A 4J9QA 4NLTA 4QBUA 2D9OA 4XIUA 3LP1A 1RHKB 2BX6A 3H7HB 1R8HA 5AJ9A 1T3OA 5EN1A 4KFBB 1E1ZP 2RUGA 2Q66A 4IH7A 3B82A 2GVDB 4AUKA 3OVSA 5EUHA 3GIRA 4XK8C 4DR3J 1P1TA 3CJKB 2J6TA 2LU2A 2B5JA 1R8BA 5I3QA 1U45A 4F26A 2R2UA 3W66A 2B4OA 5ETKA 2K1RA 1UMJA 4DZDA 4QYZJ 4X84A 3EX7B 5ETVA 1RAOA 3I87A 1S1XA 4A47A 3KDNA 1E6YA 4ZVFA 1CULB 4N47A 5L1JA 2MMYA 1L3UA 2A10A 3SCLE 4TXSA 5I3UB 1EW2A 4CLZA 1VBKA 3SI8A 5IJSA 5D15A 2JNJA 3MCOA 1K73T 1HBOB 1ELXA 3THVA 1F5BA 3K7RA 3ILOA 4I64A 3HD1A 2CDQA 1PO6A 4ECWA 1RTJB 2ZBIA 2KU7A 1VBZA 1SC4B 3OUYB 2G0JA 4X64F 2QV6A 1Q4RA 3IR7B 3KK2B 3ISZA 2E7VA 2PFFB 2UV8A 3BBBA 2HBQB 3TNVA 3PNIA 4JV5F 3I9V9 2YNIA 1HBMA 1T03A 3C66A 3WIVA 4NX9A 2B51A 2KZMA 4LQ3A 3BDPA 2L9DA 4QU7A 3GG0A 2B7CB 1ED9A 4UOGA 2DRBA 4K4YA 3NGDA 5CH7B 1RHMB 1YK9A 3C15B 3KJNB 1JLFB 1FJCA 4NXNF 3R5BA 5ETNA 2D3UA 3F41A 3WZ0A 4DR5J 2BRLA 2BJDA 3BGOP 2MZTA 3OFGA 2GVZB 3SZ2A 3MMJA 2C3MA 1RLCL 2R8IA 4DV6F 2IJNA 1VGYA 4QWDA 3CJTA 3C6UB 1RT1B 3R5DA 3FCHA 3J80Y 3T5HA 2CQ4A 1S0MA 3DRSB 4LR8A 3MECA 3SQGB 2OPSB 1XEZA 1DTTB 3J81j 2HFOA 1NDLA 1ACMB 3DLLQ 3KWMA 3UR3C 1NZ8A 1YRUA 3BDGA 3RTVA 1IKYB 2F9JA 4OIXA 1N6QB 1UFWA 4KAIA 1EQMA 1UA1A 2HK2A 1I1GA 4OYZA 3OL7A 4AFFA 4DFKA 1ZH5A 1ZTTA 3W60A 2MXYA 3H40A 3T5KA 4TNOA 4F0KA 2RDIA 3LAKA 5KXAA 2G13A 2FY8A 2Q3PA 5A6PA 3I6PA 2K2PA 2V2KA 3OLBA 4TU8A 4EK2A 2CIMA 4ZS6A 1QM9A 3C19A 3AD8C 3CT9A 2XI2A 1ALIA 4NLQA 2WBMA 4PABA 3I0SB 3ENAA 4TN2A 2HRUA 4Z37A 4HT5A 4NA1A 5LRNA 2QFIA 3KUHA 1ROFA 3Q8RB 4LFAF 1URNA 3EE3A 2H48B 3BDEA 3EMTA 4KY3A 3HSZA 1B8JA 2XR9A 1UPMB 2FY1A 3IP0A 2XNQA 3TQEA 1LFPA 4UT4A 3WAYA 4W90B 2M3DA 1RAAB 4K2XA 4GTWA 4ECQA 1HWLA 2FHKA 3N6MA 1QTMA 5KTQA 4YN3B 1LK5A 4LVNP 2PDAA 2X51A 2W5XA 1H7XA 3I4HX 2EXUA 5DDRC 4OI6A 2F4FA 1RT3B 1RA6A 2HG4A 1U1MA 3DU6A 4LSNA 2DISA 1CQMA 3LTOA 4NL5A 3D6MB 3K59A 2UU9F 4BBYA 2QZUA 2MZRA 3HVWA 1NDPA 1VQKS 2U1AA 2F1FA 3MZIA 1FXRA 4FYVB 3GYXB 4M5LA 3US5A 5ETSA 4PPDA 4IDKB 4R0JA 4H4MA 2I1RA 2NLWA 1HNXJ 4RKUC 2D41A 3SV3A 3SCKE 1ZEBA 4C7QA 3NS6A 1WC6A 5L1KA 4U7UK 1S76D 4A8YA 3QAUA 2LCWA 1MWZA 3W61A 2DNYA 1FK9B 1Y10A 1EQ0A 2XY5A 3UFCX 3BH6B 1Y6VA 4KRWA 2E9ZA 1YJUA 2ZJPQ 2EFQA 5IOLA 2IIHA 2ZH4A 2FJVA 4H4OB 1YG0A 4JI6F 3H2LA 1RT5B 3HFVA 1OMSA 4D3GA 1S6UA 3WC0A 2VC0A 2V94A 2HVHA 3KLGB 1PYSB 2M8DB 2FVSA 5J2MB 3PO4A 3OLAA 1LV5A 2R8KA 3D68A 1HL6A 4C8OA 3VR1A 2CWKA 4CYUB 1VRUB 3W5YA 1UVMA 4EI2A 1FKPB 3EGNA 4NXMJ 5ETMA 3FVYA 3UN2A 1FRJA 3BDFA 3L9ZA 3D5MA 4M5DA 4NCGA 4DV3J 3KG4A 3T41A 1AUSL 4X65F 1NXIA 4OX8A 3NKYA 4U96A 4QYZK 3ED4A 5DG9A 3G6XA 2RRAA 2XEXA 1RTIB 4NEYA 1XC9A 4OYIA 4USWA 4HT7A 1SV5A 1NSQA 2DIVA 3GU0A 5IM0A 2C28A 4C0OC 1KC8T 4F0MA 3A12A 2MJNA 3IRXA 1ZPWX 4KKOA 3N5FA 4ID8A 4A8SA 4LRCA 3B6BA 5CZVA 2V8VA 1UEVA 2RQKA 1X4EA 3LUYA 2XMMA 4PWDB 2VFSA 4WF9Q 3LH2S 2YNHB 3CD0A 2EKNA 5I3PA 4J9OA 2GA3A 1EJ7L 2B8PA 4KGKA 2VZ9A 3GIKA 2LU1A 4P9SA 2HKEA 1T3NA 3DU5A 1DQ9A 1SIZA 1DQAA 4P2XA 4DN0A 1VBXA 5LIAA 3H90A 5KFCA 2AW0A 4F4YA 3CNQP 3M8WA 1N2KA 2IUCB 4BLGA 1KOHA 2V6AA 2WSFC 4DF8A 1WKKA 1LFWA 3MR5A 2RH6A 4Y2IA 1RWXB 5K14A 4HTIA 2OTJS 3NKRA 5IV4A 2JWNA 5CA5A 3DHWC 3AY0A 1FFSB 4ITSA 1H72C 2WONA 3OVBA 2VQFF 5D3GA 3RW6A 1TKZA 4K5RA 3NGSA 2HHWA 3MM8B 1JJ2R 3L3CA 1F9FA 3O6QA 4ZPBA 2RNEA 5C2GA 5L39A 3A8EA 5HBMA 3UWTA 2XYHB 1AYEA 1UWBA 4DI6A 3NKQA 4ED3A 3G2XA 1S1VB 3ZNJ1 1FRHA 5MAOA 2KM8B 1UFLA 4DG1B 3DLHA 3W2VB 2MY7A 3FNNA 4LRBA 5D4PA 3KK1A 3R27A 3U1MA 4U8YA 4OZ2A 2BW2A 2J5AA 2CPHA 1HLWA 3E2DA 1JLQB 3H0PA 2Y1RI 2G2ZA 4BCAA 2BJ9A 4PG8A 5HLFA 4IOAQ 3KFWX 2BKOA 2RRNA 3R5CA 2ZWPA 2W9BA 1U25A 4OHZA 5C25A 2FJBB 3LWMA 3ZFVA 3NXZA 2X3GA 5L1LA 4B3TF 2FLOA 1RT4B 3DOLA 4XO0A 3D0HE 4XTTA 1GQEA 1OY9A 1JLCA 4DSIA 4GVBB 2V50A 1YZ6A 2L41A 3D54A 1TUWA 2V4JA 3VCDA 3DLEB 3V6JA 3ZTSA 4YDDB 1UW9A 3M8QB 1O98A 3FUYA 1EW9A 5KG2A 2V2QA 2H5IB 1SC3B 2OUGA 3PW0A 4YB1P 4X66F 3OVAA 4HEA9 3DDNA 2HFZA 3H5YA 2CPXA 3V4IA 1FO1A 3MDFA 3PCOB 4R8UA 4LF5J 3MM5A 2HS3A 4JI7J 3S8SA 3LAMA 3VGUA 3K5LA 1TK5A 2YKMA 3ZZYA 1LEOA 4DS5A 1FT8A 2KT3A 2KYXA 3OSPA 2W1BA 5KG6A 2OPRA 3EGWB 1VR6A 1AFIA 2EFVA 1RDRA 5EX0A 4PQUA 4ZK7M 3ILIA 4USTA 3CCMS 3CJ2A 3GILA 1N0VC 3SZZA 1FKAF 4FKYA 4RNOA 1RK8A 2HZVA 3RRHA 4A8XA 2ZOFA 3P49B 3QBCA 6AT1B 2AJ1A 1PSDA 2GMLA 2EK1A 1E33P 2M70A 1TL7B 2HNYA 3FEZA 4OI3A 3BSNA 2DGOA 5E33A 2B8QA 1DBDA 3OTCA 2YPYA 4NLVA 2JLEA 5D6GA 1RCOB 5B0FA 4USKA 2ZH2A 3BEGB 3MUMP 1OPZA 1CC8A 1RWNB 2HBYB 2LA6A 3AT1B 3MOZA 5EHHA 1HW9A 5EDWA 1S97A 3RGIA 3C6TB 1N36J 4WFYA 2OI2A 5DDQC 2BW7A 3P4UB 3V4MA 3WQPA 5DLGA 4DV4F 3M2UB 3M9OB 4F4KA 4CDIA 2DBBA 1QE1B 4AQYJ 4MKVA 3R7BB 2DVIA 4I2PB 1Q81T 5E3AA 2DYAA 1H2VZ 2UXCJ 1YJ7A 1GEHA 2GHVC 4LQYA 5KG7A 2XS7A 4QAXA 1RWOB 1BQMA 1QAJA 2FVRA 2VG5B 2VV5A 1DTQB 5B0CA 3GJSB 2XS5A 3IA0A 4ZVOB 1C1CB 2VD3A 3CEDA 4CWBA 2BABA 1WI8A 2DHAA 2NXCA 1MMLA 3A1YG 3LW5C 4CNYA 1D8ZA 2QYCA 5B08A 2GAHC 4O0NA 1B64A 1LWEA 4ECZA 4K4TA 2J7KA 1YI2S 5LSOA 5BJRA 1XR5A 1NMEB 1HPZB 3TZYA 1Q8IA 2LQ8A 2RF2A 1DLOA 4WFNQ 3KMQA 2XC9A 5E3CA 3KK3B 1IUJA 2B9EA 3T01A 5KOXA 2SXLA 4RW7A 3ONQA 2JEIA 3AQPA 1JK9B 1RAFB 4HI1A 4B02A 2W2PP 3M6XA 3K2YA 3MPDA 1U48A 4JBCA 1JLEA 2DR6A 1KBRA 3ISND 4QPXA 4CLUA 1LWFA 3X1LB 1Y11A 2DNOA 4CLSA 4LF8J 4LUBA 2DHHA 4DL6A 3F0NA 1MMNA 2DB1A 4JP8A 3CE8A 5D0HA 3LP2A 1GMUA 3GP9A 2XY7A 3MPUB 4UTGA 3ELHA 4MJKA 4CT9A 3VV2B 1Q79A 4FXWA 4IR1A 3M2VA 1ALHA 5K8MA 2RVJA 4CYRA 3M32B 4FYYB 1NM2A 1B70B 3TW0A 4UQTA 4KAVA 2JEJA 1FTCA 1VQMS 3ZZZA 1N52B 1R31A 2ZC3A 3CDEA 2ACMA 5BXIA 1PC4A 1MMDA 2V8GA 5B7WA 1FERA 1GX6A 2OIHA 1S1TA 5F8NA 5GAHI 3M1VB 2ZD1B 3MI7X 1S10A 1Y4ZB 2W2QP 1G6BA 3PY8A 2Z2MA 1G4CA 5F9LA 2JC0A 2E5LF 3NNHA 4LFBJ 2G1DA 3DI6A 2RMLA 2KHCA 2KXHA 4K0KJ 4DR2F 3C14A 1BQNA 1D8YA 1R8PA 3V6DB 3IS9B 2FVCA 8ATCB 5DM7Q 3AOBA 3K8WA 2JSXA 3QNWB 1T9UA 2MQ8A 1IBLF 4Y2KA 3PKYA 4X62J 5E0OA 2CNLB 1S72S 1GMWD 3NCRA 2PC6A 2JEFA 3PX0A 3W7BA 4ED7A 3WBZA 4PQAA 4RUCA 3W2WA 4YY3F 3PIOQ 2FD2A 3KDOA 1RP5A 1AJCA 2EK6A 3NKOA 2DR8A 1HFEL 3H5UA 3HD2A 1KHWA 5K5MA 2AF6A 4K7QA 3TG0A 1CLFA 4B3OA 5JJBA 2XWYA 1GMVA 3CJRA 2FQQB 4YDXA 1SB6A 2BANB 2Z2LA 2HGLA 1LKZA 4TYBA 1K0VA 3LPYA 1E2SP 2AJ2A 2HGNA 1NB7A 3R9LA 1NK8A 1UEKA 3JXOA 3CSKA 2FJAB 4A46A 5IWAJ 4B17A 4E0DA 1OQ3A 1U4BA 1S6OA 3G6VA 2GQQA 1F1BB 4O4RA 4YR0A 3GIIA 5J2PA 3D28A 3L09A 1QVFR 2BA9A 4KO0A 3DRPB 2CQ3A 4ZP6A 1TFYA 1KOOA 5SUHA 2VOPA 3AD9C 1X8DA 3IGNA 1TUGB 1NKBA 3KNAA 2DR9A 4KHMA 1S77D 5SZTA 3HHLC 1WTBA 4PG4A 4NLOA 4FNHA 1K44A 5D77A 2X7IA 3FBFA 3JAMU 4ED0A 3IO1A 1RU1A 5F8MA 1NDCA 4FN5A 2LQJA 3IWNC 7FD1A 5HROB 3WC2A 3KYLA 2ZFHA 4IG3B 3GYNA 3GQCA 1N33J 2LKZA 1CJTA 4MIBA 3K8VA 3PW5A 3G4SS 2EBGA 5EWGA 2Z4PA 3NLCA 4DV7J 3DXBA 4HDGA 4YS2A 2OD6A 4KV8B 4ZPDA 2XY6A 1GH8A 1E6VA 3MM9B 4WXOA 5CABA 4OYWA 1TKXA 2OJ3A 1EJJA 1AROP 1W2BR 3Q24A 2XYPB 5A8KB 1HYSB 1EB0A 3K0JA 3KLIA 1MWYA 1ZA2B 2XMTA 3RZAA 3BREA 2NSCA 2G1HA 4GKJJ 2RKIA 3TJ8A 2YKAA 4JI1F 1HQUB 2ATLA 1VISA 1RACB 1HWUA 3HI9A 4C11B 1NB2A 5A8RB 2HSEB 2OFGX 3D6FB 3KLFA 2HGMA 1YVFA 1KH4A 2QG9B 3A8KA 5THWA 4ELTA 3L7UA 1RZMA 4KKOB 2QLWA 4TLQA 4ANEA 1V5VA 4R0EA 1ZAVA 3GFXA 3NKMA 1C4CA 3KJVA 3M2RA 3QAEA 4PG6A 2J6SA 2ASLA 2IRYA 2AGQA 4WP3A 4DUTA 4PRFA 1WEZA 3F73A 1Q8KA 2OKQA 1NK0A 2IDEA 3RUBL 1FEEA 2C3UA 1X0FA 2PSZA 1WF2A 3F44A 4FPRA 1N5YB 1FXDA 4EU0A 2HRYA 3TZZA 4DX6A 4O3RA 4NLSA 3K5MA 1LNQA 1S6QB 5T7LA 2MSTA 2KFYA 4ATNA 3NGKA 4ZVHA 4UZBA 5KT3A 4EBCA 4PWWA 4MK8A 2U2FA 1CBKA 2H4WB 1R89A 4B9UA 1ZZNA 2OPQB 2YNFA 1XMOJ 1FFGB 2FPHX 1KEKA 2J6UA 2IVYA 1HR0F 1WSVA 4I6AA 2MZQA 1X4AA 2FTRA 1ZBTA 1BLUA 1YX2A 4F7VA 3QLHB 3JTNA 1NPKA 4F4ZA 2IYIA 4ZVUB 4L75A 2CQ1A 3DDKA 2AP6A 1HARA 2P9GA 2DGUA 5GOVA 4ZCKA 1FI4A 4HH1A 2R2TA 3LOUA 2HMIB 2HFNA 3I4PA 3J7Z5 2M0GB 4HHHA 1FRIA 2DNPA 1WDTA 3FC9A 2QT7A 3PEJA 3EGZA 1Q5YA 1FNMA 3ULHA 5D78A 4ZITA 3JYTB 2MQLA 4UY8T 2ZJQQ 2Z0GA 4JI3F 1WD6A 3TA2A 4CT8A 4NI2A 3HZGA 4ENOA 1S5ZA 1Q8LA 3VGVA 1A7GE 1OWXA 2A2DA 1KHLA 2EG2A 2ZVIA 4EMDA 5DRKA 3EZOA 1JMTA 1S9GA 1UL3A 1GT8A 3K58A 3JSYA 3S6EA 2HHPA 3MPWA 5KFKA 3EM1A 5DS7A 5DG7A 2RB7A 1MN9A 1EETB 4FXVA 1KQGB 2JLGA 5D4OA 4DLGA 4MKBA 2C2RA 2BKNA 4CO2A 4FYXB 3VAHA 3RAMA 2AYGA 3Q22A 5LMNJ 1KHJA 3G96A 4LFCF 4DR4F 5G0RB 2AYBA 2RIJA 1GTHA 1LW2B 4ECRA 3N6NA 1UCNA 4L76A 2R3VA 3Q8UA 3TWZA 5A76A 3PDNA 2UVUA 5GAHU 4KE5A 4MK7A 2AEJA 4R5PA 2JC1A 3T00A 1FX4A 2H5JB 5H9EJ 4B3RJ 2QTWA 1YJ9S 3CCWA 4LVOP 2XMVA 3AB4B 3PG9A 4ILRA 2HZCA 3FEXB 2NSBA 2PFDA 4OX9J 4WWSA 4M8LA 4ECVA 2GZOA 4AE5A 5KFNA 3D0GE 5KFYA 3J7AN 2DH9A 1S4FA 1SQGA 4WKYA 4QIWD 3A3NB 1HQEB 1JLAB 2RDJA 2KT5A 3KG1A 3ETMA 2XLIA 4ELVA 4E98A 2FIUA 4B3SF 4UPHA 1CJVB 1T9VA 4J9UE 3SQOP 1N0UA 5KFEA 3SSSA 1NK9A 5E7OB 3J81U 3RB3A 3V4IB 3VGSA 2BJ8A 1NPPA 1RWMB 4X4SA 2OMLA 2YWGA 3UI3A 3GJQB 2BJ1A 1G1XA 3EZUA 4ZN3A 4P6QA 4F3OA 1HNVA 1S6PB 3QIPA 1KLMA 3EDRB 2BE9B 1URAA 1TKDA 2F8MA 3DOMB 2W5WA 3MR6A 2B9YA 1PAEX 2AWZA 1N48A 4IH6A 1YHQS 3TAQA 1VQ4S 4UW2A 2W25A 4JYAJ 4B9LA 1ZM4A 2F5GA 2ADBA 1NLKL 4NA2A 2P6SA 4N56A 2DRAA 1B0VA 2XRGA 1L3SA 5J1EA 2GQCA 2HNYB 2DCUB 3OXGA 1XN9A 1CJUB 1S1WB 2VG7A 1KVKA 4V19J 4YR1A 4WP9A 4EGLA 2EEYA 4KGMA 1I94J 5L46A 2N82B 3F56A 4NWBA 4UOPA 2ILZA 3DLBA 3DGPA 5LJ5Y 3OW2R 2DCLA 4Q43A 4IG0A 4MHXA 1RKIA 5CCLA 2QYGA 1SJRA 2CQHA 5IT0A 1FCAA 4EWTA 3JQMA 3C3LA 2C1EB 4BS2A 4IFVA 1S9FA 4KGXB 2DNNA 4PYDA 1S0VA 3CMRA 4RO0A 4KFBA 1YSJA 4ZLPA 4QIVA 4QU6A 4TY9A 1KP6A 5BR8J 4DR1J 2GVDA 3AFGA 3BQ2A 5DLVA 1F6TA 3BPSP 4P71A 3L7OA 4NLDA 1RWVB 3CJKA 2BQRA 1WEYA 4DR7J 4A48A 2FDNA 3CJQA 1B4SA 1HBNB 4LF9F 4RBUA 3T02A 1VDHA 3GR0A 1J2VA 4CNZA 1M5PC 1FD2A 3QFWA 2XSFA 4RW8B 1R0AA 4KYZA 1VLOA 2BJ3A 3CPWR 2AGOA 4JI5J 3CMES 1CULA 3KUEA 4PXDA 2VHGA 2XMWA 4NCBA 5I3UA 2JL9A 4DQIA 4ZVGA 3UDEA 2RU9A 1DAXA 3SV4A 1HBOA 1KFSA 1JXLA 1X4FA 4LF7J 1IR2A 3FZ2A 4O3OA 4ZP8A 3NVLA 2I2YA 2B43A 5BYRA 4OI2A 1RT2A 1U1PA 1RTJA 1DURA 3DYAA 4WFZA 4QW8A 4QR1A 2H9ZA 2E1MC 1ZAWA 3RAQA 5AXKA 2ZKTA 1GFWB 3OUYA 5K8PA 2QX0A 1GMWA 2RU3A 2DY1A 3MAAB 4NWXA 1FDDA 3X3UA 1X60A 4RNMA 2J9DA 4QWEA 3DFEA 1U24A 3EZ5A 1DHMA 4EO6A 3MM7B 4J9MA 