3UN2A

Phosphopentomutase t85q variant enzyme
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un2A01
1AJBA 2D1GA 3DYCA 2GSUA 4GTWA 5LIAA 2XRGA 2W5RA 4ZGAA 4QAXA 3WAVA 1AJAA 4KM4A 1KH5A 5LRNA 1O99A 4KAYA 2RH6A 4FDIA 4CXUA 4MHXA 5K4PA 5IJSA 1KHJA 3NVLA 3NKPA 4NWJA 1ZEFA 1HDHA 3MK0A 1E33P 1ALHA 1ALIA 3UO0A 3T01A 1ZEBA 4FDJA 5DLVA 5LRMA 1EQJA 2IUCA 3MK1A 5L0KA 5GRRA 3WAYA 3T00A 5EGEA 1ANIA 4ZG9A 4LR9A 1KH9A 2W5WA 1EW9A 2GSOA 3A52A 3T02A 3SZYA 4UOPA 5LQQA 1KH4A 4KJGA 4UPHA 1AJCA 1SHNA 1AJDA 3OT9A 5AJ9A 2ZKTA 3WAWA 4LQYA 3M8WA 3DPCA 2GLQA 5INHA 3NKNA 4UPKA 1KH7A 1O98A 4LRDA 1EJJA 3NKOA 1ELZA 2XR9A 1P49A 1Y6VA 4UPIA 3NKRA 2ANHA 3BDFA 5IJQA 1E3CP 1N2KA 1N2LA 3WBHA 4LREA 3BDHA 1SHQA 1KHLA 4KJDA 3UN2A 1KHKA 3UN5A 3KD8A 1AUKA 1URAA 1B8JA 3BDGB 3E2DA 1HJKA 3LXQA 3WAXA 4NWXA 4LR2A 5KXAA 4N7TA 3M8YA 2GA3A 4GTZA 3NKMA 4UORA 4MIVA 1ZEDA 3TG0A 3BDGA 4LRCA 1HQAA 3IGYB 3UN3A 1K7HA 4CYRA 3TX0A 3M8ZA 2W5XA 3IGZB 5GOVA 1ALKA 1E2SP 2W5VA 1ED9A 4CXKA 5C66A 1EI6A 2W5SA 5HRTA 2G9YA 2IUCB 4UPLA 1ED8A 1FSUA 1URBA 3B5QA 1KHNA 4ZG6A 4LR7A 1EW8A 3M7VA 5L0BA 1ANJA 2W8DA 3MK2A 4GTYA 5DLWA 5TJ3A 4TN0A 4ZG7A 2X98A 4GTXA 1ELXA 4CYSA 4UOOA 4LR8A 1E1ZP 2VQRA 5L0EA 4LRAA 3UNYA 2IFYA 2W8SA 3SZZA 2W5TA 4LRBA 3IDDA 1EW2A 4B56A 3Q3QA 5EGHA 2GSNA 4KAVA 1ALJA 2QZUA 4LRFA 4CXSA 4MY4A 1Y7AA 5DLTA 3ED4A 4YR1A 3TWZA 1ELYA 2W5QA 3CMRA 3NKQA
chains in the Genus database with same CATH superfamily
2FGOA 2HK3A 4CLYA 2A6OA 2WONA 1BQNB 2BE9B 3BN7A 3MCSA 4WIQA 4CH7A 2W8KA 3BYPA 4K4TA 3MM8B 3C16A 1Q8BA 1UA0A 4NLGA 4KPCA 4ZS6A 1Q8LA 2DGVA 1Y5IB 2LMIA 3PFEA 5C25B 2HHVA 4PQUB 1YJUA 1KS2A 1X4DA 3K5OA 5DM7Q 3CJ0A 1RAJA 4ECTA 3OSPA 5IV4A 3TEGA 3PR4A 3T01A 2BABA 2MZJA 4QYZJ 1R8PA 4OX9J 2EFQA 3KK3A 3N28A 4RKUC 2O1PA 2W9BB 1R7IA 2NYIA 3CD5A 2B5JA 2BACA 2CRLA 2VJVA 4PRFA 1VQMS 5ETKA 2HHSA 2FQQB 3A8EA 2J7WA 4C48A 4UQGA 3R1LA 2XG8A 2YKQA 3QWUA 2LKZA 4RW4A 3VAFA 1REVA 4DDFA 5BYSA 5FIIA 3NKYA 4ANCA 4ZVUB 4NCGA 4CI0B 5KT2A 4WU2A 4QWDA 3OL6A 4NXNF 3A3PB 1GNKA 2EFOA 4CIOA 3NCRA 2B7BB 4OX8A 5E5NA 4U67Q 5KG2A 3BQ0A 4O3NA 5HLFB 4LQYA 3QIDA 4XPCA 2GHVC 3HVWA 3JXOA 3KXDA 1FNOA 1RBAA 1TV6A 2CPXA 2GW8A 3K7RA 3R6GB 1LWEA 4G1QA 4GMKA 4ZPBA 5MAOA 2RQCA 4DFKA 2DR9A 1KRPA 4HI2A 1RTZA 5K9FA 5T41A 2G1HA 5KFFA 4UPIA 2VG7B 1M5SA 1DAXA 4KY3A 4NEYA 4OI1A 1YVFA 1RHQB 3IGVA 1HNVA 4HR2A 2PT0A 2CJXB 4H54A 4I1TA 5HBMA 3ZZYA 5K20B 1KTVA 3BF4A 3SIPB 1Y10A 2QMWA 3T41A 4N5SA 3UN2A 4B3MF 2K3IA 3DRRA 2RU9A 1P1TA 3DMJB 2OMOA 4PQAA 3AXMA 5KFCA 2O67A 3NGDA 1S4FA 5KXAA 1F60B 1YBUA 4C98A 4NLWA 1AYEA 2IM2A 1TK0A 1D9DA 2DXFA 4O3QA 3L95X 4MIVA 1ZEDA 5KG7A 3PKYA 1TL5A 1EKRA 4DF4A 2FUG9 2Y1RI 2NZCA 2R7WA 3G82B 1YJ7A 2FVRA 2OIHA 1C0UB 5DRKA 2X7IA 4LIRA 3G6YA 1QUPA 4NASA 4FS1A 1XEZA 3Q2SC 3KLGB 2IC3A 2EEYA 2CPHA 3MZIA 4UOHA 5KFLA 3U1MA 2IMWP 1Y3JA 4L3KA 2WSCC 2BQ3A 4QBUA 1RT6A 3U1NA 4YEAA 3VZHA 3N9UC 3TAMA 4UPLA 4URQU 4WK3A 1TUGB 5J2QB 4DXLA 3HZGA 1IKWA 2GMJA 1UJ5A 2E7WA 1UVJA 5H9FK 3GSIA 1T02A 1VYAA 1QJHA 2VF3A 4A8OA 4M95A 1N32J 3WC2A 1RQ0A 2WB1D 3GFZA 2ILYA 1KD1T 3DHXA 5F8NA 2XYHB 3IC1A 1RABB 3MPYA 1P8GA 1NBEB 1WKLA 1FDAA 3HHEA 4DSFA 3IAM9 2DNGA 4LRAA 3CMAS 1T05B 2PFFB 4Y34A 2WZ1A 1EP4A 1VBKA 5E3RA 4TU9A 1X5PA 4DUZJ 2GAGC 2OUGA 1QTNB 4ITSA 2RS2A 2H51B 4DU7A 3PW4A 1X0PA 4LSLA 4DMZA 1YQHA 2H5IB 4KAVA 2ZNYA 4NOHA 1HI1A 3DLJA 2KHCA 4OYOA 4F67A 2ZH3A 3A4TA 3PEHA 2FJWA 1RSCA 3C16B 1O8BA 4B17A 3CNQP 4F3QA 2RILA 4DV6J 1MU2A 1TKZA 2ZHOA 3HSJA 4B9SA 4RNNA 3D54A 1SJRA 1JLFA 3DYCA 2YWHA 4NLXA 3IS9B 2HKEA 4J37A 1F9EB 1FDBA 1RWKB 1F6TA 2DHGA 1U2FA 2Q1LA 4JI0F 1CQMA 3OD2A 3TVZA 4CTAA 2QEXS 2AJ0A 2KT2A 2MPUA 2QL5B 2ROEA 1PILA 2YNGA 3IR7B 3MD3A 3MWBA 3M1VB 3QPIA 3RBDA 4LJMA 4F3MA 4ZVEA 4O44A 3PZPA 2C2DA 3RB6A 5J1NA 2W5RA 3T6JA 2DNNA 1UA1A 1LFPA 1X7VA 1XBWA 2V2KA 2HGLA 1XK8A 1FTRA 1C0UA 3FBEA 2OSRA 3TJ8A 3T1HF 2XGPA 3T00A 5DG9A 5IM0A 2SXLA 4FZVA 1CS4A 4A8YA 1R0AB 3TA1A 3PY8A 1DHMA 5M2RA 2LDIA 4F2RA 3A52A 4KB7A 4HT5A 3N4WA 1PYOB 1K47A 3M2UB 1SQFA 4E8UA 3BKTA 4ZP6A 1S1UB 3G6ES 4DL5A 1TL7A 3GYGA 3V4IB 4IR9A 2KYZA 1L3KA 1TFYA 1HBOB 3QGIA 3JAMY 3PJ9A 1T3NA 3B4MA 2XRGA 3DOMA 1TR0A 2BVZA 1TL3B 1V5VA 3DRSA 1UFLA 1VRTA 1S1XA 1HBUB 2CAJA 3DFEA 3LUYA 3M8PB 1S72S 5ETVA 1TVRA 5DG8A 3MAHA 4RNHA 3OHBA 1U0HB 1U8WA 3EZ5A 3PVXA 2DO0A 2OPPB 3PTWA 3EPGA 1EJJA 1P27B 3NKOA 1S7IA 4Y0FA 2IM1A 1S4EA 4NLPA 2CWKA 1Y6VA 4QWBA 4NLVA 1BQMA 2ZWOA 4OYMA 1JWWA 4HHHA 5CD4H 1N2LA 4W92B 3JTPA 4FYVB 4LREA 3HMJG 1OYEA 3NWRA 4C0BA 2COLA 4XIUA 1ZBTA 4JI3J 1G3OA 3W5ZA 1JLEB 4IQMA 5F9LA 3M9OB 5LMNJ 2RS8A 1DARA 3F44A 3QMQA 4I0WA 2OKQA 3TA0A 1S12A 3QATA 3KLIA 4NXMF 4Y2MA 6FDRA 2VJUA 4NWXA 3E01A 3AT1B 2IA6A 2O3DA 2CQ3A 3HJVA 1PJ5A 4DV1F 1LXNA 2B56A 4ZMMA 1LW0A 3P49B 4P2XA 5HJYA 1BQNA 2YNFB 3UD3P 3IGYB 3GSDA 2MLYA 2IC3B 3IRXB 1QVGR 1I94F 4MIWA 1GEHA 3M6WA 1LK5A 4UOCA 4USHA 2ZOMA 4EGLA 3AQPA 1WNEA 2F63A 5M2PA 2AV5A 4NMLA 3THPA 1N34F 4DHVA 2R8GA 3RB0A 4OQJA 2HFUA 1SCJB 3J81U 4DV4J 1U1MA 3FEYB 1H74A 2F7VA 2G9YA 2V8DA 2RH3A 5A8WB 2QLFB 4PG4A 4WCEQ 1RDRA 2V8HA 1X4BA 4K7QA 4V1Ak 4YY3J 3KLHA 1ED8A 1EETB 3BH6B 1Q81T 2B7CB 1JB0C 3D7SB 5AT1B 1U25A 4X4QA 5KFWA 2HG4A 3OUYA 1YJTA 3AD7C 2M5YA 1EW8A 1NKCA 4KIAA 1HWUA 1X5OA 4QWCA 3TAPA 3RYLA 2XHCA 4HKQA 3OSNA 9RUBA 1T03A 4JI5J 4P75A 3GPAA 1WEXA 1QUVA 4MJKA 2BEFA 3ONQA 1O0PA 4ATNA 2GZOA 2KM8C 3G2XA 1ELXA 4UOOA 1JJHA 4EUVA 1U47A 2GMLA 2IFYA 3FFIA 2DRBA 1I6JA 2DHAA 1YLXA 2AZ3A 3AJ1A 4F4AA 1XMQF 3IDDA 2RKIB 3L09A 4DJBA 4YHHF 4CRJA 1KP6A 4TQSA 4ZVOB 3UCUP 1M5KC 2RQMA 1AFIA 2CQCA 3HI9A 5EWEA 1NH7A 1TMMA 5ETNA 2K06A 2QLXA 2QZ8A 3TWZA 2R8IA 4LF9J 5F8GA 2X51A 4WFZA 1CG2A 4PQUA 9ATCB 5C2GA 3WDOA 2P5VA 2Z2LA 3VGTA 2OI2A 3AOAA 3WAVA 1Y3KA 2PEHA 2XMTA 3FRYA 2C2MB 3O3LA 5DDRC 2XEXA 1I3OB 1PJ7A 3BDEA 1IBLF 5CYJA 2MKSA 4DV7J 3R2CJ 2NCKL 3HVTB 2W2OP 4J9RA 2MY7A 2HHQA 3G9CA 3I4PA 3MR2A 4PYDA 2BYCA 3GV8B 4GKJJ 1SKSA 2Y3YA 3BKFA 5HLFA 4NEZA 2BQRA 1S49A 3FJ2A 4LF1A 2CPYA 2OFHX 4ZPVR 4Q0BB 2OP5A 3CD7A 3BKUA 3N6NA 4ZVGA 4CTAB 1EW9A 1EIYB 2P9CA 2ZDPA 3ZZ0A 2D74B 4Z37A 4JI5F 1Y4ZB 3ISZA 4KGKA 1ZTWA 1IM6A 2VICA 2EPIA 1DTTA 2H48B 2K7JA 2Z2MA 1AFJA 1SHNA 4ZHRA 1TFWA 1P9QC 3KHHA 1IKWB 4J9PA 1NJWA 5AJ9A 3H4DA 5D8HB 4IO9Q 3NCPA 3CUNA 3UQSA 4OI4A 4YDDB 1RWMB 1OIAA 4UUWA 2YWEA 1JNRB 4FKXA 2K8GA 1VBZA 3C6TA 4JI8F 3TJAA 4WTYA 1TMJA 3KWMA 3PCOB 5KG4A 5JVGQ 2ANHA 2ZJQQ 2Y1LB 4KJIA 4U7CA 3BDHA 4OX6A 1R27B 2DHHA 2QG9B 4QR2A 3E51A 3WBZA 4DPUA 5DJBA 3VTIA 1FVQA 3PJWA 1U2RA 1G2EA 4DV5J 2F9DA 2MKYA 1HPZB 1U7LA 2B9WA 2XS5A 2J76E 2HAFA 3HO1A 4J91A 2CQ2A 4ECQA 4DQRA 4X4VA 2BBEA 2VA3A 2DJWA 3QSYB 1N5YA 4E0DA 3GFYA 4G1PA 3PHEA 4QIEA 3R7SB 2CNKB 4FF3A 2IDEA 4TY8A 4GKJF 3HD2A 2NYHA 1UJ4A 1RWVB 3BDGA 2C28A 3QLHB 5J2NA 2AIRB 1Y5NB 3OXLA 1YITS 3DYAA 1I5OB 3FCWA 1W7WA 3NOCA 1NKEA 2E44A 4IKAA 3RAQA 3ILOA 3JTNA 2RQKA 3TUIC 1N5SA 1RE1B 2FLLA 3GFHA 2CPEA 1GMVA 3PYFA 5CHCB 2BMBA 1H72C 1QTMA 2J0WA 2DEJA 4DFJA 4RW4B 5HL7Q 1CJTA 1WHVA 2OD6A 4PZVA 4URSA 3N5BA 3CC2S 1X4CA 2DXEA 2E1RA 3PW7A 1VQSA 4BS2A 4I56A 4QIGA 1HBMA 2LA6A 4DX8H 5L0BA 3M7VA 3NCQA 2R7QA 2ZFHA 3LW5C 3I96A 3R1HA 4LF7F 3TO8A 2QGFB 4U8VA 2WAQD 1LWXA 1D1UA 2HZCA 5TJ3A 4ZCLA 2G2OA 5D0HA 3PXGa 3WQPA 2E9RX 4ZVTB 1J5OB 2HHHJ 2VG7A 2VONA 1HNWJ 3M8PA 4F0KA 1PBUA 1HBUA 1OQ6A 4DX7A 1RT1A 3FCVA 5FD1A 5E33A 2ZNZA 4LQ9A 3W9IA 1X4AA 4H4OB 3AFGA 2HAIA 4OJGA 2QA4S 1FJGF 4O44B 3R97A 2J9CA 1IKXB 1JXEA 4QWAA 1JK9B 2LXFA 3FC9A 1WG1A 5DLTA 4DZ6A 2L3MA 1FO1A 2FZKB 4NYZA 4USVA 3GU0A 3HX9A 3VGUA 2MTLA 1IXKA 4CQ1A 3DXSX 1WEYA 1A6LA 5L38A 1UPMB 4PR6A 2FPHX 5F8MA 5LJ3Y 4DG1A 4OFZA 4WE1A 3NGSA 2LDYA 4XPEA 2BX6A 3I0RB 4MHXA 4M5KA 4RW6A 1TL1A 3QIPB 4I7FB 1JLQA 3N5FA 4J90A 2AYMA 3CJTA 3MXHP 4PWDA 2KZZA 2OLWA 2YKAA 3T1YJ 3NGRA 2B4UA 3OL8A 2YNHA 2OEKA 2OPQA 2I5JA 4LFBF 2Q3PA 4JB8B 3IWNC 2R9LA 1VJWA 3RU0A 2Q6BA 2GIFA 1MN9A 3E8OA 2C42A 4MKBA 4Z2XA 4M5JA 1XJWB 1S77D 3OL9A 2GHWA 4R8UA 3M30A 3MR5A 2UXCJ 1UPPA 4ZHRB 3IRWP 1UZHA 2DNHA 1JLGA 1NO8A 3AHPA 2E5GA 2OPRA 1C0TA 3J7YI 1HHSA 2DNYA 1R43A 5AE3A 4LFCF 1XNRF 1HNWF 3MF5A 2BM1A 1RTHB 2CG8A 4WP8A 2W9CB 3Q24A 7FD1A 2VKZG 3OL7A 1TAUA 2U2FA 3C6TB 2PI5A 3QJPA 1WHYA 3ISNC 4F26A 1BMQB 3CSKA 5JVHQ 1JJ4A 4MKVA 3D28A 4PXBA 3J7AN 3HHLC 4V19J 2XQCA 1PJ6A 2V4JB 4L3NA 2EW9A 5IT4A 2QMUB 4K59A 5THWA 3CCVS 1NSAA 1BQXA 2DNQA 1U6FA 3B54A 3HFVA 3G71S 2DNPA 4FF4A 4NLUA 5FDLA 1VQ8S 2VFVA 4DQIA 1DTTB 4JV0A 4IG3B 2U1AA 4DS5A 4Q7AA 1O51A 3E3XA 2G0IA 1TL3A 1FTCA 2F4VF 1FXRA 2FLOA 3GLJA 4ELUA 2LFVA 1HHTP 1CULA 4IH5A 5DGBA 2XB2D 3F0NA 2YQ0A 3AJDA 2DNKA 1H6KX 1HNIA 4CLKA 1RA6A 1Y7PA 2ZE2B 5FLXU 3PDNA 1U2CA 1ZPVA 3C66A 4OX9F 3V6DA 5I42B 5J2QA 4NA2A 2CPDA 3CJRA 4HI1A 4JI2F 3I56S 4ECRA 3EUNA 1YJNS 1NK7A 1M90T 2NXUA 3EPIA 1RT5B 3HVTA 1LV5A 2BRLA 3KG1A 2UUWA 5D15A 2ZHAA 2VBYA 4U9RA 3SCKE 2KG0A 2R7TA 1S6UA 4ZP9A 2YNHB 4B3SF 4ED0A 2AGPA 3GE9A 4ZCKA 4EO8A 2W5SA 1S7HA 2BR0A 2OGUA 1DY3A 3NEKA 4ECXA 1HLWA 3D6TB 3RRGA 4IUFA 2WBRA 3NMAA 1FRIA 4QCLA 2VHGA 3EGZA 2BJ7A 5ETMA 1QE1A 3AOCA 1PCAA 1SPBP 4GRSA 3CCRS 2HWIA 3FGVA 4M5NA 5DDQC 4BC9A 3NG8A 4CNYA 4USMA 2UVUA 2ZBRA 4WTOB 2ZH7A 3OFEA 4DR3F 3RR7A 4LF5F 1NU4A 1X4GA 2QL9B 3H90A 5MLCV 5KAKA 2UUCF 4LR8A 1TKXA 2HVDA 1W2BR 1MROB 1WG4A 2ZBQA 2KVQE 5AE1A 3UDVA 2QTWA 3QGPA 5HBMB 2V0NA 2ZVIA 5CABA 4A8MP 4JI1J 4QW9A 1XNQF 1FK9A 2M9KA 2F4VJ 4IDKA 3QO9A 4B56A 1NK5A 1NB7A 3KMQA 4AD6A 3JSRA 3KDNA 3ADAC 4LRFA 1VHIA 4CH0S 4I2QB 1TP7A 4ER8A 3T5JA 3GWCA 2KTQA 4L72B 1R8CA 4NLQA 1ELYA 3ZC4A 2Y8WA 4QPXA 3CMRA 2RT3A 2EBGA 3PEJA 4N8NA 3TJ9A 2CFXA 1RT3A 1M1GA 4TXSA 1N48A 4U96A 2CYYA 2DITA 1JLAA 5DQIA 3KLIB 2G0JA 4ZPAA 1WOPA 2RH6A 4NXMJ 2DD8S 3IP0A 2V50A 5LSLA 1RTDB 3D4JA 1DJ0A 4LSNB 4ALZA 3MPVA 4HVZA 3BO4A 2CQ0A 3B78A 4TU8A 1NZ8A 2YWKA 1X9MA 4CCHA 3W3SA 2OHDA 3DLEA 4N56A 1K0VA 4DLGA 3CO9A 3TZWA 4YQWA 2DR6A 3P3DA 1GMWA 3IRXA 1KHVA 1RAIB 2IAJB 3QAEA 5K14B 1U1KA 1QAJA 2NREA 3VHQA 1EQJA 3DYAB 4NCAA 3QRRA 4PXCA 4FBUA 1QAIA 2VV5A 4D3HA 2R7XA 5ETRA 1TVRB 2QA4G 2QFIA 4B9LA 3H5XA 5EGEA 2D3UA 1LW2A 3DOKB 4K4VA 2W5WA 2FC9A 1DLOA 5B0BA 3A1YG 5IZHA 4DR7F 2RUSA 5KOWA 3GCXP 5ETTA 3FSIA 2QMXA 3SXLA 3CD0A 4J9MA 2LA4A 2GVDB 2YKMB 3M2RB 4USIA 1IQZA 2G2YA 2HFZA 2M88A 3ITHA 3K8WA 4PAAA 5AXNA 5F8LA 4BDPA 2NQPA 2X1GA 3LP2A 4LF9F 2JEGA 1AJCA 5KTQA 1I51B 1WC1A 4DUZF 1IN0A 2CA9A 4P2MA 4CLFA 5GAHI 3I6PA 3H40A 1RKJA 5HO4A 2DNRA 4LF4F 4MYUA 2HQIA 4MMOA 4ZP8A 1ZM2A 2H5EA 3DRYA 3BQ2A 4TYAA 1YDLA 2JVRA 2Y0BB 1UAWA 3D6FB 4XK8C 4RUCA 3EM1A 2CADA 5DQGA 3C14B 3ICLA 1JMTA 4FN5A 3AODA 4KE5A 2N7CA 3GIIA 1S57A 1S99A 3LQVA 4DWIA 2J5AA 3ILLA 4PWUA 5HMYA 1U0HA 2LCWA 2WSFC 4LF8F 2UZAA 4PG5A 2ZWPA 5C24A 2L9NA 3KLFA 5D78A 3VQSA 4ECUA 1U48A 3UW1A 2CG4A 3CO0P 3PM9A 3P96A 5F8IA 3CJKA 2VPWB 2ABYA 2FHJD 2VC0A 1U6ZA 2B4PA 1FKPB 2RHQB 2XMVA 3H5SA 4PXEA 3VWSA 1HR0F 4B3TF 2GA3A 3NKMA 3K5PA 2FHJA 5KFSA 4K8RA 3KK2B 2Y1IA 4FXWA 1AW0A 4LVNP 3DC2A 2IM0A 3HULA 4ZK7M 2EWHA 3I0SA 4WF9Q 2V2VA 4K4SA 4O0NA 4OJHA 3M8ZA 5A8RB 4ED6A 1BWEA 2IRXA 4PWWA 4FP9A 3X1LB 2XSJB 1IKVA 4IQXA 3EX7B 2PIIA 3HT3A 3FMWA 4OZJA 5KFAA 4Q5VA 2MSSA 5C66A 3L3CA 1YZ6A 4NZ7A 3LALA 2AU0A 5L1KA 4UTGA 5T7LB 2IAJA 3BS9A 4P74A 1NH8A 2WOMA 3THTA 1Q4RA 2F8EX 1DURA 3DU5A 1E6YB 1TKTA 3DM2A 3GR0A 3VGSA 3VZIA 4JI8J 3IG1A 1KEKA 2PA3A 2F4FA 2GS8A 3LGNA 3OR2A 2YX4A 4NLDA 4WYWA 4AXJA 2DH9A 3ISND 5DDOC 4DV2J 1YZ7A 2ERRA 4AQYF 2AJFE 4X4RA 5DLWA 4A8WA 4TVAB 4B02A 5L9XA 1NJIT 4JP8A 2E5HA 2OO4A 3H5YA 4RBVA 4WXWA 2FD2A 2CWXA 4OHZA 2ACMA 3J81j 2MKKA 4H4OA 2HPUA 1R31A 3N0VA 2R2TA 2IRYA 1E1ZP 3FEZA 3MM9B 5B08A 5GAEI 2B8PA 2AGOA 4KH1B 5B0GA 1ZAXA 1JLBB 3CCSS 4IG3A 2W5VA 4JYAF 4G1QB 1FCAA 1HARA 3D1OA 4KR0B 1X0FA 2ZC3A 2QN6B 2HS0A 1NK9A 1XTZA 2CDRB 3G86A 2CQIA 2ZUAA 1LNQA 3AD9C 2W7OA 4DR4F 2HBRB 3UVJA 4X65F 1Z4UA 4NLOA 1FF2A 5CZVA 3S01A 1CLFA 1B0VA 1UFWA 2DGOA 2D1GA 4C4WA 2LU2A 3LAMA 4ZGAA 4NA1A 3D9BA 2JLGA 2F40A 1VGYA 4ID5B 3JQKA 3PHTA 2GO9A 3CDAA 4CYUB 5LIAA 1RT7A 3UCGA 2ZM6F 2HHTA 1HKAA 4Y6IA 4DOZA 1HDHA 2AQ4A 2OPRB 3OTCA 2B3TB 1IR1A 1VBXA 1CC8A 1N33F 1JJ2R 1S1TB 3HPOA 3MCMA 2FLNA 5EX0A 4B3MJ 4RW8B 3MOJB 1HBNA 2QX0A 5L0KA 1H38A 2LQ9A 4M5DB 1WF0A 4DL0C 4ENOA 2VPZB 4YS2A 4QWEA 3H5UA 1OPZA 4DFMA 2HHHF 1G1XA 2D3ZA 4WE1B 2FY1A 4DR2F 3GFXA 1HWLA 4Q8EA 1FRLA 4B3RF 2K3KA 2DGWA 2EBEA 3PG9A 5AXKA 4EZ6A 4K0KJ 5KG3A 3RTVA 1VQLS 4O3SA 1RYRA 4DL3A 2GJ2A 3JS9A 2PE8A 4RW9B 3LWMA 3KK1B 4DPOA 5C42B 3HZEA 2M8HA 2Q43A 1D3WA 1T11A 2BA9A 4NA3A 2WVCA 1FRXA 1GXTA 4JOUA 5F8HA 2AJ4A 2ZH8A 2WB4A 3T5HA 2PC6A 3MECB 1DLOB 3SYZA 2MLXA 2HQDA 2VDHA 4ZP7A 4RNMA 3MURP 1M1KT 1J5OA 3Q83A 1TKXB 1E3CP 4PKDB 1X31C 4NX9A 5I4MA 2HS3A 1DQAA 3QFWA 4DPXA 3C46A 3AA9A 4XAKA 1T9TA 2DEIA 4J9OA 1Y9OA 3CE8A 2EFGA 2NUHA 4Y2CA 2GIQA 3KHRA 1F9FA 3K58A 2F1FA 4OMFG 2FVPA 4TQRA 1T7PA 1FWLA 1URAA 1SH0A 4A8FA 4HTIA 4ED1A 4C8ZA 2ZHBA 2KDOA 3C15B 1QSSA 2J6TA 2JC0A 1LWCA 1T0TV 4P9SA 3IO1A 3G6XA 3ZZPA 5HQMA 2H4WB 3D2WA 3AH6A 3MR3A 1U1OA 1JLAB 2J9EA 2MLZA 4LBHA 1S9FA 2OH2A 3I87A 1JLCA 4BHQA 2FHMA 3MDFA 1OS5A 4NLTA 3P6YC 5K14A 4M5HA 2BOPA 4NXNJ 2PGCA 2W24A 3BDGB 3Q0AA 3BSOA 3VVTA 4FF2A 1PO6A 5F41A 1V3RA 3DRPB 2D7SA 4X84A 3MEDA 1LW2B 1S6PB 4C7QA 3K5NA 2MQMA 8RUCA 3OHAA 3EMTA 3P8BB 3IMQJ 4FXVA 4WJBA 4EU0A 4GO7X 4OYZA 2HVHA 5IOLA 2QE5A 3KJVA 2OELA 3JSMA 3HFKA 4I2PA 4ELVA 4CLUA 5HATA 5KFJA 2BRKA 1F0XA 2RAQA 1WC3A 3MMAB 3BO2A 3DNCA 4DFPA 4P10A 1U1PA 1PGZA 3ZTRA 1U6BA 2OEJA 4K4WA 5AXLA 3A13A 4P2FA 1S76D 2UUBJ 4U95A 4DV0F 1T95A 1S1VB 5LSOA 4Y28C 4N8OA 2E5LJ 5F3ZA 2NXEA 5LMUF 3FCHA 1B0PA 4X4SA 3HSGA 1Q95G 1VQ9S 3AB4B 1DRZA 4MAKA 3VR1A 1FD8A 4HL9A 3IR6B 2OPPA 2R8JA 2XZTB 1GT8A 3CPWR 1NPKA 2CPJA 1PYSB 2ZKUA 2LQ5A 1RI7A 4IG0B 4F4ZA 4DQQA 4ZDNA 1IBMF 4LMZA 4F0HA 1TTHB 1RUSA 4HEA9 5ADZA 1SJ4P 1RWUA 2PMWA 2RRBA 2EI5A 3P5BP 4FNIA 5D4PA 3L7UA 3BR9A 2KL8A 2UU9J 3W64A 1FFGB 3UPFA 1J5EJ 1UEKA 2C2KB 2KO1A 4ILRA 3W9JA 4X62F 4ECYA 1HNZF 2J8SA 2BZ2A 2YWGA 3BGOP 3MM5B 4KAYA 2DHXA 2XYGB 5A8KB 1KHJA 3LP0A 1YWXA 4K4UA 5KG6A 1L5UA 3VCDA 1H2TZ 5L1JA 3GZ7A 2Z8QA 4M5DA 4CZCA 3FVYA 3NAHA 3MK0A 4LUBA 2BJ9A 2HVEA 3FKBA 2DKOB 3UVJB 1N8RT 1KFSA 5DLVA 2ZBPA 1RTDA 2H3EB 3DI6A 3EZUA 3AAWB 4ZLNA 4C8MA 5K8OA 2DPIA 4WKRA 4E2FB 2BKPA 3QT5A 1ANIA 5HQLA 2GVZA 4WU3A 5KOXA 2VD3A 2IY5B 1N54B 2JHEA 5EN1A 3FZ2A 1ZTTA 1N6QB 2CQDA 4QIWD 1CQNA 2KFZA 2HNYA 4P2SA 2L9WA 4MH8A 4UOPA 1JKHA 2HQGA 3I9ZA 5EDWA 3QJLA 4WWSA 3EWGA 4LBIA 1MN7A 5HP1A 1M5HA 4DR6J 1AROP 2DH8A 2R2SA 2W4CA 2C22A 1IBKJ 3PV8A 2RVJA 2V4QA 1HWKA 2Z4PA 3DRRB 4KYZA 3BM7A 4DR1F 1W2IA 4OI2A 1HHQA 4FYXB 4KKOA 3VV2B 1PAUB 1MNEA 5DLGA 3AJ2A 5HQ8A 4ID8A 3D3CJ 1R6YA 5INHA 3EXCX 1ZZNA 3ENAA 3GG0A 4LSLB 3G8TA 1FKOB 5IWAF 1ZETA 3I82A 4DN9A 1T05A 3HK2A 4EWTA 2HS4A 2W4DA 4RW9A 2F65A 2J9DE 4EBCA 2UUCJ 1MWYA 4OHWA 5U47A 3HHLA 3T6BA 4CT9A 1WTFA 3BO3A 1X9WA 3EXYA 3FMBA 1AT1B 2UVWA 1IKVB 1WWHA 2VFSA 2AYBA 2R8HA 4C8NA 1LWFB 2WSEC 1K1SA 3CIMA 2EKYA 4B08A 5BJRA 3QQCD 4FPIA 2HNDA 2MHEA 3PR5B 2HNZB 3G6VA 3B4DA 3I0SB 5L39A 4CYUA 2CVEA 5L8RC 1JLQB 2KXNB 1DBDA 3EE3A 2DGXA 1URNA 3DKDA 2AF6A 2FY8A 1E6VB 1T94A 2B4OA 2CIMA 4OX7A 2QYCA 3RBZA 4Y2KA 2HRTA 3B8HA 1S1TA 4OLPA 3OJSA 5GVQA 4CYRA 1X4HA 1U1RA 3R5JB 5GOVA 2R4FA 2F3JA 4ZVPB 4DX6A 5A0YB 1NK8A 3L4BC 1S0VA 2PI4A 1KQFB 5KFBA 4IOCQ 1TK8A 2HFNA 1ED9A 1S97A 4FPRA 2LU1A 1K73T 1J2VA 5HMWA 4AYBD 4PUOA 1FHTA 3BJYA 4KO0B 2C3OA 1SB6A 1RT5A 2E29A 3RBEA 3MOZA 1L3UA 1WTBA 4NCBA 2YKMA 1WOOA 2WVFA 5KFHA 4X66F 2LVWA 2CZVC 2E5JA 3MPDA 3N79A 2QJ3A 4KC5A 4NI2B 3JYTB 2FJXA 3B5QA 4ZG6A 4NLYA 4KT0C 5HVFA 1XMOJ 4C3LA 1BY9A 2ZH1A 4YMEA 2W8DA 2RHSB 2UV8A 3MUTP 4E98A 4NZ0A 2FB0A 3FRZA 1NDPA 4M5IA 3W63A 2DYAA 5KFVA 2V4JA 4GKKF 1RAEB 5B09A 1VLYA 2ZITA 1LK7A 1ZZFA 2I8EA 3CDUA 4DV1J 1VRUB 2AZ1A 3SCLE 1NMEB 4X2BA 3ET6B 4DCPB 3B82A 2V8VA 5KT5A 2AHOB 4DPYA 3RJMB 1G4CA 4LSNA 1RT4B 3M4XA 4CO1A 4I6WA 2KJVA 2Q66A 2YKPA 4OYIA 1Q5VA 4MIAA 1MROA 1REGX 5KFOA 4F4YA 3DLBA 3O5TB 2HVZA 2N3OA 4R25A 1FKPA 1ACMB 4CLTA 1AUSL 3H4BA 3NWGA 3CD6S 2I6WA 4ELTA 4RL1A 4DV4F 3C19A 3NNCA 2VQEF 2DB1A 3QFHA 2GAHC 3R7NB 2W7AA 1ZAVA 1AJAA 4A47A 4QU7A 3W2VB 1C4CA 2BJ3A 2HNDB 3MR7A 3HHLD 4JI7F 3CDEA 2UUAF 2ZEJA 1W26A 2XSJA 4OYWA 4RX6A 2D9PA 5K8MA 1HL6A 4Q44A 4K4ZA 1E33P 1OSCA 2ZJPQ 2XMAA 1ZEBA 1CC7A 1FRJA 3D67A 1DZ5A 1SIZA 3QSIA 3BDPA 3MK1A 5H9EJ 4KFBB 3WAYA 4J9NA 2F8HA 3DLEB 4EYIB 3GYNA 3LH2S 2FJVA 3RRKA 4LIWA 3O44A 3LWLA 2ILZA 2Y9HA 2DXDA 2VH7A 4LR9A 1YJRA 2UXDJ 3MMAA 1IQTA 1X5TA 2EFPA 2B4VA 1SXLA 4JI4J 3DOMB 1DQ8A 2GV1A 3FZBA 5SUHA 3L7OA 1KH4A 1NEEA 1KOOA 1VQ7S 4OJ3A 1ITPA 2GQ2A 4USWA 5C24B 2JLEA 2AJ2A 1FX2A 2XTJP 3POTA 2AJQA 1C2PA 3H0PA 5HVGA 1CJUA 1Q53A 4K4YA 4DL6A 3C6UB 1FERA 2DT9A 2JFDA 1C1BB 1WUUA 4ED5A 2UP1A 3DPCA 2W2PP 3TQ1A 1FRHA 1PKUA 4DZDA 3K5LA 4ZPTR 5H9FJ 3RB4A 3AXKA 1JJCB 3ILIA 3OTBA 3QO9B 2VQFF 1O98A 1NAQA 4I68A 2YBVA 4F2SA 1KHWA 2XCPA 3WIUA 3ENWA 2DTJA 1QVFR 5IC6B 4O4RA 3FNNA 3JQMA 5GADU 1X5SA 2GGPB 4B9TA 1SBRA 2RQ4A 2CJ9A 2OJ3A 3C15A 3CTRA 4Q43A 1KVKA 3CCTA 1YRTA 3D6MB 3T9NA 3U27A 3QRPA 3D3BJ 1FDDA 1KHKA 3BH7B 3CXCR 4JI7J 1IUJA 2I0XA 4O4GB 5LXRA 2LEAA 3JAMU 1S1XB 4ZVHA 4ZJLA 3BSAA 4OZ2A 2DGUA 4B9NA 2I9SA 3ZZUA 2G1DA 4QQBA 3CJKB 3I5BA 3R6LB 3SFUA 5D3GB 1RZMA 4Q45A 2XLKA 2V9KA 4DQPA 2H65B 2N3LA 1SL2A 3BYRA 2CZ9A 2Y0SD 4H4KA 4J9VA 3W61A 3KK3B 2YPZA 1ALKA 2HURA 2EFNA 3DRXA 2K1RB 3O2IA 1LKZA 1NHVA 1CS4B 3GJTB 1UTAA 4Y3CA 5IM0B 2UXDF 3QRQA 1KKHA 2QLJB 3NGUA 5DDPC 1TKDA 4URGA 1BE4A 4C3KA 2AJ1A 3OVBA 3M32B 2AYEA 1SKUB 4X4PA 1MWZA 1NB2A 4DV3F 1PG5B 2FHOB 1OPIA 3QBCA 4G65A 2HWHA 1FSUA 3TARA 1VQNS 1MW7A 2DCUB 4UQTA 3KK1A 1NDCA 1RTJB 1JKHB 2VQFJ 2YH1A 3QYYA 3K57A 4ERDA 3TZYA 2AW0A 4OHYA 1WEZA 2J9DA 1H2UX 1QDUB 2VASA 2V69A 3J7Z5 4CT8A 1ZAWA 2QRRA 4YP3A 2JC1A 1BQMB 3IWXA 4RJVA 3S6EA 2VIHA 2UUTA 1HW8A 5K8NA 4J9KA 2IVYA 2RF2B 1FJEB 3FBCA 3IWLA 4UZBA 1GTEA 3PIOQ 1HQUA 4WIIA 1QSLA 1WSRA 2A3JA 2YXLA 1B4SA 2B9EA 1SC6A 3TVYA 5JUMA 2X1AA 4HDHA 4ECZA 3TI0A 3JB9k 2C2NA 4MY4A 3BV8A 1OY8A 2CDQA 4YR1A 2HLUA 3IM8A 3MM5A 4MKAA 2W5QA 2CNNB 4KQZA 3LF0A 4OJ1A 4GTWA 4ZN3A 1DFDA 2GSUA 4QAXA 2KKHA 2IJNA 1EJ7L 3I4HX 3OTDA 5HMXA 5HROA 4PPDA 3TG0A 1TAQA 5K4PA 1F5BA 1SJ1A 1XWLA 4ZOSA 2QIFA 3I5CA 2BW7A 2IFXA 4I69A 5KT7A 5I3UA 1EAYC 4EEYA 1YKWA 2C2OB 2MYFA 3ZTOA 3I55S 1OO0B 1M0SA 5LRMA 1KOHA 1WI6A 1RHKB 3NL0A 3OLAA 2W8SA 5CYMA 3TP2A 1EX8A 1R8HA 3PJXA 3CJ8A 4F02A 2CJQA 3TUZC 2GSOA 4M63A 4I67A 3KUHA 2APOA 4IRKA 4ZVQB 1WKKA 2R2RA 4AE5A 4RUAA 1BLUA 5F9NA 4KJGA 3KJFB 1XNQJ 4ED3A 1CJVB 1RHUB 1ICEB 5T14A 1A0OB 2XO6A 2BJ8A 1N36J 2ZKTA 1HPZA 4KTQA 3DGPB 3UD5A 4R0EA 3FFIB 4B3SJ 3CCZA 1TZ0A 3E01B 4ZPDA 2GVZB 4ETZA 2XC9A 3B6BA 3DLHA 1F3FA 1SUQA 3TX8A 1M5OC 4X4NA 3GG1A 4DI6A 1S0MA 2PA8D 2MDAA 5GAEU 2UUBF 4WFAQ 3EDQB 1M1HA 2D41A 4ZJOA 4DCJB 5GAGU 1K44A 2NPIA 3NGKA 3E2EA 2DNMA 2JRSA 2YKNA 3CJSA 1VC5A 4KHPJ 1WF2A 4J9UE 3CULA 1CJUB 3GJQB 3W8PA 1ANJA 4OHXA 4YB1P 3V6DB 4F3OA 4DR3J 1B8JA 3LXQA 2ALZA 2RDDA 4UUXA 1VOMA 3I0RA 5LL6d 1Q82T 4JV5F 2MQ8A 3M8YA 4YR3A 4CXKA 2VFRA 3H98A 2LXUA 1EZZB 2UXCF 3I5AA 2Z0GA 3LP1A 1RWPB 1YX2A 3CDBA 1ZYQA 2CPZA 3GR1A 4DUYJ 2WW8A 1GQEA 4WZQA 3UN3A 3NGTA 4H4MB 5GMKa 3OXFA 2F9JA 2IVFB 1OY6A 4IH6A 3IGZB 2ZH5A 4Q0BA 2OFGX 3KLEA 4DR2J 4C11A 2J7KA 4LSZB 2KU7A 2V9WA 1R8AA 3VVUA 2BE7D 4KSEB 3ZO7A 5CA5A 1IBCB 3QLHA 2ZH4A 3LO3A 1RLCL 2D3OR 3KHLA 3HVAA 5D0EA 5L1LA 2MB0B 2EC2A 1VBYA 4P71A 3D5MA 5HP1B 1Y11A 3JQJA 1BGXT 4F04B 2AGQA 4KV8A 5AXMA 2DNLA 3HXMA 4MFBB 5KFUA 3D0GE 5DM6Q 1H0HB 3H25A 4M1KA 1S0NA 1IKXA 4C2MA 2Z2ZA 1S1WA 3M8QB 4USTA 3SFGA 3ZTSA 1T9VA 2FJDB 5KFNA 3DLLQ 2DISA 4I2PB 3EYZA 5HMZA 3MHYA 4PCQA 2E5IA 3WC0A 3OQ2A 1SIWB 1HMVA 4IFVB 3OTOJ 3IBCB 2FJEB 2C3MA 3GV5B 3NS7B 3GMGA 4TN2A 1D8YA 3DLGB 3QGGA 1Y5LB 4RBUA 4ES1A 4KHPF 1RHJB 4HH1A 4C8YA 3IA0A 3KG0A 1NHKL 1RWXB 1WF1A 2HRYA 2YH0A 1J27A 4BWJA 4R5PA 4X4OA 1JX4A 1SUQB 2KFYA 4Q8FA 1VRUA 3CC4S 1RAAB 3DHWC 1XERA 2GQCA 4PPZA 5H9EK 2J0XA 2ZD1A 1Q7YT 3TOQA 4QZVB 4L74A 2BKNA 4NPOA 1YK9A 4QR1A 2C2EA 4DUYF 2GNKA 1GX5A 3ENQA 4ZIWA 4TY8B 1ZOTA 2HQCA 3PYEA 4UZCA 4YR2A 3PO4A 1RWOB 4TNOA 1C1CB 3DLKB 1XIQA 2MY8A 4TU7A 1VQ6S 1AA1B 1UZDA 3SZ2A 5KG5A 3IFEA 4NWJA 3IM9A 1GFWB 2WRMA 3BBFA 3ZZTA 3TZXA 3RZAA 3PO5A 2YY3A 3QT8A 4NL5A 1RADB 4PUOB 2ZH2A 3LPEA 4IH7A 4F4XA 1N32F 2YWFA 1NK4A 3SSQA 5C2CA 4U7UD 2XS7A 3PRVA 3VALA 2YKOA 3GYXB 3EVWA 1FDNA 5IT0A 1W25A 3O6QA 2KG1A 2BJEA 1QD1A 4ZG9A 3ZXWA 3KLGA 1EQ0A 1YRUA 2YQ1A 1F2HA 1B64A 3LTOA 3POTB 1KLMB 3T02A 3SZYA 4RW6B 4LFAJ 2O01C 2UXBF 1Q8KA 1SKRA 4I64A 1T9XA 2ACYA 3DGPA 5LXYA 3KNGA 1VQ5S 1JNZB 2R8KA 4RU2A 4ILMA 4UOFA 2C3PA 3JYTA 1KVIA 4FYYB 2HNYB 4KV8B 5IXUA 1R6VA 1RTJA 2GLQA 3OR1A 2J6UA 1XMOF 1FJGJ 3BGRB 4G1IA 2CJKA 4DL7A 2P2CB 2W7PA 1HQUB 5L1IA 1FRMA 1GMWD 2R7OA 2KT5A 3FK4A 3I31A 4IFVA 4YY3F 4K2XA 2ASJA 1UWBB 4KPYA 4K4XA 3MM6A 3CJ2A 4C0HA 4DV2F 3CJ5A 1VFJA 3R5CA 1LXJA 3AQOA 4TLQA 2W9CA 1VCTA 3TUJC 3KD8A 3CCMS 4Y65A 5HI7A 2XMKA 4O3RA 1OYDA 2PDAA 3KJQB 5I42A 1I1GA 4K5RA 1HA1A 2XMMA 4XDCA 1VQOS 2HVIA 4LR2A 3LP0B 3LPYA 6FD1A 3BGUA 3M8SA 3M2VA 5KFRA 1LWFA 2NZ4A 2AT1B 3PYDA 3MM8A 1XMQJ 5GAHU 2XGQA 5LJ5Y 2VQEJ 1RT2A 1S6QA 1UETA 1XN9A 3NOGA 2I1RA 1GMUA 3H2LA 4FKYA 3S8SA 3NXZA 3TNVA 4DS4A 4WBFA 1A9NB 2EK6A 2MXYA 2XY5A 4X4UA 1S48A 1D9AA 1H7XA 3MEEB 1MSWD 2HSEB 3LGMA 1EI6A 1OMSA 4HTJA 4KBIA 2LQJA 5HRTA 2GFFA 3SDEA 5B0CA 4DR6F 3T3FA 1S1WB 3M8QA 4LFCJ 4ZCIA 3NNAA 2A1BA 2DY9A 5D4LA 3DOLB 2ZH6A 4OYAA 4FF1A 4WFXA 2RD5C 2XZDB 4R8UB 3L7PA 4H4MA 5KFMA 1KHNA 3PX0A 4F4WA 1C1BA 2DGTA 4K2JA 2C3UA 3OFFA 5F0WA 1RAOA 3FSXA 3M9MB 2HYIB 3JSYA 1KC8T 4DSLA 2XS2A 3O1LA 1S9GB 3Q22A 1C0TB 1FD2A 2B8QA 2BUNA 2WBMA 3UR0A 2XLJA 3PX6A 3HD1A 5T7LA 2CUYA 1WHWA 4AFFA 2ZOFA 1HI8A 1TL4A 1S9EA 2NXNA 2MZQA 1SL1A 3OFGA 3CJ3A 3TRGA 5DG7A 3BN4A 2OPSB 2DRAA 3WIVA 3ZZRA 3DDNA 4G6VB 4OZNA 4PXDA 4EMDA 1KR4A 3G96A 2V4RA 1JXLA 2OPQB 3DXBA 4IFYB 1VDHA 2ZUGA 3MMJA 4LF6J 5KFTA 3VAJA 3QJJA 3I9V9 2ZE2A 3N6LA 2MZ1A 3A8IA 3BGFA 3M1VA 5IT9Y 4RZRA 4C8OA 1S6OA 5IQ6A 2B5JB 2DNOA 3DMJA 2IVMA 1UKUA 4YB6A 2M4MA 3S1TA 3CCQS 1RAHB 1KH5A 2DK2A 2WVDA 1X9SA 4QIVA 4CXUA 1RXOB 2NXCA 4A48A 3NLCA 4R0JA 2L41A 2C3YA 2RU3A 3LOUA 3SQGA 2R42A 4AXIA 2M0GB 3MUMP 1V5IB 4OV1A 2VKRA 3GJRB 4V19X 2G2ZA 2CJBA 2VFUA 1SL0A 1FKAF 1URRA 