3UNLA

Crystal structure of ketosteroid isomerase f54g from pseudomonas testosteroni
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREGYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal structure of ketosteroid isomerase F54G from Pseudomonas testosteroni
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 34
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3unlA00
4XBYA 5CK6A 5BVBA 3I0YA 4J9AA 3FGYA 1Z1SA 4XDVA 3KKGA 2Z7AA 2QGUA 2OWPA 1W01A 3BLZA 1A2KA 2HMOB 1O7HB 1QJGA 3M8CA 4HZ9B 2JQ5A 3F8XA 1OPYA 1W02A 3NHXA 2F99A 4H3UA 3OWYA 4ORLA 2R4IA 3JUNA 3CU3A 3BB9A 1TUHA 3EN1B 3F14A 3GRDA 1Q40B 1JKGA 1NWWA 2INXA 4RZMA 5CXOA 2BNGA 2F98A 2YFIB 3FZWA 5AI1A 2A15A 3VGNA 5AIHA 2IMJA 2B1XB 2HMJB 1HKXA 4N3VA 4IIAA 5IERA 5BXQA 4LGQA 3S5CA 3F9SA 1DMMA 3MHEA 2GBXB 3GWRA 6STDA 3NV0A 4XBXA 4HM4B 3RGRA 1EG9B 1OH0A 3CNXA 4HZBB 2B24B 3OWSA 2BMOB 2BMQB 5TGNA 3ROBA 1E97A 1JN5B 1GYBA 3GZYB 3OV4A 4WYKB 3NBRA 1OHSA 3FH1A 2UX0A 3FLJA 5IG3A 1ULJB 4K1UA 1K41A 4X2OA 2Z76A 4XDWA 5AEWB 2K54A 3OX9A 3OXAA 4HM1B 5DRVA 4PEJA 3STDA 4OVMA 2GEYA 3FSDA 4GB5A 3MG1A 3ER7A 1JB5A 3MSOA 4HM0B 5IEOA 2RFRA 1OF5B 2HMKB 2HMNB 4XM4A 5KP3A 3SOYA 3UJMA 5JPPA 5AEUB 1IDPA 3DZLA 1Q40A 1S5AA 3MKIA 4OUQA 1SJWA 3FF2A 2Z77A 1OGZA 3EN8A 4HM2B 3T8NA 1U5OA 3EC9A 1Q42A 3HK4A 5CLKA 3SEDA 3F7XA 1O7NB 3OWUA 5IG5A 4HJLB 8CHOA 2QIYA 2YFLB 5STDA 4HM8B 3NM2A 3B4OA 3FF0A 2RCDA 4FCMA 1DMNA 3EF8A 2STDA 3H3HA 1JN5A 2CKFB 3CPOA 2F86B 4WYKA 1OHPA 5IEPA 1WQLB 5FW5A 5G2GA 1E3VA 3KSPA 5CF1A 1STDA 3GZBA 3NUVA 4HVNA 3B4PA 1JB4A 3DM8A 3JUOA 4R9LA 4XBTA 4LEHA 2I9WA 3EQQB 1ULIB 3G16A 4R9KA 3KE7A 2XR8B 4I4KA 2W2CA 1O7GB 3F40A 2GBWB 2YFJB 4HM3B 2GEXA 3GZXB 5DREA 3B7CA 1OF5A 1GY5A 4K1VA 4R1KA 5IF6A 2RGQA 1GY7A 5D82A 1O7WB 1UUVB 3K7CA 4MJDA 4KVHA 1AR0A 1VZZA 3DUKA 1E3RA 3WMDA 5KP4A 4J8TA 3T8UA 3CNMA 1ISKA 2XSOB 1O7MB 3DMCA 3EJVA 1QMAA 3LZAA 3D9RA 3F7SA 4HM7B 4STDA 4LMIA 3ECFA 2PZVA 3MG2A 4X2HA 5D81A 4U13A 1W6YA 4CDLA 5KP1A 5JPUA 3GZRA 1C7HA 2GXFA 2XSHB 1CQSA 3KZTA 3B8LA 1TP6A 3RGAA 1NU3A 4Q53A 4HM5B 5D83A 3JUMA 4FCJA 4WWUC 2HMLB 4HM6B 5HGRA 4L7KA 1O7PB 1OCVA 3EX9A 3Q90A 3E99A 5AIFA 3H51A 1EA2A 5IENA 1BUQA 3DXOA 1JKGB 1OUNA 3G8ZA 5CF2A 3FKAA 3F8HA 4HKVB 5AIIA 3EBYA 3LYGA 3G0KA 2CHCA 1GS3A 1UUWB 4L8PA 1W00A 3SOAA 4L8OA 5IG0A 5AIGA 3MYTA 3NXJA 2XRXB 5IG4A 1JB2A 1ZX2A 1ZO2A 3NV0B 5EVHA 3EHCA 3IPTA 7STDA 3JUPA 3MG3A 1DMQA 3EBTA 4XB5A 3A76A 3UNLA 4WP5A 2HMMB 1OHOA 3HZPA 3VSYA 2BMRB 1ASKA 3K0ZA 3JUQA 1GY6A 1NDOB 3HX8A 1OGXA
chains in the Genus database with same CATH superfamily
1G02A 2P0XA 4O3VA 4XBYA 1IT7A 2LQVA 1RGKA 2E2TA 3HIIA 2YX9A 5CK6A 1RSNA 3AMOB 3U1WA 5BVBA 3I0YA 1IK3A 2OTJ3 4ZM8A 4J9AA 3FGYA 1Z1SA 1US1A 4XDVA 3KKGA 2Z7AA 3WA2X 2QGUA 3DGLA 2SBLA 2OWPA 1W01A 3V99A 1BRKA 1SQWA 3BLZA 3FG3A 2SARA 4LYLB 1A2KA 2F5MA 2HMOB 4FR9A 3CMA3 1O7HB 4GL6A 1RTUA 3RDEA 1QJGA 2P05A 1T5YA 3M8CA 3O8YA 4BIRA 1BSEA 4HZ9B 4R80A 2JQ5A 3F8XA 4BTYA 1OPYA 1W02A 2F5WA 1V57A 2OCTA 5IW9A 1YIT3 3K63A 1VQ93 1PYLA 1VQQA 4N6UA 1QVF2 3NHXA 3VF1A 2F99A 3DH2A 2BIRA 4H3UA 2P09A 3A5EA 4N6TA 3OWYA 4ORLA 1FGOA 1KQS2 1BNJA 2R4IA 2W6JH 3JUNA 1Y4KA 1BSAA 1JRQA 3CU3A 2CG1A 3BB9A 1KD14 1TUHA 1TFOA 2P38A 3EN1B 2Y74A 1VQL3 2RSXA 3F14A 1AV4A 1SIHA 3GRDA 1Q40B 1LQMB 2WGQA 1JKGA 3CCU3 1YVSA 1NWWA 2INXA 1UI8A 1LOVA 4EC6A 4RZMA 5CXOA 3I553 2L1SA 2R41A 2BNGA 3BNEA 3NM7A 2F98A 2W0QA 2YFIB 3FZWA 5AI1A 2A15A 2K3DA 3VGNA 3ZG5A 5AIHA 3N54B 4J5KA 1J2BA 2IMJA 3HOHA 3PXMA 4RBNA 2CX0A 1VQO3 2B1XB 2HMJB 3SVAA 1HKXA 4N3VA 4IIAA 5IERA 3X41A 3J7Yd 4EV2A 3BIRA 1GOYA 1I0VA 1PFPA 1VQK3 2AAEA 5FGOA 5BXQA 4CCVA 1HYFA 1BOXA 4LGQA 3S5CA 3F9SA 1BSDA 1DMMA 3MHEA 2GBXB 1FZUA 3GWRA 1SPUA 4FMAA 1Q814 1K8A4 1VQ83 6STDA 1RGCA 1RN1A 1BRGA 2WOFA 3NV0A 4XBXA 3QK9A 4ILFA 4HM4B 3RGRA 1EUIC 2WOHA 1LNHA 3WODG 1EKMA 1B2ZA 2KAAA 5M1AA 1EG9B 1BAOA 1OH0A 1W4NA 3CNXA 1LNIA 1W7CA 4HZBB 2B24B 1YJN3 1FW7A 1D6ZA 3OWSA 1JBRA 1VQP3 4HAAA 1S723 2BMOB 3X3XA 2CX1A 2BMQB 2JDIH 5TGNA 2CFDA 3ROBA 4NREA 1E97A 2K0MA 1JN5B 3D3LA 3PCSA 1GYBA 3GZYB 3OV4A 4WYKB 4BU4A 4EXRA 5AYSC 3NBRA 1JBSA 1OHSA 4EW5A 1DVCA 2CFLA 3FH1A 2BO9B 1B27A 7RNTA 1I2GA 2UX0A 3KIIA 3OW22 3FLJA 1BNEA 3IMAB 2OQEA 1QAFA 5IG3A 4JRFA 1RRLA 3U97A 5A0OB 5BU4A 3AHSA 1ULJB 1RN7A 3LTBA 4K1UA 3GSPA 3X40A 