3UNMA

Crystal structure of the human mdc1 fha domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
101
Chain Sequence
EPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILKVLSPVSHRLRDQELILFADLLCQYHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Mediator of DNA damage checkpoint protein 1
total genus 24
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3unmA00
1J4QA 4D9VA 4EGXA 3PO8A 4QCJA 1FHRA 2JKDA 2KB3A 1WV3A 2KFUA 2KKLA 3ELSA 5E50A 3UOTA 3I6UA 3VA4A 1LGQA 3VPYA 3UNMA 1K2NA 4H87A 1YJMA 3VA1A 3I6WA 1LGPA 3ELVA 3UMZA 1K3QA 2LC1A 2W3OA 5DJOA 2G1LA 2JPEA 3I0NA 2FF4A 1J4PA 2BRFA 1K3JA 3HUEA 3OUNA 3UV0A 3MDBA 5A8IA 2AFFA 3UNNA 1R21A 1DMZA 1UHTA 2CSWA 2JQJA 3FM8A 1K2MA 2XT9B 1J4KA 1MZKA 1G3GA 1J4LA 1K3NA 1GXCA 4G2SA 2JQLA 2KB4A 1YJ5C 1QU5A 2PIEA 2EH0A 3HUFA 1UJXA 3HX1A 2FEZA 3I0MA 3KT9A 4JONA 3POAA 2JQIA 4A0EA 2A0TA 3UN0A 1G6GA 1J4OA 1WLNA 1FHQA 3GQSA 4EJQA
chains in the Genus database with same CATH superfamily
4D9VA 3V8QA 1FHRA 4HAOA 2KFUA 5E50A 3V7YA 3V8PA 2Q5FA 1G88A 4JIVD 2JGRA 1K3QA 2W3OA 5DJOA 3V7WA 1J4PA 2BRFA 2CSWA 3GMJA 3V8RA 1K2MA 2XT9B 1QWTA 5JEKA 2I2DA 2AN1A 1KHUA 1GXCA 2JQLA 4G2SA 1U7FA 2FEZA 3KT9A 5DHPA 4A0EA 4WRRA 1G6GA 1MZKA 4R9PA 3GQSA 5JELA 1Z0ZA 5DHUA 3PO8A 1Z0SA 2QVLA 4QCJA 2JKDA 2KB3A 1WV3A 4A4YA 3ELSA 2I2CA 2I2BA 1K2NA 3VA1A 5DHSA 3I6WA 1Y3HA 2I1WA 1U7VB 1Y3IA 1U7VA 4L02A 3I0NA 2I29A 2FF4A 1K3JA 3HUEA 3OUNA 3S40A 4DY6A 2AFFA 1DMZA 1UHTA 3PFNA 3VZCA 1J4KA 4JIWD 1MK2A 1J4LA 2I2AA 4WERA 1YJ5C 4JONA 4KU0D 1UJXA 1J2FA 1FHQA 2XXSA 1J4OA 2LC1A 3VZDA 4EGXA 5EJFA 5DHQA 1U0TA 5JERA 1YGSA 5BVIA 3UOTA 3VA4A 3I6UA 3UMZA 2QV7A 1DEVA 1ZOQA 2G1LA 1Z0UA 2I2FA 3DITA 3MDBA 1KHXA 3UNNA 5EJIA 3FM8A 2BONA 1MJSA 5DHTA 3T5PA 1G3GA 5EJGA 1K3NA 5JEOA 2EH0A 3HUFA 3HX1A 3UN0A 3V7UA 1DD1A 1YT5A 5EJHA 3V80A 1J4QA 3V8NA 4EJQA 4V24A 2KKLA 3VPYA 1LGQA 3UNMA 4H87A 1YJMA 1LGPA 2P1RA 3ELVA 5JEJA 1MR1A 2JPEA 5C4VA 3UV0A 5A8IA 1R21A 2JQJA 3A77A 3V8MA 5DHRA 3DSHA 3VZBA 1U0RA 3AFOA 2KB4A 1SUWA 1QU5A 2PIEA 3I0MA 5JEMA 3POAA 2JQIA 1U7FB 2A0TA 1WLNA
chains in the Genus database with same CATH topology