3PKMA 4YMEA 4OZNA 3IRWP 3JTPA 1R7IA 4ZPTR 3C15A 2VICA 1JLFA 4Z2XA 3PTWA 4MAKA 2VPXB 2IM3A 5KFAA 5KFJA 1KH5A 2GVZA 1L3KA 2RQCA 1PG5B 1Q7LB 3M2VB 2QO3A 1NDKA 3G8QA 3C6UA 1RT1A 4FZVA 5FLXU 4RW9B 3DRSA 2COLA 3SQGA 4OYXA 5INHA 2MZJA 2OPSA 2UUCF 1DTTA 3H42A 1H3DA 2ZOMA 4DQRA 1T0TV 3VGTA 3H25A 1IKYA 1N6QA 2IA0A 4G65A 1HNZJ 1IN0A 1RE1B 2AJ4A 2LQ9A 3M05A 1X5OA 1YJWS 3OSNA 2CQ0A 2YXLA 1J5EJ 2FC8A 3PACA 1YIJS 3D6HB 2F7VA 1VHIA 4DMZA 1UA0A 3QFHA 2HQIA 4N77A 2WVCA 1X5PA 4WYWA 2I38A 4LBPA 5F8HA 4CLYA 4JI8F 4C8ZA 3MD1A 4PWUA 4J9RA 2E44A 2ABYA 3R1HA 3P8BB 5KG1A 3TVZA 2OO4A 4N7TA 3AQOA 4B08A 4FDJA 2QLFB 4B9MA 3E3XA 4X4QA 1W25A 3I0SA 2FHMA 4X64J 1ZM3A 2FVPA 3IG1A 3ETOA 2UP1A 5D4LA 3FSYA 4KIAA 1NJXA 4JV5J 4TQRA 1AZSA 3TA0A 1QD1A 4DXLA 5H9EK 2KHDA 5F41A 2DHSA 1T02A 2DKOB 2AIRB 2R7TA 4ED6A 1U26A 2RRBA 3TX8A 4DR6F 4F0HA 2A1BA 4NOHA 2ALYB 2MKJA 2IBKA 3I32A 4NLXA 1HNWJ 4MK9A 1G7CB 2FHOB 3CD5A 1V3RA 3SSQA 4NXNJ 2ZBQA 4ZPWR 4C3LA 3HFKA 1IM4A 2ZE2B 3MEKA 2N7YA 3FK4A 1GXLA 4W98A 1HJKA 5FJ4A 2EFOA 1NHUA 4BWMA 4DU8A 1KDNA 2KO1A 2DD8S 2RT3A 4K5SA 1P9YA 4RX6A 1YJVA 4W4MA 4KJGA 1RT3A 4M5GA 2CJQA 2EBEA 3QRRA 3QWUA 3CC2S 2DHXA 4RBVA 4CH0S 3EYZA 1TK8A 3QGHA 1PYTA 4KHRA 1BUXA 4ZVSB 3KTQA 3N0VA 4QIGA 3ZZRA 1N5TA 5K4PA 4QYRA 3CTRA 2NS1B 3PJWA 3VAGA 1HNXF 1DFDA 4ZJQA 2D7SA 4NA3A 4A8QA 1HWKA 4IDKA 4Y3CA 2D69A 3PW7A 1APSA 2IM1A 4LBIA 2QGFB 4OL8A 3FZBA 3HULA 5HK4A 5I4MA 5KG3A 4IRDA 4DFPA 4P75A 5HQMA 1VC5A 3BM7A 1Q5VA 2CZ9A 2LMIA 3NGTA 1K1SA 2ZBCA 3BYPA 1WORA 2DNGA 2OEJA 1E3CP 3CCES 1FK9A 2XGPA 3QATA 2IJRA 2LYVA 3R2DJ 4LFAJ 2JFDA 2VA2A 4RWWA 4CO0A 1VQSA 1VJWA 4DFJA 1KSPA 4KJIA 1HI8A 5HJYA 1TR0A 2EC2A 4ED8A 1V5IB 3CDWA 1TTHB 2ZHAA 1SJ3P 4CP5A 2F40A 3MCMA 3J80U 2R7XA 2RKIB 3OPKA 2WVFA 1PAUB 5EGHA 2DO0A 4JV1A 3KLGA 3OXLA 3IBWA 1VQLS 5J2MA 3JB9k 2CRLA 9RUBA 2DR5A 4GC6A 2Y8WA 2NYHA 3H2UB 2HIQA 4KH0B 5KFWA 4GTZA 2ATCB 3CIZA 2CQIA 4JV0A 4DV3F 4CYUA 1VRUA 2W4DA 8AT1B 2HHHF 1H2UX 3ET6B 1JWWA 3QMQA 1FKPA 2NPIA 4DV0F 1R3NA 3OJUA 2CPEA 2UU9J 1Q53A 1NPRA 3KJFB 2CJAA 5L1IA 4PAAA 1RTIA 3BR8A 4ZMMA 3FDSA 2R7VA 1FDAA 3D2WA 1LQ9A 4LR2A 4NLWA 3IN5A 5LXYA 1R6YA 3P3DA 3U02A 2HHQA 1AXQA 1VQ8S 4CLWA 2FLNA 6FD1A 2K7JA 3LANA 3ADAC 1SIWB 1ZTWA 3AJ1A 2W4PA 1D9DA 2YNHA 1U1KA 4MYTA 4FXDA 5LOQA 4M5IA 5KFIA 2LDYA 1DY3A 1FRLA 1YRXA 2ROGA 1Y5LB 2VPYB 4H54A 3C2PA 1D3WA 3RB4A 1HW8A 3MUVP 2E7WA 2HQDA 4P74A 1OYEA 4YQWA 2P9EA 4ALZA 4MIAA 2D74B 2IUCA 2AX1A 1TKTB 4U8VA 2O67A 5K8NA 3Q83A 2W24A 2XSJB 4P73A 4JI0F 4CXUA 4DOZA 4U9RA 3GJRB 3G6YA 4O3PA 2R2SA 5CQGA 4LREA 5E3PA 3MPYA 2EPIA 4N8OA 1I3OB 3I55S 4DL3A 2W2NP 2MLXA 4NLPA 4LT6A 3CJ5A 3MM8A 4ECTA 2ADCA 3GLJA 2KFZA 5DG8A 4P2FA 4JB8B 1VQNS 1UJ4A 3MTJA 3NG8A 2MQNA 2HS4A 3HX9A 1XTZA 1C0TA 4X65J 3LXQA 2KG0A 1EIYB 3Q86A 4J9SA 1SH0A 2OD4A 2H54B 2BQ3A 1TZ0A 4ZIWA 5KT2A 2FJEB 1XNQF 1OY6A 3CW2C 4DG1A 4CTAB 3FJ2A 3W64A 3W2VA 5KFRA 3NGUA 2FVQA 5M2UA 4NYZA 4ZVPB 1VC6A 4DCJB 2R7OA 3PIPQ 3TUZC 2OFHX 1VMBA 3I5CA 3QWPA 2ZVSA 3ITHB 1ELZA 2HNDB 4DV5F 5LQQA 2AYEA 2NZCA 3LP0B 3HMJG 2KXFA 4OZ0A 4F4XA 2F3JA 4GTXA 5D0GA 1JIHA 2YKNA 4ICLB 3P5BP 2UXDF 2MKHA 4ELUA 2CADA 4DJBA 3OTOF 1RAJA 5M2RA 4ZHRB 4M94A 4K4ZA 3BPDA 2KG1A 3HT3A 3LF0A 2HPUA 4KC5A 4DL4A 3AOAA 1RT4A 3PX6A 2JJ4D 4Q2LA 3PHEA 5KFUA 1XMQF 5GAEI 3BGLA 4GVBA 2QMWA 1T11A 2L3MA 1HQ2A 4KJDA 2H1YA 2AJQA 3DLEA 2E66A 3ILJA 4IFYB 3M8QA 1FVQA 2NREA 3MURP 5DLTA 2R7UA 4LSLB 5I42B 2CJ9A 4IOCQ 1B0PA 3TUPA 1ED8A 1JXVA 1P9QC 2WVEA 3GZ7A 1C0UB 1GTEA 5HANA 1QY7A 4EFAC 2PMZD 3DN9A 4DWIA 2IYGA 3DRYA 2MPUA 1PC5A 3HVAA 3AAWB 4OYBA 3BJYA 2MHNA 3QT6A 1EQJA 2C2NA 1EHWA 2GS8A 4UOOA 4IR9A 2QLJB 5LSRA 1AFJA 2N7CA 3KLVA 3DGPB 3V5RA 3SFGA 3GYGA 4MFBB 1YBTA 4LQ9A 4F8RA 2WVBA 3MEDB 1KONA 5T14A 2V8HA 2N3OA 3GB0A 3DM2A 3R7NB 4I2QB 2R8JA 1FJGF 4H4KC 2ZJRQ 1RWUA 3I5BA 5IQQA 1TL7A 3IMQJ 1ELYA 4PG5A 1IR1A 3OHAA 4B3TJ 3JQJA 2GLQA 4FBTA 4DCPB 2DNMA 2DTJA 3PX4A 2IRUA 1RHJB 2DXEA 4TKTA 2OPPB 2JH3A 3ZC4A 3C6TA 5J1PA 4OHXA 4OJGA 1GNKA 3G86A 1R0AB 4CH7A 3M2UA 1Q1KA 3C46A 3T3FA 4IUFA 3SXLA 2CVEA 4NE9C 3MUTP 1VK3A 1BE4A 4E8UA 1VRTB 2BDPA 3OL8A 3CD7A 2UXCF 1QE1A 5DQGA 4ECYA 3CULA 4I2PA 1IBMJ 4B3MF 3WDOA 1HKAA 4KAYA 3WIUA 5AT1B 1MNEA 4Y0FA 1S9EB 3OFHA 5DO2A 2P9CA 4DHVA 3JQKA 1BQXA 2FZGB 1UVJA 3DRRB 3NBPA 1RT2B 4F4WA 3V6KA 3TEGA 3DYAB 1FWLA 4QIFA 4ZG9A 2VG5A 1DTQA 4QCLA 1C1CA 2C2KB 3QO9B 2PIIA 2QN6B 2HAFA 1YTYA 2HFSA 1IKWA 2ACYA 2HURA 4ZCLA 2QL9B 4USMA 1HA1A 1EKRA 3QJLA 1V3SA 4LRFA 4HVZA 4F04B 1Y5IB 4CO1A 2WOMB 2GA7A 3AA8A 3QRPA 1A9NB 1IR0A 4IO1A 2GJFA 2DGWA 1HPZA 2J9CA 1G3OA 6FDRA 1NHVA 3RBDA 3IGYB 5CAAA 2OHDA 1RT7B 2G0IA 2DRDA 3KK3A 2KJWA 3FEYB 5ETPA 3FSIA 1URRA 4ZA1A 1HBUB 1ANIA 2FJWA 1OJ4A 4OZLA 3M8SA 4TU9A 2CQDA 3NGRA 1S7IA 1Y0HA 3M9NB 4OI1A 1GK8A 2AHOB 1NJIT 4LF8F 4KR0B 2CPYA 1FJ7A 2J8AA 4OYPA 2RE1A 1M5HA 4AXJA 1RAHB 5HJXA 4TYAA 1EI6A 3HDSA 4DV4J 3U1NA 2ZH3A 3O3LA 3HM9A 2ZUAA 3PRDA 3R6GB 3BB5A 2JHEA 4HLBA 1LOUA 3TA1A 5LSLA 2HFUA 1O99A 3I96A 1WC3A 5HMZA 4JI2J 2WSCC 2VODA 1H2TZ 4ZVRB 3POTB 1JLGB 1S49A 4WE1A 3ZTOA 2YWWA 3E8OA 3M32A 1QUVA 3RBEA 5E3QA 4ED4A 4ED2A 4DF4A 2Q79A 5LRMA 2KRRA 1XR6A 2VQRA 2IHR1 3R1LA 1MG7A 3M30A 3HVTB 4S0MA 2NXJA 4LFBF 3IG1B 2PMHA 4Z7CA 4I6YA 3M1VA 4K0KF 2ZD1A 2IAJB 3D3CJ 5KT5A 4CM2A 4YEAA 4X2BA 4WYLA 1AZSB 2GNKA 5CYMB 2EG1A 1N8RT 3T6BA 2IA6A 3U7JA 2GIQA 5E2QA 1MW7A 3EJMA 3V6DA 3IS9A 4C4WA 3THTA 1S12A 4Y2AA 1VIXA 1ZOTA 3HHLB 2W4CA 2UXBJ 1MWQA 4Y2MA 1ZEDA 1U2RA 2Q6CA 2DT9A 4QQBA 1UWAA 3GJTB 2VDIA 3GWCA 4WZMA 1RU2A 3MEEB 2J0XA 2YKOA 1N2LA 3VZIA 2ZHOA 2HHUA 3PHTA 5D4NA 3CCRS 3TI0A 3N6LA 4NPOA 2UUBF 1CVJA 1FEHA 5IXUA 2DGXA 3QIDA 3EVOA 2MQQA 1SUQB 3FBCA 3MK1A 4ZCIA 2BANA 1WHXA 1IKVB 3BV8A 5F9NA 5IWAF 2FLLA 2YKPA 4LBHA 3D7SB 4OJHA 2DNKA 2G2OA 4ZLJA 4CI0B 1MSWD 4K2JA 4UQGA 3CO0P 5GAEU 4K4XA 4I69A 4CQ1A 1CC7A 3DYCA 2V9WA 2MZSA 2W9CB 1KRPA 3TZXA 1KH9A 3BGFA 3AHPA 1AUKA 2MGZB 2XG8A 3UDLA 3T19A 2R7QA 1VQ7S 1RWPB 3Q8PB 1U0SA 2I8EA 4ZDNA 2VPZB 3DRPA 3H20A 2ZEJA 4CO4A 4FYWB 2AT1B 4Q7AA 5DGAA 3H4DA 4Q5VA 4HACA 3AJ2A 1VK8A 4BWJA 3OQ2A 2X98A 4QJVA 3TJ9A 1KHNA 1PBUA 3UD3P 1Q0NA 3W9JA 3W1YC 5CZXA 5K20B 1N5SA 1U0HB 2DGQA 2QZ8A 1HI1A 4DV7F 2J8SA 2VKRA 1YDLA 2ASJA 3KLEB 5HROA 1N34F 1U47A 3MMBA 2D3O1 1Q95G 3MPVA 1R43A 4IG3A 2QMXA 2WW4A 1TL3B 4JV2A 1T94A 2QA2A 1RCXB 3CVKA 4YY3J 4ES2A 2GHPA 1WJ9A 3FBEA 3R7SB 2DNZA 4KV8A 2VQEJ 3MM9A 2YY3A 2VPWB 2DJWA 2MYFA 4GKJF 1WC1A 5KG0A 4N8NA 5A8KA 1HYSA 2DHGA 2CJYB 4G1IA 1XQIA 1RYSA 4OHVA 2FB0A 3G8TA 1O0PA 1X7VA 5L0EA 3OR2B 5TJ3A 2O3DA 3UW1A 4LRAA 4NZ0A 4LIWA 4CH1A 4QW9A 1NHKL 2YWEA 2WK4A 2MKKA 2RH3A 1HQUA 4P7VA 4C8MA 3MR2A 4AXIA 3BF4A 1D9AA 2DH8A 2VU5A 1FESA 3K57A 1RADB 3QT5A 3UCZP 1YJNS 4C11A 5A8RA 1ZM2A 1WTFA 4F2SA 1BXNA 1UJ5A 2LEBA 3HO1A 2EW9A 2C2OB 1H98A 1N4LA 1KN6A 2YBVA 4BC9A 3VALA 1NH8A 3LQVA 3QSYB 5C7PA 2CYYA 1LWCB 1HMVB 3R5JB 4J9NA 3E01A 3FFIB 2RJZA 1RT6B 3QGPA 1S0OA 2XHCA 4DL5A 2O5DA 3MCNA 1M5OC 5KFPA 1N5YA 2JRSA 4RLEA 1S4EA 2BJEA 1JB0C 3IAM9 2J7UA 3PYFA 1URBA 2RQMA 7FDRA 1Q86T 1S6QA 3L4BC 5A0YB 5HL7Q 1XMOF 3OT9A 3G6ES 4J9LA 2XLKA 2HLTA 3NCPA 3GV7B 4RW4A 4DUYJ 2Z8QA 2JZ5A 5C5JA 2OPQA 2IY5B 1GX5A 1H74A 2OP5A 2V0NA 4WJBA 2X1AA 2VONA 1REVB 3NWGA 2NPFA 3QLHA 2VBYA 2VBZA 4LF6F 5IFMA 4HR2A 1A0OB 4C97A 1YJRA 2IVMA 4RW6B 3A8IA 4L74A 4G1PA 4AL6A 2ZDPA 2D9PA 1C0TB 1WI6A 2HMIA 4K59A 5ADZA 1WEXA 2M2BA 2PI5A 5IT9Y 4Y34A 2DPJA 1VQ6S 3VTIA 1T9XA 4Y00A 3JYTA 1TVRA 5FDLB 1Q7YT 3CWJA 2OGUA 1RKJA 3NAIA 1HHQA 4P72A 2ZNYA 1MROB 1TL4A 2XHWA 4DS4A 3M7VA 5KFZA 1SCJB 5H9FJ 3THPA 4C6AA 1WUUA 2VUGA 4ILLA 4WCEQ 3BKFA 3J7ZT 4Q2MA 3TVKA 3Q8QB 2F63A 1NUEA 4P2SA 1EETA 3FMWA 2UUTA 3TEHB 2VBXA 2IFXA 4KGVB 3I82A 3AH6A 4LF2A 5KFOA 2YKNB 1JLBA 2FUG9 4DL0C 5ITHA 1K9MT 1T9WA 1RBOB 1J5OB 1CG2A 2NCKL 5G0RA 4CRJA 3IGZB 4C8KA 5CCMA 1LW2A 3PVXA 1RTDB 2ZZNA 2GAGC 5IJQA 4YOEA 5F3ZA 4YB7A 2KTQA 1WSRA 3CIMA 2M8HA 1WKJA 4LMZA 4OX9F 3FBBA 1XNRF 1JKHB 4C3MA 1HR0J 3CCTA 2YVSA 2CQGA 2C42A 3MOJB 1KTVA 2E7XA 2F4VF 2P5VA 5EGEA 3BBFA 2DPIA 3G87A 2KI2A 1RAIB 3CMAS 2V2ZA 4C9DA 1I5OB 2E9RX 2DNRA 1ZM9A 1HQEA 1JLAA 3ZZOA 4JUZA 4Q0BB 1B7YB 3GG1A 3G71S 4QIEA 1B99A 1PJ6A 4LSZB 1CJVA 3VAFA 5F8JA 2IVFB 2MY8A 2Y3YA 1KHVA 2BBEA 3WHIA 1HI0P 4DBQA 2CAJA 4JI3J 3L7PA 3V2UC 5CHCB 1U1OA 3SDEB 1UZHA 5HO4A 3OTDA 1CSJA 4ECSA 2C3YA 4JYAF 1S6PA 3OR1A 4U7UD 4UZCA 2KVQE 3SMZA 4FDIA 3FSXA 3DOMA 3I9ZA 2VL1A 1KHKA 4A8FA 5KT6A 3V81B 5GAGI 3MD3A 3W9IA 3NOCA 5AE2A 3DM2B 3RAXA 4USHA 4DR4J 3DPCA 5IC6B 5JVHQ 2WTFA 1HD1A 1RQ0A 3BGRB 2XCPA 2HVIA 3QJJA 4RUBA 1VQOS 2G9YA 3KKFA 1CJUA 1S1WA 1SC1B 1FTRA 1UKUA 3SSRA 2HQGA 4DPTA 4MY4A 1H7WA 3D1QA 2CQCA 3FCWA 4MH8A 4C0BA 1BWEA 5L0BA 1LW0B 1U09A 3HHNB 2VASA 3BSAA 4UOHA 3SIPB 4BDPA 2YH1A 4HL9A 4O4GA 1SKSA 2Y1LB 5HMXA 4RBTA 5C66A 3NAHA 4DSLA 3TANA 2BQUA 4X4TA 3SEOA 1IJEB 4PKDB 2QSWA 1VYAA 3GE9A 2FJDB 4Q8FA 3NNCA 1G2EA 4AYBD 1UVLA 3MCSA 4B3SJ 1XJWB 2OSQA 1TL1A 1JJ4A 3BN7A 2BYCA 3EPGA 1KVIA 1O51A 4KPYA 1HBNA 1S79A 3GMGA 3NBPB 5BYSA 1CJKA 3K5PA 4DL7A 4OX7A 5HSPA 2MLZA 2QIFA 2DNHA 2BM1A 2RS8A 4RW8A 2YQ1A 1HQAA 3KOAA 3D4JA 4KBIA 3TVYA 1SKRA 1IKWB 4KGZB 1H38A 3MEGB 4QWCA 4LF4F 1IWAA 4OYMA 3TOQA 3AD7C 2C22A 3HT0A 2QRRA 4WIIA 4BC7A 2E29A 4TVAB 1M5KC 4A8MP 1X4DA 3AB2B 4ZVEA 1N88A 4TU7A 4FKXA 2W7OA 4DX5A 1KD1T 5F8LA 4RU9A 3WX8A 4F36A 1YRTA 2XTJP 4M95A 1L5UA 2R8HA 1VI7A 3D67A 3H59A 2B7BB 4QWBA 3UDVA 3BZQA 4GO5X 4A8KA 4USUA 1EKSA 5KFBA 3MXHP 4I7FB 5U47A 3MAAA 1OS5A 1WWHA 3HZEA 4I4BA 1YBAA 1KFDA 3AODA 4V1Ak 2ROPA 1JJCB 4IOBA 2NXEA 2GO8A 4CLPA 3MM7A 2MQOA 3QGIA 3HSGA 4FYDA 2ZKUA 2XLJA 1IXKA 3A3PB 3H5SA 1QDUB 1W2IA 2A0FB 1Y5NB 2GIFA 4UUXA 1VCTA 1U1RA 4JI4F 4HYKA 1HDHA 5B0AA 2DR7A 5B0DA 2VG6B 3IFEA 4LF9J 4WE1B 1HNZF 1RXOB 4MKAA 3B78A 2DITA 3PM9A 1ZYQA 4RW9A 3MFIA 3QT7A 1Y00A 2R42A 1J5EF 8RUCA 2B56A 2A6OA 3M30B 3UNGC 3N79A 5DQHA 4ZLLA 1BD6A 2B0GA 5A2QY 5H9FK 4ZCMA 3ZNUA 1NJWA 1X4CA 3TX0A 1UW4A 2BE2B 1TAUA 2Y1JA 1TUVA 3MMAB 4DQSA 1LXJA 3T6JA 3VAIA 2V8DA 5F0UA 1TQLA 5KT4A 3MR3A 1VIOA 1RBLA 1IVZA 5IC4B 