2CWTA 1K41A 4GSPA 1DYUA 5RNTA 4X2OA 2P0MA 3CCL3 2Z76A 1JBTA 1HZ1A 1MWSA 2ZA4A 1EEJA 4XDWA 1W6CA 3AMOA 1RLSA 1BRSA 4TX4A 5AEWB 4DKIA 1UCIA 2K54A 3OX9A 4O2HA 2RNTA 3OXAA 3CCE3 1RKYA 1JZDA 2CFWA 2ZL8A 4G1MB 4HM1B 4PEJA 5DRVA 3STDA 2AADA 3N9HA 4IT7A 4OVMA 1YI23 2GEYA 3FSDA 2H0IA 1WMPA 2OOVA 1LQGC 4GB5A 3LTCA 2W9QA 2F4YA 1RJOA 3MG1A 1LRAA 1RCKA 3ER7A 1JB5A 3MSOA 1BNSA 4EV5A 1RGAA 1AVLA 1Q7HA 4HM0B 3S27A 1LVNA 4CPKA 5IEOA 2CH9A 2RFRA 1YGEA 1ZS7A 1I2FA 2XF3A 1OF5B 2CWUA 3V92A 1ROVA 2HMKB 2HMNB 4XM4A 4EYCA 3LXUX 2MF7A 1MNLA 3EE1A 2CWVA 3HI7A 5KP3A 1V58A 3SOYA 3UJMA 5JPPA 1IU7A 4KT3B 5AEUB 1IDPA 1ROAA 3EB8A 3DZLA 3JVCA 1Q40A 2XFSA 1GMPA 1S5AA 1M904 2IUKA 2IA7A 3MKIA 1I3IA 4OUQA 1PY3A 1STFI 1SJWA 5G1LA 1D6YA 3WDGB 3FF2A 3PZWA 4N6OB 5LC7A 2Z77A 1D6UA 2E2UA 1OGZA 3EN8A 1RMSA 3NQZA 4HM2B 4OK0A 3T8NA 1U5OA 3EC9A 1G0TA 2KXGA 3AGNA 1FGTA 3UL5A 5EEOA 1Q42A 1B21A 1BVIA 3FG1A 1BRHA 3HK4A 3G6E3 1YHQ3 1N9EA 5CLKA 1G96A 1UCLA 4GHOA 3SEDA 3GAXA 3F7XA 1B3SA 1DE3A 1NB3I 3PYJA 1O7NB 1W2ZA 3OWUA 5IG5A 1N5HA 1IQYA 2O3OA 5I97A 4HJLB 4HYZA 2ML6A 2Q07A 3K9MC 1QVG2 8CHOA 2QIYA 2BT3A 2KRTA 2YFLB 5STDA 3S67A 1BNFA 4LSOA 3BNDA 3CC23 1FYSA 1HU9A 1ZGXA 2XFTA 3CPW2 1W6GA 3DGYA 4I5QA 4HM8B 1X1WA 3NM2A 3CCS3 4R4KA 2GU1A 2ZDJA 2MC8A 2CW9A 3B4OA 3CCV3 1VQM3 3FF0A 3LMLA 2L4VA 1EQKA 1IT8A 1RNBA 2RCDA 3SX1A 2LYXA 4FCMA 4AKZA 1DMNA 3EF8A 2STDA 2WO0A 1KSIA 3H3HA 3SXXA 1JN5A 1SIIA 2CKFB 4EBGA 3CPOA 1LOXA 2QA43 1TRPA 2F86B 3ZG0A 1DETA 4WYKA 1N8QA 1OHPA 4K90B 5IEPA 1WQLB 2FGTA 1I8VA 1B2UA 5FW5A 2O9UX 1IQ8A 5G2GA 1RGFA 5AYRB 4NPBA 1E3VA 4WHAA 1Q9EA 3KSPA 2Z6BA 4LZIA 1A67A 5CF1A 2H0HA 1STDA 2XGLA 3GZBA 3FCSB 3QRDA 3NUVA 2W04A 4HVNA 2J8XB 3B4PA 4O8SA 1JB4A 2UUGC 2W56B 1I70A 5LC6A 1W2B2 1BU4A 4KFFA 1KWIA 3DM8A 3JUOA 3NQYA 4R9LA 5G1KA 1AVKA 1W5ZA 1U8CB 4XBTA 4LEHA 3NBBA 1BGSA 4KFDA 2ML5A 3WA3A 1TRQA 2CG0A 1T2HA 2I9WA 3EQQB 1ULIB 1B2SA 3D5GA 3G16A 1K734 2CC3A 2CK3H 4N6V0 4R9KA 3S29A 3CCR3 3KE7A 3D79A 3PCRA 2XR8B 4I4KA 4RNTA 2W9PA 2W2CA 4AEQA 3PS8A 2FNQA 4AKYA 4MMXB 1IVUA 1T2IA 1GOUA 1JV2B 1O7GB 3F40A 2GBWB 1C54A 3N8BA 3L0RA 1AY7A 3CXC2 8RNTA 1QALA 2YFJB 4HM3B 2GEXA 3TDGA 1MGRA 3GZXB 5DREA 1NJI4 3B7CA 1FGRA 1OF5A 1OACA 1TJDA 1GY5A 4K1VA 3LOYA 4R1KA 5JBSA 2F56A 1VQ63 3K5TA 5IF6A 2RGQA 1GY7A 2H0GA 4RNZA 5D82A 1O7WB 2V1LA 3AHWA 9RNTA 1BRNL 1FA3A 1UUVB 4FMDA 3CCJ3 3K7CA 4H61A 2CFKA 4MJDA 2OOVC 3G713 1FGQA 1IVWA 1X1YA 1FGMA 3RNTA 2XGNA 1LXEA 1NB5I 4KVHA 1LOWA 6RNTA 1BNGA 4QWTA 1AR0A 1VZZA 3DUKA 5EQLA 1E3RA 2KCDA 3WMDA 1UDII 4J8TA 3V98A 5KP4A 2HOHA 3CNMA 3T8UA 1ISKA 2XSOB 3AGOA 3X42A 3WOEB 1JJ22 1O7MB 4CJNA 1K28A 3IJEB 3DMCA 1Q864 1PU4A 3EJVA 5GSPA 1QMAA 3WHOA 3LZAA 3WOFB 1GD3A 2GU3A 4N6MA 3G4S3 3CC43 1UW1A 3D9RA 3F7SA 4HM7B 1B20A 4STDA 4LMIA 1UI7A 3ECFA 1UUGB 5HOHA 3ZFZA 3UB1A 1GMQA 2PZVA 1SARA 3MG2A 4BTWA 1RGEA 1IV7A 1RHLA 4MEIA 4X2HA 2ZHXB 5D81A 2UGIA 4N6NB 1BIRA 2D42A 1W6YA 1YGWA 4U13A 2C11A 3I563 1WMOA 4CDLA 3LT9A 1TIJA 1MWRA 3Q1CA 5KP1A 2KF5A 3GZRA 4N6LA 5JPUA 1C7HA 3BU4A 1DVDA 3X3YA 1V74A 3KCHA 2GXFA 1GMRA 2CFGA 1CH0A 1JNQA 1UGHI 1QAKA 2XSHB 1CQSA 3SYUA 1FUWA 3KZTA 3B8LA 1TP6A 3RGAA 1NU3A 4Q53A 1RGLA 2C4BA 4HM5B 5D83A 1N9JA 3CC73 1YVBI 3JUMA 1IVXA 4FCJA 4WWUC 1YJ93 2HMLB 4HM6B 5HGRA 1M9GA 4L7KA 3ALAA 2KF3A 1VQ53 3KFQC 2OTL3 2BHMA 1O7PB 2KF4A 4KZ1A 1UCKA 3SLUA 1OCVA 2FXTA 1BNIA 3EX9A 1TTOA 3BNCA 3NBJA 3T0UA 1LOYA 1T3BA 4BL3A 2W56A 1K9M4 3LH4A 3Q90A 1RNTA 3E99A 5BIRA 3LTDA 1VQ43 4IPBA 1BRJA 3S28A 5AIFA 3H51A 1EA2A 1UCJA 1CYVA 1KC84 1VQN3 2IUJA 1RGGA 5IENA 2WGOA 1BUQA 1BSCA 2KF6A 3Q3FA 2D1WA 1BNRA 1TFKA 1FUTA 4WFOA 3DXOA 1NO3A 1GSPA 2W03A 1JKGB 3CCM3 1OUNA 3BNBA 4JF8A 2GSPA 3KN4A 1B2XA 1MOLA 3Q2PA 1M1K4 3G8ZA 3MPHA 1CYUA 1L5GB 5CF2A 2C10A 3DGOA 3FKAA 3F8HA 1RCLA 2Y73A 3KSED 3EBYA 4HKVB 5AIIA 4BTXA 3CME3 1A90A 1IYYA 3LYGA 3DGNA 3G0KA 1A2PA 1GOVA 3URPA 4FMCA 1N8R4 1F8NA 1BRIA 2CHCA 1GS3A 1R4YA 1UUWB 1I2EA 1W00A 4L8PA 4HBRA 3SOAA 1RDSA 4HOHA 3D5IA 4L8OA 5IG0A 5AIGA 3X3ZA 6GSPA 1IVVA 1WTHA 1RGHA 3MYTA 3NXJA 3CD63 2XRXB 2E2VA 2OQEC 5IG4A 1JB2A 1ZX2A 3UL6A 4FMBA 1ZO2A 1MGWA 2CIUA 1BANA 3D4AA 3HIGA 4BL2A 3NV0B 4MMYB 5EVHA 1VQ73 3EHCA 3IPTA 7STDA 1TU5A 1YIJ3 1YJW3 1R4CA 3JUPA 1CEWI 1JZOA 1A2VA 3MG3A 3PGBA 1MWTA 1M1XB 4MMZB 1GD4A 1UGIA 1DMQA 2IY2A 3EBTA 3FG4A 4XB5A 3A76A 5ELJA 7GSPA 4J5GA 3UNLA 2PNCA 3CCQ3 2XH9A 3DGMA 1N5PA 1IV9A 3LT8A 1X1UA 1Q824 1WNHA 1BSBA 1MWUA 4WP5A 2HMMB 1OHOA 2IYJA 4K61A 3HZPA 1Q7Y4 2BU4A 1IQXA 3DY5A 3NX0A 3VSYA 2BMRB 1NNVA 2QEX3 4O02B 1BUJA 1ASKA 3K0ZA 3MWZA 3WR2A 3JUQA 1GY6A 1RN4A 1X1XA 4KFEA 1WMNA 1I0XA 1NDOB 3LTAA 1YNVX 3HX8A 4NHFA 4FCZA 1I3FA 1OGXA 4RNYA 1AQZA 5ELUA 2RBIA 1FUSA 5M19A 2M7OA 1B2MA 5M18A 1RRHA 2XEPA