1LFWA 1H7WA 4ZPCA 2KM8B 3KLEB 3V4IA 1B7YB 3MGJA 2YX1A 2JH3A 2HHPA 1T9WA 4M5LA 5LQQA 2W25A 2A2CA 4ZCMA 3BSCA 3TAMB 1WC0A 3DU6A 4UT4A 3PIPQ 4MTPA 4F4KA 1KVJA 4LBPA 1AJDA 4OI3A 2RJZA 3HCXA 3OT9A 4JI1F 3CGIA 3WAWA 1HNXJ 2VL1A 3M8WA 1O6XA 3SCIE 1KDNA 2BE2B 2W9BA 1VC0A 2G0CA 1HQEB 1GXLA 2VBWA 2DCLA 4K50A 2DIUA 4UPKA 1HNVB 2RMLA 3CT9A 4LRDA 3OVSA 2E9ZA 1FESA 2AEFA 5DETA 1HI0P 1UVIA 1L3TA 1M5PC 1QAYA 4J9QA 4AL6A 1BC6A 4P6QA 2VBZA 2LEBA 1VI7A 3HLUA 1DTQA 1B3TA 3QT7A 2L9DA 4UY85 4YB7A 4YDXA 2IBOA 1KQGB 1JLFB 3MMCA 4OHVA 5CD4A 1FE0A 3J80Y 1D0EA 2ZVSA 1PAEX 4NLSA 4NYOA 4AT1B 3PACA 4ES2A 1U0SA 2Q79A 3DLKA 4OZ0A 1ZPWX 3BPDA 3CEDA 2ROGA 5LMUJ 1RT7B 2PN6A 3T1AA 3MI7X 1EKSA 1TQLA 3GTYX 3CMES 2OAUA 5DZ6A 1HQAA 2BXJA 3J7A1 2JVOA 1WACA 3R5AA 4LT6A 2E9TA 4FNHA 3TEHB 5E3QA 1K7HA 2ASYA 2V34A 3H20A 3CJQA 1RLDA 4O23A 2PO4A 2AD9A 2W5XA 1KFDA 1Q78A 3SDEB 4BWMA 5CYMB 1IVZA 2CPIA 3W62A 1SH3A 1VMBA 4J7CA 3W65A 4ANEA 2EC0A 1CBKA 3SQGB 4OI6A 3Q86A 2IMOA 1Q8IA 2QA2A 3MM7A 1Z2LA 5JXSA 2XI3A 3ZTQA 1J5EF 5BR8F 2J8AA 1REVB 4RW7B 3PKMA 3OPKA 1F2GA 2A18A 3ITHB 2FGCA 3MPWA 1ZM9A 3V5RA 5KG1A 1U8SA 3H2VE 4LR7A 5ETLA 1U49A 1YJ9S 2VZ9A 4M94A 2JSXA 2KHDA 2X3DA 3CCWA 4LFBJ 3IG1B 4DV5F 4Y2AA 2KVIA 4ZG7A 1ZA1B 5GMDA 2V67A 2DBBA 2HMIA 1G7CB 2I38A 1N56A 3DCAA 4CYSA 4ZJQA 4KHRA 1SKWA 1HD1A 4WP3A 5KFDA 5A2QU 5EX3A 1RT6B 1UVKA 5BYQA 3OR1B 1FI4A 4M5GA 4RNOA 4JI6J 1Q7LB 2CZ4A 5CZXA 5EGYA 3U02A 4RU9A 3Q3QA 2GSNA 4PYAA 2CQ1A 3QWPA 1UEVA 3RUBL 4DSIA 2FYXA 1BWVA 4WFYA 3I32A 4O3OA 4CXSA 4YOEA 1H2VZ 4QPTA 4ZITA 3MAAB 3PX4A 1T03B 1KQKA 3Q8RB 1HNIB 3NKQA 5IC4B 3Q8QB 4Y00A 1HMVB 2HIYA 5HANA 1JIHA 5F3TA 5AJ3F 2XY6A 3C2PA 4I6YA 3KNAA 3KYLA 3RAMA 4X64J 5JJBA 4FDIA 2G4BA 4W4MA 1N52B 1WHXA 1QY7A 2HFSA 3A8JA 3W2WA 2GIRA 3CC7S 1NDLA 4C11B 2N82B 4DN0A 1JXVA 2HZAA 4UF4A 1N0UA 1R0AA 1B99A 2FZCB 4EBDA 5D3GA 3G82A 2FIUA 4W98A 5BR8J 4P7TA 4KHMA 2NXJA 6AT1B 3ULHA 1SV5B 2DH7A 1KONA 1VRTB 1GH8A 4DSKA 1CSJA 1T3OA 2BANB 3KJNB 1Q16B 4CM2A 2MGZB 3OTOF 4FS2A 3EGNA 3O8WA 1T8EA 1LWEB 1KNZA 2JEIA 3K59A 4P52A 4AQYJ 1K8AT 2WVBA 2UVVA 3DDIA 2R7UA 5KFGA 3BB5A 3MD1A 5HJXA 5A8WA 3KJVB 1HIYA 3T5LA 2GMHA 3D1HA 1IBMJ 1HW9A 2XHWA 1IJEB 1Q5YA 1SQGA 3CWJA 1NKBA 4JI6F 3OUYB 4XDDA 3DI6B 3V2UC 4AL7A 5E0OA 2UU9F 5FJ4A 3FSYA 3OV7A 1V3SA 1VQYA 2F8MA 2H9ZA 3F56A 3RW7A 2MQNA 2MKIA 2VG6A 3GILA 1B70B 1VLOA 2CJAA 4LVOP 7AT1B 2B9YA 4X65J 2YNFA 2XR9A 2MZSA 5IJQA 1YTYA 3TUPA 1MMNA 4CH1A 4O3PA 5A76A 5A8RA 2ZDOA 2RRNA 5AJ3J 3BREA 1N0VC 1H73A 1LWCB 3NAIA 2BM0A 4NMXA 1KN6A 1OSDA 2MQOA 3IS9A 3UN5A 2MMYA 3UR3C 5J2PA 5HSPA 4ICLA 4OI0A 5HROB 5SZTA 4NZ6A 2C1EB 1JLCB 1TKZB 3PYGA 4N7TA 2J0QD 3VAHA 3GCWP 2QLBB 3HFZB 3G87A 2HBQB 3JSMB 2VPYB 2MZTA 3IAS9 1FFWB 3HDSA 3OVAA 3MR6A 3TZZA 2AYGA 2NR0A 2XMJA 4N76A 2J6SA 4WKYA 4UOGA 1IBKF 2O66A 2HRUA 2C2ZB 1RWWB 2FC8A 4DV6F 5DS7A 3GIRA 1JQGA 2B6AB 1NK0A 2M52A 4ZKAA 1PC4A 2KYXA 4EZ9A 3CMQA 4WK1A 1RB0A 4DEZA 2LQBA 2IUCB 4OV6A 1S1UA 2CQBA 5F0UA 2RDIA 5J2MB 3PW5A 4KAIA 3PW0A 2I2YA 2XWYA 4FXDA 2KFNA 3V81A 4A8QA 4UY8T 1FJ7A 2UUAJ 2B9XA 5IV3A 3RG6A 3QAUA 4GVLA 1Z1ZA 4DR5J 3PRDA 2V5HG 1OJ4A 3UFCX 4B3OA 5F8JA 4L73A 3KUGA 5C5JA 2E1MC 4L6V3 3MFHA 4J5OA 3CCJS 3DOLA 2P9EA 1WC6A 1MU2B 3BZQA 4QJVA 5DZ7A 1MWQA 1Q86T 1SQEA 1APSA 1NRKA 1AZSB 1RBLA 2P6TA 2W4PA 4N47A 1CVJA 3R5GA 1MMLA 2R7VA 5EGHA 4RWXA 1UMJA 3MM6B 3T5KA 3H8YA 1LQ9A 1OY9A 3DGVA 4P73A 5EUHA 1V3ZA 2EVZA 4I6AA 3CVKA 3UDLA 4CLWA 5AE2A 2MJUA 2AX0A 5HVHA 3GQCA 4JI4F 1VISA 1XMBA 2CPFA 1HWJA 4OYXA 2RNEA 1RA7A 2GO8A 3EGWB 1VQ4S 1N5QA 2EKNA 3AY0A 3R2DJ 1ROFA 1FKOA 2LXIA 1YIJS 1U1LA 2OTJS 4ECSA 4NYPA 1VC6A 2QL7B 5B0FA 5A8KA 4GC6A 2C2RA 2VA2A 1UJ6A 1LW0B 1RYSA 4Y2IA 2AMCB 3MMBB 3R7BB 4MK9A 2YNIB 5ETSA 3TYTA 5L46A 2XO7A 2D1CA 3KG4A 1O5JA 2O5DA 3IBWA 4QR0A 4X66J 8AT1B 3NKPA 3FUYA 5D0GA 5RUBA 2R7RA 2FVQA 4LF2A 3KOAA 2FJAB 4KFBA 4QYRA 1YBTA 1S6PA 1YBAA 4IG0A 3MEDB 3UE2A 1R0CB 2XY7A 3OTEA 3Q8VA 1RT2B 4JI3F 3OJUA 4RPFA 5LMNF 1N6QA 2K7KA 4NRUA 4LF5J 2V2ZA 4Q2LA 1H3DA 4AUKA 2KZMA 4RR5A 2MQQA 1FWPA 4HT7A 2KB2A 5A0YA 2GQQA 3OFHA 1N5TA 2MEWA 1X4FA 4A4JA 1KH9A 3HHNB 3M8RA 5LSRA 2LECA 1S0OA 1X8DA 1RAFB 1RTHA 2WTFA 1NJZA 1IM4A 3NP5A 3H59A 1I94J 2NS1B 2N4DA 3D66A 3VAKA 3ZNJ1 1H98A 3GIMA 1UVLA 1XQIA 2CQGA 1KLMA 1LEOA 4NE9C 1BXNA 2DY1A 2VPXB 3M2UA 5CYQA 4WFBQ 5I3QA 2VUGA 4WP9A 4ZLLA 3P4UB 2UVRA 3CJ4A 1IWGA 4J9SA 5FDLB 3VQTA 3T19A 4LF7J 4QOTA 2MKCA 5E2QA 2RSQA 3M30B 5GMEA 1WC5A 4DX5A 2XNQA 5IFMA 4OZ3A 2OTLS 1P49A 1ZM3A 1SH2A 1K9MT 3BDFA 2MSTA 2POKA 3ETOA 1MMDA 1S9EB 2JX2A 5A2QY 5GAGI 2DNZA 1NUEA 3HSZA 3IR5B 3NRBA 3K8VA 4WXOA 4X62J 1YJWS 2BQUA 1D8ZA 1SHQA 1RHMB 4KGMA 2RIJA 4KJDA 2OEMA 4XTTA 2HGNA 1RISA 5FLXY 1U09A 4OIXA 5HK4A 4AL5A 1Y0HA 2JEFA 4DG1B 1HJKA 1ZS6A 1S5ZA 1FEEA 3W2VA 3QT6A 1EB0A 4P7VA 4RUHA 5H1SV 3HHLB 5BYRA 3HSDA 1P9YA 1RTIA 1TL1B 3QIPA 4I7FA 5J1EA 3N6MA 3SV3A 4EBEA 2ATCB 4UORA 5D0RA 1S79A 3IBFB 3RGIA 4RNFA 4RW7A 3KMSA 1CJKB 1XR6A 2B43A 2IM3A 2W2QP 1RP5A 1VK3A 3V4MA 4OZ1A 5KFQA 2XLIA 2CVIA 1KSPA 4YHHJ 2M3DA 4F50A 2FHKA 1SC4B 5E3PA 5G4DA 1WKJA 3G8SA 3KUEA 2HHUA 3G8QA 3JTOA 4TY9A 3RW6A 3BGLA 5J2MA 2XSFA 2NSCA 1G6BA 1NXIA 2YTCA 4DPTA 4S0MA 4IRDA 5GADI 4LFAF 2I5JB 3US5A 3CCLS 3T1YF 3BQ1A 1TUVA 3HT0A 2WHOA 2DGQA 4NWBA 2BJDA 5LT5A 3BSNA 2YQ3A 2VODA 5L9NA 2NSBA 1RAGB 1HBOA 4OYBA 4BLGA 3TANA 2ZM6J 4UW2A 4DV7F 2ASDA 4CP5A 2HW3A 1NPPA 5K5MA 4EI2A 3VAMA 1SI9A 4IOBA 4LF8J 2HLTA 4ZVFA 4DSEA 1JLGB 4X4TA 3MAAA 1N33J 3GONA 1EETA 1FFSB 4TN0A 4NI2A 4D3GA 5CCMA 3KLVA 2X98A 4FYDA 1SJFA 1HBMB 2CQHA 4CO5A 5DO2A 4KO0A 2WK4A 3W7BA 4Q2MA 3WX8A 2GGPA 4U7UK 4LRBA 4CLLA 2RB7A 2MKJA 2VDIA 1UCNA 4C8LA 1S10A 3R9LA 3UDCA 2FJBB 2VFTA 2QZUA 3WZ0A 3P5TL 5C7PA 4B3RJ 4ED4A 2QO3A 4K0KF 1Y7AA 1MG7A 4DSJA 2N4CA 2NPFA 4EK2A 2LP4A 5EWGA 2ZOGA 1HFEL 1S59A 1AZSA 1Q0NA 1VHFA 1X4EA 1KQSR 1E6VA 3TVKA 4OZ5A 3GJSB 3SEOA 1RKIA 4CO0A 4L76A 2R7SA 1IJFB 3A3NB 2HNZA 4OL8A 2V94A 3GP9A 2XWXA 2YVSA 3KKFA 4C8KA 1YSJA 4QYZK 1N5YB 3NVLA 5IJSA 5J1EB 3RR8A 4DU8A 1SV5A 5B0AA 1B7FA 3ZTPA 4DUTA 4HH0A 4PG7A 4EFAC 4WFNQ 4JV1A 1UVMA 3R5BA 4CWBA 1ALHA 4DF8A 3QZ8A 2JJ4D 4J9LA 1ALIA 4RUBA 4FDJA 2JWNA 2QYGA 5KG0A 2K2PA 3M9NB 3PNIA 3VF0B 3W2WB 2R2UA 3VGVA 3CF5Q 4HACB 2D3O1 3M2RA 1IWAA 4OYPA 1K0TA 4C97A 1WDTA 3MUVP 1N88A 4KGZB 4ZA1A 4B3OB 4ZLJA 1IKYA 3T9ZA 3V81B 3ZZOA 2EXUA 3FEXB 3MCOA 4F8RA 1PC5A 3MMCB 5I3PA 1SJ3P 2CKWA 4A8SA 4ZVSB 4CO4A 2D9OA 4O4GA 1YG0A 3D68A 2XNRA 4ICLB 1WC4A 4PG6A 1FT8A 3ET6A 4PG8A 3THVA 1XR7A 3BBBA 4M8LA 2JOQA 4BCAA 2MGZA 2KJWA 3MAQA 1U45A 2QT7A 2OPSA 4IDKB 3GIKA 1XC9A 2MKHA 3Q8YA 2HK2A 3EDRB 2HIQA 2Z2YB 3HKWA 3NMRA 4KKOB 2DHSA 1HQEA 2D69A 2NLWA 1HWIA 1U02A 1UW4A 2V8PA 4WYLA 2JDJA 2R3VA 1CJVA 3BR8A 4FYWB 1GX6A 5B0EA 3SQOP 1QLNA 1KHLA 1RCOB 1FWKA 5D4OA 2ZJRQ 3UI3A 2G13A 2HBZB 4F36A 5KFEA 3C6UA 2HFOA 3DDKA 2L08A 4CO3A 1K1QA 4ES3A 1HQ2A 1UWAA 3EVOA 2IRUA 4GVBA 4U8YA 4IR1A 2P6SA 5DQHA 1ZEFA 2WONB 1A7GE 3OXGA 3K17A 4LRCA 2DVIA 2YNIA 3MMBA 1GAOA 1NPRA 4EO6A 2GX8A 5ETQA 3PW2A 2Z57B 4H4KC 1SC1B 5D77A 2CNOB 5JMNA 1WG5A 4DL2A 2B51A 2Q6CA 2W01A 1U4BA 3HM9A 3J81Y 2QSWA 1QSYA 3W66A 3ZNUA 4JBCA 2BANA 5E41A 1AUKA 3C3LA 1UW9A 5ETOA 3SMZA 1P6TA 3Q2TC 2PD1A 2XYPB 2HFVA 2NUUG 2HGMA 5KFXA 5ITHA 1RTIB 2XMWA 8ATCB 1QE1B 1TK5A 1N4LA 1ELOA 2QLWA 4GC7A 4OLOA 1HNZJ 1HYSB 3K0JA 2BOAA 3D6HB 4ECWA 1D09B 2HBYB 2LEPA 3D0HE 1FNXH 1P1LA 4NCGB 2MQPA 1IR2A 1URBA 1RU2A 3LP2B 3ENVA 3JSBA 3GB0A 2IPOB 4FVMA 2QFJA 2HEKA 1RACB 4ZIVA 1WSVA 3R8YA 3P45B 5G0RB 4K5SA 2E1AA 2RF2A 4MT1A 1U1QA 4GTXA 1KH7A 3SSRA 3M32A 3C14A 2V63A 3MEGB 5IQQA 3F73A 1R0BG 1F5CA 1Q79A 1ZA2B 2M2BA 4CO2A 5CCLA 3SZZA 4KGVB 3S7RA 5HN0A 5BXIA 1KTQA 3ZZZA 3KLFB 2UXBJ 2KT3A 3R27A 4PWDB 3DN9A 1SVDA 2ZZTA 4ANDA 4BBYA 2ZH9A 3HVRA 3W60A 2PMZD 3X3UA 2KN4A 4DL4A 1CULB 1UFKA 2AEMA 2VOPA 3ED4A 1NJYA 3M6UA 5C25A 5D4NA 2X3GA 1AJBA 3NBPA 3UD4P 2XBPA 3CIZA 2VB6A 1FXDA 2IHR1 2JEJA 2RDJA 4F7VA 2J0SD 4CM0A 3DOKA 3EVMA 2IA0A 4CNZA 7FDRA 2Z30B 2ASLA 5ETPA 1O99A 2EG1A 4HDGA 4JUZA 1JLBA 1AXQA 4OZLA 2ADCA 1EW2A 3HHKA 2K1RA 2X1BA 2GVDA 2B6AA 4A8XA 4DR5F 1FNMA 4I2QA 3W1YC 5B0DA 4DV3J 4N77A 3UO0A 2WVEA 3Q89A 3BEGB 2Z56B 3MM7B 3M6VA 3Q8PB 4LQ3A 2QSFA 4KGXB 2IUCA 3TA2A 5GRRA 2JZ5A 4ZN1A 2XULA 1X60A 2ZC4A 5I3UB 4A46A 2UV8G 1FXLA 3OR2B 1SJQA 3RRHA 2HWTA 4RLEA 5K8PA 2L48A 1FE4A 4CLZA 5KT3A 2OMLA 3CDWA 1EQMA 2LLZA 1VIOA 1VIXA 2MHNA 1E6YA 1TKTB 2RUGA 3NY0A 2H5JB 4NLRA 4XO0A 3D1QA 3MEKA 3K5MA 5DLFA 1CEZA 3M6XA 2VG5A 3EJMA 4UPHA 1RK8A 1FA0A 3CCES 4ETXA 2FVCA 2ZBCA 3QZ7A 3J7ZT 4WPAA 3H2UB 3UDEA 1YJVA 3QGHA 1RT4A 1NHUA 5HAOA 3EGVA 1EHWA 1WD6A 3UWTA 2BDPA 4B9MA 2XI2A 1S1VA 4MYTA 4JV2A 1RHRB 4L75A 1DQ9A 3MM9A 1E2SP 3DLGA 4BC7A 5IWAJ 4HYKA 5A6WA 2W9AA 5KFIA 2AP6A 1IKYB 1FK9B 4Z7CA 3SV4A 2HHXA 1PIEA 2IJRA 2ROPA 2A6MA 1RCXB 2W8LA 1RT3B 4W90B 4MK8A 1BUXA 5CYQB 4JYAJ 3NS6A 3E2DA 3WAXA 3K89A 4ED2A 3HF5A 2M7SA 4GKKJ 4ID5A 4YR0A 1V9OA 2LYVA 2OD4A 1GTHA 4DR4J 2YNGB 2GCFA 5KT4A 2XZWA 1PYTA 2WW4A 3DM2B 4RWWA 5E3CA 1R8BA 5D6GA 5J2PB 2ZZMA 2IIHA 4WZMA 1LOUA 1WDDA 3DRPA 3EICA 3D0IE 5KFYA 3WHIA 3MEEA 2VOOA 1KWMA 5CQGA 3GV7B 1VJQA 4TKTA 4GO5X 4C0OC 5E3AA 2B0GA 4YUDA 4FVCA 4F0MA 2E1CA 2ALYB 4QIFA 1U1NA 2OSQA 1R3NA 2DGSA 1L3VA 4P72A 4O0IA 3HHDA 1HBNB 4PEOA 1BD6A 4RW8A 1RWNB 4YFUA 4JI0J 1EP4B 2BV3A 2YX7A 3RBXA 3LP1B 4G3IA 3OBIA 1S9GA 2KRBA 1WOSA 1N36F 1NDKA 4N41A 1ULRA 4USUA 5M2UA 4DPWA 4PABA 1IR0A 1Q1KA 2X1FA 1NSPA 1U24A 2MQLA 2W2MP 3FQKA 4KH0B 4USJC 4A8KA 2JLFA 2ZD1B 2M8DB 3MK2A 4GTYA 3IGNA 3SI8A 1F3VA 2FZGB 4MKYA 2N7YA 3A3OB 3MECA 3CB4A 4C3MA 3Q8UA 3G4SS 3FDSA 3V6JA 1Y00A 1NCLA 3T1HJ 2Z58B 1D9FA 5L0EA 1F9HA 1WI8A 4QW8A 2DRDA 2HQ3A 3UNGC 3QNWB 3UNYA 4ZPWR 5C42A 3BGRA 2QA1A 5CAAA 3Q8SB 4DR7J 4M5MA 3VAIA 2LQ8A 1F5AA 5KFPA 5EHHA 4JI2J 1AB8A 4TYBA 3FBFA 2IBKA 1UWBA 2CXEA 3C8YA 4JV5J 2VC1A 4RBTA 4ILLA 2JNJA 4HHUA 5G0RA 4GVBB 3NKRA 2KI2A 2E7VA 1L3SA 1NLKL 4RO0A 3KK2A 1CJKA 3PFOA 2DPJA 5IS2A 2AWZA 2F5GA 3MCNA 1NZAA 2KXHA 3R5DA 4KM4A 4U6PA 2AEJA 2MJNA 3HJFA 2DO4A 2EFVA 3FBBA 5LRNA 3J80U 2E66A 1C4AA 1FX4A 2CQ4A 2RKIA 2XCAA 3V6KA 1UL3A 1TELA 2QV6A 3MTJA 2PFDA 1FJCA 1TU0B 4HACA 2P8IA 3J7YU 1OQ3A 4IOAQ 1WJ9A 2G9OA 2WOMB 5J2NB 3KHGA 2H54B 1VS3A 4B9VA 3MTKA 3SSSA 2PMHA 2JFKA 3MPUB 1YI2S 3OLBA 3TQEA 1NNDA 1R89A 3W5XA 3H42A 3U1LA 3A8KA 2P9GA 2A10A 1FVSA 4ED7A 3U7JA 5KFZA 3UCZP 1HYSA 2BE2A 1YGYA 1F1BB 3KLHB 2HHWA 1B0TA 2RRAA 1TUWA 1RU1A 2YPYA 5E7OB 4ZVRB 5DGAA 2Y8YA 4QU6A 3HKZD 4LF6F 1NSKL 1OWXA 3N01A 1N34J 3KTQA 2FVSA 1PSDA 1QAXA 2RE1A 3GIJA 1VQPS 2BW2A 3V6HA 1ALJA 1V6HA 2EG2A 2W1BA 3Q23A 3ELHA 3TW0A 5A6PA 2HMIB 1ELZA 2XMUA 1SC3B 2ATLA 1FRKA 4DV0J 2E5LF 1U26A 2BKOA 4DCOB 5KFKA 1VQKS 3ETMA 1N2KA 1S6QB 3OW2R 1RBOB 1TV6B 3RAXA 2ADBA 3WBHA 2H1YA 1RJJA 2CQPA 1XR5A 4R5PB 1NJXA 1RT1B 1UEUA 2V6AA 3M2VB 2J7UA 1YHQS 2A0FB 2H4YB 2V8GA 3H7HB 3MFIA 1C1CA 2W2NP 2AKWB 4DQSA 4KRWA 2CJYB 2GJFA 3KDOA 2IYIA 3CW2C 2KRRA 2VBXA 3NS5A 4YN3B 1QM9A 3W8GA 3WX4A 5IT9U 4GTZA 2M70A 4HLBA 3AD8C 5J1PA 3IXQA 5CH7B 3NBPB 5LM7E 1ZM4A 4I4BA 4MK7A 2IYGA 4C6AA 3AB2B 3HP6A 2V68A 4MFBA 4YB5A 2Y1JA 3TAQA 2A2DA 1DTQB 1UP1A 2KXFA 3ILJA 3TX0A 2AX1A 5KT6A 1M5VC 2HZVA 2ZZNA 2CNLB 3R3TA 3M05A 5B7WA 1JLEA 3A12A 4HHJA 1CJTB 2VU5A 1NM2A 3EZOA 4F25A 4B9UA 1T9YA 4LF4J 4FBTA 3SBMA 2DR7A 3F41A 3ZFVA 2IDLA 3SCJE 3LA0A 3CCUS 3PRBA 4CLPA 4ECVA 4CLSA 1WELA 3MEGA 2YWWA 3BPSP 1UVNA 1Z2ZA 4TLRA 1TL7B 2GHPA 4X64F 2XM3A 2DIVA 3LGHA 5CXTA 1KBRA 2IJFA 2VG5B 1IBLJ 3K2YA 1NSQA 1GXUA 3BBCA 3W9HA 2HQFA 2GA7A 4ED8A 2EK1A 2PSZA 1PBAA 3L9ZA 3DRSB 4DLEA 1GK8A 3AOBA 3LANA 4CDIA 1KLNA 5LOQA 2E1PA 1N5VA 2E7XA 2GJIA 1CPZA 3NKNA 1VR6A 4IO1A 4C9DA 2ZBIA 1MLAA 3FQLA 2KH9A 1AUDA 2DR8A 2WCXA 2FLPA 4B3TJ 1HR0J 1NK6A 2GC8A 1HNXF 2VQRA 1RGVA 1VK8A 1VRQC 1WORA 1BHNA 4IRCA 1XNRJ 4ZLPA 2QC3A 1T9UA 2JL9A 4Z7YA 4IFYA 1ZH5A 2W5TA 3RB3A 2YKNB 4DR1J 1FEHA 2FTRA 4USKA 3TR5A 3KFWX 5EWFA 2VG6B 2V2QA 3IN5A 3W5YA 3VAGA 2DR5A 4MIBA 4EYHB 4NRTA 1YRXA 3LAKA 1HD0A 2FDNA 4FDFA 2MZRA 2PEBA 4DBQA 3NNHA 4IYQA 1EARA 2BJ1A 3AA8A