1FX2A 1GXUA 4A8OA 2AYMA 1WKLA 2F8HA 2CWXA 3SZYA 2C3OA 4UOFA 3GIJA 4K8RA 2XNRA 4A4JA 2IC3B 4LR7A 2CG8A 2R9LA 4KH1B 1HNWF 1UVNA 2WBRA 2J0QD 1FE4A 1ZZFA 3LGHA 1UAWA 3M6VA 1EX8A 3UE2A 4WU2A 3PYDA 4J90A 2A18A 5C24B 5EWEA 4DZ6A 2Z2YB 1I51B 3M6WA 2W5VA 4PUOB 2ASDA 2D1GA 3BKTA 2ZE2A 2YH0A 2ROEA 1S1UB 3BN4A 1BMQB 3UNYA 2XM3A 3RB0A 3BSCA 4R25A 2BR0A 1FKOB 1JNRB 3OL6A 4KHPJ 4UUWA 2UUCJ 1ULRA 3CJ0A 1FE0A 3OBIA 4UF4A 1RI7A 4EYIB 4DSEA 4Y65A 1KKHA 1DJ0A 5KFFA 4HACB 1B7FA 3SCJE 2IM2A 1S7HA 5LMUF 3OD2A 5GMEA 2VFVA 2GJIA 1P27B 1JNZB 4JI8J 2DNLA 2MQPA 3FKBA 2CUYA 5DGBA 2FZCB 2BOPA 3RRKA 3MMBB 1ITPA 2BUNA 1NU4A 2AQ4A 3NMAA 2G2YA 1O6XA 1WC4A 4M5KA 3T5LA 5GAGU 1FRMA 3G82A 1AJAA 2NXNA 2JLFA 2GCFA 5FD1A 1D09B 4DUZF 3T5JA 3NCQA 2HQCA 3DLGB 2J0SD 1B3TA 2EFGA 2DXDA 2BMBA 2MB0B 4GRSA 3TAMB 1SKUB 2VC1A 1SQEA 3QZ8A 1RSCA 3P96A 3T1YJ 4DR6J 3ICLA 3TUJC 3HHLD 2XBPA 2CVIA 4PG7A 3EXYA 3NMRA 5IT4A 3DOKB 3C16B 3VAJA 3SCIE 4RU2A 1FWPA 1K0TA 3D9BA 5M2PA 4FS1A 3W8GA 3JSMB 3IWLA 3ET6A 2CNKB 3M9MB 2ZH6A 3PYEA 2F65A 4N5SA 3Q89A 2QSFA 4OYAA 5J2NB 2DK2A 3I31A 4B9TA 3O2IA 4NYPA 3E01B 4TY8A 4GMKA 1U2CA 2O66A 3CUNA 1F9HA 4YHHF 3NL0A 2M9KA 3VQTA 1TV6A 2GIRA 4CIOA 2GX8A 3VVUA 1PGZA 5LT5A 1GAOA 2ZM6F 2BOAA 5KFVA 5CD4H 3E51A 2A6MA 4M5HA 2ZITA 2DO4A 2EWHA 3UN3A 4K4SA 2V68A 3CCZA 3N5BA 4RW4B 4WP8A 3JSRA 2PN6A 1NCLA 4Q8EA 2C3PA 1SH2A 2JOQA 2OTLS 2NXUA 4ER8A 3HKZD 2A2CA 3GCWP 4X4OA 1RHQB 2B6AB 2PT0A 4WKRA 1SH3A 2PGCA 4FF1A 1N32F 2VBWA 3RBZA 3NNAA 5HP1B 2N3LA 2CNNB 5ETTA 3DMJA 1T8EA 2YX1A 1R8CA 1TKTA 1Z1ZA 2BACA 3N28A 2DGTA 2XSJA 1T9YA 3H2VE 1TVRB 3HHKA 4N76A 4PEOA 3IXQA 5AXLA 2IDLA 5CD4A 4TQSA 3VAMA 2OLWA 4P10A 5DJBA 4KM4A 2GO9A 2R8GA 4OX6A 3NS5A 2HHHJ 2CJXB 4J9PA 3HLUA 5LL6d 1VQYA 5D8HB 2YWFA 2R2RA 4JOUA 4Q44A 4DEZA 2OEMA 2LA4A 3MF5A 5CYQB 4IKAA 4DV0J 1EP4A 3WAXA 1TU0B 5KFQA 2QL7B 4OZ5A 4YP3A 1JLBB 1S99A 1IBKF 3HFZB 3IBFB 2QC3A 3M8PB 5KFXA 3GV5B 1Y3KA 3UN5A 3MMCB 1PJ5A 2RAQA 3P45B 3MAHA 4C2MA 2V4QA 4PZVA 4FDFA 2QA4G 2IRXA 3GTYX 2V34A 2AX0A 2ERRA 2BE7D 1EAYC 4CTAA 1FF2A 2O01C 5C42B 1IM6A 2MJUA 4ZG7A 4URQU 2FC9A 5HQ8A 3ITHA 5KFGA 2HNDA 1CQNA 1C1BB 1U8WA 3LP0A 3BH7B 2KH9A 1NK4A 1XK8A 4NLGA 4ZOSA 4DV2F 5AJ3F 3DC2A 4F50A 4ICLA 2P2CB 3CO9A 3M8ZA 4CXSA 4NLRA 2KB2A 2Q1LA 3T1HJ 2YQ0A 4X4VA 1MU2B 4ZHRA 5A8WB 4NWJA 1TFWA 2ASYA 3PXGa 1VFJA 1RTHB 3A4TA 1UVKA 4WIQA 2GSUA 4C98A 1EW8A 4JI0J 4ED1A 3W65A 4OI4A 4AT1B 2AZ3A 2W2OP 4IQMA 3HF5A 4RL1A 3KLHA 4GKKF 1R0CB 2DEIA 2UZAA 4ZPVR 3BKUA 3J7YI 4IFYA 4M5NA 4C0HA 2M5YA 2MKCA 1Q78A 3OR1B 4LSLA 2OAUA 5I42A 2GC8A 1OQ6A 4FF2A 4NYOA 2W5SA 4HDHA 4L3KA 1T7PA 4IRCA 1PBAA 1C0UA 2RUSA 3CDUA 1XNQJ 2JX2A 3ZTRA 1FDNA 4MTPA 4PXCA 2QA4S 1R6VA 2MQMA 2XMKA 5HRTA 1BC6A 3E2EA 2L9NA 4CM0A 3MK0A 3I0RB 4DLEA 2EFNA 2H65B 2WB4A 4DV1F 2H4YB 4DV5J 3R5AA 3K89A 2MKSA 3PYGA 2LXIA 2PD1A 2OEKA 3TJAA 3TR5A 1U1LA 1NKCA 2ZH5A 4MFBA 3ZTQA 1FWKA 2UXDJ 3VAKA 3EDQB 2X1FA 1T05B 3MEDA 4ECXA 4IQXA 3UCUP 1OIAA 5G4DA 1D1UA 4O4GB 1JXEA 3OTOJ 5LXRA 4W92B 4FVMA 4I2QA 1RYRA 2H51B 1SJ1A 2IPOB 1DQ8A 4NEZA 4DR3F 1RLDA 3MGJA 2QLBB 1R27B 2GMHA 4C48A 2J0WA 3L95X 3CJSA 1TL1B 4FVCA 2Y0SD 5A6WA 4WK3A 1VJQA 1N56A 2BRKA 5IV3A 3UCGA 1B0TA 1XMQJ 3W5XA 3MM6B 3I56S 3KMSA 2YNGB 3CCJS 1CJKB 1NJZA 1QSLA 2OPPA 4CLLA 2PE8A 5J2QB 1IBMF 4K4VA 2E1RA 2Y0BB 2ZWOA 1VRTA 4K50A 4RUAA 1M90T 4GC7A 3ZO7A 4FP9A 4X4PA 4CCHA 2J76E 3LO3A 2DGSA 2RDDA 1S9EA 4ED5A 1X0PA 2QJ3A 3DRRA 3DLKA 2UUAJ 2ALZA 2MTLA 3KUGA 2BJ7A 3QO9A 4F02A 1RHRB 2PMWA 3B4MA 4C8YA 4OJ1A 4KTQA 4LF1A 2HVZA 1Q82T 1HNIA 4ANDA 3HVRA 3H8YA 3DRXA 1IKXA 3WX4A 2W7PA 4G3IA 1WHVA 1WOPA 1NK6A 4ZVQB 3LP1B 3HJVA 1DZ5A 2RD5C 2WOMA 1ZPVA 2W8DA 3H98A 4NZ6A 1FJGJ 3KHRA 4DR5F 3EVMA 5IQ6A 5C2CA 2DXFA 3BO2A 4OFZA 2G4BA 5DLFA 2VDHA 1QAIA 4ANCA 2ZH9A 1RT7A 2WZ1A 2B5JB 2Z58B 2ZOGA 4PR6A 3Q8SB 2M88A 4DU7A 3R2CJ 1VLYA 1HBUA 5KFHA 2K1RB 5KG5A 2XMAA 4RPFA 2PEBA 3W5ZA 2CXEA 3TZWA 2Y8YA 4MIWA 4EBEA 1YLXA 3T9NA 5DM6Q 3RR8A 2HQFA 1Z2LA 1S1XB 1E6YB 2HLUA 5F3TA 4EYHB 1UZDA 4O3QA 2ZNZA 1NKEA 1IWGA 5GRRA 2HVEA 2HYIB 3UPFA 4L73A 4JI2F 2FYXA 2A3JA 1VQ9S 4V19X 1F2HA 1CPZA 1V9OA 4U67Q 2IJFA 2R7WA 4B3MJ 2X3DA 3SFUA 4O44A 3ISNC 1AUDA 3POTA 1JLGA 2IBOA 3BO4A 4ZP9A 2RSQA 4O0IA 4A8WA 4J7CA 1U1QA 2YWHA 1HWJA 2CZ4A 2OMOA 5EGYA 3S7RA 2X1BA 4IRKA 2L48A 1SHNA 1YJTA 2YNIB 3BS9A 1HBMB 1T03B 1OSCA 3HVTA 1NNDA 1NAQA 5HN0A 1N54B 2FGOA 3QQCD 2CA9A 2AZ1A 4OZ3A 1ALJA 2IAJA 3HKWA 1VRQC 4J9VA 1FRXA 3LGMA 4DN9A 3D3BJ 1WELA 1Y9OA 2UXBF 5CYMA 2WW8A 3IGVA 1IQZA 1YZ7A 5JMNA 3FCVA 1XIQA 3Q3QA 2R7SA 2EC0A 1P8GA 1C2PA 4QPTA 1S57A 3S1TA 2LLZA 4CLKA 1EZZB 2HNZA 1LWXA 3HHLA 4DX7A 5D0EA 2ZC4A 4OZ1A 1WC5A 2RHSB 3MECB 3V6HA 1ZEFA 5L8RC 3CMQA 1UJ6A 1Z2ZA 4DV6J 4RNFA 3BDGB 5L38A 5EX3A 3MEEA 3CJ3A 2MEWA 4O23A 3IBCB 4KT0C 3MK2A 2EVZA 5KAKA 2KJVA 2VFTA 5B0GA 2WSEC 1NBEB 1WC0A 1AT1B 2LP4A 1FJEB 1SUQA 2DEJA 4RJVA 2HHVA 1FXLA 1IKVA 4BHQA 3PJXA 1U49A 3A52A 3A8JA 2DGVA 1U7LA 3HCXA 4ETZA 5B09A 3KHGA 3Q0AA 1X9WA 1X4GA 3PFEA 4Q45A 4Y6IA 1WHYA 3NY0A 3ZZPA 2W9CA 3J7YU 5CYJA 1O8BA 1LK7A 1F60B 3UDCA 3NKPA 1PILA 4MMOA 1F0XA 2MGZA 1X9MA 3KHLA 4OMFG 1NEEA 1X5SA 5KG4A 2XCAA 4WK1A 2LXFA 1F3FA 3PO5A 1RWKB 3G82B 3KNGA 2C2EA 3HXMA 2GGPA 2KXNB 4YUDA 1VBYA 1RWWB 1WHWA 1XWLA 4ES3A 3GR1A 3LA0A 1TL5A 2G0CA 3QPIA 1R0BG 5AE3A 1SC6A 4WZQA 1U0HA 2QLXA 1KNZA 2DNQA 1Z4UA 1H0HB 4DFMA 3NEKA 2HK3A 3W3SA 3KLEA 3R97A 3SBMA 1ZETA 2VQEF 3UD5A 3CXCR 3W62A 2YX4A 1TL3A 3NOGA 4FF4A 3O5TB 2H3EB 2IFYA 4MT1A 3D66A 2Z57B 4K4UA 4NXMF 4I67A 3LWLA 1M5VC 4LSNB 2F9DA 1FHTA 2FZKB
chains in the Genus database with same CATH topology
1KH9A 1KHLA 1URBA 4KAYA 1HQAA 4CYSA 4LRDA 4ZG6A 4ZGAA 2G9YA 1AUKA 3Q3QA 3SZYA 2W5RA 2GA3A 3UN5A 3SZZA 3NKQA 4YR1A 5LRNA 2QZUA 1AJDA 4LQYA 1EI6A 5L0EA 3OT9A 5TJ3A 1KH5A 4QAXA 5GRRA 1EW2A 3NKNA 5K4PA 1HDHA 4GTZA 4ZG9A 4LR7A 4MY4A 4UPIA 4LRAA 4KJDA 5IJSA 4UOPA 4UPHA 1E33P 1ZEDA 1FSUA 5L0BA 1ANJA 1O98A 1EW9A 4GTYA 4MHXA 1ELXA 5DLTA 3WAWA 5LIAA 1ELYA 3BDHA 3WBHA 4LR8A 2XR9A 1B8JA 1ZEFA 4TN0A 1KHJA 4LRBA 5INHA 3NVLA 2X98A 4ZG7A 3M8WA 3UN2A 1N2KA 4UORA 4LR9A 2IUCB 1ELZA 3BDGB 1KHNA 1O99A 2IUCA 1AJCA 1ED8A 3BDFA 3BDGA 5LQQA 1ZEBA 5C66A 1KH4A 1Y7AA 1N2LA 3IGZB 2GLQA 3WAYA 2W5SA 4LRFA 3NKOA 4GTWA 1ALHA 2RH6A 3TWZA 4CXUA 3MK2A 4GTXA 4CYRA 2ZKTA 1AJAA 3NKRA 3B5QA 2W5VA 3E2DA 3ED4A 3TG0A 5AJ9A 5IJQA 3CMRA 1AJBA 2W8DA 3UO0A 4UPLA 2D1GA 1E1ZP 5GOVA 4LREA 4KAVA 3NKMA 4UPKA 1E3CP 1ALKA 3KD8A 3M8ZA 3T00A 3MK1A 4CXKA 2W8SA 1URAA 4CXSA 2GSNA 5LRMA 5DLVA 4FDIA 3UNYA 1HJKA 5HRTA 2W5WA 1E2SP 3IGYB 1K7HA 3TX0A 4KM4A 4NWXA 1SHQA 1Y6VA 4LR2A 2VQRA 3WAVA 2W5XA 1SHNA 2W5TA 3MK0A 3A52A 5KXAA 1KHKA 1EQJA 2IFYA 3IDDA 4NWJA 3T02A 5DLWA 4UOOA 1KH7A 2ANHA 3T01A 4B56A 1ANIA 4LRCA 1ALJA 5L0KA 5EGEA 4KJGA 3UN3A 3M8YA 4N7TA 1ED9A 2XRGA 3WAXA 4MIVA 2GSOA 3DYCA 3DPCA 2GSUA 1EW8A 1P49A 3LXQA 1EJJA 4FDJA 1ALIA 2W5QA 5EGHA 3M7VA 3NKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KH9 A;  1KHL A;  1URB A;  4KAY A;  1HQA A;  4CYS A;  4LRD A;  4ZG6 A;  4ZGA A;  2G9Y A;  1AUK A;  3Q3Q A;  3SZY A;  2W5R A;  2GA3 A;  3UN5 A;  3SZZ A;  3NKQ A;  4YR1 A;  5LRN A;  2QZU A;  1AJD A;  4LQY A;  1EI6 A;  5L0E A;  3OT9 A;  5TJ3 A;  1KH5 A;  4QAX A;  5GRR A;  1EW2 A;  3NKN A;  5K4P A;  1HDH A;  4GTZ A;  4ZG9 A;  4LR7 A;  4MY4 A;  4UPI A;  4LRA A;  4KJD A;  5IJS A;  4UOP A;  4UPH A;  1E33 P;  1ZED A;  1FSU A;  5L0B A;  1ANJ A;  1O98 A;  1EW9 A;  4GTY A;  4MHX A;  1ELX A;  5DLT A;  3WAW A;  5LIA A;  1ELY A;  3BDH A;  3WBH A;  4LR8 A;  2XR9 A;  1B8J A;  1ZEF A;  4TN0 A;  1KHJ A;  4LRB A;  5INH A;  3NVL A;  2X98 A;  4ZG7 A;  3M8W A;  3UN2 A;  1N2K A;  4UOR A;  4LR9 A;  2IUC B;  1ELZ A;  3BDG B;  1KHN A;  1O99 A;  2IUC A;  1AJC A;  1ED8 A;  3BDF A;  3BDG A;  5LQQ A;  1ZEB A;  5C66 A;  1KH4 A;  1Y7A A;  1N2L A;  3IGZ B;  2GLQ A;  3WAY A;  2W5S A;  4LRF A;  3NKO A;  4GTW A;  1ALH A;  2RH6 A;  3TWZ A;  4CXU A;  3MK2 A;  4GTX A;  4CYR A;  2ZKT A;  1AJA A;  3NKR A;  3B5Q A;  2W5V A;  3E2D A;  3ED4 A;  3TG0 A;  5AJ9 A;  5IJQ A;  3CMR A;  1AJB A;  2W8D A;  3UO0 A;  4UPL A;  2D1G A;  1E1Z P;  5GOV A;  4LRE A;  4KAV A;  3NKM A;  4UPK A;  1E3C P;  1ALK A;  3KD8 A;  3M8Z A;  3T00 A;  3MK1 A;  4CXK A;  2W8S A;  1URA A;  4CXS A;  2GSN A;  5LRM A;  5DLV A;  4FDI A;  3UNY A;  1HJK A;  5HRT A;  2W5W A;  1E2S P;  3IGY B;  1K7H A;  3TX0 A;  4KM4 A;  4NWX A;  1SHQ A;  1Y6V A;  4LR2 A;  2VQR A;  3WAV A;  2W5X A;  1SHN A;  2W5T A;  3MK0 A;  3A52 A;  5KXA A;  1KHK A;  1EQJ A;  2IFY A;  3IDD A;  4NWJ A;  3T02 A;  5DLW A;  4UOO A;  1KH7 A;  2ANH A;  3T01 A;  4B56 A;  1ANI A;  4LRC A;  1ALJ A;  5L0K A;  5EGE A;  4KJG A;  3UN3 A;  3M8Y A;  4N7T A;  1ED9 A;  2XRG A;  3WAX A;  4MIV A;  2GSO A;  3DYC A;  3DPC A;  2GSU A;  1EW8 A;  1P49 A;  3LXQ A;  1EJJ A;  4FDJ A;  1ALI A;  2W5Q A;  5EGH A;  3M7V A;  3NKP A; 
#chains in the Genus database with same CATH topology