chains in the Genus database with same CATH topology
2P0XA 4O3VA 4XBYA 1IT7A 2LQVA 2E2TA 3HIIA 2YX9A 5CK6A 3AMOB 3U1WA 5BVBA 3I0YA 1IK3A 2OTJ3 4ZM8A 4J9AA 3FGYA 1Z1SA 1US1A 4XDVA 3KKGA 2Z7AA 3WA2X 2QGUA 3DGLA 2SBLA 2OWPA 1W01A 3V99A 1SQWA 3BLZA 3FG3A 1A2KA 2HMOB 4FR9A 3CMA3 1O7HB 4GL6A 3RDEA 1QJGA 2P05A 1T5YA 3M8CA 3O8YA 4HZ9B 4R80A 2JQ5A 3F8XA 4BTYA 1OPYA 1W02A 2OCTA 1YIT3 5IW9A 3K63A 1VQ93 1QVF2 4N6UA 3NHXA 3VF1A 2F99A 4H3UA 2P09A 4N6TA 3OWYA 4ORLA 1FGOA 1KQS2 2W6JH 2R4IA 3JUNA 1Y4KA 1JRQA 3CU3A 2CG1A 3BB9A 1KD14 1TUHA 1TFOA 2P38A 3EN1B 2Y74A 1VQL3 2RSXA 3F14A 1AV4A 1SIHA 3GRDA 1Q40B 2WGQA 1JKGA 3CCU3 1NWWA 2INXA 1UI8A 4EC6A 4RZMA 5CXOA 3I553 2BNGA 3BNEA 3NM7A 2F98A 2W0QA 2YFIB 3FZWA 5AI1A 2A15A 3VGNA 5AIHA 3N54B 1J2BA 2IMJA 1VQO3 3PXMA 4RBNA 2B1XB 2HMJB 3SVAA 1HKXA 4N3VA 4IIAA 5IERA 3X41A 3J7Yd 4EV2A 1PFPA 1VQK3 5FGOA 5BXQA 4CCVA 4LGQA 3S5CA 3F9SA 1DMMA 3MHEA 2GBXB 3GWRA 1SPUA 4FMAA 1Q814 1K8A4 1VQ83 6STDA 2WOFA 3NV0A 4XBXA 3QK9A 4HM4B 3RGRA 2WOHA 1LNHA 3WODG 1EKMA 1EG9B 1OH0A 1YJN3 1W4NA 3CNXA 1W7CA 4HZBB 2B24B 1D6ZA 3OWSA 1VQP3 1S723 2BMOB 3X3XA 2JDIH 2BMQB 5TGNA 2CFDA 3ROBA 4NREA 1E97A 2K0MA 1JN5B 3D3LA 3PCSA 1GYBA 3GZYB 3OV4A 4WYKB 4EXRA 5AYSC 3NBRA 1OHSA 1DVCA 2CFLA 3FH1A 2BO9B 2UX0A 3KIIA 3OW22 3FLJA 2OQEA 3IMAB 5IG3A 1QAFA 4JRFA 1RRLA 3U97A 5A0OB 1ULJB 1RN7A 3LTBA 4K1UA 3X40A 2CWTA 1K41A 1DYUA 4X2OA 2P0MA 3CCL3 2Z76A 4XDWA 1W6CA 3AMOA 5AEWB 4TX4A 2K54A 3OX9A 4O2HA 3OXAA 3CCE3 1RKYA 2CFWA 2ZL8A 4G1MB 4HM1B 5DRVA 4PEJA 3STDA 4IT7A 3N9HA 4OVMA 1YI23 2GEYA 3FSDA 1WMPA 2OOVA 4GB5A 3LTCA 2W9QA 3MG1A 1RJOA 3ER7A 1JB5A 3MSOA 4EV5A 1AVLA 4HM0B 3S27A 1LVNA 5IEOA 2CH9A 2RFRA 1YGEA 2XF3A 1OF5B 2CWUA 3V92A 1ROVA 2HMKB 2HMNB 4XM4A 4EYCA 3LXUX 2MF7A 1MNLA 3EE1A 2CWVA 3HI7A 5KP3A 3SOYA 3UJMA 5JPPA 1IU7A 5AEUB 1IDPA 1ROAA 3EB8A 3DZLA 3JVCA 1Q40A 2XFSA 1S5AA 1M904 2IUKA 2IA7A 3MKIA 4OUQA 1STFI 1SJWA 1D6YA 3WDGB 3FF2A 3PZWA 4N6OB 5LC7A 2Z77A 1D6UA 2E2UA 1OGZA 3EN8A 3NQZA 4HM2B 4OK0A 3T8NA 1U5OA 3EC9A 2KXGA 1FGTA 3UL5A 5EEOA 1Q42A 3FG1A 3HK4A 3G6E3 1YHQ3 1N9EA 5CLKA 1G96A 3SEDA 3GAXA 3F7XA 1NB3I 3PYJA 1O7NB 1W2ZA 3OWUA 5IG5A 1N5HA 1IQYA 2O3OA 5I97A 4HJLB 4HYZA 2ML6A 2Q07A 3K9MC 1QVG2 8CHOA 2QIYA 2BT3A 2KRTA 2YFLB 5STDA 3S67A 4LSOA 3BNDA 3CC23 1HU9A 2XFTA 3CPW2 1W6GA 4HM8B 3NM2A 3CCS3 4R4KA 2GU1A 2ZDJA 2MC8A 2CW9A 3B4OA 3CCV3 1VQM3 3FF0A 3LMLA 2L4VA 1EQKA 1IT8A 2RCDA 3SX1A 2LYXA 4FCMA 4AKZA 1DMNA 3EF8A 2STDA 2WO0A 1KSIA 3H3HA 3SXXA 1JN5A 1SIIA 2CKFB 4EBGA 3CPOA 1LOXA 2QA43 2F86B 4WYKA 1N8QA 1OHPA 4K90B 5IEPA 1WQLB 2FGTA 5FW5A 5AYRB 2O9UX 1IQ8A 5G2GA 1E3VA 4WHAA 4LZIA 3KSPA 2Z6BA 1A67A 5CF1A 1STDA 2XGLA 3GZBA 3FCSB 3QRDA 3NUVA 2W04A 4HVNA 3B4PA 4O8SA 1JB4A 2W56B 1W2B2 5LC6A 4KFFA 1KWIA 3DM8A 3JUOA 3NQYA 4R9LA 1AVKA 1W5ZA 1U8CB 4XBTA 4LEHA 3NBBA 4KFDA 2ML5A 3WA3A 2CG0A 2I9WA 3EQQB 1ULIB 1K734 3G16A 2CC3A 2CK3H 4N6V0 4R9KA 3S29A 3CCR3 3KE7A 3PCRA 2XR8B 4I4KA 2W9PA 2W2CA 4AEQA 3PS8A 2FNQA 4AKYA 4MMXB 1IVUA 1JV2B 1O7GB 3F40A 2GBWB 3N8BA 3L0RA 3CXC2 1QALA 2YFJB 4HM3B 2GEXA 3TDGA 3GZXB 5DREA 1NJI4 3B7CA 1FGRA 1OF5A 1OACA 1GY5A 4K1VA 3LOYA 4R1KA 5JBSA 1VQ63 3K5TA 5IF6A 2RGQA 1GY7A 4RNZA 5D82A 1O7WB 2V1LA 1FA3A 1UUVB 4FMDA 3CCJ3 3K7CA 4H61A 2CFKA 4MJDA 2OOVC 3G713 1FGQA 1IVWA 1FGMA 2XGNA 1LXEA 1NB5I 4KVHA 4QWTA 1AR0A 1VZZA 3DUKA 5EQLA 1E3RA 2KCDA 3WMDA 3V98A 4J8TA 5KP4A 3T8UA 3CNMA 1ISKA 2XSOB 3X42A 3WOEB 1JJ22 1O7MB 1K28A 3IJEB 3DMCA 1Q864 1PU4A 3EJVA 1QMAA 3LZAA 3WOFB 1GD3A 2GU3A 4N6MA 3G4S3 3CC43 1UW1A 3D9RA 3F7SA 4HM7B 4STDA 4LMIA 1UI7A 3ECFA 3UB1A 2PZVA 3MG2A 4BTWA 1IV7A 4MEIA 4X2HA 5D81A 4N6NB 2D42A 1W6YA 4U13A 2C11A 3I563 1WMOA 4CDLA 3LT9A 1TIJA 3Q1CA 5KP1A 4N6LA 3GZRA 5JPUA 1C7HA 3X3YA 1V74A 2GXFA 2CFGA 1JNQA 2XSHB 1FUWA 1QAKA 1CQSA 3KZTA 3B8LA 1TP6A 3RGAA 1NU3A 4Q53A 4HM5B 5D83A 3CC73 1DVDA 1N9JA 1YVBI 3JUMA 1IVXA 