chains in the Genus database with same CATH topology
1AJBA 2D1GA 3DYCA 2GSUA 4GTWA 5LIAA 2XRGA 2W5RA 4ZGAA 4QAXA 3WAVA 1AJAA 4KM4A 1KH5A 5LRNA 1O99A 4KAYA 2RH6A 4FDIA 4CXUA 4MHXA 5K4PA 5IJSA 1KHJA 3NVLA 3NKPA 4NWJA 1ZEFA 1HDHA 3MK0A 1E33P 1ALHA 1ALIA 3UO0A 3T01A 1ZEBA 4FDJA 5DLVA 5LRMA 1EQJA 2IUCA 3MK1A 5L0KA 5GRRA 3WAYA 3T00A 5EGEA 1ANIA 4ZG9A 4LR9A 1KH9A 2W5WA 1EW9A 2GSOA 3A52A 3T02A 3SZYA 4UOPA 5LQQA 1KH4A 4KJGA 4UPHA 1AJCA 1SHNA 1AJDA 3OT9A 5AJ9A 2ZKTA 3WAWA 4LQYA 3M8WA 3DPCA 2GLQA 5INHA 3NKNA 4UPKA 1KH7A 1O98A 4LRDA 1EJJA 3NKOA 1ELZA 2XR9A 1P49A 1Y6VA 4UPIA 3NKRA 2ANHA 3BDFA 5IJQA 1E3CP 1N2KA 1N2LA 3WBHA 4LREA 3BDHA 1SHQA 1KHLA 4KJDA 3UN2A 1KHKA 3UN5A 3KD8A 1AUKA 1URAA 1B8JA 3BDGB 3E2DA 1HJKA 3LXQA 3WAXA 4NWXA 4LR2A 5KXAA 4N7TA 3M8YA 2GA3A 4GTZA 3NKMA 4UORA 4MIVA 1ZEDA 3TG0A 3BDGA 4LRCA 1HQAA 3IGYB 3UN3A 1K7HA 4CYRA 3TX0A 3M8ZA 2W5XA 3IGZB 5GOVA 1ALKA 1E2SP 2W5VA 1ED9A 4CXKA 5C66A 1EI6A 2W5SA 5HRTA 2G9YA 2IUCB 4UPLA 1ED8A 1FSUA 1URBA 3B5QA 1KHNA 4ZG6A 4LR7A 1EW8A 3M7VA 5L0BA 1ANJA 2W8DA 3MK2A 4GTYA 5DLWA 5TJ3A 4TN0A 4ZG7A 2X98A 4GTXA 1ELXA 4CYSA 4UOOA 4LR8A 1E1ZP 2VQRA 5L0EA 4LRAA 3UNYA 2IFYA 2W8SA 3SZZA 2W5TA 4LRBA 3IDDA 1EW2A 4B56A 3Q3QA 5EGHA 2GSNA 4KAVA 1ALJA 2QZUA 4LRFA 4CXSA 4MY4A 1Y7AA 5DLTA 3ED4A 4YR1A 3TWZA 1ELYA 2W5QA 3CMRA 3NKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJB A;  2D1G A;  3DYC A;  2GSU A;  4GTW A;  5LIA A;  2XRG A;  2W5R A;  4ZGA A;  4QAX A;  3WAV A;  1AJA A;  4KM4 A;  1KH5 A;  5LRN A;  1O99 A;  4KAY A;  2RH6 A;  4FDI A;  4CXU A;  4MHX A;  5K4P A;  5IJS A;  1KHJ A;  3NVL A;  3NKP A;  4NWJ A;  1ZEF A;  1HDH A;  3MK0 A;  1E33 P;  1ALH A;  1ALI A;  3UO0 A;  3T01 A;  1ZEB A;  4FDJ A;  5DLV A;  5LRM A;  1EQJ A;  2IUC A;  3MK1 A;  5L0K A;  5GRR A;  3WAY A;  3T00 A;  5EGE A;  1ANI A;  4ZG9 A;  4LR9 A;  1KH9 A;  2W5W A;  1EW9 A;  2GSO A;  3A52 A;  3T02 A;  3SZY A;  4UOP A;  5LQQ A;  1KH4 A;  4KJG A;  4UPH A;  1AJC A;  1SHN A;  1AJD A;  3OT9 A;  5AJ9 A;  2ZKT A;  3WAW A;  4LQY A;  3M8W A;  3DPC A;  2GLQ A;  5INH A;  3NKN A;  4UPK A;  1KH7 A;  1O98 A;  4LRD A;  1EJJ A;  3NKO A;  1ELZ A;  2XR9 A;  1P49 A;  1Y6V A;  4UPI A;  3NKR A;  2ANH A;  3BDF A;  5IJQ A;  1E3C P;  1N2K A;  1N2L A;  3WBH A;  4LRE A;  3BDH A;  1SHQ A;  1KHL A;  4KJD A;  3UN2 A;  1KHK A;  3UN5 A;  3KD8 A;  1AUK A;  1URA A;  1B8J A;  3BDG B;  3E2D A;  1HJK A;  3LXQ A;  3WAX A;  4NWX A;  4LR2 A;  5KXA A;  4N7T A;  3M8Y A;  2GA3 A;  4GTZ A;  3NKM A;  4UOR A;  4MIV A;  1ZED A;  3TG0 A;  3BDG A;  4LRC A;  1HQA A;  3IGY B;  3UN3 A;  1K7H A;  4CYR A;  3TX0 A;  3M8Z A;  2W5X A;  3IGZ B;  5GOV A;  1ALK A;  1E2S P;  2W5V A;  1ED9 A;  4CXK A;  5C66 A;  1EI6 A;  2W5S A;  5HRT A;  2G9Y A;  2IUC B;  4UPL A;  1ED8 A;  1FSU A;  1URB A;  3B5Q A;  1KHN A;  4ZG6 A;  4LR7 A;  1EW8 A;  3M7V A;  5L0B A;  1ANJ A;  2W8D A;  3MK2 A;  4GTY A;  5DLW A;  5TJ3 A;  4TN0 A;  4ZG7 A;  2X98 A;  4GTX A;  1ELX A;  4CYS A;  4UOO A;  4LR8 A;  1E1Z P;  2VQR A;  5L0E A;  4LRA A;  3UNY A;  2IFY A;  2W8S A;  3SZZ A;  2W5T A;  4LRB A;  3IDD A;  1EW2 A;  4B56 A;  3Q3Q A;  5EGH A;  2GSN A;  4KAV A;  1ALJ A;  2QZU A;  4LRF A;  4CXS A;  4MY4 A;  1Y7A A;  5DLT A;  3ED4 A;  4YR1 A;  3TWZ A;  1ELY A;  2W5Q A;  3CMR A;  3NKQ A; 
#chains in the Genus database with same CATH topology
 2FGO A;  2HK3 A;  4CLY A;  2A6O A;  2WON A;  1BQN B;  2BE9 B;  3BN7 A;  3MCS A;  4WIQ A;  4CH7 A;  2W8K A;  3BYP A;  4K4T A;  3MM8 B;  3C16 A;  1Q8B A;  1UA0 A;  4NLG A;  4KPC A;  4ZS6 A;  1Q8L A;  2DGV A;  1Y5I B;  2LMI A;  3PFE A;  5C25 B;  2HHV A;  4PQU B;  1YJU A;  1KS2 A;  1X4D A;  3K5O A;  5DM7 Q;  3CJ0 A;  1RAJ A;  4ECT A;  3OSP A;  5IV4 A;  3TEG A;  3PR4 A;  3T01 A;  2BAB A;  2MZJ A;  4QYZ J;  1R8P A;  4OX9 J;  2EFQ A;  3KK3 A;  3N28 A;  4RKU C;  2O1P A;  2W9B B;  1R7I A;  2NYI A;  3CD5 A;  2B5J A;  2BAC A;  2CRL A;  2VJV A;  4PRF A;  1VQM S;  5ETK A;  2HHS A;  2FQQ B;  3A8E A;  2J7W A;  4C48 A;  4UQG A;  3R1L A;  2XG8 A;  2YKQ A;  3QWU A;  2LKZ A;  4RW4 A;  3VAF A;  1REV A;  4DDF A;  5BYS A;  5FII A;  3NKY A;  4ANC A;  4ZVU B;  4NCG A;  4CI0 B;  5KT2 A;  4WU2 A;  4QWD A;  3OL6 A;  4NXN F;  3A3P B;  1GNK A;  2EFO A;  4CIO A;  3NCR A;  2B7B B;  4OX8 A;  5E5N A;  4U67 Q;  5KG2 A;  3BQ0 A;  4O3N A;  5HLF B;  4LQY A;  3QID A;  4XPC A;  2GHV C;  3HVW A;  3JXO A;  3KXD A;  1FNO A;  1RBA A;  1TV6 A;  2CPX A;  2GW8 A;  3K7R A;  3R6G B;  1LWE A;  4G1Q A;  4GMK A;  4ZPB A;  5MAO A;  2RQC A;  4DFK A;  2DR9 A;  1KRP A;  4HI2 A;  1RTZ A;  5K9F A;  5T41 A;  2G1H A;  5KFF A;  4UPI A;  2VG7 B;  1M5S A;  1DAX A;  4KY3 A;  4NEY A;  4OI1 A;  1YVF A;  1RHQ B;  3IGV A;  1HNV A;  4HR2 A;  2PT0 A;  2CJX B;  4H54 A;  4I1T A;  5HBM A;  3ZZY A;  5K20 B;  1KTV A;  3BF4 A;  3SIP B;  1Y10 A;  2QMW A;  3T41 A;  4N5S A;  3UN2 A;  4B3M F;  2K3I A;  3DRR A;  2RU9 A;  1P1T A;  3DMJ B;  2OMO A;  4PQA A;  3AXM A;  5KFC A;  2O67 A;  3NGD A;  1S4F A;  5KXA A;  1F60 B;  1YBU A;  4C98 A;  4NLW A;  1AYE A;  2IM2 A;  1TK0 A;  1D9D A;  2DXF A;  4O3Q A;  3L95 X;  4MIV A;  1ZED A;  5KG7 A;  3PKY A;  1TL5 A;  1EKR A;  4DF4 A;  2FUG 9;  2Y1R I;  2NZC A;  2R7W A;  3G82 B;  1YJ7 A;  2FVR A;  2OIH A;  1C0U B;  5DRK A;  2X7I A;  4LIR A;  3G6Y A;  1QUP A;  4NAS A;  4FS1 A;  1XEZ A;  3Q2S C;  3KLG B;  2IC3 A;  2EEY A;  2CPH A;  3MZI A;  4UOH A;  5KFL A;  3U1M A;  2IMW P;  1Y3J A;  4L3K A;  2WSC C;  2BQ3 A;  4QBU A;  1RT6 A;  3U1N A;  4YEA A;  3VZH A;  3N9U C;  3TAM A;  4UPL A;  4URQ U;  4WK3 A;  1TUG B;  5J2Q B;  4DXL A;  3HZG A;  1IKW A;  2GMJ A;  1UJ5 A;  2E7W A;  1UVJ A;  5H9F K;  3GSI A;  1T02 A;  1VYA A;  1QJH A;  2VF3 A;  4A8O A;  4M95 A;  1N32 J;  3WC2 A;  1RQ0 A;  2WB1 D;  3GFZ A;  2ILY A;  1KD1 T;  3DHX A;  5F8N A;  2XYH B;  3IC1 A;  1RAB B;  3MPY A;  1P8G A;  1NBE B;  1WKL A;  1FDA A;  3HHE A;  4DSF A;  3IAM 9;  2DNG A;  4LRA A;  3CMA S;  1T05 B;  2PFF B;  4Y34 A;  2WZ1 A;  1EP4 A;  1VBK A;  5E3R A;  4TU9 A;  1X5P A;  4DUZ J;  2GAG C;  2OUG A;  1QTN B;  4ITS A;  2RS2 A;  2H51 B;  4DU7 A;  3PW4 A;  1X0P A;  4LSL A;  4DMZ A;  1YQH A;  2H5I B;  4KAV A;  2ZNY A;  4NOH A;  1HI1 A;  3DLJ A;  2KHC A;  4OYO A;  4F67 A;  2ZH3 A;  3A4T A;  3PEH A;  2FJW A;  1RSC A;  3C16 B;  1O8B A;  4B17 A;  3CNQ P;  4F3Q A;  2RIL A;  4DV6 J;  1MU2 A;  1TKZ A;  2ZHO A;  3HSJ A;  4B9S A;  4RNN A;  3D54 A;  1SJR A;  1JLF A;  3DYC A;  2YWH A;  4NLX A;  3IS9 B;  2HKE A;  4J37 A;  1F9E B;  1FDB A;  1RWK B;  1F6T A;  2DHG A;  1U2F A;  2Q1L A;  4JI0 F;  1CQM A;  3OD2 A;  3TVZ A;  4CTA A;  2QEX S;  2AJ0 A;  2KT2 A;  2MPU A;  2QL5 B;  2ROE A;  1PIL A;  2YNG A;  3IR7 B;  3MD3 A;  3MWB A;  3M1V B;  3QPI A;  3RBD A;  4LJM A;  4F3M A;  4ZVE A;  4O44 A;  3PZP A;  2C2D A;  3RB6 A;  5J1N A;  2W5R A;  3T6J A;  2DNN A;  1UA1 A;  1LFP A;  1X7V A;  1XBW A;  2V2K A;  2HGL A;  1XK8 A;  1FTR A;  1C0U A;  3FBE A;  2OSR A;  3TJ8 A;  3T1H F;  2XGP A;  3T00 A;  5DG9 A;  5IM0 A;  2SXL A;  4FZV A;  1CS4 A;  4A8Y A;  1R0A B;  3TA1 A;  3PY8 A;  1DHM A;  5M2R A;  2LDI A;  4F2R A;  3A52 A;  4KB7 A;  4HT5 A;  3N4W A;  1PYO B;  1K47 A;  3M2U B;  1SQF A;  4E8U A;  3BKT A;  4ZP6 A;  1S1U B;  3G6E S;  4DL5 A;  1TL7 A;  3GYG A;  3V4I B;  4IR9 A;  2KYZ A;  1L3K A;  1TFY A;  1HBO B;  3QGI A;  3JAM Y;  3PJ9 A;  1T3N A;  3B4M A;  2XRG A;  3DOM A;  1TR0 A;  2BVZ A;  1TL3 B;  1V5V A;  3DRS A;  1UFL A;  1VRT A;  1S1X A;  1HBU B;  2CAJ A;  3DFE A;  3LUY A;  3M8P B;  1S72 S;  5ETV A;  1TVR A;  5DG8 A;  3MAH A;  4RNH A;  3OHB A;  1U0H B;  1U8W A;  3EZ5 A;  3PVX A;  2DO0 A;  2OPP B;  3PTW A;  3EPG A;  1EJJ A;  1P27 B;  3NKO A;  1S7I A;  4Y0F A;  2IM1 A;  1S4E A;  4NLP A;  2CWK A;  1Y6V A;  4QWB A;  4NLV A;  1BQM A;  2ZWO A;  4OYM A;  1JWW A;  4HHH A;  5CD4 H;  1N2L A;  4W92 B;  3JTP A;  4FYV B;  4LRE A;  3HMJ G;  1OYE A;  3NWR A;  4C0B A;  2COL A;  4XIU A;  1ZBT A;  4JI3 J;  1G3O A;  3W5Z A;  1JLE B;  4IQM A;  5F9L A;  3M9O B;  5LMN J;  2RS8 A;  1DAR A;  3F44 A;  3QMQ A;  4I0W A;  2OKQ A;  3TA0 A;  1S12 A;  3QAT A;  3KLI A;  4NXM F;  4Y2M A;  6FDR A;  2VJU A;  4NWX A;  3E01 A;  3AT1 B;  2IA6 A;  2O3D A;  2CQ3 A;  3HJV A;  1PJ5 A;  4DV1 F;  1LXN A;  2B56 A;  4ZMM A;  1LW0 A;  3P49 B;  4P2X A;  5HJY A;  1BQN A;  2YNF B;  3UD3 P;  3IGY B;  3GSD A;  2MLY A;  2IC3 B;  3IRX B;  1QVG R;  1I94 F;  4MIW A;  1GEH A;  3M6W A;  1LK5 A;  4UOC A;  4USH A;  2ZOM A;  4EGL A;  3AQP A;  1WNE A;  2F63 A;  5M2P A;  2AV5 A;  4NML A;  3THP A;  1N34 F;  4DHV A;  2R8G A;  3RB0 A;  4OQJ A;  2HFU A;  1SCJ B;  3J81 U;  4DV4 J;  1U1M A;  3FEY B;  1H74 A;  2F7V A;  2G9Y A;  2V8D A;  2RH3 A;  5A8W B;  2QLF B;  4PG4 A;  4WCE Q;  1RDR A;  2V8H A;  1X4B A;  4K7Q A;  4V1A k;  4YY3 J;  3KLH A;  1ED8 A;  1EET B;  3BH6 B;  1Q81 T;  2B7C B;  1JB0 C;  3D7S B;  5AT1 B;  1U25 A;  4X4Q A;  5KFW A;  2HG4 A;  3OUY A;  1YJT A;  3AD7 C;  2M5Y A;  1EW8 A;  1NKC A;  4KIA A;  1HWU A;  1X5O A;  4QWC A;  3TAP A;  3RYL A;  2XHC A;  4HKQ A;  3OSN A;  9RUB A;  1T03 A;  4JI5 J;  4P75 A;  3GPA A;  1WEX A;  1QUV A;  4MJK A;  2BEF A;  3ONQ A;  1O0P A;  4ATN A;  2GZO A;  2KM8 C;  3G2X A;  1ELX A;  4UOO A;  1JJH A;  4EUV A;  1U47 A;  2GML A;  2IFY A;  3FFI A;  2DRB A;  1I6J A;  2DHA A;  1YLX A;  2AZ3 A;  3AJ1 A;  4F4A A;  1XMQ F;  3IDD A;  2RKI B;  3L09 A;  4DJB A;  4YHH F;  4CRJ A;  1KP6 A;  4TQS A;  4ZVO B;  3UCU P;  1M5K C;  2RQM A;  1AFI A;  2CQC A;  3HI9 A;  5EWE A;  1NH7 A;  1TMM A;  5ETN A;  2K06 A;  2QLX A;  2QZ8 A;  3TWZ A;  2R8I A;  4LF9 J;  5F8G A;  2X51 A;  4WFZ A;  1CG2 A;  4PQU A;  9ATC B;  5C2G A;  3WDO A;  2P5V A;  2Z2L A;  3VGT A;  2OI2 A;  3AOA A;  3WAV A;  1Y3K A;  2PEH A;  2XMT A;  3FRY A;  2C2M B;  3O3L A;  5DDR C;  2XEX A;  1I3O B;  1PJ7 A;  3BDE A;  1IBL F;  5CYJ A;  2MKS A;  4DV7 J;  3R2C J;  2NCK L;  3HVT B;  2W2O P;  4J9R A;  2MY7 A;  2HHQ A;  3G9C A;  3I4P A;  3MR2 A;  4PYD A;  2BYC A;  3GV8 B;  4GKJ J;  1SKS A;  2Y3Y A;  3BKF A;  5HLF A;  4NEZ A;  2BQR A;  1S49 A;  3FJ2 A;  4LF1 A;  2CPY A;  2OFH