 1FRK A;  5EWF A;  2UUB J;  3PW4 A;  2AJ0 A;  2VA3 A;  2NUH A;  4OHY A;  4YFU A;  2WHO A;  3M4X A;  1WNE A;  3H4B A;  3OR2 A;  4ZP7 A;  2L08 A;  4TY8 B;  2B4U A;  4GTY A;  3HK2 A;  4H4M B;  1TV6 B;  1SBR A;  2HZA A;  3BSO A;  3Q2T C;  3UVJ A;  1FNX H;  1V3Z A;  2R4F A;  5B0E A;  1DRZ A;  2HWH A;  5AE1 A;  4U7C A;  2WRM A;  3QJP A;  4ES1 A;  1OSD A;  2D1C A;  2UVW A;  2GMJ A;  2B4P A;  3U27 A;  2NQP A;  3ZZT A;  3GFY A;  4F25 A;  2XS2 A;  5LJ3 Y;  1LWC A;  4K4W A;  3IR6 B;  4ZIV A;  2YWK A;  1HMV A;  4P7T A;  2ZBP A;  3FFI A;  3W63 A;  1JX4 A;  1FA0 A;  1RT6 A;  3EGV A;  5DLW A;  3B4D A;  4OZJ A;  4OQJ A;  1RBA A;  3FQL A;  2GSO A;  1WDD A;  2K7K A;  3PW2 A;  4L72 B;  3LAL A;  1PJ7 A;  2CKW A;  4ZGA A;  4JI6 J;  4DUY F;  2ZH8 A;  3GSD A;  5A0Y A;  1YIT S;  1N34 J;  1D0E A;  1TAQ A;  1XMB A;  3DMJ B;  3NKN A;  2CPJ A;  2LEA A;  2EFP A;  3D1H A;  3NP5 A;  1FNO A;  1XR7 A;  1QVG R;  4CO5 A;  3GIM A;  4HHU A;  2E5J A;  5ETR A;  4L6V 3;  2CDR B;  1HD0 A;  1REV A;  4M5D B;  4NCG B;  2AEM A;  3BO3 A;  2EI5 A;  4X4N A;  2V8P A;  2HVD A;  5L9X A;  2XI3 A;  2ZHB A;  2MSS A;  4RW6 A;  1SJQ A;  4CLT A;  1EP4 B;  5GVQ A;  1R8A A;  3K5N A;  2FHJ D;  4DSF A;  5HAT A;  2GSN A;  4NCA A;  1SV5 B;  3FRY A;  5IM0 B;  3IR5 B;  2LXU A;  4ZKA A;  2W5T A;  3KHH A;  4J5O A;  3IRX B;  5LM7 E;  2HHT A;  4J9K A;  3PRB A;  1HHS A;  5FDL A;  1HIY A;  3EUN A;  2GQ2 A;  4I1T A;  3MWB A;  5GAD I;  3VQS A;  4GVL A;  3QYY A;  4HKQ A;  1MRO A;  2XZD B;  2B4V A;  1NZA A;  2GW8 A;  2PO4 A;  4LRD A;  4FNI A;  3GV8 B;  1U1N A;  4NLY A;  4KSE B;  2W8L A;  1X9S A;  3LPE A;  2HEK A;  2HWI A;  5AXM A;  4IO9 Q;  1TMM A;  5KFM A;  4WXW A;  2PA8 D;  2N4D A;  2CJB A;  4F4A A;  1MN7 A;  3M8R A;  2OSR A;  2P6T A;  5HVG A;  4CZC A;  4QR2 A;  1J5O A;  4NZ7 A;  3QGG A;  1TP7 A;  4HHJ A;  4LR9 A;  1RGV A;  2UV8 G;  3AXK A;  1S59 A;  3TP2 A;  5K14 B;  4NRU A;  1RTD A;  3RBX A;  2HW3 A;  3VVT A;  1NO8 A;  4FS2 A;  2WON B;  1UTA A;  3VWS A;  2J9E A;  5D3G B;  1TKZ B;  5BYQ A;  4PPZ A;  4QOT A;  5F0W A;  5KFD A;  1JKH A;  1LXN A;  2F8E X;  3IDD A;  1BHN A;  1SJF A;  2ANH A;  4PXE A;  2VQF J;  3KLH B;  3OFE A;  4OI0 A;  3K17 A;  4USV A;  4I6W A;  4DCO B;  2I5J A;  4LF6 J;  1W26 A;  4ZG6 A;  3PFO A;  5HBM B;  2JFK A;  2YQ3 A;  1UWB B;  3MFH A;  4CYS A;  4MKY A;  2W5R A;  1CS4 A;  3OXF A;  2X1G A;  4D3H A;  3OFF A;  2CPD A;  2CNO B;  2RS2 A;  1SL2 A;  1XER A;  4Q0B A;  3VZH A;  1X31 C;  4G1Q A;  1AW0 A;  4LF5 F;  3TAP A;  4EZ6 A;  2M4M A;  4JI7 F;  1FDB A;  2MDA A;  2NR0 A;  4QR0 A;  4F3Q A;  2E9T A;  3CJ4 A;  3IC1 A;  4UOR A;  3KK1 B;  3CC4 S;  4QZV B;  1KQK A;  4DSK A;  1Y7A A;  4WU3 A;  3HSJ A;  3SDE A;  1F5C A;  4AD6 A;  1ZA1 B;  1RIS A;  2Z2Z A;  3BBC A;  2B3T B;  3U1L A;  1JQG A;  1WAC A;  5HLF B;  3NWR A;  1YKW A;  2E5H A;  2D3Z A;  4KB7 A;  2YPZ A;  3V81 A;  2W9B B;  1S48 A;  5C25 B;  2KN4 A;  2CQP A;  2OH2 A;  4M5M A;  5DZ6 A;  1YQH A;  1RTZ A;  2HIY A;  3MAQ A;  4B9S A;  1VHF A;  3DOL B;  7AT1 B;  2HBR B;  1RUS A;  3EXC X;  3BGR A;  2KDO A;  1VS3 A;  3SYZ A;  2V69 A;  1JLC B;  1C4A A;  1AB8 A;  3J7A 1;  2V4J B;  1N36 F;  3W9H A;  1XNR J;  2J9D E;  2K8G A;  3FGV A;  1LW0 A;  1OYD A;  2KM8 C;  2F4V J;  3ILL A;  4ZVT B;  2EKY A;  4AL5 A;  5IT9 U;  2GV1 A;  3KXD A;  1SL0 A;  4AQY F;  4DQQ A;  3JSB A;  2W2M P;  3ENW A;  2VOO A;  3N9U C;  5E3R A;  4FBU A;  4RUH A;  1M1G A;  4OJ3 A;  3GPA A;  3CDB A;  2GFF A;  3AA9 A;  3QZ7 A;  1CEZ A;  3KD8 A;  2YKQ A;  3RR7 A;  4X66 J;  1QSY A;  2BEF A;  2AKW B;  4R8U B;  3MM5 B;  4FPI A;  2YKM B;  1O5J A;  1OPI A;  4RNN A;  2OPR B;  1WOS A;  3DLK B;  4PQU B;  1UP1 A;  1H73 A;  2R7R A;  1K8A T;  3AOC A;  2XO7 A;  5DDP C;  1HNI B;  1Y3J A;  3MEG A;  1IKX B;  3B54 A;  4C8N A;  2PA3 A;  2W8K A;  2I0X A;  2V5H G;  3RYL A;  4IH5 A;  1DAR A;  3GCX P;  4ID5 A;  2MKI A;  1TMJ A;  2LQB A;  2XO6 A;  3G8S A;  2JEG A;  5IS2 A;  2KVI A;  1PYO B;  1HWI A;  1V6H A;  3OHB A;  4OV6 A;  3GFZ A;  2IM0 A;  9ATC B;  4M1K A;  4EZ9 A;  4CXK A;  4I7F A;  1X4B A;  3GFH A;  3GSI A;  2XGQ A;  2LQ5 A;  3CCQ S;  1T95 A;  4ECU A;  1AA1 B;  2XZW A;  2RHQ B;  2KL8 A;  1VOM A;  1U6B A;  2ILY A;  3M8Y A;  4U6P A;  2BZ2 A;  2CPZ A;  2E5I A;  4J91 A;  1RB0 A;  4I68 A;  2Z56 B;  3BYR A;  3D1O A;  3Q23 A;  1L3T A;  2CQ2 A;  2HAI A;  4M5J A;  2XMJ A;  5ETO A;  4G6V B;  2C2Z B;  2AJF E;  2PEH A;  2AGP A;  1BQM B;  1KTQ A;  4O44 B;  1QTN B;  3BQ0 A;  1FFW B;  2VG6 A;  1WOO A;  3VHQ A;  2ZZM A;  4YB6 A;  4WFA Q;  3OTE A;  2L9W A;  2HHX A;  4TLR A;  2VFU A;  1Q16 B;  3EPI A;  3TRG A;  1LWE B;  3RB6 A;  1QAY A;  3UD4 P;  3TYT A;  1RAE B;  5KFT A;  1SVD A;  4I56 A;  5MLC V;  1UVI A;  2XB2 D;  2E1A A;  5ETQ A;  1IQT A;  4LF4 J;  4Y28 C;  4NLU A;  5GAD U;  2RF2 B;  3CDA A;  3N01 A;  1DLO B;  2BE2 A;  3D0I E;  4CO3 A;  4LIR A;  4X62 F;  3MMA A;  4ZN1 A;  2WB1 D;  2XMU A;  3JAM Y;  4QWA A;  1U6Z A;  3PR5 B;  4RW7 B;  2LVW A;  2JVR A;  2HNZ B;  3KK2 A;  1M5S A;  4P52 A;  2ZH1 A;  3P5T L;  1JJH A;  1JLE B;  3DNC A;  2CZV C;  1TK0 A;  2GJ2 A;  5JXS A;  2KRB A;  3UR0 A;  1LWF B;  3LGN A;  1XBW A;  5HVF A;  4CLF A;  2B9W A;  2WCX A;  1F5A A;  2IC3 A;  4YR3 A;  3T1A A;  3DHX A;  2O1P A;  4PYA A;  3LP2 B;  4N41 A;  5F8G A;  3I5A A;  3KJQ B;  2BM0 A;  2GHW A;  1FVS A;  2LFV A;  2HWT A;  5C24 A;  3FMB A;  4ETX A;  5E5N A;  1UFK A;  4WBF A;  2ZDO A;  3QRQ A;  1T9T A;  4PUO A;  1AJB A;  3UO0 A;  5HAO A;  4JI4 J;  2JDJ A;  2XYG B;  4KHP F;  4UPK A;  1WF1 A;  3CD6 S;  2MZ1 A;  3C8Y A;  5KOW A;  2KT2 A;  1S1U A;  3OL9 A;  2AEF A;  5D0R A;  1FKO A;  1S1T B;  1RJJ A;  3D6T B;  2HQ3 A;  1F3V A;  4WTO B;  1QSS A;  4PXB A;  4NMX A;  5H1S V;  1P49 A;  2FJX A;  5HMY A;  3JTO A;  3DI6 B;  5KFS A;  1ELO A;  1QUP A;  3R3T A;  3T9Z A;  3O8W A;  4C8L A;  5F8I A;  2GGP B;  3C14 B;  5HMW A;  1BQN B;  1YWX A;  5DDO C;  1RHU B;  3EVW A;  2BXJ A;  2VB6 A;  1IBC B;  2VIH A;  2E5L J;  1SQF A;  2M7S A;  2ZUG A;  4C3K A;  2MKY A;  2W01 A;  3UQS A;  4ZLN A;  5CXT A;  2AD9 A;  4DR2 J;  1OY8 A;  1N33 F;  1SL1 A;  2ZZT A;  3W2W B;  1IBL J;  1X4H A;  3O44 A;  4O3N A;  3OV7 A;  4YB5 A;  4B9N A;  2UVR A;  2AU0 A;  1RA7 A;  4J37 A;  2AMC B;  4B3O B;  4UOC A;  2V67 A;  4U95 A;  3M6U A;  3CCL S;  2QA1 A;  2MLY A;  1U8S A;  3T1Y F;  2HFV A;  4ZPA A;  3DLG A;  1SHQ A;  3A3O B;  2VH7 A;  3TAM A;  2LEC A;  1SXL A;  1KQS R;  5HVH A;  5KT7 A;  4GO7 X;  4IYQ A;  2Z30 B;  2KYZ A;  3P6Y C;  5L0K A;  1M1K T;  2ZBR A;  4WFX A;  3BR9 A;  2FHJ A;  4MIV A;  3TUI C;  2W7A A;  3ZTP A;  2W9A A;  3CF5 Q;  2J7W A;  1QJH A;  4XDD A;  4OV1 A;  1KLN A;  1REG X;  3CCU S;  5J2P B;  3G9C A;  3DOK A;  3C16 A;  2V4R A;  4KO0 B;  1J27 A;  3UVJ B;  5A2Q U;  1KR4 A;  4DPY A;  1PCA A;  4OLP A;  2M52 A;  3JSM A;  2E5G A;  1ICE B;  4TN0 A;  4XDC A;  3RU0 A;  3OTB A;  3QSI A;  3HP6 A;  4KPC A;  5J2N A;  4HI2 A;  3PV8 A;  2V2V A;  5K8O A;  5LMU J;  4L3N A;  2RQ4 A;  2QMU B;  4DX8 H;  5ETL A;  1VQ5 S;  4WPA A;  1SI9 A;  1CJT B;  4XAK A;  3CJ8 A;  3JS9 A;  2BV3 A;  2XQC A;  1F9E B;  3Q8V A;  1KH7 A;  3R5G A;  5GMK a;  4B56 A;  2VJU A;  4NRT A;  2DIU A;  1E6V B;  5J1N A;  1NRK A;  2WVD A;  1WG5 A;  1TKX B;  2UVV A;  2MHE A;  4B9V A;  3KLI B;  3W8P A;  4ZJL A;  4WTY A;  2LEP A;  2CJK A;  2IMO A;  4EEY A;  3IM8 A;  4DUZ J;  1IJF B;  4H4O A;  1YBU A;  1RT5 A;  2NUU G;  2HHS A;  3ZZ0 A;  4UPI A;  2PI4 A;  1Q8B A;  1FSU A;  2B6A A;  2CG4 A;  2I6W A;  4RZR A;  1D9F A;  3TQ1 A;  3HHE A;  2YX7 A;  4DPW A;  4HTJ A;  4EUV A;  1VQP S;  5HP1 A;  3KLF B;  3MHY A;  4ZJO A;  3FRZ A;  4JI1 J;  4P2M A;  1KWM A;  3PJ9 A;  1I6J A;  4OYO A;  1Y7P A;  4ERD A;  5AXN A;  1P6T A;  2BKP A;  2VFR A;  1OO0 B;  5GMD A;  2QL5 B;  3FQK A;  3KJV B;  3IWX A;  4DPO A;  2VJV A;  3M2R B;  3DCA A;  1K7H A;  4F2R A;  3J81 Y;  2FLP A;  3TAR A;  1BWV A;  4F3M A;  4XPC A;  1HHT P;  2XZT B;  4PCQ A;  3RG6 A;  4DDF A;  3Q8Y A;  3BGU A;  5LMN F;  3ZZU A;  3CGI A;  5CYQ A;  3EIC A;  2CPI A;  2KFN A;  3DGV A;  1VC0 A;  1EAR A;  4EBD A;  1WG4 A;  2W5Q A;  4NAS A;  4USJ C;  1RAB B;  5T7L B;  1RAG B;  4YHH J;  3DKD A;  2QEX S;  3M8P A;  1TEL A;  2NZ4 A;  1YGY A;  2HRT A;  3MMC A;  2ZM6 J;  4URG A;  1L3V A;  4Z7Y A;  1N5V A;  2ZH7 A;  4B3R F;  2CQB A;  4RWX A;  1K47 A;  1U02 A;  1NK5 A;  4PWD A;  2YNF B;  1W7W A;  5C42 A;  3WAW A;  1NJY A;  2NYI A;  4UY8 5;  5DET A;  1NSP A;  3IAS 9;  1FD8 A;  3CCV S;  1C1B A;  1SPB P;  2YTC A;  3Q2S C;  1KS2 A;  3T1H F;  3H5X A;  2DY9 A;  4HH0 A;  1P1L A;  4DQP A;  2POK A;  4EO8 A;  3HHD A;  2H5E A;  3O1L A;  2W8S A;  4YR2 A;  3MR7 A;  2I5J B;  1NK7 A;  2Y1I A;  2K3I A;  1BGX T;  1M1H A;  2XWX A;  3HPO A;  1N32 J;  5DZ7 A;  1MU2 A;  1CS4 B;  5IZH A;  4RNH A;  3B8H A;  5A8W A;  2I9S A;  4DPX A;  5KFL A;  1RTH A;  1F2G A;  4NI2 B;  2QE5 A;  4G1Q B;  5L9N A;  1WG1 A;  3VF0 B;  4WFB Q;  3GON A;  4H4K A;  5DQI A;  5FII A;  1S9G B;  3PR4 A;  1H6K X;  2V9K A;  3OJS A;  3HSD A;  3NRB A;  1M0S A;  1AJD A;  5T41 A;  2C2D A;  3RRG A;  2CPF A;  4XPE A;  2V63 A;  3AJD A;  1MLA A;  1ANJ A;  5JUM A;  1PKU A;  2BVZ A;  3BDH A;  1WF0 A;  2QFJ A;  1KVJ A;  1S1V A;  3DXS X;  1IBK J;  3CC7 S;  1BY9 A;  2Q6B A;  4USI A;  5HQL A;  3N4W A;  4LFC J;  4UPL A;  2KZZ A;  5JVG Q;  4R5P B;  2Y9H A;  4X4U A;  2D3O R;  2KKH A;  2LDI A;  4DPU A;  1A6L A;  1ZAX A;  2HBZ B;  4DL2 A;  2FGC A;  1I94 F;  3WAV A;  3PZP A;  5E41 A;  1UEU A;  4RR5 A;  1NH7 A;  3I0R A;  3K5O A;  4ZPC A;  3R8Y A;  4O3S A;  1UPP A;  1NSA A;  3A13 A;  1JLQ A;  1U2F A;  3NS7 B;  1PIE A;  3ENQ A;  2G9O A;  1K1Q A;  2IMW P;  3DDI A;  2DH7 A;  1S0N A;  4DV2 J;  5AJ3 J;  4FF3 A;  3RW7 A;  3CCS S;  4LJM A;  1T05 A;  4OLO A;  2P8I A;  3S01 A;  5K9F A;  3R6L B;  4OHW A;  5BR8 F;  4DR1 F;  3BQ1 A;  3EWG A;  4URS A;  2C2M B;  3MTK A;  4DR7 F;  4E2F B;  1ZS6 A;  1SJ4 P;  2JVO A;  2B9X A;  4I0W A;  3PRV A;  5B0B A;  4KQZ A;  2UUW A;  2K3K A;  3TO8 A;  2HS0 A;  1QAX A;  3ENV A;  1QLN A;  1HNV B;  4M63 A;  2VF3 A;  3B5Q A;  2E1C A;  2OEL A;  2E1P A;  3QIP B;  1KLM B;  3MM6 A;  4DSJ A;  4ILM A;  2YNG A;  4X4R A;  4JI5 F;  4GKK J;  1NSK L;  1ALK A;  3RJM B;  2XUL A;  5FLX Y;  1GXT A;  5J2Q A;  3QT8 A;  2CFX A;  2RIL A;  3KG0 A;  3DLJ A;  4LF7 F;  2WAQ D;  5HI7 A;  1KQF B;  5J1E B;  1N5Q A;  3PEH A;  4MYU A;  2UUA F;  3IM9 A;  2AV5 A;  4ID5 B;  2VG7 B;  2APO A;  1UET A;  1U6F A;  4Y2C A;  4NML A;  2Q43 A;  1X5T A;  3ZXW A;  5RUB A;  2N4C A;  4IG0 B;  3WBH A;  4DV1 J;  2K06 A;  3HJF A;  3AXM A;  3CB4 A;  4AL7 A;  2VKZ G;  1SKW A;  4IFV B;  4F67 A;  4J9Q A;  4NLT A;  4QBU A;  2D9O A;  4XIU A;  3LP1 A;  1RHK B;  2BX6 A;  3H7H B;  1R8H A;  5AJ9 A;  1T3O A;  5EN1 A;  4KFB B;  1E1Z P;  2RUG A;  2Q66 A;  4IH7 A;  3B82 A;  2GVD B;  4AUK A;  3OVS A;  5EUH A;  3GIR A;  4XK8 C;  4DR3 J;  1P1T A;  3CJK B;  2J6T A;  2LU2 A;  2B5J A;  1R8B A;  5I3Q A;  1U45 A;  4F26 A;  2R2U A;  3W66 