4FCJA 4WWUC 1YJ93 2HMLB 4HM6B 5HGRA 1M9GA 4L7KA 3ALAA 1VQ53 3KFQC 2OTL3 2BHMA 1O7PB 4KZ1A 3SLUA 1OCVA 2FXTA 3EX9A 3BNCA 3NBJA 3T0UA 2W56A 1K9M4 3LH4A 3Q90A 3E99A 3LTDA 1VQ43 4IPBA 3S28A 5AIFA 3H51A 1EA2A 1CYVA 1KC84 1VQN3 2IUJA 5IENA 2WGOA 1BUQA 2D1WA 1TFKA 4WFOA 3DXOA 1NO3A 2W03A 1JKGB 3CCM3 1OUNA 3BNBA 4JF8A 3KN4A 1M1K4 1MOLA 3Q2PA 3G8ZA 3MPHA 1CYUA 1L5GB 5CF2A 2C10A 3DGOA 3FKAA 3F8HA 4HKVB 2Y73A 3KSED 3EBYA 5AIIA 4BTXA 3CME3 1A90A 3LYGA 3DGNA 3G0KA 4FMCA 1N8R4 1F8NA 2CHCA 1GS3A 1UUWB 4L8PA 1W00A 4HBRA 3SOAA 4L8OA 5IG0A 5AIGA 3X3ZA 1IVVA 1WTHA 3MYTA 3NXJA 3CD63 2XRXB 2E2VA 2OQEC 5IG4A 1JB2A 1ZX2A 3UL6A 4FMBA 1ZO2A 2CIUA 3HIGA 3NV0B 4MMYB 5EVHA 1VQ73 3EHCA 3IPTA 7STDA 1TU5A 1YIJ3 1YJW3 1R4CA 3JUPA 1CEWI 3MG3A 1A2VA 3PGBA 1M1XB 4MMZB 1GD4A 3FG4A 1DMQA 3EBTA 4XB5A 3A76A 5ELJA 3UNLA 3CCQ3 2PNCA 2XH9A 3DGMA 1N5PA 1IV9A 3LT8A 1Q824 1WNHA 4WP5A 2HMMB 1OHOA 4K61A 3HZPA 1Q7Y4 1IQXA 3DY5A 3NX0A 3VSYA 2BMRB 2QEX3 4O02B 1ASKA 3K0ZA 3MWZA 3JUQA 1GY6A 4KFEA 1WMNA 3LTAA 1NDOB 3HX8A 4NHFA 4FCZA 1OGXA 4RNYA 5ELUA 2M7OA 1RRHA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBY A;  5CK6 A;  5BVB A;  3I0Y A;  4J9A A;  3FGY A;  1Z1S A;  4XDV A;  3KKG A;  2Z7A A;  2QGU A;  2OWP A;  1W01 A;  3BLZ A;  1A2K A;  2HMO B;  1O7H B;  1QJG A;  3M8C A;  4HZ9 B;  2JQ5 A;  3F8X A;  1OPY A;  1W02 A;  3NHX A;  2F99 A;  4H3U A;  3OWY A;  4ORL A;  2R4I A;  3JUN A;  3CU3 A;  3BB9 A;  1TUH A;  3EN1 B;  3F14 A;  3GRD A;  1Q40 B;  1JKG A;  1NWW A;  2INX A;  4RZM A;  5CXO A;  2BNG A;  2F98 A;  2YFI B;  3FZW A;  5AI1 A;  2A15 A;  3VGN A;  5AIH A;  2IMJ A;  2B1X B;  2HMJ B;  1HKX A;  4N3V A;  4IIA A;  5IER A;  5BXQ A;  4LGQ A;  3S5C A;  3F9S A;  1DMM A;  3MHE A;  2GBX B;  3GWR A;  6STD A;  3NV0 A;  4XBX A;  4HM4 B;  3RGR A;  1EG9 B;  1OH0 A;  3CNX A;  4HZB B;  2B24 B;  3OWS A;  2BMO B;  2BMQ B;  5TGN A;  3ROB A;  1E97 A;  1JN5 B;  1GYB A;  3GZY B;  3OV4 A;  4WYK B;  3NBR A;  1OHS A;  3FH1 A;  2UX0 A;  3FLJ A;  5IG3 A;  1ULJ B;  4K1U A;  1K41 A;  4X2O A;  2Z76 A;  4XDW A;  5AEW B;  2K54 A;  3OX9 A;  3OXA A;  4HM1 B;  5DRV A;  4PEJ A;  3STD A;  4OVM A;  2GEY A;  3FSD A;  4GB5 A;  3MG1 A;  3ER7 A;  1JB5 A;  3MSO A;  4HM0 B;  5IEO A;  2RFR A;  1OF5 B;  2HMK B;  2HMN B;  4XM4 A;  5KP3 A;  3SOY A;  3UJM A;  5JPP A;  5AEU B;  1IDP A;  3DZL A;  1Q40 A;  1S5A A;  3MKI A;  4OUQ A;  1SJW A;  3FF2 A;  2Z77 A;  1OGZ A;  3EN8 A;  4HM2 B;  3T8N A;  1U5O A;  3EC9 A;  1Q42 A;  3HK4 A;  5CLK A;  3SED A;  3F7X A;  1O7N B;  3OWU A;  5IG5 A;  4HJL B;  8CHO A;  2QIY A;  2YFL B;  5STD A;  4HM8 B;  3NM2 A;  3B4O A;  3FF0 A;  2RCD A;  4FCM A;  1DMN A;  3EF8 A;  2STD A;  3H3H A;  1JN5 A;  2CKF B;  3CPO A;  2F86 B;  4WYK A;  1OHP A;  5IEP A;  1WQL B;  5FW5 A;  5G2G A;  1E3V A;  3KSP A;  5CF1 A;  1STD A;  3GZB A;  3NUV A;  4HVN A;  3B4P A;  1JB4 A;  3DM8 A;  3JUO A;  4R9L A;  4XBT A;  4LEH A;  2I9W A;  3EQQ B;  1ULI B;  3G16 A;  4R9K A;  3KE7 A;  2XR8 B;  4I4K A;  2W2C A;  1O7G B;  3F40 A;  2GBW B;  2YFJ B;  4HM3 B;  2GEX A;  3GZX B;  5DRE A;  3B7C A;  1OF5 A;  1GY5 A;  4K1V A;  4R1K A;  5IF6 A;  2RGQ A;  1GY7 A;  5D82 A;  1O7W B;  1UUV B;  3K7C A;  4MJD A;  4KVH A;  1AR0 A;  1VZZ A;  3DUK A;  1E3R A;  3WMD A;  5KP4 A;  4J8T A;  3T8U A;  3CNM A;  1ISK A;  2XSO B;  1O7M B;  3DMC A;  3EJV A;  1QMA A;  3LZA A;  3D9R A;  3F7S A;  4HM7 B;  4STD A;  4LMI A;  3ECF A;  2PZV A;  3MG2 A;  4X2H A;  5D81 A;  4U13 A;  1W6Y A;  4CDL A;  5KP1 A;  5JPU A;  3GZR A;  1C7H A;  2GXF A;  2XSH B;  1CQS A;  3KZT A;  3B8L A;  1TP6 A;  3RGA A;  1NU3 A;  4Q53 A;  4HM5 B;  5D83 A;  3JUM A;  4FCJ A;  4WWU C;  2HML B;  4HM6 B;  5HGR A;  4L7K A;  1O7P B;  1OCV A;  3EX9 A;  3Q90 A;  3E99 A;  5AIF A;  3H51 A;  1EA2 A;  5IEN A;  1BUQ A;  3DXO A;  1JKG B;  1OUN A;  3G8Z A;  5CF2 A;  3FKA A;  3F8H A;  4HKV B;  5AII A;  3EBY A;  3LYG A;  3G0K A;  2CHC A;  1GS3 A;  1UUW B;  4L8P A;  1W00 A;  3SOA A;  4L8O A;  5IG0 A;  5AIG A;  3MYT A;  3NXJ A;  2XRX B;  5IG4 A;  1JB2 A;  1ZX2 A;  1ZO2 A;  3NV0 B;  5EVH A;  3EHC A;  3IPT A;  7STD A;  3JUP A;  3MG3 A;  1DMQ A;  3EBT A;  4XB5 A;  3A76 A;  3UNL A;  4WP5 A;  2HMM B;  1OHO A;  3HZP A;  3VSY A;  2BMR B;  1ASK A;  3K0Z A;  3JUQ A;  1GY6 A;  1NDO B;  3HX8 A;  1OGX A; 
