3UNMA

Crystal structure of the human mdc1 fha domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
101
Chain Sequence
EPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILKVLSPVSHRLRDQELILFADLLCQYHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of DNA damage checkpoint protein 1
publication title Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3unmA00
3HUEA 4H87A 1J4OA 4JONA 1K3JA 1LGPA 5DJOA 3GQSA 3ELSA 4EGXA 3PO8A 1YJ5C 4EJQA 2KB3A 1WLNA 2KKLA 3UMZA 1WV3A 3HUFA 3I6UA 4G2SA 2BRFA 3UV0A 4A0EA 1MZKA 3I0MA 3OUNA 5A8IA 2G1LA 1G6GA 2EH0A 2JQJA 2W3OA 2LC1A 1J4KA 1K2NA 3VA1A 1J4QA 1YJMA 2JQLA 1QU5A 2JQIA 3UN0A 3UOTA 2KFUA 1G3GA 2AFFA 1DMZA 1UHTA 5E50A 3UNMA 3UNNA 1FHRA 2XT9B 3FM8A 1FHQA 1GXCA 3I6WA 1LGQA 3KT9A 3VPYA 3VA4A 2FEZA 3I0NA 1R21A 2A0TA 2KB4A 3HX1A 3MDBA 3POAA 2JPEA 4D9VA 2FF4A 1J4LA 4QCJA 1J4PA 1K3QA 1UJXA 2JKDA 1K2MA 1K3NA 3ELVA 2PIEA 2CSWA
chains in the Genus database with same CATH superfamily
3HUEA 4H87A 1U7VB 1J4OA 4JONA 1U7VA 1K3JA 1U7FA 5DHTA 1LGPA 5DJOA 5DHRA 3GQSA 5DHPA 2QVLA 1J2FA 3ELSA 2I1WA 5EJGA 5JEMA 4EGXA 3PO8A 1YJ5C 5DHUA 4DY6A 2I29A 3VZCA 4EJQA 2KB3A 1Z0ZA 1WLNA 2KKLA 1U0RA 3A77A 3UMZA 1WV3A 3HUFA 3I6UA 4G2SA 2BRFA 1G88A 1KHUA 2I2DA 3UV0A 4A0EA 1MZKA 1U7FB 3S40A 3I0MA 3OUNA 5A8IA 5JEKA 2G1LA 1G6GA 2EH0A 2JQJA 1MR1A 2W3OA 1DEVA 2I2BA 2LC1A 1J4KA 1K2NA 3V7YA 1KHXA 5C4VA 1ZOQA 4A4YA 3VA1A 3T5PA 1Z0SA 3V8PA 1J4QA 1YGSA 1YJMA 2JQLA 4JIWD 4KU0D 1QU5A 5EJHA 4L02A 2JQIA 2XXSA 3UN0A 2KFUA 3UOTA 1Z0UA 3V8QA 3V8MA 5BVIA 3PFNA 3DITA 1G3GA 3V80A 2AFFA 1DMZA 1YT5A 1UHTA 1MJSA 2AN1A 5EJFA 5E50A 3VZDA 2P1RA 3UNMA 3AFOA 3UNNA 5EJIA 3V7UA 1FHRA 2XT9B 3FM8A 5DHSA 1FHQA 4JIVD 3V8NA 4WRRA 1GXCA 3V8RA 1SUWA 3I6WA 1LGQA 4WERA 2QV7A 3KT9A 1MK2A 3GMJA 1QWTA 3VPYA 3VA4A 1Y3HA 2BONA 2FEZA 3VZBA 2I2CA 3I0NA 5JEOA 1R21A 5JELA 2A0TA 4R9PA 2KB4A 3HX1A 3MDBA 3POAA 5JEJA 1Y3IA 2JPEA 4D9VA 1U0TA 1DD1A 5DHQA 2FF4A 3V7WA 5JERA 1J4LA 2JGRA 4QCJA 2I2AA 1J4PA 1K3QA 1UJXA 4V24A 2JKDA 1K2MA 2Q5FA 4HAOA 1K3NA 3ELVA 2PIEA 3DSHA 2CSWA 2I2FA
chains in the Genus database with same CATH topology