A;  2B4O A;  5ETK A;  2K1R A;  1UMJ A;  4DZD A;  4QYZ J;  4X84 A;  3EX7 B;  5ETV A;  1RAO A;  3I87 A;  1S1X A;  4A47 A;  3KDN A;  1E6Y A;  4ZVF A;  1CUL B;  4N47 A;  5L1J A;  2MMY A;  1L3U A;  2A10 A;  3SCL E;  4TXS A;  5I3U B;  1EW2 A;  4CLZ A;  1VBK A;  3SI8 A;  5IJS A;  5D15 A;  2JNJ A;  3MCO A;  1K73 T;  1HBO B;  1ELX A;  3THV A;  1F5B A;  3K7R A;  3ILO A;  4I64 A;  3HD1 A;  2CDQ A;  1PO6 A;  4ECW A;  1RTJ B;  2ZBI A;  2KU7 A;  1VBZ A;  1SC4 B;  3OUY B;  2G0J A;  4X64 F;  2QV6 A;  1Q4R A;  3IR7 B;  3KK2 B;  3ISZ A;  2E7V A;  2PFF B;  2UV8 A;  3BBB A;  2HBQ B;  3TNV A;  3PNI A;  4JV5 F;  3I9V 9;  2YNI A;  1HBM A;  1T03 A;  3C66 A;  3WIV A;  4NX9 A;  2B51 A;  2KZM A;  4LQ3 A;  3BDP A;  2L9D A;  4QU7 A;  3GG0 A;  2B7C B;  1ED9 A;  4UOG A;  2DRB A;  4K4Y A;  3NGD A;  5CH7 B;  1RHM B;  1YK9 A;  3C15 B;  3KJN B;  1JLF B;  1FJC A;  4NXN F;  3R5B A;  5ETN A;  2D3U A;  3F41 A;  3WZ0 A;  4DR5 J;  2BRL A;  2BJD A;  3BGO P;  2MZT A;  3OFG A;  2GVZ B;  3SZ2 A;  3MMJ A;  2C3M A;  1RLC L;  2R8I A;  4DV6 F;  2IJN A;  1VGY A;  4QWD A;  3CJT A;  3C6U B;  1RT1 B;  3R5D A;  3FCH A;  3J80 Y;  3T5H A;  2CQ4 A;  1S0M A;  3DRS B;  4LR8 A;  3MEC A;  3SQG B;  2OPS B;  1XEZ A;  1DTT B;  3J81 j;  2HFO A;  1NDL A;  1ACM B;  3DLL Q;  3KWM A;  3UR3 C;  1NZ8 A;  1YRU A;  3BDG A;  3RTV A;  1IKY B;  2F9J A;  4OIX A;  1N6Q B;  1UFW A;  4KAI A;  1EQM A;  1UA1 A;  2HK2 A;  1I1G A;  4OYZ A;  3OL7 A;  4AFF A;  4DFK A;  1ZH5 A;  1ZTT A;  3W60 A;  2MXY A;  3H40 A;  3T5K A;  4TNO A;  4F0K A;  2RDI A;  3LAK A;  5KXA A;  2G13 A;  2FY8 A;  2Q3P A;  5A6P A;  3I6P A;  2K2P A;  2V2K A;  3OLB A;  4TU8 A;  4EK2 A;  2CIM A;  4ZS6 A;  1QM9 A;  3C19 A;  3AD8 C;  3CT9 A;  2XI2 A;  1ALI A;  4NLQ A;  2WBM A;  4PAB A;  3I0S B;  3ENA A;  4TN2 A;  2HRU A;  4Z37 A;  4HT5 A;  4NA1 A;  5LRN A;  2QFI A;  3KUH A;  1ROF A;  3Q8R B;  4LFA F;  1URN A;  3EE3 A;  2H48 B;  3BDE A;  3EMT A;  4KY3 A;  3HSZ A;  1B8J A;  2XR9 A;  1UPM B;  2FY1 A;  3IP0 A;  2XNQ A;  3TQE A;  1LFP A;  4UT4 A;  3WAY A;  4W90 B;  2M3D A;  1RAA B;  4K2X A;  4GTW A;  4ECQ A;  1HWL A;  2FHK A;  3N6M A;  1QTM A;  5KTQ A;  4YN3 B;  1LK5 A;  4LVN P;  2PDA A;  2X51 A;  2W5X A;  1H7X A;  3I4H X;  2EXU A;  5DDR C;  4OI6 A;  2F4F A;  1RT3 B;  1RA6 A;  2HG4 A;  1U1M A;  3DU6 A;  4LSN A;  2DIS A;  1CQM A;  3LTO A;  4NL5 A;  3D6M B;  3K59 A;  2UU9 F;  4BBY A;  2QZU A;  2MZR A;  3HVW A;  1NDP A;  1VQK S;  2U1A A;  2F1F A;  3MZI A;  1FXR A;  4FYV B;  3GYX B;  4M5L A;  3US5 A;  5ETS A;  4PPD A;  4IDK B;  4R0J A;  4H4M A;  2I1R A;  2NLW A;  1HNX J;  4RKU C;  2D41 A;  3SV3 A;  3SCK E;  1ZEB A;  4C7Q A;  3NS6 A;  1WC6 A;  5L1K A;  4U7U K;  1S76 D;  4A8Y A;  3QAU A;  2LCW A;  1MWZ A;  3W61 A;  2DNY A;  1FK9 B;  1Y10 A;  1EQ0 A;  2XY5 A;  3UFC X;  3BH6 B;  1Y6V A;  4KRW A;  2E9Z A;  1YJU A;  2ZJP Q;  2EFQ A;  5IOL A;  2IIH A;  2ZH4 A;  2FJV A;  4H4O B;  1YG0 A;  4JI6 F;  3H2L A;  1RT5 B;  3HFV A;  1OMS A;  4D3G A;  1S6U A;  3WC0 A;  2VC0 A;  2V94 A;  2HVH A;  3KLG B;  1PYS B;  2M8D B;  2FVS A;  5J2M B;  3PO4 A;  3OLA A;  1LV5 A;  2R8K A;  3D68 A;  1HL6 A;  4C8O A;  3VR1 A;  2CWK A;  4CYU B;  1VRU B;  3W5Y A;  1UVM A;  4EI2 A;  1FKP B;  3EGN A;  4NXM J;  5ETM A;  3FVY A;  3UN2 A;  1FRJ A;  3BDF A;  3L9Z A;  3D5M A;  4M5D A;  4NCG A;  4DV3 J;  3KG4 A;  3T41 A;  1AUS L;  4X65 F;  1NXI A;  4OX8 A;  3NKY A;  4U96 A;  4QYZ K;  3ED4 A;  5DG9 A;  3G6X A;  2RRA A;  2XEX A;  1RTI B;  4NEY A;  1XC9 A;  4OYI A;  4USW A;  4HT7 A;  1SV5 A;  1NSQ A;  2DIV A;  3GU0 A;  5IM0 A;  2C28 A;  4C0O C;  1KC8 T;  4F0M A;  3A12 A;  2MJN A;  3IRX A;  1ZPW X;  4KKO A;  3N5F A;  4ID8 A;  4A8S A;  4LRC A;  3B6B A;  5CZV A;  2V8V A;  1UEV A;  2RQK A;  1X4E A;  3LUY A;  2XMM A;  4PWD B;  2VFS A;  4WF9 Q;  3LH2 S;  2YNH B;  3CD0 A;  2EKN A;  5I3P A;  4J9O A;  2GA3 A;  1EJ7 L;  2B8P A;  4KGK A;  2VZ9 A;  3GIK A;  2LU1 A;  4P9S A;  2HKE A;  1T3N A;  3DU5 A;  1DQ9 A;  1SIZ A;  1DQA A;  4P2X A;  4DN0 A;  1VBX A;  5LIA A;  3H90 A;  5KFC A;  2AW0 A;  4F4Y A;  3CNQ P;  3M8W A;  1N2K A;  2IUC B;  4BLG A;  1KOH A;  2V6A A;  2WSF C;  4DF8 A;  1WKK A;  1LFW A;  3MR5 A;  2RH6 A;  4Y2I A;  1RWX B;  5K14 A;  4HTI A;  2OTJ S;  3NKR A;  5IV4 A;  2JWN A;  5CA5 A;  3DHW C;  3AY0 A;  1FFS B;  4ITS A;  1H72 C;  2WON A;  3OVB A;  2VQF F;  5D3G A;  3RW6 A;  1TKZ A;  4K5R A;  3NGS A;  2HHW A;  3MM8 B;  1JJ2 R;  3L3C A;  1F9F A;  3O6Q A;  4ZPB A;  2RNE A;  5C2G A;  5L39 A;  3A8E A;  5HBM A;  3UWT A;  2XYH B;  1AYE A;  1UWB A;  4DI6 A;  3NKQ A;  4ED3 A;  3G2X A;  1S1V B;  3ZNJ 1;  1FRH A;  5MAO A;  2KM8 B;  1UFL A;  4DG1 B;  3DLH A;  3W2V B;  2MY7 A;  3FNN A;  4LRB A;  5D4P A;  3KK1 A;  3R27 A;  3U1M A;  4U8Y A;  4OZ2 A;  2BW2 A;  2J5A A;  2CPH A;  1HLW A;  3E2D A;  1JLQ B;  3H0P A;  2Y1R I;  2G2Z A;  4BCA A;  2BJ9 A;  4PG8 A;  5HLF A;  4IOA Q;  3KFW X;  2BKO A;  2RRN A;  3R5C A;  2ZWP A;  2W9B A;  1U25 A;  4OHZ A;  5C25 A;  2FJB B;  3LWM A;  3ZFV A;  3NXZ A;  2X3G A;  5L1L A;  4B3T F;  2FLO A;  1RT4 B;  3DOL A;  4XO0 A;  3D0H E;  4XTT A;  1GQE A;  1OY9 A;  1JLC A;  4DSI A;  4GVB B;  2V50 A;  1YZ6 A;  2L41 A;  3D54 A;  1TUW A;  2V4J A;  3VCD A;  3DLE B;  3V6J A;  3ZTS A;  4YDD B;  1UW9 A;  3M8Q B;  1O98 A;  3FUY A;  1EW9 A;  5KG2 A;  2V2Q A;  2H5I B;  1SC3 B;  2OUG A;  3PW0 A;  4YB1 P;  4X66 F;  3OVA A;  4HEA 9;  3DDN A;  2HFZ A;  3H5Y A;  2CPX A;  3V4I A;  1FO1 A;  3MDF A;  3PCO B;  4R8U A;  4LF5 J;  3MM5 A;  2HS3 A;  4JI7 J;  3S8S A;  3LAM A;  3VGU A;  3K5L A;  1TK5 A;  2YKM A;  3ZZY A;  1LEO A;  4DS5 A;  1FT8 A;  2KT3 A;  2KYX A;  3OSP A;  2W1B A;  5KG6 A;  2OPR A;  3EGW B;  1VR6 A;  1AFI A;  2EFV A;  1RDR A;  5EX0 A;  4PQU A;  4ZK7 M;  3ILI A;  4UST A;  3CCM S;  3CJ2 A;  3GIL A;  1N0V C;  3SZZ A;  1FKA F;  4FKY A;  4RNO A;  1RK8 A;  2HZV A;  3RRH A;  4A8X A;  2ZOF A;  3P49 B;  3QBC A;  6AT1 B;  2AJ1 A;  1PSD A;  2GML A;  2EK1 A;  1E33 P;  2M70 A;  1TL7 B;  2HNY A;  3FEZ A;  4OI3 A;  3BSN A;  2DGO A;  5E33 A;  2B8Q A;  1DBD A;  3OTC A;  2YPY A;  4NLV A;  2JLE A;  5D6G A;  1RCO B;  5B0F A;  4USK A;  2ZH2 A;  3BEG B;  3MUM P;  1OPZ A;  1CC8 A;  1RWN B;  2HBY B;  2LA6 A;  3AT1 B;  3MOZ A;  5EHH A;  1HW9 A;  5EDW A;  1S97 A;  3RGI A;  3C6T B;  1N36 J;  4WFY A;  2OI2 A;  5DDQ C;  2BW7 A;  3P4U B;  3V4M A;  3WQP A;  5DLG A;  4DV4 F;  3M2U B;  3M9O B;  4F4K A;  4CDI A;  2DBB A;  1QE1 B;  4AQY J;  4MKV A;  3R7B B;  2DVI A;  4I2P B;  1Q81 T;  5E3A A;  2DYA A;  1H2V Z;  2UXC J;  1YJ7 A;  1GEH A;  2GHV C;  4LQY A;  5KG7 A;  2XS7 A;  4QAX A;  1RWO B;  1BQM A;  1QAJ A;  2FVR A;  2VG5 B;  2VV5 A;  1DTQ B;  5B0C A;  3GJS B;  2XS5 A;  3IA0 A;  4ZVO B;  1C1C B;  2VD3 A;  3CED A;  4CWB A;  2BAB A;  1WI8 A;  2DHA A;  2NXC A;  1MML A;  3A1Y G;  3LW5 C;  4CNY A;  1D8Z A;  2QYC A;  5B08 A;  2GAH C;  4O0N A;  1B64 A;  1LWE A;  4ECZ A;  4K4T A;  2J7K A;  1YI2 S;  5LSO A;  5BJR A;  1XR5 A;  1NME B;  1HPZ B;  3TZY A;  1Q8I A;  2LQ8 A;  2RF2 A;  1DLO A;  4WFN Q;  3KMQ A;  2XC9 A;  5E3C A;  3KK3 B;  1IUJ A;  2B9E A;  3T01 A;  5KOX A;  2SXL A;  4RW7 A;  3ONQ A;  2JEI A;  3AQP A;  1JK9 B;  1RAF B;  4HI1 A;  4B02 A;  2W2P P;  3M6X A;  3K2Y A;  3MPD A;  1U48 A;  4JBC A;  1JLE A;  2DR6 A;  1KBR A;  3ISN D;  4QPX A;  4CLU A;  1LWF A;  3X1L B;  1Y11 A;  2DNO A;  4CLS A;  4LF8 J;  4LUB A;  2DHH A;  4DL6 A;  3F0N A;  1MMN A;  2DB1 A;  4JP8 A;  3CE8 A;  5D0H A;  3LP2 A;  1GMU A;  3GP9 A;  2XY7 A;  3MPU B;  4UTG A;  3ELH A;  4MJK A;  4CT9 A;  3VV2 B;  1Q79 A;  4FXW A;  4IR1 A;  3M2V A;  1ALH A;  5K8M A;  2RVJ A;  4CYR A;  3M32 B;  4FYY B;  1NM2 A;  1B70 B;  3TW0 A;  4UQT A;  4KAV A;  2JEJ A;  1FTC A;  1VQM S;  3ZZZ A;  1N52 B;  1R31 A;  2ZC3 A;  3CDE A;  2ACM A;  5BXI A;  1PC4 A;  1MMD A;  2V8G A;  5B7W A;  1FER A;  1GX6 A;  2OIH A;  1S1T A;  5F8N A;  5GAH I;  3M1V B;  2ZD1 B;  3MI7 X;  1S10 A;  1Y4Z B;  2W2Q P;  1G6B A;  3PY8 A;  2Z2M A;  1G4C A;  5F9L A;  2JC0 A;  2E5L F;  3NNH A;  4LFB J;  2G1D A;  3DI6 A;  2RML A;  2KHC A;  2KXH A;  4K0K J;  4DR2 F;  3C14 A;  1BQN A;  1D8Y A;  1R8P A;  3V6D B;  3IS9 B;  2FVC A;  8ATC B;  5DM7 Q;  3AOB A;  3K8W A;  2JSX A;  3QNW B;  1T9U A;  2MQ8 A;  1IBL F;  4Y2K A;  3PKY A;  4X62 J;  5E0O A;  2CNL B;  1S72 S;  1GMW D;  3NCR A;  2PC6 A;  2JEF A;  3PX0 A;  3W7B A;  4ED7 A;  3WBZ A;  4PQA A;  4RUC A;  3W2W A;  4YY3 F;  3PIO Q;  2FD2 A;  3KDO A;  1RP5 A;  1AJC A;  2EK6 A;  3NKO A;  2DR8 A;  1HFE L;  3H5U A;  3HD2 A;  1KHW A;  5K5M A;  2AF6 A;  4K7Q A;  3TG0 A;  1CLF A;  4B3O A;  5JJB A;  2XWY A;  1GMV A;  3CJR A;  2FQQ B;  4YDX A;  1SB6 A;  2BAN B;  2Z2L A;  2HGL A;  1LKZ A;  4TYB A;  1K0V A;  3LPY A;  1E2S P;  2AJ2 A;  2HGN A;  1NB7 A;  3R9L A;  1NK8 A;  1UEK A;  3JXO A;  3CSK A;  2FJA B;  4A46 A;  5IWA J;  4B17 A;  4E0D A;  1OQ3 A;  1U4B A;  1S6O A;  3G6V A;  2GQQ A;  1F1B B;  4O4R A;  4YR0 A;  3GII A;  5J2P A;  3D28 A;  3L09 A;  1QVF R;  2BA9 A;  4KO0 A;  3DRP B;  2CQ3 A;  4ZP6 A;  1TFY A;  1KOO A;  5SUH A;  2VOP A;  3AD9 C;  1X8D A;  3IGN A;  1TUG B;  1NKB A;  3KNA A;  2DR9 A;  4KHM A;  1S77 D;  5SZT A;  3HHL C;  1WTB A;  4PG4 A;  4NLO A;  4FNH A;  1K44 A;  5D77 A;  2X7I A;  3FBF A;  3JAM U;  4ED0 A;  3IO1 A;  1RU1 A;  5F8M A;  1NDC A;  4FN5 A;  2LQJ A;  3IWN C;  7FD1 A;  5HRO B;  3WC2 A;  3KYL A;  2ZFH A;  4IG3 B;  3GYN A;  3GQC A;  1N33 J;  2LKZ A;  1CJT A;  4MIB A;  3K8V A;  3PW5 A;  3G4S S;  2EBG A;  5EWG A;  2Z4P A;  3NLC A;  4DV7 J;  3DXB A;  4HDG A;  4YS2 A;  2OD6 A;  4KV8 B;  4ZPD A;  2XY6 A;  1GH8 A;  1E6V A;  3MM9 B;  4WXO A;  5CAB A;  4OYW A;  1TKX A;  2OJ3 A;  1EJJ A;  1ARO P;  1W2B R;  3Q24 A;  2XYP B;  5A8K B;  1HYS B;  1EB0 A;  3K0J A;  3KLI A;  1MWY A;  1ZA2 B;  2XMT A;  3RZA A;  3BRE A;  2NSC A;  2G1H A;  4GKJ J;  2RKI A;  3TJ8 A;  2YKA A;  4JI1 F;  1HQU B;  2ATL A;  1VIS A;  1RAC