#chains in the Genus database with same CATH topology
 1G02 A;  2P0X A;  4O3V A;  4XBY A;  1IT7 A;  2LQV A;  1RGK A;  2E2T A;  3HII A;  2YX9 A;  5CK6 A;  1RSN A;  3AMO B;  3U1W A;  5BVB A;  3I0Y A;  1IK3 A;  2OTJ 3;  4ZM8 A;  4J9A A;  3FGY A;  1Z1S A;  1US1 A;  4XDV A;  3KKG A;  2Z7A A;  3WA2 X;  2QGU A;  3DGL A;  2SBL A;  2OWP A;  1W01 A;  3V99 A;  1BRK A;  1SQW A;  3BLZ A;  3FG3 A;  2SAR A;  4LYL B;  1A2K A;  2F5M A;  2HMO B;  4FR9 A;  3CMA 3;  1O7H B;  4GL6 A;  1RTU A;  3RDE A;  1QJG A;  2P05 A;  1T5Y A;  3M8C A;  3O8Y A;  4BIR A;  1BSE A;  4HZ9 B;  4R80 A;  2JQ5 A;  3F8X A;  4BTY A;  1OPY A;  1W02 A;  2F5W A;  1V57 A;  2OCT A;  5IW9 A;  1YIT 3;  3K63 A;  1VQ9 3;  1PYL A;  1VQQ A;  4N6U A;  1QVF 2;  3NHX A;  3VF1 A;  2F99 A;  3DH2 A;  2BIR A;  4H3U A;  2P09 A;  3A5E A;  4N6T A;  3OWY A;  4ORL A;  1FGO A;  1KQS 2;  1BNJ A;  2R4I A;  2W6J H;  3JUN A;  1Y4K A;  1BSA A;  1JRQ A;  3CU3 A;  2CG1 A;  3BB9 A;  1KD1 4;  1TUH A;  1TFO A;  2P38 A;  3EN1 B;  2Y74 A;  1VQL 3;  2RSX A;  3F14 A;  1AV4 A;  1SIH A;  3GRD A;  1Q40 B;  1LQM B;  2WGQ A;  1JKG A;  3CCU 3;  1YVS A;  1NWW A;  2INX A;  1UI8 A;  1LOV A;  4EC6 A;  4RZM A;  5CXO A;  3I55 3;  2L1S A;  2R41 A;  2BNG A;  3BNE A;  3NM7 A;  2F98 A;  2W0Q A;  2YFI B;  3FZW A;  5AI1 A;  2A15 A;  2K3D A;  3VGN A;  3ZG5 A;  5AIH A;  3N54 B;  4J5K A;  1J2B A;  2IMJ A;  3HOH A;  3PXM A;  4RBN A;  2CX0 A;  1VQO 3;  2B1X B;  2HMJ B;  3SVA A;  1HKX A;  4N3V A;  4IIA A;  5IER A;  3X41 A;  3J7Y d;  4EV2 A;  3BIR A;  1GOY A;  1I0V A;  1PFP A;  1VQK 3;  2AAE A;  5FGO A;  5BXQ A;  4CCV A;  1HYF A;  1BOX A;  4LGQ A;  3S5C A;  3F9S A;  1BSD A;  1DMM A;  3MHE A;  2GBX B;  1FZU A;  3GWR A;  1SPU A;  4FMA A;  1Q81 4;  1K8A 4;  1VQ8 3;  6STD A;  1RGC A;  1RN1 A;  1BRG A;  2WOF A;  3NV0 A;  4XBX A;  3QK9 A;  4ILF A;  4HM4 B;  3RGR A;  1EUI C;  2WOH A;  1LNH A;  3WOD G;  1EKM A;  1B2Z A;  2KAA A;  5M1A A;  1EG9 B;  1BAO A;  1OH0 A;  1W4N A;  3CNX A;  1LNI A;  1W7C A;  4HZB B;  2B24 B;  1YJN 3;  1FW7 A;  1D6Z A;  3OWS A;  1JBR A;  1VQP 3;  4HAA A;  1S72 3;  2BMO B;  3X3X A;  2CX1 A;  2BMQ B;  2JDI H;  5TGN A;  2CFD A;  3ROB A;  4NRE A;  1E97 A;  2K0M A;  1JN5 B;  3D3L A;  3PCS A;  1GYB A;  3GZY B;  3OV4 A;  4WYK B;  4BU4 A;  4EXR A;  5AYS C;  3NBR A;  1JBS A;  1OHS A;  4EW5 A;  1DVC A;  2CFL A;  3FH1 A;  2BO9 B;  1B27 A;  7RNT A;  1I2G A;  2UX0 A;  3KII A;  3OW2 2;  3FLJ A;  1BNE A;  3IMA B;  2OQE A;  1QAF A;  5IG3 A;  4JRF A;  1RRL A;  3U97 A;  5A0O B;  5BU4 A;  3AHS A;  1ULJ B;  1RN7 A;  3LTB A;  4K1U A;  3GSP A;  3X40 A;  2CWT A;  1K41 A;  4GSP A;  1DYU A;  5RNT A;  4X2O A;  2P0M A;  3CCL 3;  2Z76 A;  1JBT A;  1HZ1 A;  1MWS A;  2ZA4 A;  1EEJ A;  4XDW A;  1W6C A;  3AMO A;  1RLS A;  1BRS A;  4TX4 A;  5AEW B;  4DKI A;  1UCI A;  2K54 A;  3OX9 A;  4O2H A;  2RNT A;  3OXA A;  3CCE 3;  1RKY A;  1JZD A;  2CFW A;  2ZL8 A;  4G1M B;  4HM1 B;  4PEJ A;  5DRV A;  3STD A;  2AAD A;  3N9H A;  4IT7 A;  4OVM A;  1YI2 3;  2GEY A;  3FSD A;  2H0I A;  1WMP A;  2OOV A;  1LQG C;  4GB5 A;  3LTC A;  2W9Q A;  2F4Y A;  1RJO A;  3MG1 A;  1LRA A;  1RCK A;  3ER7 A;  1JB5 A;  3MSO A;  1BNS A;  4EV5 A;  1RGA A;  1AVL A;  1Q7H A;  4HM0 B;  3S27 A;  1LVN A;  4CPK A;  5IEO A;  2CH9 A;  2RFR A;  1YGE A;  1ZS7 A;  1I2F A;  2XF3 A;  1OF5 B;  2CWU A;  3V92 A;  1ROV A;  2HMK B;  2HMN B;  4XM4 A;  4EYC A;  3LXU X;  2MF7 A;  1MNL A;  3EE1 A;  2CWV A;  3HI7 A;  5KP3 A;  1V58 A;  3SOY A;  3UJM A;  5JPP A;  1IU7 A;  4KT3 B;  5AEU B;  1IDP A;  1ROA A;  3EB8 A;  3DZL A;  3JVC A;  1Q40 A;  2XFS A;  1GMP A;  1S5A A;  1M90 4;  2IUK A;  2IA7 A;  3MKI A;  1I3I A;  4OUQ A;  1PY3 A;  1STF I;  1SJW A;  5G1L A;  1D6Y A;  3WDG B;  3FF2 A;  3PZW A;  4N6O B;  5LC7 A;  2Z77 A;  1D6U A;  2E2U A;  1OGZ A;  3EN8 A;  1RMS A;  3NQZ A;  4HM2 B;  4OK0 A;  3T8N A;  1U5O A;  3EC9 A;  1G0T A;  2KXG A;  3AGN A;  1FGT A;  3UL5 A;  5EEO A;  1Q42 A;  1B21 A;  1BVI A;  3FG1 A;  1BRH A;  3HK4 A;  3G6E 3;  1YHQ 3;  1N9E A;  5CLK A;  1G96 A;  1UCL A;  4GHO A;  3SED A;  3GAX A;  3F7X A;  1B3S A;  1DE3 A;  1NB3 I;  3PYJ A;  1O7N B;  1W2Z A;  3OWU A;  5IG5 A;  1N5H A;  1IQY A;  2O3O A;  5I97 A;  4HJL B;  4HYZ A;  2ML6 A;  2Q07 A;  3K9M C;  