4D9VA 1FHRA 2KFUA 5E50A 1G88A 4JIVD 2JGRA 1K3QA 2W3OA 5DJOA 1J4PA 2BRFA 2CSWA 3GMJA 1K2MA 2XT9B 1QWTA 5JEKA 1KHUA 1GXCA 2JQLA 4G2SA 1U7FA 2FEZA 3KT9A 4A0EA 4WRRA 1G6GA 1MZKA 4R9PA 3GQSA 5JELA 3PO8A 2QVLA 4QCJA 2JKDA 2KB3A 1WV3A 4A4YA 3ELSA 1K2NA 3VA1A 3I6WA 1U7VB 1U7VA 4L02A 3I0NA 2FF4A 1K3JA 3HUEA 3OUNA 3S40A 2AFFA 1DMZA 1UHTA 3VZCA 1J4KA 4JIWD 1MK2A 1J4LA 4WERA 1YJ5C 4JONA 4KU0D 1UJXA 1J2FA 1FHQA 2XXSA 1J4OA 2LC1A 3VZDA 4EGXA 5JERA 1YGSA 5BVIA 3UOTA 3VA4A 3I6UA 3UMZA 2QV7A 1DEVA 1ZOQA 2G1LA 3DITA 3MDBA 1KHXA 3UNNA 3FM8A 2BONA 1MJSA 3T5PA 1G3GA 1K3NA 5JEOA 2EH0A 3HUFA 3HX1A 3UN0A 1DD1A 4EJQA 1J4QA 4V24A 2KKLA 3VPYA 1LGQA 3UNMA 4H87A 1YJMA 1LGPA 2P1RA 3ELVA 5JEJA 1MR1A 2JPEA 5C4VA 3UV0A 5A8IA 1R21A 2JQJA 3A77A 3DSHA 3VZBA 2KB4A 1QU5A 2PIEA 3I0MA 5JEMA 3POAA 2JQIA 1U7FB 2A0TA 1WLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4Q A;  4D9V A;  4EGX A;  3PO8 A;  4QCJ A;  1FHR A;  2JKD A;  2KB3 A;  1WV3 A;  2KFU A;  2KKL A;  3ELS A;  5E50 A;  3UOT A;  3I6U A;  3VA4 A;  1LGQ A;  3VPY A;  3UNM A;  1K2N A;  4H87 A;  1YJM A;  3VA1 A;  3I6W A;  1LGP A;  3ELV A;  3UMZ A;  1K3Q A;  2LC1 A;  2W3O A;  5DJO A;  2G1L A;  2JPE A;  3I0N A;  2FF4 A;  1J4P A;  2BRF A;  1K3J A;  3HUE A;  3OUN A;  3UV0 A;  3MDB A;  5A8I A;  2AFF A;  3UNN A;  1R21 A;  1DMZ A;  1UHT A;  2CSW A;  2JQJ A;  3FM8 A;  1K2M A;  2XT9 B;  1J4K A;  1MZK A;  1G3G A;  1J4L A;  1K3N A;  1GXC A;  4G2S A;  2JQL A;  2KB4 A;  1YJ5 C;  1QU5 A;  2PIE A;  2EH0 A;  3HUF A;  1UJX A;  3HX1 A;  2FEZ A;  3I0M A;  3KT9 A;  4JON A;  3POA A;  2JQI A;  4A0E A;  2A0T A;  3UN0 A;  1G6G A;  1J4O A;  1WLN A;  1FHQ A;  3GQS A;  4EJQ A; 
#chains in the Genus database with same CATH topology
 4D9V A;  3V8Q A;  1FHR A;  4HAO A;  2KFU A;  5E50 A;  3V7Y A;  3V8P A;  2Q5F A;  1G88 A;  4JIV D;  2JGR A;  1K3Q A;  2W3O A;  5DJO A;  3V7W A;  1J4P A;  2BRF A;  2CSW A;  3GMJ A;  3V8R A;  1K2M A;  2XT9 B;  1QWT A;  5JEK A;  2I2D A;  2AN1 A;  1KHU A;  1GXC A;  2JQL A;  4G2S A;  1U7F A;  2FEZ A;  3KT9 A;  5DHP A;  4A0E A;  4WRR A;  1G6G A;  1MZK A;  4R9P A;  3GQS A;  5JEL A;  1Z0Z A;  5DHU A;  3PO8 A;  1Z0S A;  2QVL A;  4QCJ A;  2JKD A;  2KB3 A;  1WV3 A;  4A4Y A;  3ELS A;  2I2C A;  2I2B A;  1K2N A;  3VA1 A;  5DHS A;  3I6W A;  1Y3H A;  2I1W A;  1U7V B;  1Y3I A;  1U7V A;  4L02 A;  3I0N A;  2I29 A;  2FF4 A;  1K3J A;  3HUE A;  3OUN A;  3S40 A;  4DY6 A;  2AFF A;  1DMZ A;  1UHT A;  3PFN A;  3VZC A;  1J4K A;  4JIW D;  1MK2 A;  1J4L A;  2I2A A;  4WER A;  1YJ5 C;  4JON A;  4KU0 D;  1UJX A;  1J2F A;  1FHQ A;  2XXS A;  1J4O A;  2LC1 A;  3VZD A;  4EGX A;  5EJF A;  5DHQ A;  1U0T A;  5JER A;  1YGS A;  5BVI A;  3UOT A;  3VA4 A;  3I6U A;  3UMZ A;  2QV7 A;  1DEV A;  1ZOQ A;  2G1L A;  1Z0U A;  2I2F A;  3DIT A;  3MDB A;  1KHX A;  3UNN A;  5EJI A;  3FM8 A;  2BON A;  1MJS A;  5DHT A;  3T5P A;  1G3G A;  5EJG A;  1K3N A;  5JEO A;  2EH0 A;  3HUF A;  3HX1 A;  3UN0 A;  3V7U A;  1DD1 A;  1YT5 A;  5EJH A;  3V80 A;  1J4Q A;  3V8N A;  4EJQ A;  4V24 A;  2KKL A;  3VPY A;  1LGQ A;  3UNM A;  4H87 A;  1YJM A;  1LGP A;  2P1R A;  3ELV A;  5JEJ A;  1MR1 A;  2JPE A;  5C4V A;  3UV0 A;  5A8I A;  1R21 A;  2JQJ A;  3A77 A;  3V8M A;  5DHR A;  3DSH A;  3VZB A;  1U0R A;  3AFO A;  2KB4 A;  1SUW A;  1QU5 A;  2PIE A;  3I0M A;  5JEM A;  3POA A;  2JQI A;  1U7F B;  2A0T A;  1WLN A; 
#chains in the Genus database with same CATH homology
 4D9V A;  1FHR A;  2KFU A;  5E50 A;  1G88 A;  4JIV D;  2JGR A;  1K3Q A;  2W3O A;  5DJO A;  1J4P A;  2BRF A;  2CSW A;  3GMJ A;  1K2M A;  2XT9 B;  1QWT A;  5JEK A;  1KHU A;  1GXC A;  2JQL A;  4G2S A;  1U7F A;  2FEZ A;  3KT9 A;  4A0E A;  4WRR A;  1G6G A;  1MZK A;  4R9P A;  3GQS A;  5JEL A;  3PO8 A;  2QVL A;  4QCJ A;  2JKD A;  2KB3 A;  1WV3 A;  4A4Y A;  3ELS A;  1K2N A;  3VA1 A;  3I6W A;  1U7V B;  1U7V A;  4L02 A;  3I0N A;  2FF4 A;  1K3J A;  3HUE A;  3OUN A;  3S40 A;  2AFF A;  1DMZ A;  1UHT A;  3VZC A;  1J4K A;  4JIW D;  1MK2 A;  1J4L A;  4WER A;  1YJ5 C;  4JON A;  4KU0 D;  1UJX A;  1J2F A;  1FHQ A;  2XXS A;  1J4O A;  2LC1 A;  3VZD A;  4EGX A;  5JER A;  1YGS A;  5BVI A;  3UOT A;  3VA4 A;  3I6U A;  3UMZ A;  2QV7 A;  1DEV A;  1ZOQ A;  2G1L A;  3DIT A;  3MDB A;  1KHX A;  3UNN A;  3FM8 A;  2BON A;  1MJS A;  3T5P A;  1G3G A;  1K3N A;  5JEO A;  2EH0 A;  3HUF A;  3HX1 A;  3UN0 A;  1DD1 A;  4EJQ A;  1J4Q A;  4V24 A;  2KKL A;  3VPY A;  1LGQ A;  3UNM A;  4H87 A;  1YJM A;  1LGP A;  2P1R A;  3ELV A;  5JEJ A;  1MR1 A;  2JPE A;  5C4V A;  3UV0 A;  5A8I A;  1R21 A;  2JQJ A;  3A77 A;  3DSH A;  3VZB A;  2KB4 A;  1QU5 A;  2PIE A;  3I0M A;  5JEM A;  3POA A;  2JQI A;  1U7F B;  2A0T A;  1WLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...