B;  1HWU A;  3HI9 A;  4C11 B;  1NB2 A;  5A8R B;  2HSE B;  2OFG X;  3D6F B;  3KLF A;  2HGM A;  1YVF A;  1KH4 A;  2QG9 B;  3A8K A;  5THW A;  4ELT A;  3L7U A;  1RZM A;  4KKO B;  2QLW A;  4TLQ A;  4ANE A;  1V5V A;  4R0E A;  1ZAV A;  3GFX A;  3NKM A;  1C4C A;  3KJV A;  3M2R A;  3QAE A;  4PG6 A;  2J6S A;  2ASL A;  2IRY A;  2AGQ A;  4WP3 A;  4DUT A;  4PRF A;  1WEZ A;  3F73 A;  1Q8K A;  2OKQ A;  1NK0 A;  2IDE A;  3RUB L;  1FEE A;  2C3U A;  1X0F A;  2PSZ A;  1WF2 A;  3F44 A;  4FPR A;  1N5Y B;  1FXD A;  4EU0 A;  2HRY A;  3TZZ A;  4DX6 A;  4O3R A;  4NLS A;  3K5M A;  1LNQ A;  1S6Q B;  5T7L A;  2MST A;  2KFY A;  4ATN A;  3NGK A;  4ZVH A;  4UZB A;  5KT3 A;  4EBC A;  4PWW A;  4MK8 A;  2U2F A;  1CBK A;  2H4W B;  1R89 A;  4B9U A;  1ZZN A;  2OPQ B;  2YNF A;  1XMO J;  1FFG B;  2FPH X;  1KEK A;  2J6U A;  2IVY A;  1HR0 F;  1WSV A;  4I6A A;  2MZQ A;  1X4A A;  2FTR A;  1ZBT A;  1BLU A;  1YX2 A;  4F7V A;  3QLH B;  3JTN A;  1NPK A;  4F4Z A;  2IYI A;  4ZVU B;  4L75 A;  2CQ1 A;  3DDK A;  2AP6 A;  1HAR A;  2P9G A;  2DGU A;  5GOV A;  4ZCK A;  1FI4 A;  4HH1 A;  2R2T A;  3LOU A;  2HMI B;  2HFN A;  3I4P A;  3J7Z 5;  2M0G B;  4HHH A;  1FRI A;  2DNP A;  1WDT A;  3FC9 A;  2QT7 A;  3PEJ A;  3EGZ A;  1Q5Y A;  1FNM A;  3ULH A;  5D78 A;  4ZIT A;  3JYT B;  2MQL A;  4UY8 T;  2ZJQ Q;  2Z0G A;  4JI3 F;  1WD6 A;  3TA2 A;  4CT8 A;  4NI2 A;  3HZG A;  4ENO A;  1S5Z A;  1Q8L A;  3VGV A;  1A7G E;  1OWX A;  2A2D A;  1KHL A;  2EG2 A;  2ZVI A;  4EMD A;  5DRK A;  3EZO A;  1JMT A;  1S9G A;  1UL3 A;  1GT8 A;  3K58 A;  3JSY A;  3S6E A;  2HHP A;  3MPW A;  5KFK A;  3EM1 A;  5DS7 A;  5DG7 A;  2RB7 A;  1MN9 A;  1EET B;  4FXV A;  1KQG B;  2JLG A;  5D4O A;  4DLG A;  4MKB A;  2C2R A;  2BKN A;  4CO2 A;  4FYX B;  3VAH A;  3RAM A;  2AYG A;  3Q22 A;  5LMN J;  1KHJ A;  3G96 A;  4LFC F;  4DR4 F;  5G0R B;  2AYB A;  2RIJ A;  1GTH A;  1LW2 B;  4ECR A;  3N6N A;  1UCN A;  4L76 A;  2R3V A;  3Q8U A;  3TWZ A;  5A76 A;  3PDN A;  2UVU A;  5GAH U;  4KE5 A;  4MK7 A;  2AEJ A;  4R5P A;  2JC1 A;  3T00 A;  1FX4 A;  2H5J B;  5H9E J;  4B3R J;  2QTW A;  1YJ9 S;  3CCW A;  4LVO P;  2XMV A;  3AB4 B;  3PG9 A;  4ILR A;  2HZC A;  3FEX B;  2NSB A;  2PFD A;  4OX9 J;  4WWS A;  4M8L A;  4ECV A;  2GZO A;  4AE5 A;  5KFN A;  3D0G E;  5KFY A;  3J7A N;  2DH9 A;  1S4F A;  1SQG A;  4WKY A;  4QIW D;  3A3N B;  1HQE B;  1JLA B;  2RDJ A;  2KT5 A;  3KG1 A;  3ETM A;  2XLI A;  4ELV A;  4E98 A;  2FIU A;  4B3S F;  4UPH A;  1CJV B;  1T9V A;  4J9U E;  3SQO P;  1N0U A;  5KFE A;  3SSS A;  1NK9 A;  5E7O B;  3J81 U;  3RB3 A;  3V4I B;  3VGS A;  2BJ8 A;  1NPP A;  1RWM B;  4X4S A;  2OML A;  2YWG A;  3UI3 A;  3GJQ B;  2BJ1 A;  1G1X A;  3EZU A;  4ZN3 A;  4P6Q A;  4F3O A;  1HNV A;  1S6P B;  3QIP A;  1KLM A;  3EDR B;  2BE9 B;  1URA A;  1TKD A;  2F8M A;  3DOM B;  2W5W A;  3MR6 A;  2B9Y A;  1PAE X;  2AWZ A;  1N48 A;  4IH6 A;  1YHQ S;  3TAQ A;  1VQ4 S;  4UW2 A;  2W25 A;  4JYA J;  4B9L A;  1ZM4 A;  2F5G A;  2ADB A;  1NLK L;  4NA2 A;  2P6S A;  4N56 A;  2DRA A;  1B0V A;  2XRG A;  1L3S A;  5J1E A;  2GQC A;  2HNY B;  2DCU B;  3OXG A;  1XN9 A;  1CJU B;  1S1W B;  2VG7 A;  1KVK A;  4V19 J;  4YR1 A;  4WP9 A;  4EGL A;  2EEY A;  4KGM A;  1I94 J;  5L46 A;  2N82 B;  3F56 A;  4NWB A;  4UOP A;  2ILZ A;  3DLB A;  3DGP A;  5LJ5 Y;  3OW2 R;  2DCL A;  4Q43 A;  4IG0 A;  4MHX A;  1RKI A;  5CCL A;  2QYG A;  1SJR A;  2CQH A;  5IT0 A;  1FCA A;  4EWT A;  3JQM A;  3C3L A;  2C1E B;  4BS2 A;  4IFV A;  1S9F A;  4KGX B;  2DNN A;  4PYD A;  1S0V A;  3CMR A;  4RO0 A;  4KFB A;  1YSJ A;  4ZLP A;  4QIV A;  4QU6 A;  4TY9 A;  1KP6 A;  5BR8 J;  4DR1 J;  2GVD A;  3AFG A;  3BQ2 A;  5DLV A;  1F6T A;  3BPS P;  4P71 A;  3L7O A;  4NLD A;  1RWV B;  3CJK A;  2BQR A;  1WEY A;  4DR7 J;  4A48 A;  2FDN A;  3CJQ A;  1B4S A;  1HBN B;  4LF9 F;  4RBU A;  3T02 A;  1VDH A;  3GR0 A;  1J2V A;  4CNZ A;  1M5P C;  1FD2 A;  3QFW A;  2XSF A;  4RW8 B;  1R0A A;  4KYZ A;  1VLO A;  2BJ3 A;  3CPW R;  2AGO A;  4JI5 J;  3CME S;  1CUL A;  3KUE A;  4PXD A;  2VHG A;  2XMW A;  4NCB A;  5I3U A;  2JL9 A;  4DQI A;  4ZVG A;  3UDE A;  2RU9 A;  1DAX A;  3SV4 A;  1HBO A;  1KFS A;  1JXL A;  1X4F A;  4LF7 J;  1IR2 A;  3FZ2 A;  4O3O A;  4ZP8 A;  3NVL A;  2I2Y A;  2B43 A;  5BYR A;  4OI2 A;  1RT2 A;  1U1P A;  1RTJ A;  1DUR A;  3DYA A;  4WFZ A;  4QW8 A;  4QR1 A;  2H9Z A;  2E1M C;  1ZAW A;  3RAQ A;  5AXK A;  2ZKT A;  1GFW B;  3OUY A;  5K8P A;  2QX0 A;  1GMW A;  2RU3 A;  2DY1 A;  3MAA B;  4NWX A;  1FDD A;  3X3U A;  1X60 A;  4RNM A;  2J9D A;  4QWE A;  3DFE A;  1U24 A;  3EZ5 A;  1DHM A;  4EO6 A;  3MM7 B;  4J9M A;  3PKM A;  4YME A;  4OZN A;  3IRW P;  3JTP A;  1R7I A;  4ZPT R;  3C15 A;  2VIC A;  1JLF A;  4Z2X A;  3PTW A;  4MAK A;  2VPX B;  2IM3 A;  5KFA A;  5KFJ A;  1KH5 A;  2GVZ A;  1L3K A;  2RQC A;  1PG5 B;  1Q7L B;  3M2V B;  2QO3 A;  1NDK A;  3G8Q A;  3C6U A;  1RT1 A;  4FZV A;  5FLX U;  4RW9 B;  3DRS A;  2COL A;  3SQG A;  4OYX A;  5INH A;  2MZJ A;  2OPS A;  2UUC F;  1DTT A;  3H42 A;  1H3D A;  2ZOM A;  4DQR A;  1T0T V;  3VGT A;  3H25 A;  1IKY A;  1N6Q A;  2IA0 A;  4G65 A;  1HNZ J;  1IN0 A;  1RE1 B;  2AJ4 A;  2LQ9 A;  3M05 A;  1X5O A;  1YJW S;  3OSN A;  2CQ0 A;  2YXL A;  1J5E J;  2FC8 A;  3PAC A;  1YIJ S;  3D6H B;  2F7V A;  1VHI A;  4DMZ A;  1UA0 A;  3QFH A;  2HQI A;  4N77 A;  2WVC A;  1X5P A;  4WYW A;  2I38 A;  4LBP A;  5F8H A;  4CLY A;  4JI8 F;  4C8Z A;  3MD1 A;  4PWU A;  4J9R A;  2E44 A;  2ABY A;  3R1H A;  3P8B B;  5KG1 A;  3TVZ A;  2OO4 A;  4N7T A;  3AQO A;  4B08 A;  4FDJ A;  2QLF B;  4B9M A;  3E3X A;  4X4Q A;  1W25 A;  3I0S A;  2FHM A;  4X64 J;  1ZM3 A;  2FVP A;  3IG1 A;  3ETO A;  2UP1 A;  5D4L A;  3FSY A;  4KIA A;  1NJX A;  4JV5 J;  4TQR A;  1AZS A;  3TA0 A;  1QD1 A;  4DXL A;  5H9E K;  2KHD A;  5F41 A;  2DHS A;  1T02 A;  2DKO B;  2AIR B;  2R7T A;  4ED6 A;  1U26 A;  2RRB A;  3TX8 A;  4DR6 F;  4F0H A;  2A1B A;  4NOH A;  2ALY B;  2MKJ A;  2IBK A;  3I32 A;  4NLX A;  1HNW J;  4MK9 A;  1G7C B;  2FHO B;  3CD5 A;  1V3R A;  3SSQ A;  4NXN J;  2ZBQ A;  4ZPW R;  4C3L A;  3HFK A;  1IM4 A;  2ZE2 B;  3MEK A;  2N7Y A;  3FK4 A;  1GXL A;  4W98 A;  1HJK A;  5FJ4 A;  2EFO A;  1NHU A;  4BWM A;  4DU8 A;  1KDN A;  2KO1 A;  2DD8 S;  2RT3 A;  4K5S A;  1P9Y A;  4RX6 A;  1YJV A;  4W4M A;  4KJG A;  1RT3 A;  4M5G A;  2CJQ A;  2EBE A;  3QRR A;  3QWU A;  3CC2 S;  2DHX A;  4RBV A;  4CH0 S;  3EYZ A;  1TK8 A;  3QGH A;  1PYT A;  4KHR A;  1BUX A;  4ZVS B;  3KTQ A;  3N0V A;  4QIG A;  3ZZR A;  1N5T A;  5K4P A;  4QYR A;  3CTR A;  2NS1 B;  3PJW A;  3VAG A;  1HNX F;  1DFD A;  4ZJQ A;  2D7S A;  4NA3 A;  4A8Q A;  1HWK A;  4IDK A;  4Y3C A;  2D69 A;  3PW7 A;  1APS A;  2IM1 A;  4LBI A;  2QGF B;  4OL8 A;  3FZB A;  3HUL A;  5HK4 A;  5I4M A;  5KG3 A;  4IRD A;  4DFP A;  4P75 A;  5HQM A;  1VC5 A;  3BM7 A;  1Q5V A;  2CZ9 A;  2LMI A;  3NGT A;  1K1S A;  2ZBC A;  3BYP A;  1WOR A;  2DNG A;  2OEJ A;  1E3C P;  3CCE S;  1FK9 A;  2XGP A;  3QAT A;  2IJR A;  2LYV A;  3R2D J;  4LFA J;  2JFD A;  2VA2 A;  4RWW A;  4CO0 A;  1VQS A;  1VJW A;  4DFJ A;  1KSP A;  4KJI A;  1HI8 A;  5HJY A;  1TR0 A;  2EC2 A;  4ED8 A;  1V5I B;  3CDW A;  1TTH B;  2ZHA A;  1SJ3 P;  4CP5 A;  2F40 A;  3MCM A;  3J80 U;  2R7X A;  2RKI B;  3OPK A;  2WVF A;  1PAU B;  5EGH A;  2DO0 A;  4JV1 A;  3KLG A;  3OXL A;  3IBW A;  1VQL S;  5J2M A;  3JB9 k;  2CRL A;  9RUB A;  2DR5 A;  4GC6 A;  2Y8W A;  2NYH A;  3H2U B;  2HIQ A;  4KH0 B;  5KFW A;  4GTZ A;  2ATC B;  3CIZ A;  2CQI A;  4JV0 A;  4DV3 F;  4CYU A;  1VRU A;  2W4D A;  8AT1 B;  2HHH F;  1H2U X;  3ET6 B;  1JWW A;  3QMQ A;  1FKP A;  2NPI A;  4DV0 F;  1R3N A;  3OJU A;  2CPE A;  2UU9 J;  1Q53 A;  1NPR A;  3KJF B;  2CJA A;  5L1I A;  4PAA A;  1RTI A;  3BR8 A;  4ZMM A;  3FDS A;  2R7V A;  1FDA A;  3D2W A;  1LQ9 A;  4LR2 A;  4NLW A;  3IN5 A;  5LXY A;  1R6Y A;  3P3D A;  3U02 A;  2HHQ A;  1AXQ A;  1VQ8 S;  4CLW A;  2FLN A;  6FD1 A;  2K7J A;  3LAN A;  3ADA C;  1SIW B;  1ZTW A;  3AJ1 A;  2W4P A;  1D9D A;  2YNH A;  1U1K A;  4MYT A;  4FXD A;  5LOQ A;  4M5I A;  5KFI A;  2LDY A;  1DY3 A;  1FRL A;  1YRX A;  2ROG A;  1Y5L B;  2VPY B;  4H54 A;  3C2P A;  1D3W A;  3RB4 A;  1HW8 A;  3MUV P;  2E7W A;  2HQD A;  4P74 A;  1OYE A;  4YQW A;  2P9E A;  4ALZ A;  4MIA A;  2D74 B;  2IUC A;  2AX1 A;  1TKT B;  4U8V A;  2O67 A;  5K8N A;  3Q83 A;  2W24 A;  2XSJ B;  4P73 A;  4JI0 F;  4CXU A;  4DOZ A;  4U9R A;  3GJR B;  3G6Y A;  4O3P A;  2R2S A;  5CQG A;  4LRE A;  5E3P A;  3MPY A;  2EPI A;  4N8O A;  1I3O B;  3I55 S;  4DL3 A;  2W2N P;  2MLX A;  4NLP A;  4LT6 A;  3CJ5 A;  3MM8 A;  4ECT A;  2ADC A;  3GLJ A;  2KFZ A;  5DG8 A;  4P2F A;  4JB8 B;  1VQN S;  1UJ4 A;  3MTJ A;  3NG8 A;  2MQN A;  2HS4 A;  3HX9 A;  1XTZ A;  1C0T A;  4X65 J;  3LXQ A;  2KG0 A;  1EIY B;  3Q86 A;  4J9S A;  1SH0 A;  2OD4 A;  2H54 B;  2BQ3 A;  1TZ0 A;  4ZIW A;  5KT2 A;  2FJE B;  1XNQ F;  1OY6 A;  3CW2 C;  4DG1 A;  4CTA B;  3FJ2 A;  3W64 A;  3W2V A;  5KFR A;  3NGU A;  2FVQ A;  5M2U A;  4NYZ A;  4ZVP B;  1VC6 A;  4DCJ B;  2R7O A;  3PIP Q;  3TUZ C;  2OFH X;  1VMB A;  3I5C A;  3QWP A;  2ZVS A;  3ITH B;  1ELZ A;  2HND B;  4DV5 F;  5LQQ A;  2AYE A;  2NZC A;  3LP0 B;  3HMJ G;  2KXF A;  4OZ0 A;  4F4X A;  2F3J A;  4GTX A;  5D0G A;  1JIH A;  2YKN A;  4ICL B;  3P5B P;  2UXD F;  2MKH A;  4ELU A;  2CAD A;  4DJB A;  3OTO F;  1RAJ A;  5M2R A;  4ZHR B;  4M94 A;  4K4Z A;  3BPD A;  2KG1 A;  3HT3 A;  3LF0 A;  2HPU A;  4KC5 A;  4DL4 A;  3AOA A;  1RT4 A;  3PX6 A;  2JJ4 D;  4Q2L A;  3PHE A;  5KFU A;  1XMQ F;  5GAE I;  3BGL A;  4GVB A;  2QMW A;  1T11 A;  2L3M A;  1HQ2 A;  4KJD A;  2H1Y A;  2AJQ A;  3DLE A;  2E66 A;  3ILJ A;  4IFY B;  3M8Q A;  1FVQ A;  2NRE A;  3MUR P;  5DLT A;  2R7U A;  4LSL B;  5I42 B;  2CJ9 A;  4IOC Q;  1B0P A;  3TUP A;  1ED8 A;  1JXV A;  1P9Q C;  2WVE A;  3GZ7 A;  1C0U B;  1GTE A;  5HAN A;  1QY7 A;  4EFA C;  2PMZ D;  3DN9 A;  4DWI A;  2IYG A;  3DRY A;  2MPU A;  1PC5 A;  3HVA