1QVG 2;  8CHO A;  2QIY A;  2BT3 A;  2KRT A;  2YFL B;  5STD A;  3S67 A;  1BNF A;  4LSO A;  3BND A;  3CC2 3;  1FYS A;  1HU9 A;  1ZGX A;  2XFT A;  3CPW 2;  1W6G A;  3DGY A;  4I5Q A;  4HM8 B;  1X1W A;  3NM2 A;  3CCS 3;  4R4K A;  2GU1 A;  2ZDJ A;  2MC8 A;  2CW9 A;  3B4O A;  3CCV 3;  1VQM 3;  3FF0 A;  3LML A;  2L4V A;  1EQK A;  1IT8 A;  1RNB A;  2RCD A;  3SX1 A;  2LYX A;  4FCM A;  4AKZ A;  1DMN A;  3EF8 A;  2STD A;  2WO0 A;  1KSI A;  3H3H A;  3SXX A;  1JN5 A;  1SII A;  2CKF B;  4EBG A;  3CPO A;  1LOX A;  2QA4 3;  1TRP A;  2F86 B;  3ZG0 A;  1DET A;  4WYK A;  1N8Q A;  1OHP A;  4K90 B;  5IEP A;  1WQL B;  2FGT A;  1I8V A;  1B2U A;  5FW5 A;  2O9U X;  1IQ8 A;  5G2G A;  1RGF A;  5AYR B;  4NPB A;  1E3V A;  4WHA A;  1Q9E A;  3KSP A;  2Z6B A;  4LZI A;  1A67 A;  5CF1 A;  2H0H A;  1STD A;  2XGL A;  3GZB A;  3FCS B;  3QRD A;  3NUV A;  2W04 A;  4HVN A;  2J8X B;  3B4P A;  4O8S A;  1JB4 A;  2UUG C;  2W56 B;  1I70 A;  5LC6 A;  1W2B 2;  1BU4 A;  4KFF A;  1KWI A;  3DM8 A;  3JUO A;  3NQY A;  4R9L A;  5G1K A;  1AVK A;  1W5Z A;  1U8C B;  4XBT A;  4LEH A;  3NBB A;  1BGS A;  4KFD A;  2ML5 A;  3WA3 A;  1TRQ A;  2CG0 A;  1T2H A;  2I9W A;  3EQQ B;  1ULI B;  1B2S A;  3D5G A;  3G16 A;  1K73 4;  2CC3 A;  2CK3 H;  4N6V 0;  4R9K A;  3S29 A;  3CCR 3;  3KE7 A;  3D79 A;  3PCR A;  2XR8 B;  4I4K A;  4RNT A;  2W9P A;  2W2C A;  4AEQ A;  3PS8 A;  2FNQ A;  4AKY A;  4MMX B;  1IVU A;  1T2I A;  1GOU A;  1JV2 B;  1O7G B;  3F40 A;  2GBW B;  1C54 A;  3N8B A;  3L0R A;  1AY7 A;  3CXC 2;  8RNT A;  1QAL A;  2YFJ B;  4HM3 B;  2GEX A;  3TDG A;  1MGR A;  3GZX B;  5DRE A;  1NJI 4;  3B7C A;  1FGR A;  1OF5 A;  1OAC A;  1TJD A;  1GY5 A;  4K1V A;  3LOY A;  4R1K A;  5JBS A;  2F56 A;  1VQ6 3;  3K5T A;  5IF6 A;  2RGQ A;  1GY7 A;  2H0G A;  4RNZ A;  5D82 A;  1O7W B;  2V1L A;  3AHW A;  9RNT A;  1BRN L;  1FA3 A;  1UUV B;  4FMD A;  3CCJ 3;  3K7C A;  4H61 A;  2CFK A;  4MJD A;  2OOV C;  3G71 3;  1FGQ A;  1IVW A;  1X1Y A;  1FGM A;  3RNT A;  2XGN A;  1LXE A;  1NB5 I;  4KVH A;  1LOW A;  6RNT A;  1BNG A;  4QWT A;  1AR0 A;  1VZZ A;  3DUK A;  5EQL A;  1E3R A;  2KCD A;  3WMD A;  1UDI I;  4J8T A;  3V98 A;  5KP4 A;  2HOH A;  3CNM A;  3T8U A;  1ISK A;  2XSO B;  3AGO A;  3X42 A;  3WOE B;  1JJ2 2;  1O7M B;  4CJN A;  1K28 A;  3IJE B;  3DMC A;  1Q86 4;  1PU4 A;  3EJV A;  5GSP A;  1QMA A;  3WHO A;  3LZA A;  3WOF B;  1GD3 A;  2GU3 A;  4N6M A;  3G4S 3;  3CC4 3;  1UW1 A;  3D9R A;  3F7S A;  4HM7 B;  1B20 A;  4STD A;  4LMI A;  1UI7 A;  3ECF A;  1UUG B;  5HOH A;  3ZFZ A;  3UB1 A;  1GMQ A;  2PZV A;  1SAR A;  3MG2 A;  4BTW A;  1RGE A;  1IV7 A;  1RHL A;  4MEI A;  4X2H A;  2ZHX B;  5D81 A;  2UGI A;  4N6N B;  1BIR A;  2D42 A;  1W6Y A;  1YGW A;  4U13 A;  2C11 A;  3I56 3;  1WMO A;  4CDL A;  3LT9 A;  1TIJ A;  1MWR A;  3Q1C A;  5KP1 A;  2KF5 A;  3GZR A;  4N6L A;  5JPU A;  1C7H A;  3BU4 A;  1DVD A;  3X3Y A;  1V74 A;  3KCH A;  2GXF A;  1GMR A;  2CFG A;  1CH0 A;  1JNQ A;  1UGH I;  1QAK A;  2XSH B;  1CQS A;  3SYU A;  1FUW A;  3KZT A;  3B8L A;  1TP6 A;  3RGA A;  1NU3 A;  4Q53 A;  1RGL A;  2C4B A;  4HM5 B;  5D83 A;  1N9J A;  3CC7 3;  1YVB I;  3JUM A;  1IVX A;  4FCJ A;  4WWU C;  1YJ9 3;  2HML B;  4HM6 B;  5HGR A;  1M9G A;  4L7K A;  3ALA A;  2KF3 A;  1VQ5 3;  3KFQ C;  2OTL 3;  2BHM A;  1O7P B;  2KF4 A;  4KZ1 A;  1UCK A;  3SLU A;  1OCV A;  2FXT A;  1BNI A;  3EX9 A;  1TTO A;  3BNC A;  3NBJ A;  3T0U A;  1LOY A;  1T3B A;  4BL3 A;  2W56 A;  1K9M 4;  3LH4 A;  3Q90 A;  1RNT A;  3E99 A;  5BIR A;  3LTD A;  1VQ4 3;  4IPB A;  1BRJ A;  3S28 A;  5AIF A;  3H51 A;  1EA2 A;  1UCJ A;  1CYV A;  1KC8 4;  1VQN 3;  2IUJ A;  1RGG A;  5IEN A;  2WGO A;  1BUQ A;  1BSC A;  2KF6 A;  3Q3F A;  2D1W A;  1BNR A;  1TFK A;  1FUT A;  4WFO A;  3DXO A;  1NO3 A;  1GSP A;  2W03 A;  1JKG B;  3CCM 3;  1OUN A;  3BNB A;  4JF8 A;  2GSP A;  3KN4 A;  1B2X A;  1MOL A;  3Q2P A;  1M1K 4;  3G8Z A;  3MPH A;  1CYU A;  1L5G B;  5CF2 A;  2C10 A;  3DGO A;  3FKA A;  3F8H A;  1RCL A;  2Y73 A;  3KSE D;  3EBY A;  4HKV B;  5AII A;  4BTX A;  3CME 3;  1A90 A;  1IYY A;  3LYG A;  3DGN A;  3G0K A;  1A2P A;  1GOV A;  3URP A;  4FMC A;  1N8R 4;  1F8N A;  1BRI A;  2CHC A;  1GS3 A;  1R4Y A;  1UUW B;  1I2E A;  1W00 A;  4L8P A;  4HBR A;  3SOA A;  1RDS A;  4HOH A;  3D5I