X;  4ZPV R;  4Q0B B;  2OP5 A;  3CD7 A;  3BKU A;  3N6N A;  4ZVG A;  4CTA B;  1EW9 A;  1EIY B;  2P9C A;  2ZDP A;  3ZZ0 A;  2D74 B;  4Z37 A;  4JI5 F;  1Y4Z B;  3ISZ A;  4KGK A;  1ZTW A;  1IM6 A;  2VIC A;  2EPI A;  1DTT A;  2H48 B;  2K7J A;  2Z2M A;  1AFJ A;  1SHN A;  4ZHR A;  1TFW A;  1P9Q C;  3KHH A;  1IKW B;  4J9P A;  1NJW A;  5AJ9 A;  3H4D A;  5D8H B;  4IO9 Q;  3NCP A;  3CUN A;  3UQS A;  4OI4 A;  4YDD B;  1RWM B;  1OIA A;  4UUW A;  2YWE A;  1JNR B;  4FKX A;  2K8G A;  1VBZ A;  3C6T A;  4JI8 F;  3TJA A;  4WTY A;  1TMJ A;  3KWM A;  3PCO B;  5KG4 A;  5JVG Q;  2ANH A;  2ZJQ Q;  2Y1L B;  4KJI A;  4U7C A;  3BDH A;  4OX6 A;  1R27 B;  2DHH A;  2QG9 B;  4QR2 A;  3E51 A;  3WBZ A;  4DPU A;  5DJB A;  3VTI A;  1FVQ A;  3PJW A;  1U2R A;  1G2E A;  4DV5 J;  2F9D A;  2MKY A;  1HPZ B;  1U7L A;  2B9W A;  2XS5 A;  2J76 E;  2HAF A;  3HO1 A;  4J91 A;  2CQ2 A;  4ECQ A;  4DQR A;  4X4V A;  2BBE A;  2VA3 A;  2DJW A;  3QSY B;  1N5Y A;  4E0D A;  3GFY A;  4G1P A;  3PHE A;  4QIE A;  3R7S B;  2CNK B;  4FF3 A;  2IDE A;  4TY8 A;  4GKJ F;  3HD2 A;  2NYH A;  1UJ4 A;  1RWV B;  3BDG A;  2C28 A;  3QLH B;  5J2N A;  2AIR B;  1Y5N B;  3OXL A;  1YIT S;  3DYA A;  1I5O B;  3FCW A;  1W7W A;  3NOC A;  1NKE A;  2E44 A;  4IKA A;  3RAQ A;  3ILO A;  3JTN A;  2RQK A;  3TUI C;  1N5S A;  1RE1 B;  2FLL A;  3GFH A;  2CPE A;  1GMV A;  3PYF A;  5CHC B;  2BMB A;  1H72 C;  1QTM A;  2J0W A;  2DEJ A;  4DFJ A;  4RW4 B;  5HL7 Q;  1CJT A;  1WHV A;  2OD6 A;  4PZV A;  4URS A;  3N5B A;  3CC2 S;  1X4C A;  2DXE A;  2E1R A;  3PW7 A;  1VQS A;  4BS2 A;  4I56 A;  4QIG A;  1HBM A;  2LA6 A;  4DX8 H;  5L0B A;  3M7V A;  3NCQ A;  2R7Q A;  2ZFH A;  3LW5 C;  3I96 A;  3R1H A;  4LF7 F;  3TO8 A;  2QGF B;  4U8V A;  2WAQ D;  1LWX A;  1D1U A;  2HZC A;  5TJ3 A;  4ZCL A;  2G2O A;  5D0H A;  3PXG a;  3WQP A;  2E9R X;  4ZVT B;  1J5O B;  2HHH J;  2VG7 A;  2VON A;  1HNW J;  3M8P A;  4F0K A;  1PBU A;  1HBU A;  1OQ6 A;  4DX7 A;  1RT1 A;  3FCV A;  5FD1 A;  5E33 A;  2ZNZ A;  4LQ9 A;  3W9I A;  1X4A A;  4H4O B;  3AFG A;  2HAI A;  4OJG A;  2QA4 S;  1FJG F;  4O44 B;  3R97 A;  2J9C A;  1IKX B;  1JXE A;  4QWA A;  1JK9 B;  2LXF A;  3FC9 A;  1WG1 A;  5DLT A;  4DZ6 A;  2L3M A;  1FO1 A;  2FZK B;  4NYZ A;  4USV A;  3GU0 A;  3HX9 A;  3VGU A;  2MTL A;  1IXK A;  4CQ1 A;  3DXS X;  1WEY A;  1A6L A;  5L38 A;  1UPM B;  4PR6 A;  2FPH X;  5F8M A;  5LJ3 Y;  4DG1 A;  4OFZ A;  4WE1 A;  3NGS A;  2LDY A;  4XPE A;  2BX6 A;  3I0R B;  4MHX A;  4M5K A;  4RW6 A;  1TL1 A;  3QIP B;  4I7F B;  1JLQ A;  3N5F A;  4J90 A;  2AYM A;  3CJT A;  3MXH P;  4PWD A;  2KZZ A;  2OLW A;  2YKA A;  3T1Y J;  3NGR A;  2B4U A;  3OL8 A;  2YNH A;  2OEK A;  2OPQ A;  2I5J A;  4LFB F;  2Q3P A;  4JB8 B;  3IWN C;  2R9L A;  1VJW A;  3RU0 A;  2Q6B A;  2GIF A;  1MN9 A;  3E8O A;  2C42 A;  4MKB A;  4Z2X A;  4M5J A;  1XJW B;  1S77 D;  3OL9 A;  2GHW A;  4R8U A;  3M30 A;  3MR5 A;  2UXC J;  1UPP A;  4ZHR B;  3IRW P;  1UZH A;  2DNH A;  1JLG A;  1NO8 A;  3AHP A;  2E5G A;  2OPR A;  1C0T A;  3J7Y I;  1HHS A;  2DNY A;  1R43 A;  5AE3 A;  4LFC F;  1XNR F;  1HNW F;  3MF5 A;  2BM1 A;  1RTH B;  2CG8 A;  4WP8 A;  2W9C B;  3Q24 A;  7FD1 A;  2VKZ G;  3OL7 A;  1TAU A;  2U2F A;  3C6T B;  2PI5 A;  3QJP A;  1WHY A;  3ISN C;  4F26 A;  1BMQ B;  3CSK A;  5JVH Q;  1JJ4 A;  4MKV A;  3D28 A;  4PXB A;  3J7A N;  3HHL C;  4V19 J;  2XQC A;  1PJ6 A;  2V4J B;  4L3N A;  2EW9 A;  5IT4 A;  2QMU B;  4K59 A;  5THW A;  3CCV S;  1NSA A;  1BQX A;  2DNQ A;  1U6F A;  3B54 A;  3HFV A;  3G71 S;  2DNP A;  4FF4 A;  4NLU A;  5FDL A;  1VQ8 S;  2VFV A;  4DQI A;  1DTT B;  4JV0 A;  4IG3 B;  2U1A A;  4DS5 A;  4Q7A A;  1O51 A;  3E3X A;  2G0I A;  1TL3 A;  1FTC A;  2F4V F;  1FXR A;  2FLO A;  3GLJ A;  4ELU A;  2LFV A;  1HHT P;  1CUL A;  4IH5 A;  5DGB A;  2XB2 D;  3F0N A;  2YQ0 A;  3AJD A;  2DNK A;  1H6K X;  1HNI A;  4CLK A;  1RA6 A;  1Y7P A;  2ZE2 B;  5FLX U;  3PDN A;  1U2C A;  1ZPV A;  3C66 A;  4OX9 F;  3V6D A;  5I42 B;  5J2Q A;  4NA2 A;  2CPD A;  3CJR A;  4HI1 A;  4JI2 F;  3I56 S;  4ECR A;  3EUN A;  1YJN S;  1NK7 A;  1M90 T;  2NXU A;  3EPI A;  1RT5 B;  3HVT A;  1LV5 A;  2BRL A;  3KG1 A;  2UUW A;  5D15 A;  2ZHA A;  2VBY A;  4U9R A;  3SCK E;  2KG0 A;  2R7T A;  1S6U A;  4ZP9 A;  2YNH B;  4B3S F;  4ED0 A;  2AGP A;  3GE9 A;  4ZCK A;  4EO8 A;  2W5S A;  1S7H A;  2BR0 A;  2OGU A;  1DY3 A;  3NEK A;  4ECX A;  1HLW A;  3D6T B;  3RRG A;  4IUF A;  2WBR A;  3NMA A;  1FRI A;  4QCL A;  2VHG A;  3EGZ A;  2BJ7 A;  5ETM A;  1QE1 A;  3AOC A;  1PCA A;  1SPB P;  4GRS A;  3CCR S;  2HWI A;  3FGV A;  4M5N A;  5DDQ C;  4BC9 A;  3NG8 A;  4CNY A;  4USM A;  2UVU A;  2ZBR A;  4WTO B;  2ZH7 A;  3OFE A;  4DR3 F;  3RR7 A;  4LF5 F;  1NU4 A;  1X4G A;  2QL9 B;  3H90 A;  5MLC V;  5KAK A;  2UUC F;  4LR8 A;  1TKX A;  2HVD A;  1W2B R;  1MRO B;  1WG4 A;  2ZBQ A;  2KVQ E;  5AE1 A;  3UDV A;  2QTW A;  3QGP A;  5HBM B;  2V0N A;  2ZVI A;  5CAB A;  4A8M P;  4JI1 J;  4QW9 A;  1XNQ F;  1FK9 A;  2M9K A;  2F4V J;  4IDK A;  3QO9 A;  4B56 A;  1NK5 A;  1NB7 A;  3KMQ A;  4AD6 A;  3JSR A;  3KDN A;  3ADA C;  4LRF A;  1VHI A;  4CH0 S;  4I2Q B;  1TP7 A;  4ER8 A;  3T5J A;  3GWC A;  2KTQ A;  4L72 B;  1R8C A;  4NLQ A;  1ELY A;  3ZC4 A;  2Y8W A;  4QPX A;  3CMR A;  2RT3 A;  2EBG A;  3PEJ A;  4N8N A;  3TJ9 A;  2CFX A;  1RT3 A;  1M1G A;  4TXS A;  1N48 A;  4U96 A;  2CYY A;  2DIT A;  1JLA A;  5DQI A;  3KLI B;  2G0J A;  4ZPA A;  1WOP A;  2RH6 A;  4NXM J;  2DD8 S;  3IP0 A;  2V50 A;  5LSL A;  1RTD B;  3D4J A;  1DJ0 A;  4LSN B;  4ALZ A;  3MPV A;  4HVZ A;  3BO4 A;  2CQ0 A;  3B78 A;  4TU8 A;  1NZ8 A;  2YWK A;  1X9M A;  4CCH A;  3W3S A;  2OHD A;  3DLE A;  4N56 A;  1K0V A;  4DLG A;  3CO9 A;  3TZW A;  4YQW A;  2DR6 A;  3P3D A;  1GMW A;  3IRX A;  1KHV A;  1RAI B;  2IAJ B;  3QAE A;  5K14 B;  1U1K A;  1QAJ A;  2NRE A;  3VHQ A;  1EQJ A;  3DYA B;  4NCA A;  3QRR A;  4PXC A;  4FBU A;  1QAI A;  2VV5 A;  4D3H A;  2R7X A;  5ETR A;  1TVR B;  2QA4 G;  2QFI A;  4B9L A;  3H5X A;  5EGE A;  2D3U A;  1LW2 A;  3DOK B;  4K4V A;  2W5W A;  2FC9 A;  1DLO A;  5B0B A;  3A1Y G;  5IZH A;  4DR7 F;  2RUS A;  5KOW A;  3GCX P;  5ETT A;  3FSI A;  2QMX A;  3SXL A;  3CD0 A;  4J9M A;  2LA4 A;  2GVD B;  2YKM B;  3M2R B;  4USI A;  1IQZ A;  2G2Y A;  2HFZ A;  2M88 A;  3ITH A;  3K8W A;  4PAA A;  5AXN A;  5F8L A;  4BDP A;  2NQP A;  2X1G A;  3LP2 A;  4LF9 F;  2JEG A;  1AJC A;  5KTQ A;  1I51 B;  1WC1 A;  4DUZ F;  1IN0 A;  2CA9 A;  4P2M A;  4CLF A;  5GAH I;  3I6P A;  3H40 A;  1RKJ A;  5HO4 A;  2DNR A;  4LF4 F;  4MYU A;  2HQI A;  4MMO A;  4ZP8 A;  1ZM2 A;  2H5E A;  3DRY A;  3BQ2 A;  4TYA A;  1YDL A;  2JVR A;  2Y0B B;  1UAW A;  3D6F B;  4XK8 C;  4RUC A;  3EM1 A;  2CAD A;  5DQG A;  3C14 B;  3ICL A;  1JMT A;  4FN5 A;  3AOD A;  4KE5 A;  2N7C A;  3GII A;  1S57 A;  1S99 A;  3LQV A;  4DWI A;  2J5A A;  3ILL A;  4PWU A;  5HMY A;  1U0H A;  2LCW A;  2WSF C;  4LF8 F;  2UZA A;  4PG5 A;  2ZWP A;  5C24 A;  2L9N A;  3KLF A;  5D78 A;  3VQS A;  4ECU A;  1U48 A;  3UW1 A;  2CG4 A;  3CO0 P;  3PM9 A;  3P96 A;  5F8I A;  3CJK A;  2VPW B;  2ABY A;  2FHJ D;  2VC0 A;  1U6Z A;  2B4P A;  1FKP B;  2RHQ B;  2XMV A;  3H5S A;  4PXE A;  3VWS A;  1HR0 F;  4B3T F;  2GA3 A;  3NKM A;  3K5P A;  2FHJ A;  5KFS A;  4K8R A;  3KK2 B;  2Y1I A;  4FXW A;  1AW0 A;  4LVN P;  3DC2 A;  2IM0 A;  3HUL A;  4ZK7 M;  2EWH A;  3I0S A;  4WF9 Q;  2V2V A;  4K4S A;  4O0N A;  4OJH A;  3M8Z A;  5A8R B;  4ED6 A;  1BWE A;  2IRX A;  4PWW A;  4FP9 A;  3X1L B;  2XSJ B;  1IKV A;  4IQX A;  3EX7 B;  2PII A;  3HT3 A;  3FMW A;  4OZJ A;  5KFA A;  4Q5V A;  2MSS A;  5C66 A;  3L3C A;  1YZ6 A;  4NZ7 A;  3LAL A;  2AU0 A;  5L1K A;  4UTG A;  5T7L B;  2IAJ A;  3BS9 A;  4P74 A;  1NH8 A;  2WOM A;  3THT A;  1Q4R A;  2F8E X;  1DUR A;  3DU5 A;  1E6Y B;  1TKT A;  3DM2 A;  3GR0 A;  3VGS A;  3VZI A;  4JI8 J;  3IG1 A;  1KEK A;  2PA3 A;  2F4F A;  2GS8 A;  3LGN A;  3OR2 A;  2YX4 A;  4NLD A;  4WYW A;  4AXJ A;  2DH9 A;  3ISN D;  5DDO C;  4DV2 J;  1YZ7 A;  2ERR A;  4AQY F;  2AJF E;  4X4R A;  5DLW A;  4A8W A;  4TVA B;  4B02 A;  5L9X A;  1NJI T;  4JP8 A;  2E5H A;  2OO4 A;  3H5Y A;  4RBV A;  4WXW A;  2FD2 A;  2CWX A;  4OHZ A;  2ACM A;  3J81 j;  2MKK A;  4H4O A;  2HPU A;  1R31 A;  3N0V A;  2R2T A;  2IRY A;  1E1Z P;  3FEZ A;  3MM9 B;  5B08 A;  5GAE I;  2B8P A;  2AGO A;  4KH1 B;  5B0G A;  1ZAX A;  1JLB B;  3CCS S;  4IG3 A;  2W5V A;  4JYA F;  4G1Q B;  1FCA A;  1HAR A;  3D1O A;  4KR0 B;  1X0F A;  2ZC3 A;  2QN6 B;  2HS0 A;  1NK9 A;  1XTZ A;  2CDR B;  3G86 A;  2CQI A;  2ZUA A;  1LNQ A;  3AD9 C;  2W7O A;  4DR4 F;  2HBR B;  3UVJ A;  4X65 F;  1Z4U A;  4NLO A;  1FF2 A;  5CZV A;  3S01 A;  1CLF A;  1B0V A;  1UFW A;  2DGO A;  2D1G A;  4C4W A;  2LU2 A;  3LAM A;  4ZGA A;  4NA1 A;  3D9B A;  2JLG A;  2F40 A;  1VGY A;  4ID5 B;  3JQK A;  3PHT A;  2GO9 A;  3CDA A;  4CYU B;  5LIA A;  1RT7 A;  3UCG A;  2ZM6 F;  2HHT A;  1HKA A;  4Y6I A;  4DOZ A;  1HDH A;  2AQ4 A;  2OPR B;  3OTC A;  2B3T B;  1IR1 A;  1VBX A;  1CC8 A;  1N33 F;  1JJ2 R;  1S1T B;  3HPO A;  3MCM A;  2FLN A;  5EX0 A;  4B3M J;  4RW8 B;  3MOJ B;  1HBN A;  2QX0 A;  5L0K A;  1H38 A;  2LQ9 A;  4M5D B;  1WF0 A;  4DL0 C;  4ENO A;  2VPZ B;  4YS2 A;  4QWE A;  3H5U A;  1OPZ A;  4DFM A;  2HHH F;  1G1X A;  2D3Z A;  4WE1 B;  2FY1 A;  4DR2 F;  3GFX A;  1HWL A;  4Q8E A;  1FRL A;  4B3R F;  2K3K A;  2DGW A;  2EBE A;  3PG9 A;  5AXK A;  4EZ6 A;  4K0K J;  5KG3 A;  3RTV A;  1VQL S;  4O3S A;  1RYR A;  4DL3 A;  2GJ2 A;  3JS9 A;  2PE8 A;  4RW9 B;  3LWM A;  3KK1 B;  4DPO A;  5C42 B;  3HZE A;  2M8H A;  2Q43 A;  1D3W A;  1T11 A;  2BA9 A;  4NA3 A;  2WVC A;  1FRX A;  1GXT A;  4JOU A;  5F8H A;  2AJ4 A;  2ZH8 A;  2WB4 A;  3T5H A;  2PC6 A;  3MEC B;  1DLO B;  3SYZ A;  2MLX A;  2HQD A;  2VDH A;  4ZP7 A;  4RNM A;  3MUR P;  1M1K T;  1J5O A;  3Q83 A;  1TKX B;  1E3C P;  4PKD B;  1X31 C;  4NX9 A;  5I4M A;  2HS3 A;  1DQA A;  3QFW A;  4DPX A;  3C46 A;  3AA9 A;  4XAK A;  1T9T A;  2DEI A;  4J9O A;  1Y9O A;  3CE8 A;  2EFG A;  2NUH A;  4Y2C A;  2GIQ A;  3KHR A;  1F9F A;  3K58 A;  2F1F A;  4OMF G;  2FVP A;  4TQR A;  1T7P A;  1FWL A;  1URA A;  1SH0 A;  4A8F A;  4HTI A;  4ED1 A;  4C8Z A;  2ZHB A;  2KDO A;  3C15 B;  1QSS A;  2J6T A;  2JC0 A;  1LWC A;  1T0T V;  4P9S A;  3IO1 A;  3G6X A;  3ZZP A;  5HQM A;  2H4W B;  3D2W A;  3AH6 A;  3MR3 A;  1U1O A;  1JLA B;  2J9E A;  2MLZ A;  4LBH A;  1S9F A;  2OH2 A;  3I87 A;  1JLC A;  4BHQ A;  2FHM A;  3MDF A;  1OS5 A;  4NLT A;  3P6Y C;  5K14 A;  4M5H A;  2BOP A;  4NXN J;  2PGC A;  2W24 A;  3BDG B;  3Q0A A;  3BSO A;  3VVT A;  4FF2 A;  1PO6 A;  5F41 A;  1V3R A;  3DRP B;  2D7S A;  4X84 A;  3MED A;  1LW2 B;  1S6P B;  4C7Q A;  3K5N A;  2MQM A;  8RUC A;  3OHA A;  3EMT A;  3P8B B;  3IMQ J;  4FXV A;  4WJB A;  4EU0 A;  4GO7 X;  4OYZ A;  2HVH A;  5IOL A;  2QE5 A;  3KJV A;  2OEL A;  3JSM A;  3HFK A;  4I2P A;  4ELV A;  4CLU A;  5HAT A;  5KFJ A;  2BRK A;  1F0X A;  2RAQ A;  1WC3 A;  3MMA B;  3BO2 A;  3DNC A;  4DFP A;  4P10 A;  1U1P A;  1PGZ A;  