A;  3AAW B;  4OYB A;  3BJY A;  2MHN A;  3QT6 A;  1EQJ A;  2C2N A;  1EHW A;  2GS8 A;  4UOO A;  4IR9 A;  2QLJ B;  5LSR A;  1AFJ A;  2N7C A;  3KLV A;  3DGP B;  3V5R A;  3SFG A;  3GYG A;  4MFB B;  1YBT A;  4LQ9 A;  4F8R A;  2WVB A;  3MED B;  1KON A;  5T14 A;  2V8H A;  2N3O A;  3GB0 A;  3DM2 A;  3R7N B;  4I2Q B;  2R8J A;  1FJG F;  4H4K C;  2ZJR Q;  1RWU A;  3I5B A;  5IQQ A;  1TL7 A;  3IMQ J;  1ELY A;  4PG5 A;  1IR1 A;  3OHA A;  4B3T J;  3JQJ A;  2GLQ A;  4FBT A;  4DCP B;  2DNM A;  2DTJ A;  3PX4 A;  2IRU A;  1RHJ B;  2DXE A;  4TKT A;  2OPP B;  2JH3 A;  3ZC4 A;  3C6T A;  5J1P A;  4OHX A;  4OJG A;  1GNK A;  3G86 A;  1R0A B;  4CH7 A;  3M2U A;  1Q1K A;  3C46 A;  3T3F A;  4IUF A;  3SXL A;  2CVE A;  4NE9 C;  3MUT P;  1VK3 A;  1BE4 A;  4E8U A;  1VRT B;  2BDP A;  3OL8 A;  3CD7 A;  2UXC F;  1QE1 A;  5DQG A;  4ECY A;  3CUL A;  4I2P A;  1IBM J;  4B3M F;  3WDO A;  1HKA A;  4KAY A;  3WIU A;  5AT1 B;  1MNE A;  4Y0F A;  1S9E B;  3OFH A;  5DO2 A;  2P9C A;  4DHV A;  3JQK A;  1BQX A;  2FZG B;  1UVJ A;  3DRR B;  3NBP A;  1RT2 B;  4F4W A;  3V6K A;  3TEG A;  3DYA B;  1FWL A;  4QIF A;  4ZG9 A;  2VG5 A;  1DTQ A;  4QCL A;  1C1C A;  2C2K B;  3QO9 B;  2PII A;  2QN6 B;  2HAF A;  1YTY A;  2HFS A;  1IKW A;  2ACY A;  2HUR A;  4ZCL A;  2QL9 B;  4USM A;  1HA1 A;  1EKR A;  3QJL A;  1V3S A;  4LRF A;  4HVZ A;  4F04 B;  1Y5I B;  4CO1 A;  2WOM B;  2GA7 A;  3AA8 A;  3QRP A;  1A9N B;  1IR0 A;  4IO1 A;  2GJF A;  2DGW A;  1HPZ A;  2J9C A;  1G3O A;  6FDR A;  1NHV A;  3RBD A;  3IGY B;  5CAA A;  2OHD A;  1RT7 B;  2G0I A;  2DRD A;  3KK3 A;  2KJW A;  3FEY B;  5ETP A;  3FSI A;  1URR A;  4ZA1 A;  1HBU B;  1ANI A;  2FJW A;  1OJ4 A;  4OZL A;  3M8S A;  4TU9 A;  2CQD A;  3NGR A;  1S7I A;  1Y0H A;  3M9N B;  4OI1 A;  1GK8 A;  2AHO B;  1NJI T;  4LF8 F;  4KR0 B;  2CPY A;  1FJ7 A;  2J8A A;  4OYP A;  2RE1 A;  1M5H A;  4AXJ A;  1RAH B;  5HJX A;  4TYA A;  1EI6 A;  3HDS A;  4DV4 J;  3U1N A;  2ZH3 A;  3O3L A;  3HM9 A;  2ZUA A;  3PRD A;  3R6G B;  3BB5 A;  2JHE A;  4HLB A;  1LOU A;  3TA1 A;  5LSL A;  2HFU A;  1O99 A;  3I96 A;  1WC3 A;  5HMZ A;  4JI2 J;  2WSC C;  2VOD A;  1H2T Z;  4ZVR B;  3POT B;  1JLG B;  1S49 A;  4WE1 A;  3ZTO A;  2YWW A;  3E8O A;  3M32 A;  1QUV A;  3RBE A;  5E3Q A;  4ED4 A;  4ED2 A;  4DF4 A;  2Q79 A;  5LRM A;  2KRR A;  1XR6 A;  2VQR A;  2IHR 1;  3R1L A;  1MG7 A;  3M30 A;  3HVT B;  4S0M A;  2NXJ A;  4LFB F;  3IG1 B;  2PMH A;  4Z7C A;  4I6Y A;  3M1V A;  4K0K F;  2ZD1 A;  2IAJ B;  3D3C J;  5KT5 A;  4CM2 A;  4YEA A;  4X2B A;  4WYL A;  1AZS B;  2GNK A;  5CYM B;  2EG1 A;  1N8R T;  3T6B A;  2IA6 A;  3U7J A;  2GIQ A;  5E2Q A;  1MW7 A;  3EJM A;  3V6D A;  3IS9 A;  4C4W A;  3THT A;  1S12 A;  4Y2A A;  1VIX A;  1ZOT A;  3HHL B;  2W4C A;  2UXB J;  1MWQ A;  4Y2M A;  1ZED A;  1U2R A;  2Q6C A;  2DT9 A;  4QQB A;  1UWA A;  3GJT B;  2VDI A;  3GWC A;  4WZM A;  1RU2 A;  3MEE B;  2J0X A;  2YKO A;  1N2L A;  3VZI A;  2ZHO A;  2HHU A;  3PHT A;  5D4N A;  3CCR S;  3TI0 A;  3N6L A;  4NPO A;  2UUB F;  1CVJ A;  1FEH A;  5IXU A;  2DGX A;  3QID A;  3EVO A;  2MQQ A;  1SUQ B;  3FBC A;  3MK1 A;  4ZCI A;  2BAN A;  1WHX A;  1IKV B;  3BV8 A;  5F9N A;  5IWA F;  2FLL A;  2YKP A;  4LBH A;  3D7S B;  4OJH A;  2DNK A;  2G2O A;  4ZLJ A;  4CI0 B;  1MSW D;  4K2J A;  4UQG A;  3CO0 P;  5GAE U;  4K4X A;  4I69 A;  4CQ1 A;  1CC7 A;  3DYC A;  2V9W A;  2MZS A;  2W9C B;  1KRP A;  3TZX A;  1KH9 A;  3BGF A;  3AHP A;  1AUK A;  2MGZ B;  2XG8 A;  3UDL A;  3T19 A;  2R7Q A;  1VQ7 S;  1RWP B;  3Q8P B;  1U0S A;  2I8E A;  4ZDN A;  2VPZ B;  3DRP A;  3H20 A;  2ZEJ A;  4CO4 A;  4FYW B;  2AT1 B;  4Q7A A;  5DGA A;  3H4D A;  4Q5V A;  4HAC A;  3AJ2 A;  1VK8 A;  4BWJ A;  3OQ2 A;  2X98 A;  4QJV A;  3TJ9 A;  1KHN A;  1PBU A;  3UD3 P;  1Q0N A;  3W9J A;  3W1Y C;  5CZX A;  5K20 B;  1N5S A;  1U0H B;  2DGQ A;  2QZ8 A;  1HI1 A;  4DV7 F;  2J8S A;  2VKR A;  1YDL A;  2ASJ A;  3KLE B;  5HRO A;  1N34 F;  1U47 A;  3MMB A;  2D3O 1;  1Q95 G;  3MPV A;  1R43 A;  4IG3 A;  2QMX A;  2WW4 A;  1TL3 B;  4JV2 A;  1T94 A;  2QA2 A;  1RCX B;  3CVK A;  4YY3 J;  4ES2 A;  2GHP A;  1WJ9 A;  3FBE A;  3R7S B;  2DNZ A;  4KV8 A;  2VQE J;  3MM9 A;  2YY3 A;  2VPW B;  2DJW A;  2MYF A;  4GKJ F;  1WC1 A;  5KG0 A;  4N8N A;  5A8K A;  1HYS A;  2DHG A;  2CJY B;  4G1I A;  1XQI A;  1RYS A;  4OHV A;  2FB0 A;  3G8T A;  1O0P A;  1X7V A;  5L0E A;  3OR2 B;  5TJ3 A;  2O3D A;  3UW1 A;  4LRA A;  4NZ0 A;  4LIW A;  4CH1 A;  4QW9 A;  1NHK L;  2YWE A;  2WK4 A;  2MKK A;  2RH3 A;  1HQU A;  4P7V A;  4C8M A;  3MR2 A;  4AXI A;  3BF4 A;  1D9A A;  2DH8 A;  2VU5 A;  1FES A;  3K57 A;  1RAD B;  3QT5 A;  3UCZ P;  1YJN S;  4C11 A;  5A8R A;  1ZM2 A;  1WTF A;  4F2S A;  1BXN A;  1UJ5 A;  2LEB A;  3HO1 A;  2EW9 A;  2C2O B;  1H98 A;  1N4L A;  1KN6 A;  2YBV A;  4BC9 A;  3VAL A;  1NH8 A;  3LQV A;  3QSY B;  5C7P A;  2CYY A;  1LWC B;  1HMV B;  3R5J B;  4J9N A;  3E01 A;  3FFI B;  2RJZ A;  1RT6 B;  3QGP A;  1S0O A;  2XHC A;  4DL5 A;  2O5D A;  3MCN A;  1M5O C;  5KFP A;  1N5Y A;  2JRS A;  4RLE A;  1S4E A;  2BJE A;  1JB0 C;  3IAM 9;  2J7U A;  3PYF A;  1URB A;  2RQM A;  7FDR A;  1Q86 T;  1S6Q A;  3L4B C;  5A0Y B;  5HL7 Q;  1XMO F;  3OT9 A;  3G6E S;  4J9L A;  2XLK A;  2HLT A;  3NCP A;  3GV7 B;  4RW4 A;  4DUY J;  2Z8Q A;  2JZ5 A;  5C5J A;  2OPQ A;  2IY5 B;  1GX5 A;  1H74 A;  2OP5 A;  2V0N A;  4WJB A;  2X1A A;  2VON A;  1REV B;  3NWG A;  2NPF A;  3QLH A;  2VBY A;  2VBZ A;  4LF6 F;  5IFM A;  4HR2 A;  1A0O B;  4C97 A;  1YJR A;  2IVM A;  4RW6 B;  3A8I A;  4L74 A;  4G1P A;  4AL6 A;  2ZDP A;  2D9P A;  1C0T B;  1WI6 A;  2HMI A;  4K59 A;  5ADZ A;  1WEX A;  2M2B A;  2PI5 A;  5IT9 Y;  4Y34 A;  2DPJ A;  1VQ6 S;  3VTI A;  1T9X A;  4Y00 A;  3JYT A;  1TVR A;  5FDL B;  1Q7Y T;  3CWJ A;  2OGU A;  1RKJ A;  3NAI A;  1HHQ A;  4P72 A;  2ZNY A;  1MRO B;  1TL4 A;  2XHW A;  4DS4 A;  3M7V A;  5KFZ A;  1SCJ B;  5H9F J;  3THP A;  4C6A A;  1WUU A;  2VUG A;  4ILL A;  4WCE Q;  3BKF A;  3J7Z T;  4Q2M A;  3TVK A;  3Q8Q B;  2F63 A;  1NUE A;  4P2S A;  1EET A;  3FMW A;  2UUT A;  3TEH B;  2VBX A;  2IFX A;  4KGV B;  3I82 A;  3AH6 A;  4LF2 A;  5KFO A;  2YKN B;  1JLB A;  2FUG 9;  4DL0 C;  5ITH A;  1K9M T;  1T9W A;  1RBO B;  1J5O B;  1CG2 A;  2NCK L;  5G0R A;  4CRJ A;  3IGZ B;  4C8K A;  5CCM A;  1LW2 A;  3PVX A;  1RTD B;  2ZZN A;  2GAG C;  5IJQ A;  4YOE A;  5F3Z A;  4YB7 A;  2KTQ A;  1WSR A;  3CIM A;  2M8H A;  1WKJ A;  4LMZ A;  4OX9 F;  3FBB A;  1XNR F;  1JKH B;  4C3M A;  1HR0 J;  3CCT A;  2YVS A;  2CQG A;  2C42 A;  3MOJ B;  1KTV A;  2E7X A;  2F4V F;  2P5V A;  5EGE A;  3BBF A;  2DPI A;  3G87 A;  2KI2 A;  1RAI B;  3CMA S;  2V2Z A;  4C9D A;  1I5O B;  2E9R X;  2DNR A;  1ZM9 A;  1HQE A;  1JLA A;  3ZZO A;  4JUZ A;  4Q0B B;  1B7Y B;  3GG1 A;  3G71 S;  4QIE A;  1B99 A;  1PJ6 A;  4LSZ B;  1CJV A;  3VAF A;  5F8J A;  2IVF B;  2MY8 A;  2Y3Y A;  1KHV A;  2BBE A;  3WHI A;  1HI0 P;  4DBQ A;  2CAJ A;  4JI3 J;  3L7P A;  3V2U C;  5CHC B;  1U1O A;  3SDE B;  1UZH A;  5HO4 A;  3OTD A;  1CSJ A;  4ECS A;  2C3Y A;  4JYA F;  1S6P A;  3OR1 A;  4U7U D;  4UZC A;  2KVQ E;  3SMZ A;  4FDI A;  3FSX A;  3DOM A;  3I9Z A;  2VL1 A;  1KHK A;  4A8F A;  5KT6 A;  3V81 B;  5GAG I;  3MD3 A;  3W9I A;  3NOC A;  5AE2 A;  3DM2 B;  3RAX A;  4USH A;  4DR4 J;  3DPC A;  5IC6 B;  5JVH Q;  2WTF A;  1HD1 A;  1RQ0 A;  3BGR B;  2XCP A;  2HVI A;  3QJJ A;  4RUB A;  1VQO S;  2G9Y A;  3KKF A;  1CJU A;  1S1W A;  1SC1 B;  1FTR A;  1UKU A;  3SSR A;  2HQG A;  4DPT A;  4MY4 A;  1H7W A;  3D1Q A;  2CQC A;  3FCW A;  4MH8 A;  4C0B A;  1BWE A;  5L0B A;  1LW0 B;  1U09 A;  3HHN B;  2VAS A;  3BSA A;  4UOH A;  3SIP B;  4BDP A;  2YH1 A;  4HL9 A;  4O4G A;  1SKS A;  2Y1L B;  5HMX A;  4RBT A;  5C66 A;  3NAH A;  4DSL A;  3TAN A;  2BQU A;  4X4T A;  3SEO A;  1IJE B;  4PKD B;  2QSW A;  1VYA A;  3GE9 A;  2FJD B;  4Q8F A;  3NNC A;  1G2E A;  4AYB D;  1UVL A;  3MCS A;  4B3S J;  1XJW B;  2OSQ A;  1TL1 A;  1JJ4 A;  3BN7 A;  2BYC A;  3EPG A;  1KVI A;  1O51 A;  4KPY A;  1HBN A;  1S79 A;  3GMG A;  3NBP B;  5BYS A;  1CJK A;  3K5P A;  4DL7 A;  4OX7 A;  5HSP A;  2MLZ A;  2QIF A;  2DNH A;  2BM1 A;  2RS8 A;  4RW8 A;  2YQ1 A;  1HQA A;  3KOA A;  3D4J A;  4KBI A;  3TVY A;  1SKR A;  1IKW B;  4KGZ B;  1H38 A;  3MEG B;  4QWC A;  4LF4 F;  1IWA A;  4OYM A;  3TOQ A;  3AD7 C;  2C22 A;  3HT0 A;  2QRR A;  4WII A;  4BC7 A;  2E29 A;  4TVA B;  1M5K C;  4A8M P;  1X4D A;  3AB2 B;  4ZVE A;  1N88 A;  4TU7 A;  4FKX A;  2W7O A;  4DX5 A;  1KD1 T;  5F8L A;  4RU9 A;  3WX8 A;  4F36 A;  1YRT A;  2XTJ P;  4M95 A;  1L5U A;  2R8H A;  1VI7 A;  3D67 A;  3H59 A;  2B7B B;  4QWB A;  3UDV A;  3BZQ A;  4GO5 X;  4A8K A;  4USU A;  1EKS A;  5KFB A;  3MXH P;  4I7F B;  5U47 A;  3MAA A;  1OS5 A;  1WWH A;  3HZE A;  4I4B A;  1YBA A;  1KFD A;  3AOD A;  4V1A k;  2ROP A;  1JJC B;  4IOB A;  2NXE A;  2GO8 A;  4CLP A;  3MM7 A;  2MQO A;  3QGI A;  3HSG A;  4FYD A;  2ZKU A;  2XLJ A;  1IXK A;  3A3P B;  3H5S A;  1QDU B;  1W2I A;  2A0F B;  1Y5N B;  2GIF A;  4UUX A;  1VCT A;  1U1R A;  4JI4 F;  4HYK A;  1HDH A;  5B0A A;  2DR7 A;  5B0D A;  2VG6 B;  3IFE A;  4LF9 J;  4WE1 B;  1HNZ F;  1RXO B;  4MKA A;  3B78 A;  2DIT A;  3PM9 A;  1ZYQ A;  4RW9 A;  3MFI A;  3QT7 A;  1Y00 A;  2R42 A;  1J5E F;  8RUC A;  2B56 A;  2A6O A;  3M30 B;  3UNG C;  3N79 A;  5DQH A;  4ZLL A;  1BD6 A;  2B0G A;  5A2Q Y;  5H9F K;  4ZCM A;  3ZNU A;  1NJW A;  1X4C A;  3TX0 A;  1UW4 A;  2BE2 B;  1TAU A;  2Y1J A;  1TUV A;  3MMA B;  4DQS A;  1LXJ A;  3T6J A;  3VAI A;  2V8D A;  5F0U A;  1TQL A;  5KT4 A;  3MR3 A;  1VIO A;  1RBL A;  1IVZ A;  5IC4 B;  1FX2 A;  1GXU A;  4A8O A;  2AYM A;  1WKL A;  2F8H A;  2CWX A;  3SZY A;  2C3O A;  4UOF A;  3GIJ A;  4K8R A;  2XNR A;  4A4J A;  2IC3 B;  4LR7 A;  2CG8 A;  2R9L A;  4KH1 B;  1HNW F;  1UVN A;  2WBR A;  2J0Q D;  1FE4 A;  1ZZF A;  3LGH A;  1UAW A;  3M6V A;  1EX8 A;  3UE2 A;  4WU2 A;  3PYD A;  4J90 A;  2A18 A;  5C24 B;  5EWE A;  4DZ6 