A;  4L8O A;  5IG0 A;  5AIG A;  3X3Z A;  6GSP A;  1IVV A;  1WTH A;  1RGH A;  3MYT A;  3NXJ A;  3CD6 3;  2XRX B;  2E2V A;  2OQE C;  5IG4 A;  1JB2 A;  1ZX2 A;  3UL6 A;  4FMB A;  1ZO2 A;  1MGW A;  2CIU A;  1BAN A;  3D4A A;  3HIG A;  4BL2 A;  3NV0 B;  4MMY B;  5EVH A;  1VQ7 3;  3EHC A;  3IPT A;  7STD A;  1TU5 A;  1YIJ 3;  1YJW 3;  1R4C A;  3JUP A;  1CEW I;  1JZO A;  1A2V A;  3MG3 A;  3PGB A;  1MWT A;  1M1X B;  4MMZ B;  1GD4 A;  1UGI A;  1DMQ A;  2IY2 A;  3EBT A;  3FG4 A;  4XB5 A;  3A76 A;  5ELJ A;  7GSP A;  4J5G A;  3UNL A;  2PNC A;  3CCQ 3;  2XH9 A;  3DGM A;  1N5P A;  1IV9 A;  3LT8 A;  1X1U A;  1Q82 4;  1WNH A;  1BSB A;  1MWU A;  4WP5 A;  2HMM B;  1OHO A;  2IYJ A;  4K61 A;  3HZP A;  1Q7Y 4;  2BU4 A;  1IQX A;  3DY5 A;  3NX0 A;  3VSY A;  2BMR B;  1NNV A;  2QEX 3;  4O02 B;  1BUJ A;  1ASK A;  3K0Z A;  3MWZ A;  3WR2 A;  3JUQ A;  1GY6 A;  1RN4 A;  1X1X A;  4KFE A;  1WMN A;  1I0X A;  1NDO B;  3LTA A;  1YNV X;  3HX8 A;  4NHF A;  4FCZ A;  1I3F A;  1OGX A;  4RNY A;  1AQZ A;  5ELU A;  2RBI A;  1FUS A;  5M19 A;  2M7O A;  1B2M A;  5M18 A;  1RRH A;  2XEP A; 
#chains in the Genus database with same CATH homology
 2P0X A;  4O3V A;  4XBY A;  1IT7 A;  2LQV A;  2E2T A;  3HII A;  2YX9 A;  5CK6 A;  3AMO B;  3U1W A;  5BVB A;  3I0Y A;  1IK3 A;  2OTJ 3;  4ZM8 A;  4J9A A;  3FGY A;  1Z1S A;  1US1 A;  4XDV A;  3KKG A;  2Z7A A;  3WA2 X;  2QGU A;  3DGL A;  2SBL A;  2OWP A;  1W01 A;  3V99 A;  1SQW A;  3BLZ A;  3FG3 A;  1A2K A;  2HMO B;  4FR9 A;  3CMA 3;  1O7H B;  4GL6 A;  3RDE A;  1QJG A;  2P05 A;  1T5Y A;  3M8C A;  3O8Y A;  4HZ9 B;  4R80 A;  2JQ5 A;  3F8X A;  4BTY A;  1OPY A;  1W02 A;  2OCT A;  1YIT 3;  5IW9 A;  3K63 A;  1VQ9 3;  1QVF 2;  4N6U A;  3NHX A;  3VF1 A;  2F99 A;  4H3U A;  2P09 A;  4N6T A;  3OWY A;  4ORL A;  1FGO A;  1KQS 2;  2W6J H;  2R4I A;  3JUN A;  1Y4K A;  1JRQ A;  3CU3 A;  2CG1 A;  3BB9 A;  1KD1 4;  1TUH A;  1TFO A;  2P38 A;  3EN1 B;  2Y74 A;  1VQL 3;  2RSX A;  3F14 A;  1AV4 A;  1SIH A;  3GRD A;  1Q40 B;  2WGQ A;  1JKG A;  3CCU 3;  1NWW A;  2INX A;  1UI8 A;  4EC6 A;  4RZM A;  5CXO A;  3I55 3;  2BNG A;  3BNE A;  3NM7 A;  2F98 A;  2W0Q A;  2YFI B;  3FZW A;  5AI1 A;  2A15 A;  3VGN A;  5AIH A;  3N54 B;  1J2B A;  2IMJ A;  1VQO 3;  3PXM A;  4RBN A;  2B1X B;  2HMJ B;  3SVA A;  1HKX A;  4N3V A;  4IIA A;  5IER A;  3X41 A;  3J7Y d;  4EV2 A;  1PFP A;  1VQK 3;  5FGO A;  5BXQ A;  4CCV A;  4LGQ A;  3S5C A;  3F9S A;  1DMM A;  3MHE A;  2GBX B;  3GWR A;  1SPU A;  4FMA A;  1Q81 4;  1K8A 4;  1VQ8 3;  6STD A;  2WOF A;  3NV0 A;  4XBX A;  3QK9 A;  4HM4 B;  3RGR A;  2WOH A;  1LNH A;  3WOD G;  1EKM A;  1EG9 B;  1OH0 A;  1YJN 3;  1W4N A;  3CNX A;  1W7C A;  4HZB B;  2B24 B;  1D6Z A;  3OWS A;  1VQP 3;  1S72 3;  2BMO B;  3X3X A;  2JDI H;  2BMQ B;  5TGN A;  2CFD A;  3ROB A;  4NRE A;  1E97 A;  2K0M A;  1JN5 B;  3D3L A;  3PCS A;  1GYB A;  3GZY B;  3OV4 A;  4WYK B;  4EXR A;  5AYS C;  3NBR A;  1OHS A;  1DVC A;  2CFL A;  3FH1 A;  2BO9 B;  2UX0 A;  3KII A;  3OW2 2;  3FLJ A;  2OQE A;  3IMA B;  5IG3 A;  1QAF A;  4JRF A;  1RRL A;  3U97 A;  5A0O B;  1ULJ B;  1RN7 A;  3LTB A;  4K1U A;  3X40 A;  2CWT A;  1K41 A;  1DYU A;  4X2O A;  2P0M A;  3CCL 3;  2Z76 A;  4XDW A;  1W6C A;  3AMO A;  5AEW B;  4TX4 A;  2K54 A;  3OX9 A;  4O2H A;  3OXA A;  3CCE 3;  1RKY A;  2CFW A;  2ZL8 A;  4G1M B;  4HM1 B;  5DRV A;  4PEJ A;  3STD A;  4IT7 A;  3N9H A;  4OVM A;  1YI2 3;  2GEY A;  3FSD A;  1WMP A;  2OOV A;  4GB5 A;  3LTC A;  2W9Q A;  3MG1 A;  1RJO A;  3ER7 A;  1JB5 A;  3MSO A;  4EV5 A;  1AVL A;  4HM0 B;  3S27 A;  1LVN A;  5IEO A;  2CH9 A;  2RFR A;  1YGE A;  2XF3 A;  1OF5 B;  2CWU A;  3V92 A;  1ROV A;  2HMK B;  2HMN B;  4XM4 A;  4EYC A;  3LXU X;  2MF7 A;  1MNL A;  3EE1 A;  2CWV A;  3HI7 A;  5KP3 A;  3SOY A;  3UJM A;  5JPP A;  1IU7 A;  5AEU B;  1IDP A;  1ROA A;  3EB8 A;  3DZL A;  3JVC A;  1Q40 A;  2XFS A;  1S5A A;  1M90 4;  2IUK A;  2IA7 A;  3MKI A;  4OUQ A;  1STF I;  1SJW A;  1D6Y A;  3WDG B;  3FF2 A;  3PZW A;  4N6O B;  5LC7 A;  2Z77 A;  1D6U A;  2E2U A;  1OGZ A;  3EN8 A;  3NQZ A;  4HM2 B;  4OK0 A;  3T8N A;  1U5O A;  3EC9 A;  2KXG A;  1FGT A;  3UL5 A;  5EEO A;  1Q42 A;  3FG1 A;  3HK4 A;  3G6E 3;  1YHQ 3;  1N9E A;  5CLK A;  1G96 A;  3SED A;  3GAX A;  3F7X A;  1NB3 I;  