3ZTR A;  1U6B A;  2OEJ A;  4K4W A;  5AXL A;  3A13 A;  4P2F A;  1S76 D;  2UUB J;  4U95 A;  4DV0 F;  1T95 A;  1S1V B;  5LSO A;  4Y28 C;  4N8O A;  2E5L J;  5F3Z A;  2NXE A;  5LMU F;  3FCH A;  1B0P A;  4X4S A;  3HSG A;  1Q95 G;  1VQ9 S;  3AB4 B;  1DRZ A;  4MAK A;  3VR1 A;  1FD8 A;  4HL9 A;  3IR6 B;  2OPP A;  2R8J A;  2XZT B;  1GT8 A;  3CPW R;  1NPK A;  2CPJ A;  1PYS B;  2ZKU A;  2LQ5 A;  1RI7 A;  4IG0 B;  4F4Z A;  4DQQ A;  4ZDN A;  1IBM F;  4LMZ A;  4F0H A;  1TTH B;  1RUS A;  4HEA 9;  5ADZ A;  1SJ4 P;  1RWU A;  2PMW A;  2RRB A;  2EI5 A;  3P5B P;  4FNI A;  5D4P A;  3L7U A;  3BR9 A;  2KL8 A;  2UU9 J;  3W64 A;  1FFG B;  3UPF A;  1J5E J;  1UEK A;  2C2K B;  2KO1 A;  4ILR A;  3W9J A;  4X62 F;  4ECY A;  1HNZ F;  2J8S A;  2BZ2 A;  2YWG A;  3BGO P;  3MM5 B;  4KAY A;  2DHX A;  2XYG B;  5A8K B;  1KHJ A;  3LP0 A;  1YWX A;  4K4U A;  5KG6 A;  1L5U A;  3VCD A;  1H2T Z;  5L1J A;  3GZ7 A;  2Z8Q A;  4M5D A;  4CZC A;  3FVY A;  3NAH A;  3MK0 A;  4LUB A;  2BJ9 A;  2HVE A;  3FKB A;  2DKO B;  3UVJ B;  1N8R T;  1KFS A;  5DLV A;  2ZBP A;  1RTD A;  2H3E B;  3DI6 A;  3EZU A;  3AAW B;  4ZLN A;  4C8M A;  5K8O A;  2DPI A;  4WKR A;  4E2F B;  2BKP A;  3QT5 A;  1ANI A;  5HQL A;  2GVZ A;  4WU3 A;  5KOX A;  2VD3 A;  2IY5 B;  1N54 B;  2JHE A;  5EN1 A;  3FZ2 A;  1ZTT A;  1N6Q B;  2CQD A;  4QIW D;  1CQN A;  2KFZ A;  2HNY A;  4P2S A;  2L9W A;  4MH8 A;  4UOP A;  1JKH A;  2HQG A;  3I9Z A;  5EDW A;  3QJL A;  4WWS A;  3EWG A;  4LBI A;  1MN7 A;  5HP1 A;  1M5H A;  4DR6 J;  1ARO P;  2DH8 A;  2R2S A;  2W4C A;  2C22 A;  1IBK J;  3PV8 A;  2RVJ A;  2V4Q A;  1HWK A;  2Z4P A;  3DRR B;  4KYZ A;  3BM7 A;  4DR1 F;  1W2I A;  4OI2 A;  1HHQ A;  4FYX B;  4KKO A;  3VV2 B;  1PAU B;  1MNE A;  5DLG A;  3AJ2 A;  5HQ8 A;  4ID8 A;  3D3C J;  1R6Y A;  5INH A;  3EXC X;  1ZZN A;  3ENA A;  3GG0 A;  4LSL B;  3G8T A;  1FKO B;  5IWA F;  1ZET A;  3I82 A;  4DN9 A;  1T05 A;  3HK2 A;  4EWT A;  2HS4 A;  2W4D A;  4RW9 A;  2F65 A;  2J9D E;  4EBC A;  2UUC J;  1MWY A;  4OHW A;  5U47 A;  3HHL A;  3T6B A;  4CT9 A;  1WTF A;  3BO3 A;  1X9W A;  3EXY A;  3FMB A;  1AT1 B;  2UVW A;  1IKV B;  1WWH A;  2VFS A;  2AYB A;  2R8H A;  4C8N A;  1LWF B;  2WSE C;  1K1S A;  3CIM A;  2EKY A;  4B08 A;  5BJR A;  3QQC D;  4FPI A;  2HND A;  2MHE A;  3PR5 B;  2HNZ B;  3G6V A;  3B4D A;  3I0S B;  5L39 A;  4CYU A;  2CVE A;  5L8R C;  1JLQ B;  2KXN B;  1DBD A;  3EE3 A;  2DGX A;  1URN A;  3DKD A;  2AF6 A;  2FY8 A;  1E6V B;  1T94 A;  2B4O A;  2CIM A;  4OX7 A;  2QYC A;  3RBZ A;  4Y2K A;  2HRT A;  3B8H A;  1S1T A;  4OLP A;  3OJS A;  5GVQ A;  4CYR A;  1X4H A;  1U1R A;  3R5J B;  5GOV A;  2R4F A;  2F3J A;  4ZVP B;  4DX6 A;  5A0Y B;  1NK8 A;  3L4B C;  1S0V A;  2PI4 A;  1KQF B;  5KFB A;  4IOC Q;  1TK8 A;  2HFN A;  1ED9 A;  1S97 A;  4FPR A;  2LU1 A;  1K73 T;  1J2V A;  5HMW A;  4AYB D;  4PUO A;  1FHT A;  3BJY A;  4KO0 B;  2C3O A;  1SB6 A;  1RT5 A;  2E29 A;  3RBE A;  3MOZ A;  1L3U A;  1WTB A;  4NCB A;  2YKM A;  1WOO A;  2WVF A;  5KFH A;  4X66 F;  2LVW A;  2CZV C;  2E5J A;  3MPD A;  3N79 A;  2QJ3 A;  4KC5 A;  4NI2 B;  3JYT B;  2FJX A;  3B5Q A;  4ZG6 A;  4NLY A;  4KT0 C;  5HVF A;  1XMO J;  4C3L A;  1BY9 A;  2ZH1 A;  4YME A;  2W8D A;  2RHS B;  2UV8 A;  3MUT P;  4E98 A;  4NZ0 A;  2FB0 A;  3FRZ A;  1NDP A;  4M5I A;  3W63 A;  2DYA A;  5KFV A;  2V4J A;  4GKK F;  1RAE B;  5B09 A;  1VLY A;  2ZIT A;  1LK7 A;  1ZZF A;  2I8E A;  3CDU A;  4DV1 J;  1VRU B;  2AZ1 A;  3SCL E;  1NME B;  4X2B A;  3ET6 B;  4DCP B;  3B82 A;  2V8V A;  5KT5 A;  2AHO B;  4DPY A;  3RJM B;  1G4C A;  4LSN A;  1RT4 B;  3M4X A;  4CO1 A;  4I6W A;  2KJV A;  2Q66 A;  2YKP A;  4OYI A;  1Q5V A;  4MIA A;  1MRO A;  1REG X;  5KFO A;  4F4Y A;  3DLB A;  3O5T B;  2HVZ A;  2N3O A;  4R25 A;  1FKP A;  1ACM B;  4CLT A;  1AUS L;  3H4B A;  3NWG A;  3CD6 S;  2I6W A;  4ELT A;  4RL1 A;  4DV4 F;  3C19 A;  3NNC A;  2VQE F;  2DB1 A;  3QFH A;  2GAH C;  3R7N B;  2W7A A;  1ZAV A;  1AJA A;  4A47 A;  4QU7 A;  3W2V B;  1C4C A;  2BJ3 A;  2HND B;  3MR7 A;  3HHL D;  4JI7 F;  3CDE A;  2UUA F;  2ZEJ A;  1W26 A;  2XSJ A;  4OYW A;  4RX6 A;  2D9P A;  5K8M A;  1HL6 A;  4Q44 A;  4K4Z A;  1E33 P;  1OSC A;  2ZJP Q;  2XMA A;  1ZEB A;  1CC7 A;  1FRJ A;  3D67 A;  1DZ5 A;  1SIZ A;  3QSI A;  3BDP A;  3MK1 A;  5H9E J;  4KFB B;  3WAY A;  4J9N A;  2F8H A;  3DLE B;  4EYI B;  3GYN A;  3LH2 S;  2FJV A;  3RRK A;  4LIW A;  3O44 A;  3LWL A;  2ILZ A;  2Y9H A;  2DXD A;  2VH7 A;  4LR9 A;  1YJR A;  2UXD J;  3MMA A;  1IQT A;  1X5T A;  2EFP A;  2B4V A;  1SXL A;  4JI4 J;  3DOM B;  1DQ8 A;  2GV1 A;  3FZB A;  5SUH A;  3L7O A;  1KH4 A;  1NEE A;  1KOO A;  1VQ7 S;  4OJ3 A;  1ITP A;  2GQ2 A;  4USW A;  5C24 B;  2JLE A;  2AJ2 A;  1FX2 A;  2XTJ P;  3POT A;  2AJQ A;  1C2P A;  3H0P A;  5HVG A;  1CJU A;  1Q53 A;  4K4Y A;  4DL6 A;  3C6U B;  1FER A;  2DT9 A;  2JFD A;  1C1B B;  1WUU A;  4ED5 A;  2UP1 A;  3DPC A;  2W2P P;  3TQ1 A;  1FRH A;  1PKU A;  4DZD A;  3K5L A;  4ZPT R;  5H9F J;  3RB4 A;  3AXK A;  1JJC B;  3ILI A;  3OTB A;  3QO9 B;  2VQF F;  1O98 A;  1NAQ A;  4I68 A;  2YBV A;  4F2S A;  1KHW A;  2XCP A;  3WIU A;  3ENW A;  2DTJ A;  1QVF R;  5IC6 B;  4O4R A;  3FNN A;  3JQM A;  5GAD U;  1X5S A;  2GGP B;  4B9T A;  1SBR A;  2RQ4 A;  2CJ9 A;  2OJ3 A;  3C15 A;  3CTR A;  4Q43 A;  1KVK A;  3CCT A;  1YRT A;  3D6M B;  3T9N A;  3U27 A;  3QRP A;  3D3B J;  1FDD A;  1KHK A;  3BH7 B;  3CXC R;  4JI7 J;  1IUJ A;  2I0X A;  4O4G B;  5LXR A;  2LEA A;  3JAM U;  1S1X B;  4ZVH A;  4ZJL A;  3BSA A;  4OZ2 A;  2DGU A;  4B9N A;  2I9S A;  3ZZU A;  2G1D A;  4QQB A;  3CJK B;  3I5B A;  3R6L B;  3SFU A;  5D3G B;  1RZM A;  4Q45 A;  2XLK A;  2V9K A;  4DQP A;  2H65 B;  2N3L A;  1SL2 A;  3BYR A;  2CZ9 A;  2Y0S D;  4H4K A;  4J9V A;  3W61 A;  3KK3 B;  2YPZ A;  1ALK A;  2HUR A;  2EFN A;  3DRX A;  2K1R B;  3O2I A;  1LKZ A;  1NHV A;  1CS4 B;  3GJT B;  1UTA A;  4Y3C A;  5IM0 B;  2UXD F;  3QRQ A;  1KKH A;  2QLJ B;  3NGU A;  5DDP C;  1TKD A;  4URG A;  1BE4 A;  4C3K A;  2AJ1 A;  3OVB A;  3M32 B;  2AYE A;  1SKU B;  4X4P A;  1MWZ A;  1NB2 A;  4DV3 F;  1PG5 B;  2FHO B;  1OPI A;  3QBC A;  4G65 A;  2HWH A;  1FSU A;  3TAR A;  1VQN S;  1MW7 A;  2DCU B;  4UQT A;  3KK1 A;  1NDC A;  1RTJ B;  1JKH B;  2VQF J;  2YH1 A;  3QYY A;  3K57 A;  4ERD A;  3TZY A;  2AW0 A;  4OHY A;  1WEZ A;  2J9D A;  1H2U X;  1QDU B;  2VAS A;  2V69 A;  3J7Z 5;  4CT8 A;  1ZAW A;  2QRR A;  4YP3 A;  2JC1 A;  1BQM B;  3IWX A;  4RJV A;  3S6E A;  2VIH A;  2UUT A;  1HW8 A;  5K8N A;  4J9K A;  2IVY A;  2RF2 B;  1FJE B;  3FBC A;  3IWL A;  4UZB A;  1GTE A;  3PIO Q;  1HQU A;  4WII A;  1QSL A;  1WSR A;  2A3J A;  2YXL A;  1B4S A;  2B9E A;  1SC6 A;  3TVY A;  5JUM A;  2X1A A;  4HDH A;  4ECZ A;  3TI0 A;  3JB9 k;  2C2N A;  4MY4 A;  3BV8 A;  1OY8 A;  2CDQ A;  4YR1 A;  2HLU A;  3IM8 A;  3MM5 A;  4MKA A;  2W5Q A;  2CNN B;  4KQZ A;  3LF0 A;  4OJ1 A;  4GTW A;  4ZN3 A;  1DFD A;  2GSU A;  4QAX A;  2KKH A;  2IJN A;  1EJ7 L;  3I4H X;  3OTD A;  5HMX A;  5HRO A;  4PPD A;  3TG0 A;  1TAQ A;  5K4P A;  1F5B A;  1SJ1 A;  1XWL A;  4ZOS A;  2QIF A;  3I5C A;  2BW7 A;  2IFX A;  4I69 A;  5KT7 A;  5I3U A;  1EAY C;  4EEY A;  1YKW A;  2C2O B;  2MYF A;  3ZTO A;  3I55 S;  1OO0 B;  1M0S A;  5LRM A;  1KOH A;  1WI6 A;  1RHK B;  3NL0 A;  3OLA A;  2W8S A;  5CYM A;  3TP2 A;  1EX8 A;  1R8H A;  3PJX A;  3CJ8 A;  4F02 A;  2CJQ A;  3TUZ C;  2GSO A;  4M63 A;  4I67 A;  3KUH A;  2APO A;  4IRK A;  4ZVQ B;  1WKK A;  2R2R A;  4AE5 A;  4RUA A;  1BLU A;  5F9N A;  4KJG A;  3KJF B;  1XNQ J;  4ED3 A;  1CJV B;  1RHU B;  1ICE B;  5T14 A;  1A0O B;  2XO6 A;  2BJ8 A;  1N36 J;  2ZKT A;  1HPZ A;  4KTQ A;  3DGP B;  3UD5 A;  4R0E A;  3FFI B;  4B3S J;  3CCZ A;  1TZ0 A;  3E01 B;  4ZPD A;  2GVZ B;  4ETZ A;  2XC9 A;  3B6B A;  3DLH A;  1F3F A;  1SUQ A;  3TX8 A;  1M5O C;  4X4N A;  3GG1 A;  4DI6 A;  1S0M A;  2PA8 D;  2MDA A;  5GAE U;  2UUB F;  4WFA Q;  3EDQ B;  1M1H A;  2D41 A;  4ZJO A;  4DCJ B;  5GAG U;  1K44 A;  2NPI A;  3NGK A;  3E2E A;  2DNM A;  2JRS A;  2YKN A;  3CJS A;  1VC5 A;  4KHP J;  1WF2 A;  4J9U E;  3CUL A;  1CJU B;  3GJQ B;  3W8P A;  1ANJ A;  4OHX A;  4YB1 P;  3V6D B;  4F3O A;  4DR3 J;  1B8J A;  3LXQ A;  2ALZ A;  2RDD A;  4UUX A;  1VOM A;  3I0R A;  5LL6 d;  1Q82 T;  4JV5 F;  2MQ8 A;  3M8Y A;  4YR3 A;  4CXK A;  2VFR A;  3H98 A;  2LXU A;  1EZZ B;  2UXC F;  3I5A A;  2Z0G A;  3LP1 A;  1RWP B;  1YX2 A;  3CDB A;  1ZYQ A;  2CPZ A;  3GR1 A;  4DUY J;  2WW8 A;  1GQE A;  4WZQ A;  3UN3 A;  3NGT A;  4H4M B;  5GMK a;  3OXF A;  2F9J A;  2IVF B;  1OY6 A;  4IH6 A;  3IGZ B;  2ZH5 A;  4Q0B A;  2OFG X;  3KLE A;  4DR2 J;  4C11 A;  2J7K A;  4LSZ B;  2KU7 A;  2V9W A;  1R8A A;  3VVU A;  2BE7 D;  4KSE B;  3ZO7 A;  5CA5 A;  1IBC B;  3QLH A;  2ZH4 A;  3LO3 A;  1RLC L;  2D3O R;  3KHL A;  3HVA A;  5D0E A;  5L1L A;  2MB0 B;  2EC2 A;  1VBY A;  4P71 A;  3D5M A;  5HP1 B;  1Y11 A;  3JQJ A;  1BGX T;  4F04 B;  2AGQ A;  4KV8 A;  5AXM A;  2DNL A;  3HXM A;  4MFB B;  5KFU A;  3D0G E;  5DM6 Q;  1H0H B;  3H25 A;  4M1K A;  1S0N A;  1IKX A;  4C2M A;  2Z2Z A;  1S1W A;  3M8Q B;  4UST A;  3SFG A;  3ZTS A;  1T9V A;  2FJD B;  5KFN A;  3DLL Q;  2DIS A;  4I2P B;  3EYZ A;  5HMZ A;  3MHY A;  4PCQ A;  2E5I A;  3WC0 A;  3OQ2 A;  1SIW B;  1HMV A;  4IFV B;  3OTO J;  3IBC B;  2FJE B;  2C3M A;  3GV5 B;  3NS7 B;  3GMG A;  4TN2 A;  1D8Y A;  3DLG B;  3QGG A;  1Y5L B;  4RBU A;  4ES1 A;  4KHP F;  1RHJ B;  4HH1 A;  4C8Y A;  3IA0 A;  3KG0 A;  1NHK L;  1RWX B;  1WF1 A;  2HRY A;  2YH0 A;  1J27 A;  4BWJ A;  4R5P A;  4X4O A;  1JX4 A;  1SUQ B;  2KFY A;  4Q8F A;  1VRU A;  3CC4 S;  1RAA B;  3DHW C;  1XER A;  2GQC A;  4PPZ A;  5H9E K;  2J0X A;  2ZD1 A;  1Q7Y T;  3TOQ A;  4QZV B;  4L74 A;  2BKN A;  4NPO A;  1YK9 A;  4QR1 A;  2C2E A;  4DUY F;  2GNK A;  1GX5 A;  3ENQ A;  4ZIW A;  4TY8 B;  1ZOT A;  2HQC A;  3PYE A;  4UZC A;  4YR2 A;  3PO4 A;  1RWO B;  4TNO A;  1C1C B;  3DLK B;  1XIQ A;  2MY8 A;  4TU7 A;  1VQ6 S;  1AA1 B;  1UZD A;  3SZ2 A;  5KG5 A;  3IFE A;  4NWJ A;  3IM9 A;  1GFW B;  2WRM A;  3BBF A;  3ZZT A;  3TZX A;  3RZA A;  3PO5 A;  2YY3 A;  3QT8 A;  4NL5 A;  1RAD B;  4PUO B;  2ZH2 A;  3LPE A;  4IH7 A;  4F4X A;  1N32 F;  2YWF A;  1NK4 A;  3SSQ A;  5C2C A;  4U7U D;  2XS7 A;  3PRV A;  3VAL A;  2YKO A;  3GYX B;  3EVW A;  1FDN A;  5IT0 A;  1W25 A;  3O6Q A;  2KG1 A;  2BJE A;  1QD1 A;  4ZG9 A;  3ZXW A;  3KLG A;  1EQ0 A;  1YRU A;  2YQ1 A;  1F2H A;  1B64 A;  3LTO A;  3POT B;  1KLM B;  3T02 A;  3SZY A;  4RW6 B;  4LFA J;  2O01 C;  2UXB F;  1Q8K A;  1SKR A;  4I64 A;  1T9X A;  2ACY A;  3DGP A;  5LXY A;  3KNG A;  1VQ5 S;  1JNZ B;  2R8K A;  4RU2 A;  4ILM A;  4UOF A;  2C3P A;  3JYT A;  1KVI A;  4FYY B;  2HNY B;  4KV8 B;  5IXU A;  1R6V A;  1RTJ A;  2GLQ A;  3OR1 A;  2J6U A;  1XMO F;  1FJG J;  3BGR B;  4G1I A;  2CJK A;  4DL7 A;  2P2C B;  2W7P A;  1HQU B;  5L1I A;  1FRM A;  1GMW D;  2R7O A;  2KT5 A;  3FK4 A;  3I31 A;  4IFV A;  4YY3 F;  4K2X A;  2ASJ A;  1UWB B;  4KPY A;  4K4X A;  3MM6 A;  3CJ2 A;  4C0H A;  4DV2 