A;  2Z2Y B;  1I51 B;  3M6W A;  2W5V A;  4PUO B;  2ASD A;  2D1G A;  3BKT A;  2ZE2 A;  2YH0 A;  2ROE A;  1S1U B;  3BN4 A;  1BMQ B;  3UNY A;  2XM3 A;  3RB0 A;  3BSC A;  4R25 A;  2BR0 A;  1FKO B;  1JNR B;  3OL6 A;  4KHP J;  4UUW A;  2UUC J;  1ULR A;  3CJ0 A;  1FE0 A;  3OBI A;  4UF4 A;  1RI7 A;  4EYI B;  4DSE A;  4Y65 A;  1KKH A;  1DJ0 A;  5KFF A;  4HAC B;  1B7F A;  3SCJ E;  2IM2 A;  1S7H A;  5LMU F;  3OD2 A;  5GME A;  2VFV A;  2GJI A;  1P27 B;  1JNZ B;  4JI8 J;  2DNL A;  2MQP A;  3FKB A;  2CUY A;  5DGB A;  2FZC B;  2BOP A;  3RRK A;  3MMB B;  1ITP A;  2BUN A;  1NU4 A;  2AQ4 A;  3NMA A;  2G2Y A;  1O6X A;  1WC4 A;  4M5K A;  3T5L A;  5GAG U;  1FRM A;  3G82 A;  1AJA A;  2NXN A;  2JLF A;  2GCF A;  5FD1 A;  1D09 B;  4DUZ F;  3T5J A;  3NCQ A;  2HQC A;  3DLG B;  2J0S D;  1B3T A;  2EFG A;  2DXD A;  2BMB A;  2MB0 B;  4GRS A;  3TAM B;  1SKU B;  2VC1 A;  1SQE A;  3QZ8 A;  1RSC A;  3P96 A;  3T1Y J;  4DR6 J;  3ICL A;  3TUJ C;  3HHL D;  2XBP A;  2CVI A;  4PG7 A;  3EXY A;  3NMR A;  5IT4 A;  3DOK B;  3C16 B;  3VAJ A;  3SCI E;  4RU2 A;  1FWP A;  1K0T A;  3D9B A;  5M2P A;  4FS1 A;  3W8G A;  3JSM B;  3IWL A;  3ET6 A;  2CNK B;  3M9M B;  2ZH6 A;  3PYE A;  2F65 A;  4N5S A;  3Q89 A;  2QSF A;  4OYA A;  5J2N B;  2DK2 A;  3I31 A;  4B9T A;  3O2I A;  4NYP A;  3E01 B;  4TY8 A;  4GMK A;  1U2C A;  2O66 A;  3CUN A;  1F9H A;  4YHH F;  3NL0 A;  2M9K A;  3VQT A;  1TV6 A;  2GIR A;  4CIO A;  2GX8 A;  3VVU A;  1PGZ A;  5LT5 A;  1GAO A;  2ZM6 F;  2BOA A;  5KFV A;  5CD4 H;  3E51 A;  2A6M A;  4M5H A;  2ZIT A;  2DO4 A;  2EWH A;  3UN3 A;  4K4S A;  2V68 A;  3CCZ A;  3N5B A;  4RW4 B;  4WP8 A;  3JSR A;  2PN6 A;  1NCL A;  4Q8E A;  2C3P A;  1SH2 A;  2JOQ A;  2OTL S;  2NXU A;  4ER8 A;  3HKZ D;  2A2C A;  3GCW P;  4X4O A;  1RHQ B;  2B6A B;  2PT0 A;  4WKR A;  1SH3 A;  2PGC A;  4FF1 A;  1N32 F;  2VBW A;  3RBZ A;  3NNA A;  5HP1 B;  2N3L A;  2CNN B;  5ETT A;  3DMJ A;  1T8E A;  2YX1 A;  1R8C A;  1TKT A;  1Z1Z A;  2BAC A;  3N28 A;  2DGT A;  2XSJ A;  1T9Y A;  3H2V E;  1TVR B;  3HHK A;  4N76 A;  4PEO A;  3IXQ A;  5AXL A;  2IDL A;  5CD4 A;  4TQS A;  3VAM A;  2OLW A;  4P10 A;  5DJB A;  4KM4 A;  2GO9 A;  2R8G A;  4OX6 A;  3NS5 A;  2HHH J;  2CJX B;  4J9P A;  3HLU A;  5LL6 d;  1VQY A;  5D8H B;  2YWF A;  2R2R A;  4JOU A;  4Q44 A;  4DEZ A;  2OEM A;  2LA4 A;  3MF5 A;  5CYQ B;  4IKA A;  4DV0 J;  1EP4 A;  3WAX A;  1TU0 B;  5KFQ A;  2QL7 B;  4OZ5 A;  4YP3 A;  1JLB B;  1S99 A;  1IBK F;  3HFZ B;  3IBF B;  2QC3 A;  3M8P B;  5KFX A;  3GV5 B;  1Y3K A;  3UN5 A;  3MMC B;  1PJ5 A;  2RAQ A;  3P45 B;  3MAH A;  4C2M A;  2V4Q A;  4PZV A;  4FDF A;  2QA4 G;  2IRX A;  3GTY X;  2V34 A;  2AX0 A;  2ERR A;  2BE7 D;  1EAY C;  4CTA A;  1FF2 A;  2O01 C;  5C42 B;  1IM6 A;  2MJU A;  4ZG7 A;  4URQ U;  2FC9 A;  5HQ8 A;  3ITH A;  5KFG A;  2HND A;  1CQN A;  1C1B B;  1U8W A;  3LP0 A;  3BH7 B;  2KH9 A;  1NK4 A;  1XK8 A;  4NLG A;  4ZOS A;  4DV2 F;  5AJ3 F;  3DC2 A;  4F50 A;  4ICL A;  2P2C B;  3CO9 A;  3M8Z A;  4CXS A;  4NLR A;  2KB2 A;  2Q1L A;  3T1H J;  2YQ0 A;  4X4V A;  1MU2 B;  4ZHR A;  5A8W B;  4NWJ A;  1TFW A;  2ASY A;  3PXG a;  1VFJ A;  1RTH B;  3A4T A;  1UVK A;  4WIQ A;  2GSU A;  4C98 A;  1EW8 A;  4JI0 J;  4ED1 A;  3W65 A;  4OI4 A;  4AT1 B;  2AZ3 A;  2W2O P;  4IQM A;  3HF5 A;  4RL1 A;  3KLH A;  4GKK F;  1R0C B;  2DEI A;  2UZA A;  4ZPV R;  3BKU A;  3J7Y I;  4IFY A;  4M5N A;  4C0H A;  2M5Y A;  2MKC A;  1Q78 A;  3OR1 B;  4LSL A;  2OAU A;  5I42 A;  2GC8 A;  1OQ6 A;  4FF2 A;  4NYO A;  2W5S A;  4HDH A;  4L3K A;  1T7P A;  4IRC A;  1PBA A;  1C0U A;  2RUS A;  3CDU A;  1XNQ J;  2JX2 A;  3ZTR A;  1FDN A;  4MTP A;  4PXC A;  2QA4 S;  1R6V A;  2MQM A;  2XMK A;  5HRT A;  1BC6 A;  3E2E A;  2L9N A;  4CM0 A;  3MK0 A;  3I0R B;  4DLE A;  2EFN A;  2H65 B;  2WB4 A;  4DV1 F;  2H4Y B;  4DV5 J;  3R5A A;  3K89 A;  2MKS A;  3PYG A;  2LXI A;  2PD1 A;  2OEK A;  3TJA A;  3TR5 A;  1U1L A;  1NKC A;  2ZH5 A;  4MFB A;  3ZTQ A;  1FWK A;  2UXD J;  3VAK A;  3EDQ B;  2X1F A;  1T05 B;  3MED A;  4ECX A;  4IQX A;  3UCU P;  1OIA A;  5G4D A;  1D1U A;  4O4G B;  1JXE A;  3OTO J;  5LXR A;  4W92 B;  4FVM A;  4I2Q A;  1RYR A;  2H51 B;  1SJ1 A;  2IPO B;  1DQ8 A;  4NEZ A;  4DR3 F;  1RLD A;  3MGJ A;  2QLB B;  1R27 B;  2GMH A;  4C48 A;  2J0W A;  3L95 X;  3CJS A;  1TL1 B;  4FVC A;  2Y0S D;  5A6W A;  4WK3 A;  1VJQ A;  1N56 A;  2BRK A;  5IV3 A;  3UCG A;  1B0T A;  1XMQ J;  3W5X A;  3MM6 B;  3I56 S;  3KMS A;  2YNG B;  3CCJ S;  1CJK B;  1NJZ A;  1QSL A;  2OPP A;  4CLL A;  2PE8 A;  5J2Q B;  1IBM F;  4K4V A;  2E1R A;  2Y0B B;  2ZWO A;  1VRT A;  4K50 A;  4RUA A;  1M90 T;  4GC7 A;  3ZO7 A;  4FP9 A;  4X4P A;  4CCH A;  2J76 E;  3LO3 A;  2DGS A;  2RDD A;  1S9E A;  4ED5 A;  1X0P A;  2QJ3 A;  3DRR A;  3DLK A;  2UUA J;  2ALZ A;  2MTL A;  3KUG A;  2BJ7 A;  3QO9 A;  4F02 A;  1RHR B;  2PMW A;  3B4M A;  4C8Y A;  4OJ1 A;  4KTQ A;  4LF1 A;  2HVZ A;  1Q82 T;  1HNI A;  4AND A;  3HVR A;  3H8Y A;  3DRX A;  1IKX A;  3WX4 A;  2W7P A;  4G3I A;  1WHV A;  1WOP A;  1NK6 A;  4ZVQ B;  3LP1 B;  3HJV A;  1DZ5 A;  2RD5 C;  2WOM A;  1ZPV A;  2W8D A;  3H98 A;  4NZ6 A;  1FJG J;  3KHR A;  4DR5 F;  3EVM A;  5IQ6 A;  5C2C A;  2DXF A;  3BO2 A;  4OFZ A;  2G4B A;  5DLF A;  2VDH A;  1QAI A;  4ANC A;  2ZH9 A;  1RT7 A;  2WZ1 A;  2B5J B;  2Z58 B;  2ZOG A;  4PR6 A;  3Q8S B;  2M88 A;  4DU7 A;  3R2C J;  1VLY A;  1HBU A;  5KFH A;  2K1R B;  5KG5 A;  2XMA A;  4RPF A;  2PEB A;  3W5Z A;  2CXE A;  3TZW A;  2Y8Y A;  4MIW A;  4EBE A;  1YLX A;  3T9N A;  5DM6 Q;  3RR8 A;  2HQF A;  1Z2L A;  1S1X B;  1E6Y B;  2HLU A;  5F3T A;  4EYH B;  1UZD A;  4O3Q A;  2ZNZ A;  1NKE A;  1IWG A;  5GRR A;  2HVE A;  2HYI B;  3UPF A;  4L73 A;  4JI2 F;  2FYX A;  2A3J A;  1VQ9 S;  4V19 X;  1F2H A;  1CPZ A;  1V9O A;  4U67 Q;  2IJF A;  2R7W A;  4B3M J;  2X3D A;  3SFU A;  4O44 A;  3ISN C;  1AUD A;  3POT A;  1JLG A;  2IBO A;  3BO4 A;  4ZP9 A;  2RSQ A;  4O0I A;  4A8W A;  4J7C A;  1U1Q A;  2YWH A;  1HWJ A;  2CZ4 A;  2OMO A;  5EGY A;  3S7R A;  2X1B A;  4IRK A;  2L48 A;  1SHN A;  1YJT A;  2YNI B;  3BS9 A;  1HBM B;  1T03 B;  1OSC A;  3HVT A;  1NND A;  1NAQ A;  5HN0 A;  1N54 B;  2FGO A;  3QQC D;  2CA9 A;  2AZ1 A;  4OZ3 A;  1ALJ A;  2IAJ A;  3HKW A;  1VRQ C;  4J9V A;  1FRX A;  3LGM A;  4DN9 A;  3D3B J;  1WEL A;  1Y9O A;  2UXB F;  5CYM A;  2WW8 A;  3IGV A;  1IQZ A;  1YZ7 A;  5JMN A;  3FCV A;  1XIQ A;  3Q3Q A;  2R7S A;  2EC0 A;  1P8G A;  1C2P A;  4QPT A;  1S57 A;  3S1T A;  2LLZ A;  4CLK A;  1EZZ B;  2HNZ A;  1LWX A;  3HHL A;  4DX7 A;  5D0E A;  2ZC4 A;  4OZ1 A;  1WC5 A;  2RHS B;  3MEC B;  3V6H A;  1ZEF A;  5L8R C;  3CMQ A;  1UJ6 A;  1Z2Z A;  4DV6 J;  4RNF A;  3BDG B;  5L38 A;  5EX3 A;  3MEE A;  3CJ3 A;  2MEW A;  4O23 A;  3IBC B;  4KT0 C;  3MK2 A;  2EVZ A;  5KAK A;  2KJV A;  2VFT A;  5B0G A;  2WSE C;  1NBE B;  1WC0 A;  1AT1 B;  2LP4 A;  1FJE B;  1SUQ A;  2DEJ A;  4RJV A;  2HHV A;  1FXL A;  1IKV A;  4BHQ A;  3PJX A;  1U49 A;  3A52 A;  3A8J A;  2DGV A;  1U7L A;  3HCX A;  4ETZ A;  5B09 A;  3KHG A;  3Q0A A;  1X9W A;  1X4G A;  3PFE A;  4Q45 A;  4Y6I A;  1WHY A;  3NY0 A;  3ZZP A;  2W9C A;  3J7Y U;  5CYJ A;  1O8B A;  1LK7 A;  1F60 B;  3UDC A;  3NKP A;  1PIL A;  4MMO A;  1F0X A;  2MGZ A;  1X9M A;  3KHL A;  4OMF G;  1NEE A;  1X5S A;  5KG4 A;  2XCA A;  4WK1 A;  2LXF A;  1F3F A;  3PO5 A;  1RWK B;  3G82 B;  3KNG A;  2C2E A;  3HXM A;  2GGP A;  2KXN B;  4YUD A;  1VBY A;  1RWW B;  1WHW A;  1XWL A;  4ES3 A;  3GR1 A;  3LA0 A;  1TL5 A;  2G0C A;  3QPI A;  1R0B G;  5AE3 A;  1SC6 A;  4WZQ A;  1U0H A;  2QLX A;  1KNZ A;  2DNQ A;  1Z4U A;  1H0H B;  4DFM A;  3NEK A;  2HK3 A;  3W3S A;  3KLE A;  3R97 A;  3SBM A;  1ZET A;  2VQE F;  3UD5 A;  3CXC R;  3W62 A;  2YX4 A;  1TL3 A;  3NOG A;  4FF4 A;  3O5T B;  2H3E B;  2IFY A;  4MT1 A;  3D66 A;  2Z57 B;  4K4U A;  4NXM F;  4I67 A;  3LWL A;  1M5V C;  4LSN B;  2F9D A;  1FHT A;  2FZK B; 
#chains in the Genus database with same CATH homology
 1KH9 A;  1KHL A;  1URB A;  4KAY A;  1HQA A;  4CYS A;  4LRD A;  4ZG6 A;  4ZGA A;  2G9Y A;  1AUK A;  3Q3Q A;  3SZY A;  2W5R A;  2GA3 A;  3UN5 A;  3SZZ A;  3NKQ A;  4YR1 A;  5LRN A;  2QZU A;  1AJD A;  4LQY A;  1EI6 A;  5L0E A;  3OT9 A;  5TJ3 A;  1KH5 A;  4QAX A;  5GRR A;  1EW2 A;  3NKN A;  5K4P A;  1HDH A;  4GTZ A;  4ZG9 A;  4LR7 A;  4MY4 A;  4UPI A;  4LRA A;  4KJD A;  5IJS A;  4UOP A;  4UPH A;  1E33 P;  1ZED A;  1FSU A;  5L0B A;  1ANJ A;  1O98 A;  1EW9 A;  4GTY A;  4MHX A;  1ELX A;  5DLT A;  3WAW A;  5LIA A;  1ELY A;  3BDH A;  3WBH A;  4LR8 A;  2XR9 A;  1B8J A;  1ZEF A;  4TN0 A;  1KHJ A;  4LRB A;  5INH A;  3NVL A;  2X98 A;  4ZG7 A;  3M8W A;  3UN2 A;  1N2K A;  4UOR A;  4LR9 A;  2IUC B;  1ELZ A;  3BDG B;  1KHN A;  1O99 A;  2IUC A;  1AJC A;  1ED8 A;  3BDF A;  3BDG A;  5LQQ A;  1ZEB A;  5C66 A;  1KH4 A;  1Y7A A;  1N2L A;  3IGZ B;  2GLQ A;  3WAY A;  2W5S A;  4LRF A;  3NKO A;  4GTW A;  1ALH A;  2RH6 A;  3TWZ A;  4CXU A;  3MK2 A;  4GTX A;  4CYR A;  2ZKT A;  1AJA A;  3NKR A;  3B5Q A;  2W5V A;  3E2D A;  3ED4 A;  3TG0 A;  5AJ9 A;  5IJQ A;  3CMR A;  1AJB A;  2W8D A;  3UO0 A;  4UPL A;  2D1G A;  1E1Z P;  5GOV A;  4LRE A;  4KAV A;  3NKM A;  4UPK A;  1E3C P;  1ALK A;  3KD8 A;  3M8Z A;  3T00 A;  3MK1 A;  4CXK A;  2W8S A;  1URA A;  4CXS A;  2GSN A;  5LRM A;  5DLV A;  4FDI A;  3UNY A;  1HJK A;  5HRT A;  2W5W A;  1E2S P;  3IGY B;  1K7H A;  3TX0 A;  4KM4 A;  4NWX A;  1SHQ A;  1Y6V A;  4LR2 A;  2VQR A;  3WAV A;  2W5X A;  1SHN A;  2W5T A;  3MK0 A;  3A52 A;  5KXA A;  1KHK A;  1EQJ A;  2IFY A;  3IDD A;  4NWJ A;  3T02 A;  5DLW A;  4UOO A;  1KH7 A;  2ANH A;  3T01 A;  4B56 A;  1ANI A;  4LRC A;  1ALJ A;  5L0K A;  5EGE A;  4KJG A;  3UN3 A;  3M8Y A;  4N7T A;  1ED9 A;  2XRG A;  3WAX A;  4MIV A;  2GSO A;  3DYC A;  3DPC A;  2GSU A;  1EW8 A;  1P49 A;  3LXQ A;  1EJJ A;  4FDJ A;  1ALI A;  2W5Q A;  5EGH A;  3M7V A;  3NKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...