3PYJ A;  1O7N B;  1W2Z A;  3OWU A;  5IG5 A;  1N5H A;  1IQY A;  2O3O A;  5I97 A;  4HJL B;  4HYZ A;  2ML6 A;  2Q07 A;  3K9M C;  1QVG 2;  8CHO A;  2QIY A;  2BT3 A;  2KRT A;  2YFL B;  5STD A;  3S67 A;  4LSO A;  3BND A;  3CC2 3;  1HU9 A;  2XFT A;  3CPW 2;  1W6G A;  4HM8 B;  3NM2 A;  3CCS 3;  4R4K A;  2GU1 A;  2ZDJ A;  2MC8 A;  2CW9 A;  3B4O A;  3CCV 3;  1VQM 3;  3FF0 A;  3LML A;  2L4V A;  1EQK A;  1IT8 A;  2RCD A;  3SX1 A;  2LYX A;  4FCM A;  4AKZ A;  1DMN A;  3EF8 A;  2STD A;  2WO0 A;  1KSI A;  3H3H A;  3SXX A;  1JN5 A;  1SII A;  2CKF B;  4EBG A;  3CPO A;  1LOX A;  2QA4 3;  2F86 B;  4WYK A;  1N8Q A;  1OHP A;  4K90 B;  5IEP A;  1WQL B;  2FGT A;  5FW5 A;  5AYR B;  2O9U X;  1IQ8 A;  5G2G A;  1E3V A;  4WHA A;  4LZI A;  3KSP A;  2Z6B A;  1A67 A;  5CF1 A;  1STD A;  2XGL A;  3GZB A;  3FCS B;  3QRD A;  3NUV A;  2W04 A;  4HVN A;  3B4P A;  4O8S A;  1JB4 A;  2W56 B;  1W2B 2;  5LC6 A;  4KFF A;  1KWI A;  3DM8 A;  3JUO A;  3NQY A;  4R9L A;  1AVK A;  1W5Z A;  1U8C B;  4XBT A;  4LEH A;  3NBB A;  4KFD A;  2ML5 A;  3WA3 A;  2CG0 A;  2I9W A;  3EQQ B;  1ULI B;  1K73 4;  3G16 A;  2CC3 A;  2CK3 H;  4N6V 0;  4R9K A;  3S29 A;  3CCR 3;  3KE7 A;  3PCR A;  2XR8 B;  4I4K A;  2W9P A;  2W2C A;  4AEQ A;  3PS8 A;  2FNQ A;  4AKY A;  4MMX B;  1IVU A;  1JV2 B;  1O7G B;  3F40 A;  2GBW B;  3N8B A;  3L0R A;  3CXC 2;  1QAL A;  2YFJ B;  4HM3 B;  2GEX A;  3TDG A;  3GZX B;  5DRE A;  1NJI 4;  3B7C A;  1FGR A;  1OF5 A;  1OAC A;  1GY5 A;  4K1V A;  3LOY A;  4R1K A;  5JBS A;  1VQ6 3;  3K5T A;  5IF6 A;  2RGQ A;  1GY7 A;  4RNZ A;  5D82 A;  1O7W B;  2V1L A;  1FA3 A;  1UUV B;  4FMD A;  3CCJ 3;  3K7C A;  4H61 A;  2CFK A;  4MJD A;  2OOV C;  3G71 3;  1FGQ A;  1IVW A;  1FGM A;  2XGN A;  1LXE A;  1NB5 I;  4KVH A;  4QWT A;  1AR0 A;  1VZZ A;  3DUK A;  5EQL A;  1E3R A;  2KCD A;  3WMD A;  3V98 A;  4J8T A;  5KP4 A;  3T8U A;  3CNM A;  1ISK A;  2XSO B;  3X42 A;  3WOE B;  1JJ2 2;  1O7M B;  1K28 A;  3IJE B;  3DMC A;  1Q86 4;  1PU4 A;  3EJV A;  1QMA A;  3LZA A;  3WOF B;  1GD3 A;  2GU3 A;  4N6M A;  3G4S 3;  3CC4 3;  1UW1 A;  3D9R A;  3F7S A;  4HM7 B;  4STD A;  4LMI A;  1UI7 A;  3ECF A;  3UB1 A;  2PZV A;  3MG2 A;  4BTW A;  1IV7 A;  4MEI A;  4X2H A;  5D81 A;  4N6N B;  2D42 A;  1W6Y A;  4U13 A;  2C11 A;  3I56 3;  1WMO A;  4CDL A;  3LT9 A;  1TIJ A;  3Q1C A;  5KP1 A;  4N6L A;  3GZR A;  5JPU A;  1C7H A;  3X3Y A;  1V74 A;  2GXF A;  2CFG A;  1JNQ A;  2XSH B;  1FUW A;  1QAK A;  1CQS A;  3KZT A;  3B8L A;  1TP6 A;  3RGA A;  1NU3 A;  4Q53 A;  4HM5 B;  5D83 A;  3CC7 3;  1DVD A;  1N9J A;  1YVB I;  3JUM A;  1IVX A;  4FCJ A;  4WWU C;  1YJ9 3;  2HML B;  4HM6 B;  5HGR A;  1M9G A;  4L7K A;  3ALA A;  1VQ5 3;  3KFQ C;  2OTL 3;  2BHM A;  1O7P B;  4KZ1 A;  3SLU A;  1OCV A;  2FXT A;  3EX9 A;  3BNC A;  3NBJ A;  3T0U A;  2W56 A;  1K9M 4;  3LH4 A;  3Q90 A;  3E99 A;  3LTD A;  1VQ4 3;  4IPB A;  3S28 A;  5AIF A;  3H51 A;  1EA2 A;  1CYV A;  1KC8 4;  1VQN 3;  2IUJ A;  5IEN A;  2WGO A;  1BUQ A;  2D1W A;  1TFK A;  4WFO A;  3DXO A;  1NO3 A;  2W03 A;  1JKG B;  3CCM 3;  1OUN A;  3BNB A;  4JF8 A;  3KN4 A;  1M1K 4;  1MOL A;  3Q2P A;  3G8Z A;  3MPH A;  1CYU A;  1L5G B;  5CF2 A;  2C10 A;  3DGO A;  3FKA A;  3F8H A;  4HKV B;  2Y73 A;  3KSE D;  3EBY A;  5AII A;  4BTX A;  3CME 3;  1A90 A;  3LYG A;  3DGN A;  3G0K A;  4FMC A;  1N8R 4;  1F8N A;  2CHC A;  1GS3 A;  1UUW B;  4L8P A;  1W00 A;  4HBR A;  3SOA A;  4L8O A;  5IG0 A;  5AIG A;  3X3Z A;  1IVV A;  1WTH A;  3MYT A;  3NXJ A;  3CD6 3;  2XRX B;  2E2V A;  2OQE C;  5IG4 A;  1JB2 A;  1ZX2 A;  3UL6 A;  4FMB A;  1ZO2 A;  2CIU A;  3HIG A;  3NV0 B;  4MMY B;  5EVH A;  1VQ7 3;  3EHC A;  3IPT A;  7STD A;  1TU5 A;  1YIJ 3;  1YJW 3;  1R4C A;  3JUP A;  1CEW I;  3MG3 A;  1A2V A;  3PGB A;  1M1X B;  4MMZ B;  1GD4 A;  3FG4 A;  1DMQ A;  3EBT A;  4XB5 A;  3A76 A;  5ELJ A;  3UNL A;  3CCQ 3;  2PNC A;  2XH9 A;  3DGM A;  1N5P A;  1IV9 A;  3LT8 A;  1Q82 4;  1WNH A;  4WP5 A;  2HMM B;  1OHO A;  4K61 A;  3HZP A;  1Q7Y 4;  1IQX A;  3DY5 A;  3NX0 A;  3VSY A;  2BMR B;  2QEX 3;  4O02 B;  1ASK A;  3K0Z A;  3MWZ A;  3JUQ A;  1GY6 A;  4KFE A;  1WMN A;  3LTA A;  1NDO B;  3HX8 A;  4NHF A;  4FCZ A;  1OGX A;  4RNY A;  5ELU A;  2M7O A;  1RRH A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...