F;  3CJ5 A;  1VFJ A;  3R5C A;  1LXJ A;  3AQO A;  4TLQ A;  2W9C A;  1VCT A;  3TUJ C;  3KD8 A;  3CCM S;  4Y65 A;  5HI7 A;  2XMK A;  4O3R A;  1OYD A;  2PDA A;  3KJQ B;  5I42 A;  1I1G A;  4K5R A;  1HA1 A;  2XMM A;  4XDC A;  1VQO S;  2HVI A;  4LR2 A;  3LP0 B;  3LPY A;  6FD1 A;  3BGU A;  3M8S A;  3M2V A;  5KFR A;  1LWF A;  2NZ4 A;  2AT1 B;  3PYD A;  3MM8 A;  1XMQ J;  5GAH U;  2XGQ A;  5LJ5 Y;  2VQE J;  1RT2 A;  1S6Q A;  1UET A;  1XN9 A;  3NOG A;  2I1R A;  1GMU A;  3H2L A;  4FKY A;  3S8S A;  3NXZ A;  3TNV A;  4DS4 A;  4WBF A;  1A9N B;  2EK6 A;  2MXY A;  2XY5 A;  4X4U A;  1S48 A;  1D9A A;  1H7X A;  3MEE B;  1MSW D;  2HSE B;  3LGM A;  1EI6 A;  1OMS A;  4HTJ A;  4KBI A;  2LQJ A;  5HRT A;  2GFF A;  3SDE A;  5B0C A;  4DR6 F;  3T3F A;  1S1W B;  3M8Q A;  4LFC J;  4ZCI A;  3NNA A;  2A1B A;  2DY9 A;  5D4L A;  3DOL B;  2ZH6 A;  4OYA A;  4FF1 A;  4WFX A;  2RD5 C;  2XZD B;  4R8U B;  3L7P A;  4H4M A;  5KFM A;  1KHN A;  3PX0 A;  4F4W A;  1C1B A;  2DGT A;  4K2J A;  2C3U A;  3OFF A;  5F0W A;  1RAO A;  3FSX A;  3M9M B;  2HYI B;  3JSY A;  1KC8 T;  4DSL A;  2XS2 A;  3O1L A;  1S9G B;  3Q22 A;  1C0T B;  1FD2 A;  2B8Q A;  2BUN A;  2WBM A;  3UR0 A;  2XLJ A;  3PX6 A;  3HD1 A;  5T7L A;  2CUY A;  1WHW A;  4AFF A;  2ZOF A;  1HI8 A;  1TL4 A;  1S9E A;  2NXN A;  2MZQ A;  1SL1 A;  3OFG A;  3CJ3 A;  3TRG A;  5DG7 A;  3BN4 A;  2OPS B;  2DRA A;  3WIV A;  3ZZR A;  3DDN A;  4G6V B;  4OZN A;  4PXD A;  4EMD A;  1KR4 A;  3G96 A;  2V4R A;  1JXL A;  2OPQ B;  3DXB A;  4IFY B;  1VDH A;  2ZUG A;  3MMJ A;  4LF6 J;  5KFT A;  3VAJ A;  3QJJ A;  3I9V 9;  2ZE2 A;  3N6L A;  2MZ1 A;  3A8I A;  3BGF A;  3M1V A;  5IT9 Y;  4RZR A;  4C8O A;  1S6O A;  5IQ6 A;  2B5J B;  2DNO A;  3DMJ A;  2IVM A;  1UKU A;  4YB6 A;  2M4M A;  3S1T A;  3CCQ S;  1RAH B;  1KH5 A;  2DK2 A;  2WVD A;  1X9S A;  4QIV A;  4CXU A;  1RXO B;  2NXC A;  4A48 A;  3NLC A;  4R0J A;  2L41 A;  2C3Y A;  2RU3 A;  3LOU A;  3SQG A;  2R42 A;  4AXI A;  2M0G B;  3MUM P;  1V5I B;  4OV1 A;  2VKR A;  3GJR B;  4V19 X;  2G2Z A;  2CJB A;  2VFU A;  1SL0 A;  1FKA F;  1URR A;  1LFW A;  1H7W A;  4ZPC A;  2KM8 B;  3KLE B;  3V4I A;  1B7Y B;  3MGJ A;  2YX1 A;  2JH3 A;  2HHP A;  1T9W A;  4M5L A;  5LQQ A;  2W25 A;  2A2C A;  4ZCM A;  3BSC A;  3TAM B;  1WC0 A;  3DU6 A;  4UT4 A;  3PIP Q;  4MTP A;  4F4K A;  1KVJ A;  4LBP A;  1AJD A;  4OI3 A;  2RJZ A;  3HCX A;  3OT9 A;  4JI1 F;  3CGI A;  3WAW A;  1HNX J;  2VL1 A;  3M8W A;  1O6X A;  3SCI E;  1KDN A;  2BE2 B;  2W9B A;  1VC0 A;  2G0C A;  1HQE B;  1GXL A;  2VBW A;  2DCL A;  4K50 A;  2DIU A;  4UPK A;  1HNV B;  2RML A;  3CT9 A;  4LRD A;  3OVS A;  2E9Z A;  1FES A;  2AEF A;  5DET A;  1HI0 P;  1UVI A;  1L3T A;  1M5P C;  1QAY A;  4J9Q A;  4AL6 A;  1BC6 A;  4P6Q A;  2VBZ A;  2LEB A;  1VI7 A;  3HLU A;  1DTQ A;  1B3T A;  3QT7 A;  2L9D A;  4UY8 5;  4YB7 A;  4YDX A;  2IBO A;  1KQG B;  1JLF B;  3MMC A;  4OHV A;  5CD4 A;  1FE0 A;  3J80 Y;  1D0E A;  2ZVS A;  1PAE X;  4NLS A;  4NYO A;  4AT1 B;  3PAC A;  4ES2 A;  1U0S A;  2Q79 A;  3DLK A;  4OZ0 A;  1ZPW X;  3BPD A;  3CED A;  2ROG A;  5LMU J;  1RT7 B;  2PN6 A;  3T1A A;  3MI7 X;  1EKS A;  1TQL A;  3GTY X;  3CME S;  2OAU A;  5DZ6 A;  1HQA A;  2BXJ A;  3J7A 1;  2JVO A;  1WAC A;  3R5A A;  4LT6 A;  2E9T A;  4FNH A;  3TEH B;  5E3Q A;  1K7H A;  2ASY A;  2V34 A;  3H20 A;  3CJQ A;  1RLD A;  4O23 A;  2PO4 A;  2AD9 A;  2W5X A;  1KFD A;  1Q78 A;  3SDE B;  4BWM A;  5CYM B;  1IVZ A;  2CPI A;  3W62 A;  1SH3 A;  1VMB A;  4J7C A;  3W65 A;  4ANE A;  2EC0 A;  1CBK A;  3SQG B;  4OI6 A;  3Q86 A;  2IMO A;  1Q8I A;  2QA2 A;  3MM7 A;  1Z2L A;  5JXS A;  2XI3 A;  3ZTQ A;  1J5E F;  5BR8 F;  2J8A A;  1REV B;  4RW7 B;  3PKM A;  3OPK A;  1F2G A;  2A18 A;  3ITH B;  2FGC A;  3MPW A;  1ZM9 A;  3V5R A;  5KG1 A;  1U8S A;  3H2V E;  4LR7 A;  5ETL A;  1U49 A;  1YJ9 S;  2VZ9 A;  4M94 A;  2JSX A;  2KHD A;  2X3D A;  3CCW A;  4LFB J;  3IG1 B;  4DV5 F;  4Y2A A;  2KVI A;  4ZG7 A;  1ZA1 B;  5GMD A;  2V67 A;  2DBB A;  2HMI A;  1G7C B;  2I38 A;  1N56 A;  3DCA A;  4CYS A;  4ZJQ A;  4KHR A;  1SKW A;  1HD1 A;  4WP3 A;  5KFD A;  5A2Q U;  5EX3 A;  1RT6 B;  1UVK A;  5BYQ A;  3OR1 B;  1FI4 A;  4M5G A;  4RNO A;  4JI6 J;  1Q7L B;  2CZ4 A;  5CZX A;  5EGY A;  3U02 A;  4RU9 A;  3Q3Q A;  2GSN A;  4PYA A;  2CQ1 A;  3QWP A;  1UEV A;  3RUB L;  4DSI A;  2FYX A;  1BWV A;  4WFY A;  3I32 A;  4O3O A;  4CXS A;  4YOE A;  1H2V Z;  4QPT A;  4ZIT A;  3MAA B;  3PX4 A;  1T03 B;  1KQK A;  3Q8R B;  1HNI B;  3NKQ A;  5IC4 B;  3Q8Q B;  4Y00 A;  1HMV B;  2HIY A;  5HAN A;  1JIH A;  5F3T A;  5AJ3 F;  2XY6 A;  3C2P A;  4I6Y A;  3KNA A;  3KYL A;  3RAM A;  4X64 J;  5JJB A;  4FDI A;  2G4B A;  4W4M A;  1N52 B;  1WHX A;  1QY7 A;  2HFS A;  3A8J A;  3W2W A;  2GIR A;  3CC7 S;  1NDL A;  4C11 B;  2N82 B;  4DN0 A;  1JXV A;  2HZA A;  4UF4 A;  1N0U A;  1R0A A;  1B99 A;  2FZC B;  4EBD A;  5D3G A;  3G82 A;  2FIU A;  4W98 A;  5BR8 J;  4P7T A;  4KHM A;  2NXJ A;  6AT1 B;  3ULH A;  1SV5 B;  2DH7 A;  1KON A;  1VRT B;  1GH8 A;  4DSK A;  1CSJ A;  1T3O A;  2BAN B;  3KJN B;  1Q16 B;  4CM2 A;  2MGZ B;  3OTO F;  4FS2 A;  3EGN A;  3O8W A;  1T8E A;  1LWE B;  1KNZ A;  2JEI A;  3K59 A;  4P52 A;  4AQY J;  1K8A T;  2WVB A;  2UVV A;  3DDI A;  2R7U A;  5KFG A;  3BB5 A;  3MD1 A;  5HJX A;  5A8W A;  3KJV B;  1HIY A;  3T5L A;  2GMH A;  3D1H A;  1IBM J;  1HW9 A;  2XHW A;  1IJE B;  1Q5Y A;  1SQG A;  3CWJ A;  1NKB A;  4JI6 F;  3OUY B;  4XDD A;  3DI6 B;  3V2U C;  4AL7 A;  5E0O A;  2UU9 F;  5FJ4 A;  3FSY A;  3OV7 A;  1V3S A;  1VQY A;  2F8M A;  2H9Z A;  3F56 A;  3RW7 A;  2MQN A;  2MKI A;  2VG6 A;  3GIL A;  1B70 B;  1VLO A;  2CJA A;  4LVO P;  7AT1 B;  2B9Y A;  4X65 J;  2YNF A;  2XR9 A;  2MZS A;  5IJQ A;  1YTY A;  3TUP A;  1MMN A;  4CH1 A;  4O3P A;  5A76 A;  5A8R A;  2ZDO A;  2RRN A;  5AJ3 J;  3BRE A;  1N0V C;  1H73 A;  1LWC B;  3NAI A;  2BM0 A;  4NMX A;  1KN6 A;  1OSD A;  2MQO A;  3IS9 A;  3UN5 A;  2MMY A;  3UR3 C;  5J2P A;  5HSP A;  4ICL A;  4OI0 A;  5HRO B;  5SZT A;  4NZ6 A;  2C1E B;  1JLC B;  1TKZ B;  3PYG A;  4N7T A;  2J0Q D;  3VAH A;  3GCW P;  2QLB B;  3HFZ B;  3G87 A;  2HBQ B;  3JSM B;  2VPY B;  2MZT A;  3IAS 9;  1FFW B;  3HDS A;  3OVA A;  3MR6 A;  3TZZ A;  2AYG A;  2NR0 A;  2XMJ A;  4N76 A;  2J6S A;  4WKY A;  4UOG A;  1IBK F;  2O66 A;  2HRU A;  2C2Z B;  1RWW B;  2FC8 A;  4DV6 F;  5DS7 A;  3GIR A;  1JQG A;  2B6A B;  1NK0 A;  2M52 A;  4ZKA A;  1PC4 A;  2KYX A;  4EZ9 A;  3CMQ A;  4WK1 A;  1RB0 A;  4DEZ A;  2LQB A;  2IUC B;  4OV6 A;  1S1U A;  2CQB A;  5F0U A;  2RDI A;  5J2M B;  3PW5 A;  4KAI A;  3PW0 A;  2I2Y A;  2XWY A;  4FXD A;  2KFN A;  3V81 A;  4A8Q A;  4UY8 T;  1FJ7 A;  2UUA J;  2B9X A;  5IV3 A;  3RG6 A;  3QAU A;  4GVL A;  1Z1Z A;  4DR5 J;  3PRD A;  2V5H G;  1OJ4 A;  3UFC X;  4B3O A;  5F8J A;  4L73 A;  3KUG A;  5C5J A;  2E1M C;  4L6V 3;  3MFH A;  4J5O A;  3CCJ S;  3DOL A;  2P9E A;  1WC6 A;  1MU2 B;  3BZQ A;  4QJV A;  5DZ7 A;  1MWQ A;  1Q86 T;  1SQE A;  1APS A;  1NRK A;  1AZS B;  1RBL A;  2P6T A;  2W4P A;  4N47 A;  1CVJ A;  3R5G A;  1MML A;  2R7V A;  5EGH A;  4RWX A;  1UMJ A;  3MM6 B;  3T5K A;  3H8Y A;  1LQ9 A;  1OY9 A;  3DGV A;  4P73 A;  5EUH A;  1V3Z A;  2EVZ A;  4I6A A;  3CVK A;  3UDL A;  4CLW A;  5AE2 A;  2MJU A;  2AX0 A;  5HVH A;  3GQC A;  4JI4 F;  1VIS A;  1XMB A;  2CPF A;  1HWJ A;  4OYX A;  2RNE A;  1RA7 A;  2GO8 A;  3EGW B;  1VQ4 S;  1N5Q A;  2EKN A;  3AY0 A;  3R2D J;  1ROF A;  1FKO A;  2LXI A;  1YIJ S;  1U1L A;  2OTJ S;  4ECS A;  4NYP A;  1VC6 A;  2QL7 B;  5B0F A;  5A8K A;  4GC6 A;  2C2R A;  2VA2 A;  1UJ6 A;  1LW0 B;  1RYS A;  4Y2I A;  2AMC B;  3MMB B;  3R7B B;  4MK9 A;  2YNI B;  5ETS A;  3TYT A;  5L46 A;  2XO7 A;  2D1C A;  3KG4 A;  1O5J A;  2O5D A;  3IBW A;  4QR0 A;  4X66 J;  8AT1 B;  3NKP A;  3FUY A;  5D0G A;  5RUB A;  2R7R A;  2FVQ A;  4LF2 A;  3KOA A;  2FJA B;  4KFB A;  4QYR A;  1YBT A;  1S6P A;  1YBA A;  4IG0 A;  3MED B;  3UE2 A;  1R0C B;  2XY7 A;  3OTE A;  3Q8V A;  1RT2 B;  4JI3 F;  3OJU A;  4RPF A;  5LMN F;  1N6Q A;  2K7K A;  4NRU A;  4LF5 J;  2V2Z A;  4Q2L A;  1H3D A;  4AUK A;  2KZM A;  4RR5 A;  2MQQ A;  1FWP A;  4HT7 A;  2KB2 A;  5A0Y A;  2GQQ A;  3OFH A;  1N5T A;  2MEW A;  1X4F A;  4A4J A;  1KH9 A;  3HHN B;  3M8R A;  5LSR A;  2LEC A;  1S0O A;  1X8D A;  1RAF B;  1RTH A;  2WTF A;  1NJZ A;  1IM4 A;  3NP5 A;  3H59 A;  1I94 J;  2NS1 B;  2N4D A;  3D66 A;  3VAK A;  3ZNJ 1;  1H98 A;  3GIM A;  1UVL A;  1XQI A;  2CQG A;  1KLM A;  1LEO A;  4NE9 C;  1BXN A;  2DY1 A;  2VPX B;  3M2U A;  5CYQ A;  4WFB Q;  5I3Q A;  2VUG A;  4WP9 A;  4ZLL A;  3P4U B;  2UVR A;  3CJ4 A;  1IWG A;  4J9S A;  5FDL B;  3VQT A;  3T19 A;  4LF7 J;  4QOT A;  2MKC A;  5E2Q A;  2RSQ A;  3M30 B;  5GME A;  1WC5 A;  4DX5 A;  2XNQ A;  5IFM A;  4OZ3 A;  2OTL S;  1P49 A;  1ZM3 A;  1SH2 A;  1K9M T;  3BDF A;  2MST A;  2POK A;  3ETO A;  1MMD A;  1S9E B;  2JX2 A;  5A2Q Y;  5GAG I;  2DNZ A;  1NUE A;  3HSZ A;  3IR5 B;  3NRB A;  3K8V A;  4WXO A;  4X62 J;  1YJW S;  2BQU A;  1D8Z A;  1SHQ A;  1RHM B;  4KGM A;  2RIJ A;  4KJD A;  2OEM A;  4XTT A;  2HGN A;  1RIS A;  5FLX Y;  1U09 A;  4OIX A;  5HK4 A;  4AL5 A;  1Y0H A;  2JEF A;  4DG1 B;  1HJK A;  1ZS6 A;  1S5Z A;  1FEE A;  3W2V A;  3QT6 A;  1EB0 A;  4P7V A;  4RUH A;  5H1S V;  3HHL B;  5BYR A;  3HSD A;  1P9Y A;  1RTI A;  1TL1 B;  3QIP A;  4I7F A;  5J1E A;  3N6M A;  3SV3 A;  4EBE A;  2ATC B;  4UOR A;  5D0R A;  1S79 A;  3IBF B;  3RGI A;  4RNF A;  4RW7 A;  3KMS A;  1CJK B;  1XR6 A;  2B43 A;  2IM3 A;  2W2Q P;  1RP5 A;  1VK3 A;  3V4M A;  4OZ1 A;  5KFQ A;  2XLI A;  2CVI A;  1KSP A;  4YHH J;  2M3D A;  4F50 A;  2FHK A;  1SC4 B;  5E3P A;  5G4D A;  1WKJ A;  3G8S A;  3KUE A;  2HHU A;  3G8Q A;  3JTO A;  4TY9 A;  3RW6 A;  3BGL A;  5J2M A;  2XSF A;  2NSC A;  1G6B A;  1NXI A;  2YTC A;  4DPT A;  4S0M A;  4IRD A;  5GAD I;  4LFA F;  2I5J B;  3US5 A;  3CCL S;  3T1Y F;  3BQ1 A;  1TUV A;  3HT0 A;  2WHO A;  2DGQ A;  4NWB A;  2BJD A;  5LT5 A;  3BSN A;  2YQ3 A;  2VOD A;  5L9N A;  2NSB A;  1RAG B;  1HBO A;  4OYB A;  4BLG A;  3TAN A;  2ZM6 J;  4UW2 A;  4DV7 F;  2ASD A;  4CP5 A;  2HW3 A;  1NPP A;  5K5M A;  4EI2 A;  3VAM A;  1SI9 A;  4IOB A;  4LF8 J;  2HLT A;  4ZVF A;  4DSE A;  1JLG B;  4X4T A;  3MAA A;  1N33 J;  3GON A;  1EET A;  1FFS B;  4TN0 A;  4NI2 A;  4D3G A;  5CCM A;  3KLV A;  2X98 A;  4FYD A;  1SJF A;  1HBM B;  2CQH A;  4CO5 A;  5DO2 A;  4KO0 A;  2WK4 A;  3W7B A;  4Q2M A;  3WX8 A;  2GGP A;  4U7U K;  4LRB A;  4CLL A;  2RB7 A;  2MKJ A;  2VDI A;  1UCN A;  4C8L A;  1S10 A;  3R9L A;  3UDC A;  2FJB B;  2VFT A;  2QZU A;  3WZ0 A;  3P5T L;  5C7P A;  4B3R J;  4ED4 A;  2QO3 A;  4K0K F;  1Y7A A;  1MG7 A;  4DSJ A;  2N4C A;  2NPF A;  4EK2 A;  2LP4 A;  5EWG A;  2ZOG A;  1HFE L;  1S59 A;  1AZS A;  1Q0N A;  1VHF A;  1X4E A;  1KQS R;  1E6V A;  3TVK A;  4OZ5 A;  3GJS B;  3SEO A;  1RKI A;  4CO0 A;  4L76 A;  2R7S A;  1IJF B;  3A3N B;  2HNZ A;  4OL8 A;  2V94 A;  3GP9 A;  2XWX A;  2YVS A;  3KKF A;  4C8K A;  1YSJ A;  4QYZ K;  1N5Y B;  3NVL A;  5IJS A;  5J1E B;  3RR8 A;  4DU8 A;  1SV5 A;  5B0A A;  1B7F A;  3ZTP A;  4DUT A;  4HH0 A;  4PG7 A;  4EFA C;  4WFN Q;  4JV1 A;  1UVM A;  3R5B A;  4CWB A;  1ALH A;  4DF8 A;  3QZ8 A;  2JJ4 D;  4J9L A;  1ALI A;  4RUB A;  4FDJ A;  2JWN A;  2QYG A;  5KG0 A;  2K2P A;  3M9N B;  3PNI A;  3VF0 B;  3W2W B;  2R2U A;  3VGV A;  3CF5 Q;  4HAC B;  2D3O 1;  3M2R A;  1IWA A;  4OYP A;  1K0T A;  4C97 A;  1WDT A;  3MUV P;  1N88 A;  4KGZ B;  4ZA1 A;  4B3O B;  4ZLJ A;  1IKY A;  3T9Z A;  3V81 B;  3ZZO A;  2EXU A;  3FEX B;  3MCO A;  4F8R A;  1PC5 A;  3MMC B;  5I3P A;  1SJ3 P;  2CKW A;  4A8S A;  4ZVS B;  4CO4 A;  2D9O A;  4O4G A;  1YG0 A;  3D68 A;  2XNR A;  4ICL B;  1WC4 A;  4PG6 A;  1FT8 A;  3ET6 A;  4PG8 A;  3THV A;  1XR7 A;  3BBB A;  4M8L A;  2JOQ A;  4BCA A;  2MGZ A;  2KJW A;  3MAQ A;  1U45 A;  2QT7 A;  2OPS A;  4IDK B;  3GIK A;  1XC9 A;  2MKH A;  3Q8Y A;  2HK2 A;  3EDR B;  2HIQ A;  2Z2Y B;  3HKW A;  3NMR A;  4KKO B;  2DHS A;  1HQE A;  2D69 A;  2NLW A;  1HWI A;  1U02 A;  1UW4 A;  2V8P A;  4WYL A;  2JDJ A;  2R3V A;  1CJV A;  3BR8 A;  4FYW B;  1GX6 A;  5B0E A;  3SQO P;  1QLN A;  1KHL A;  1RCO B;  1FWK A;  5D4O A;  2ZJR Q;  3UI3 A;  2G13 A;  2HBZ B;  4F36 A;  5KFE A;  3C6U A;  2HFO A;  3DDK A;  2L08 A;  4CO3 A;  1K1Q A;  4ES3 A;  1HQ2 A;  1UWA A;  3EVO A;  2IRU A;  4GVB A;  4U8Y A;  4IR1 A;  2P6S A;  5DQH A;  1ZEF A;  2WON B;  1A7G E;  3OXG A;  3K17 A;  4LRC A;  2DVI A;  2YNI A;  3MMB A;  1GAO A;  1NPR A;  4EO6 A;  2GX8 A;  5ETQ A;  3PW2 A;  2Z57 B;  4H4K C;  1SC1 B;  5D77 A;  2CNO B;  5JMN A;  1WG5 A;  4DL2 A;  2B51 A;  2Q6C A;  2W01 A;  1U4B A;  3HM9 A;  3J81 Y;  2QSW A;  1QSY A;  3W66 A;  3ZNU A;  4JBC A;  2BAN A;  5E41 A;  1AUK A;  3C3L A;  1UW9 A;  5ETO A;  3SMZ A;  1P6T A;  3Q2T C;  2PD1 A;  2XYP B;  2HFV A;  2NUU G;  2HGM A;  5KFX A;  5ITH A;  1RTI B;  2XMW A;  8ATC B;  1QE1 B;  1TK5 A;  1N4L A;  1ELO A;  2QLW A;  4GC7 A;  4OLO A;  1HNZ J;  1HYS B;  3K0J A;  2BOA A;  3D6H B;  4ECW A;  1D09 B;  2HBY B;  2LEP A;  3D0H E;  1FNX H;  1P1L A;  4NCG B;  2MQP A;  1IR2 A;  1URB A;  1RU2 A;  3LP2 B;  3ENV A;  3JSB A;  3GB0 A;  2IPO B;  4FVM A;  2QFJ A;  2HEK A;  1RAC B;  4ZIV A;  1WSV A;  3R8Y A;  3P45 B;  5G0R B;  4K5S A;  2E1A A;  2RF2 A;  4MT1 A;  1U1Q A;  4GTX A;  1KH7 A;  3SSR A;  3M32 A;  3C14 A;  2V63 A;  3MEG B;  5IQQ A;  3F73 A;  1R0B G;  1F5C A;  1Q79 A;  1ZA2 B;  2M2B A;  4CO2 A;  5CCL A;  3SZZ A;  4KGV B;  3S7R A;  5HN0 A;  5BXI A;  1KTQ A;  3ZZZ A;  3KLF B;  2UXB J;  2KT3 A;  3R27 A;  4PWD B;  3DN9 A;  1SVD A;  2ZZT A;  4AND A;  4BBY A;  2ZH9 A;  3HVR A;  3W60 A;  2PMZ D;  3X3U A;  2KN4 A;  4DL4 A;  1CUL B;  1UFK A;  2AEM A;  2VOP A;  3ED4 A;  1NJY A;  3M6U A;  5C25 A;  5D4N A;  2X3G A;  1AJB A;  3NBP A;  3UD4 P;  2XBP A;  3CIZ A;  2VB6 A;  1FXD A;  2IHR 1;  2JEJ A;  2RDJ A;  4F7V A;  2J0S D;  4CM0 A;  3DOK A;  3EVM A;  2IA0 A;  4CNZ A;  7FDR A;  2Z30 B;  2ASL A;  5ETP A;  1O99 A;  2EG1 A;  4HDG A;  4JUZ A;  1JLB A;  1AXQ A;  4OZL A;  2ADC A;  1EW2 A;  3HHK A;  2K1R A;  2X1B A;  2GVD A;  2B6A A;  4A8X A;  4DR5 F;  1FNM A;  4I2Q A;  3W1Y C;  5B0D A;  4DV3 J;  4N77 A;  3UO0 A;  2WVE A;  3Q89 A;  3BEG B;  2Z56 B;  3MM7 B;  3M6V A;  3Q8P B;  4LQ3 A;  2QSF A;  4KGX B;  2IUC A;  3TA2 A;  5GRR A;  2JZ5 A;  4ZN1 A;  2XUL A;  1X60 A;  2ZC4 A;  5I3U B;  4A46 A;  2UV8 G;  1FXL A;  3OR2 B;  1SJQ A;  3RRH A;  2HWT A;  4RLE A;  5K8P A;  2L48 A;  1FE4 A;  4CLZ A;  5KT3 A;  2OML A;  3CDW A;  1EQM A;  2LLZ A;  1VIO A;  1VIX A;  2MHN A;  1E6Y A;  1TKT B;  2RUG A;  3NY0 A;  2H5J B;  4NLR A;  4XO0 A;  3D1Q A;  3MEK A;  3K5M A;  5DLF A;  1CEZ A;  3M6X A;  2VG5 A;  3EJM A;  4UPH A;  1RK8 A;  1FA0 A;  3CCE S;  4ETX A;  2FVC A;  2ZBC A;  3QZ7 A;  3J7Z T;  4WPA A;  3H2U B;  3UDE A;  1YJV A;  3QGH A;  1RT4 A;  1NHU A;  5HAO A;  3EGV A;  1EHW A;  1WD6 A;  3UWT A;  2BDP A;  4B9M A;  2XI2 A;  1S1V A;  4MYT A;  4JV2 A;  1RHR B;  4L75 A;  1DQ9 A;  3MM9 A;  1E2S P;  3DLG A;  4BC7 A;  5IWA J;  4HYK A;  5A6W A;  2W9A A;  5KFI A;  2AP6 A;  1IKY B;  1FK9 B;  4Z7C A;  3SV4 A;  2HHX A;  1PIE A;  2IJR A;  2ROP A;  2A6M A;  1RCX B;  2W8L A;  1RT3 B;  4W90 B;  4MK8 A;  1BUX A;  5CYQ B;  4JYA J;  3NS6 A;  3E2D A;  3WAX A;  3K89 A;  4ED2 A;  3HF5 A;  2M7S A;  4GKK J;  4ID5 A;  4YR0 A;  1V9O A;  2LYV A;  2OD4 A;  1GTH A;  4DR4 J;  2YNG B;  2GCF A;  5KT4 A;  2XZW A;  1PYT A;  2WW4 A;  3DM2 B;  4RWW A;  5E3C A;  1R8B A;  5D6G A;  5J2P B;  2ZZM A;  2IIH A;  4WZM A;  1LOU A;  1WDD A;  3DRP A;  3EIC A;  3D0I E;  5KFY A;  3WHI A;  3MEE A;  2VOO A;  1KWM A;  5CQG A;  3GV7 B;  1VJQ A;  4TKT A;  4GO5 X;  4C0O C;  5E3A A;  2B0G A;  4YUD A;  4FVC A;  4F0M A;  2E1C A;  2ALY B;  4QIF A;  1U1N A;  2OSQ A;  1R3N A;  2DGS A;  1L3V A;  4P72 A;  4O0I A;  3HHD A;  1HBN B;  4PEO A;  1BD6 A;  4RW8 A;  1RWN B;  4YFU A;  4JI0 J;  1EP4 B;  2BV3 A;  2YX7 A;  3RBX A;  3LP1 B;  4G3I A;  3OBI A;  1S9G A;  2KRB A;  1WOS A;  1N36 F;  1NDK A;  4N41 A;  1ULR A;  4USU A;  5M2U A;  4DPW A;  4PAB A;  1IR0 A;  1Q1K A;  2X1F A;  1NSP A;  1U24 A;  2MQL A;  2W2M P;  3FQK A;  4KH0 B;  4USJ C;  4A8K A;  2JLF A;  2ZD1 B;  2M8D B;  3MK2 A;  4GTY A;  3IGN A;  3SI8 A;  1F3V A;  2FZG B;  4MKY A;  2N7Y A;  3A3O B;  3MEC A;  3CB4 A;  4C3M A;  3Q8U A;  3G4S S;  3FDS A;  3V6J A;  1Y00 A;  1NCL A;  3T1H J;  2Z58 B;  1D9F A;  5L0E A;  1F9H A;  1WI8 A;  4QW8 A;  2DRD A;  2HQ3 A;  3UNG C;  3QNW B;  3UNY A;  4ZPW R;  5C42 A;  3BGR A;  2QA1 A;  5CAA A;  3Q8S B;  4DR7 J;  4M5M A;  3VAI A;  2LQ8 A;  1F5A A;  5KFP A;  5EHH A;  4JI2 J;  1AB8 A;  4TYB A;  3FBF A;  2IBK A;  1UWB A;  2CXE A;  3C8Y A;  4JV5 J;  2VC1 A;  4RBT A;  4ILL A;  2JNJ A;  4HHU A;  5G0R A;  4GVB B;  3NKR A;  2KI2 A;  2E7V A;  1L3S A;  1NLK L;  4RO0 A;  3KK2 A;  1CJK A;  3PFO A;  2DPJ A;  5IS2 A;  2AWZ A;  2F5G A;  3MCN A;  1NZA A;  2KXH A;  3R5D A;  4KM4 A;  4U6P A;  2AEJ A;  2MJN A;  3HJF A;  2DO4 A;  2EFV A;  3FBB A;  5LRN A;  3J80 U;  2E66 A;  1C4A A;  1FX4 A;  2CQ4 A;  2RKI A;  2XCA A;  3V6K A;  1UL3 A;  1TEL A;  2QV6 A;  3MTJ A;  2PFD A;  1FJC A;  1TU0 B;  4HAC A;  2P8I A;  3J7Y U;  1OQ3 A;  4IOA Q;  1WJ9 A;  2G9O A;  2WOM B;  5J2N B;  3KHG A;  2H54 B;  1VS3 A;  4B9V A;  3MTK A;  3SSS A;  2PMH A;  2JFK A;  3MPU B;  1YI2 S;  3OLB A;  3TQE A;  1NND A;  1R89 A;  3W5X A;  3H42 A;  3U1L A;  3A8K A;  2P9G A;  2A10 A;  1FVS A;  4ED7 A;  3U7J A;  5KFZ A;  3UCZ P;  1HYS A;  2BE2 A;  1YGY A;  1F1B B;  3KLH B;  2HHW A;  1B0T A;  2RRA A;  1TUW A;  1RU1 A;  2YPY A;  5E7O B;  4ZVR B;  5DGA A;  2Y8Y A;  4QU6 A;  3HKZ D;  4LF6 F;  1NSK L;  1OWX A;  3N01 A;  1N34 J;  3KTQ A;  2FVS A;  1PSD A;  1QAX A;  2RE1 A;  3GIJ A;  1VQP S;  2BW2 A;  3V6H A;  1ALJ A;  1V6H A;  2EG2 A;  2W1B A;  3Q23 A;  3ELH A;  3TW0 A;  5A6P A;  2HMI B;  1ELZ A;  2XMU A;  1SC3 B;  2ATL A;  1FRK A;  4DV0 J;  2E5L F;  1U26 A;  2BKO A;  4DCO B;  5KFK A;  1VQK S;  3ETM A;  1N2K A;  1S6Q B;  3OW2 R;  1RBO B;  1TV6 B;  3RAX A;  2ADB A;  3WBH A;  2H1Y A;  1RJJ A;  2CQP A;  1XR5 A;  4R5P B;  1NJX A;  1RT1 B;  1UEU A;  2V6A A;  3M2V B;  2J7U A;  1YHQ S;  2A0F B;  2H4Y B;  2V8G A;  3H7H B;  3MFI A;  1C1C A;  2W2N P;  2AKW B;  4DQS A;  4KRW A;  2CJY B;  2GJF A;  3KDO A;  2IYI A;  3CW2 C;  2KRR A;  2VBX A;  3NS5 A;  4YN3 B;  1QM9 A;  3W8G A;  3WX4 A;  5IT9 U;  4GTZ A;  2M70 A;  4HLB A;  3AD8 C;  5J1P A;  3IXQ A;  5CH7 B;  3NBP B;  5LM7 E;  1ZM4 A;  4I4B A;  4MK7 A;  2IYG A;  4C6A A;  3AB2 B;  3HP6 A;  2V68 A;  4MFB A;  4YB5 A;  2Y1J A;  3TAQ A;  2A2D A;  1DTQ B;  1UP1 A;  2KXF A;  3ILJ A;  3TX0 A;  2AX1 A;  5KT6 A;  1M5V C;  2HZV A;  2ZZN A;  2CNL B;  3R3T A;  3M05 A;  5B7W A;  1JLE A;  3A12 A;  4HHJ A;  1CJT B;  2VU5 A;  1NM2 A;  3EZO A;  4F25 A;  4B9U A;  1T9Y A;  4LF4 J;  4FBT A;  3SBM A;  2DR7 A;  3F41 A;  3ZFV A;  2IDL A;  3SCJ E;  3LA0 A;  3CCU S;  3PRB A;  4CLP A;  4ECV A;  4CLS A;  1WEL A;  3MEG A;  2YWW A;  3BPS P;  1UVN A;  1Z2Z A;  4TLR A;  1TL7 B;  2GHP A;  4X64 F;  2XM3 A;  2DIV A;  3LGH A;  5CXT A;  1KBR A;  2IJF A;  2VG5 B;  1IBL J;  3K2Y A;  1NSQ A;  1GXU A;  3BBC A;  3W9H A;  2HQF A;  2GA7 A;  4ED8 A;  2EK1 A;  2PSZ A;  1PBA A;  3L9Z A;  3DRS B;  4DLE A;  1GK8 A;  3AOB A;  3LAN A;  4CDI A;  1KLN A;  5LOQ A;  2E1P A;  1N5V A;  2E7X A;  2GJI A;  1CPZ A;  3NKN A;  1VR6 A;  4IO1 A;  4C9D A;  2ZBI A;  1MLA A;  3FQL A;  2KH9 A;  1AUD A;  2DR8 A;  2WCX A;  2FLP A;  4B3T J;  1HR0 J;  1NK6 A;  2GC8 A;  1HNX F;  2VQR A;  1RGV A;  1VK8 A;  1VRQ C;  1WOR A;  1BHN A;  4IRC A;  1XNR J;  4ZLP A;  2QC3 A;  1T9U A;  2JL9 A;  4Z7Y A;  4IFY A;  1ZH5 A;  2W5T A;  3RB3 A;  2YKN B;  4DR1 J;  1FEH A;  2FTR A;  4USK A;  3TR5 A;  3KFW X;  5EWF A;  2VG6 B;  2V2Q A;  3IN5 A;  3W5Y A;  3VAG A;  2DR5 A;  4MIB A;  4EYH B;  4NRT A;  1YRX A;  3LAK A;  1HD0 A;  2FDN A;  4FDF A;  2MZR A;  2PEB A;  4DBQ A;  3NNH A;  4IYQ A;  1EAR A;  2BJ1 A;  3AA8 A; 
#chains in the Genus database with same CATH homology
 1AJB A;  2D1G A;  3DYC A;  2GSU A;  4GTW A;  5LIA A;  2XRG A;  2W5R A;  4ZGA A;  4QAX A;  3WAV A;  1AJA A;  4KM4 A;  1KH5 A;  5LRN A;  1O99 A;  4KAY A;  2RH6 A;  4FDI A;  4CXU A;  4MHX A;  5K4P A;  5IJS A;  1KHJ A;  3NVL A;  3NKP A;  4NWJ A;  1ZEF A;  1HDH A;  3MK0 A;  1E33 P;  1ALH A;  1ALI A;  3UO0 A;  3T01 A;  1ZEB A;  4FDJ A;  5DLV A;  5LRM A;  1EQJ A;  2IUC A;  3MK1 A;  5L0K A;  5GRR A;  3WAY A;  3T00 A;  5EGE A;  1ANI A;  4ZG9 A;  4LR9 A;  1KH9 A;  2W5W A;  1EW9 A;  2GSO A;  3A52 A;  3T02 A;  3SZY A;  4UOP A;  5LQQ A;  1KH4 A;  4KJG A;  4UPH A;  1AJC A;  1SHN A;  1AJD A;  3OT9 A;  5AJ9 A;  2ZKT A;  3WAW A;  4LQY A;  3M8W A;  3DPC A;  2GLQ A;  5INH A;  3NKN A;  4UPK A;  1KH7 A;  1O98 A;  4LRD A;  1EJJ A;  3NKO A;  1ELZ A;  2XR9 A;  1P49 A;  1Y6V A;  4UPI A;  3NKR A;  2ANH A;  3BDF A;  5IJQ A;  1E3C P;  1N2K A;  1N2L A;  3WBH A;  4LRE A;  3BDH A;  1SHQ A;  1KHL A;  4KJD A;  3UN2 A;  1KHK A;  3UN5 A;  3KD8 A;  1AUK A;  1URA A;  1B8J A;  3BDG B;  3E2D A;  1HJK A;  3LXQ A;  3WAX A;  4NWX A;  4LR2 A;  5KXA A;  4N7T A;  3M8Y A;  2GA3 A;  4GTZ A;  3NKM A;  4UOR A;  4MIV A;  1ZED A;  3TG0 A;  3BDG A;  4LRC A;  1HQA A;  3IGY B;  3UN3 A;  1K7H A;  4CYR A;  3TX0 A;  3M8Z A;  2W5X A;  3IGZ B;  5GOV A;  1ALK A;  1E2S P;  2W5V A;  1ED9 A;  4CXK A;  5C66 A;  1EI6 A;  2W5S A;  5HRT A;  2G9Y A;  2IUC B;  4UPL A;  1ED8 A;  1FSU A;  1URB A;  3B5Q A;  1KHN A;  4ZG6 A;  4LR7 A;  1EW8 A;  3M7V A;  5L0B A;  1ANJ A;  2W8D A;  3MK2 A;  4GTY A;  5DLW A;  5TJ3 A;  4TN0 A;  4ZG7 A;  2X98 A;  4GTX A;  1ELX A;  4CYS A;  4UOO A;  4LR8 A;  1E1Z P;  2VQR A;  5L0E A;  4LRA A;  3UNY A;  2IFY A;  2W8S A;  3SZZ A;  2W5T A;  4LRB A;  3IDD A;  1EW2 A;  4B56 A;  3Q3Q A;  5EGH A;  2GSN A;  4KAV A;  1ALJ A;  2QZU A;  4LRF A;  4CXS A;  4MY4 A;  1Y7A A;  5DLT A;  3ED4 A;  4YR1 A;  3TWZ A;  1ELY A;  2W5Q A;  3CMR A;  3NKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...