3HUEA 4H87A 1U7VB 1J4OA 4JONA 1U7VA 1K3JA 1U7FA 1LGPA 5DJOA 3GQSA 2QVLA 1J2FA 3ELSA 5JEMA 4EGXA 3PO8A 1YJ5C 4EJQA 3VZCA 2KB3A 1WLNA 2KKLA 3A77A 3UMZA 1WV3A 3HUFA 3I6UA 4G2SA 2BRFA 1G88A 1KHUA 3UV0A 4A0EA 1MZKA 1U7FB 3S40A 3I0MA 3OUNA 5A8IA 5JEKA 2G1LA 1G6GA 2EH0A 2JQJA 1MR1A 2W3OA 1DEVA 2LC1A 1J4KA 1K2NA 1KHXA 5C4VA 1ZOQA 4A4YA 3VA1A 3T5PA 1J4QA 1YGSA 1YJMA 2JQLA 4JIWD 4KU0D 1QU5A 4L02A 2XXSA 2JQIA 3UN0A 2KFUA 3UOTA 5BVIA 3DITA 1G3GA 2AFFA 1DMZA 1UHTA 1MJSA 3VZDA 5E50A 2P1RA 3UNMA 3UNNA 1FHRA 2XT9B 3FM8A 1FHQA 4JIVD 4WRRA 1GXCA 3I6WA 1LGQA 4WERA 2QV7A 3KT9A 1MK2A 3GMJA 1QWTA 3VPYA 3VA4A 2BONA 2FEZA 3VZBA 3I0NA 5JEOA 1R21A 5JELA 2A0TA 4R9PA 2KB4A 3HX1A 3MDBA 3POAA 5JEJA 2JPEA 4D9VA 1DD1A 2FF4A 5JERA 1J4LA 2JGRA 4QCJA 1J4PA 1K3QA 1UJXA 4V24A 2JKDA 1K2MA 1K3NA 3ELVA 2PIEA 3DSHA 2CSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUE A;  4H87 A;  1J4O A;  4JON A;  1K3J A;  1LGP A;  5DJO A;  3GQS A;  3ELS A;  4EGX A;  3PO8 A;  1YJ5 C;  4EJQ A;  2KB3 A;  1WLN A;  2KKL A;  3UMZ A;  1WV3 A;  3HUF A;  3I6U A;  4G2S A;  2BRF A;  3UV0 A;  4A0E A;  1MZK A;  3I0M A;  3OUN A;  5A8I A;  2G1L A;  1G6G A;  2EH0 A;  2JQJ A;  2W3O A;  2LC1 A;  1J4K A;  1K2N A;  3VA1 A;  1J4Q A;  1YJM A;  2JQL A;  1QU5 A;  2JQI A;  3UN0 A;  3UOT A;  2KFU A;  1G3G A;  2AFF A;  1DMZ A;  1UHT A;  5E50 A;  3UNM A;  3UNN A;  1FHR A;  2XT9 B;  3FM8 A;  1FHQ A;  1GXC A;  3I6W A;  1LGQ A;  3KT9 A;  3VPY A;  3VA4 A;  2FEZ A;  3I0N A;  1R21 A;  2A0T A;  2KB4 A;  3HX1 A;  3MDB A;  3POA A;  2JPE A;  4D9V A;  2FF4 A;  1J4L A;  4QCJ A;  1J4P A;  1K3Q A;  1UJX A;  2JKD A;  1K2M A;  1K3N A;  3ELV A;  2PIE A;  2CSW A; 
#chains in the Genus database with same CATH topology
 3HUE A;  4H87 A;  1U7V B;  1J4O A;  4JON A;  1U7V A;  1K3J A;  1U7F A;  5DHT A;  1LGP A;  5DJO A;  5DHR A;  3GQS A;  5DHP A;  2QVL A;  1J2F A;  3ELS A;  2I1W A;  5EJG A;  5JEM A;  4EGX A;  3PO8 A;  1YJ5 C;  5DHU A;  4DY6 A;  2I29 A;  3VZC A;  4EJQ A;  2KB3 A;  1Z0Z A;  1WLN A;  2KKL A;  1U0R A;  3A77 A;  3UMZ A;  1WV3 A;  3HUF A;  3I6U A;  4G2S A;  2BRF A;  1G88 A;  1KHU A;  2I2D A;  3UV0 A;  4A0E A;  1MZK A;  1U7F B;  3S40 A;  3I0M A;  3OUN A;  5A8I A;  5JEK A;  2G1L A;  1G6G A;  2EH0 A;  2JQJ A;  1MR1 A;  2W3O A;  1DEV A;  2I2B A;  2LC1 A;  1J4K A;  1K2N A;  3V7Y A;  1KHX A;  5C4V A;  1ZOQ A;  4A4Y A;  3VA1 A;  3T5P A;  1Z0S A;  3V8P A;  1J4Q A;  1YGS A;  1YJM A;  2JQL A;  4JIW D;  4KU0 D;  1QU5 A;  5EJH A;  4L02 A;  2JQI A;  2XXS A;  3UN0 A;  2KFU A;  3UOT A;  1Z0U A;  3V8Q A;  3V8M A;  5BVI A;  3PFN A;  3DIT A;  1G3G A;  3V80 A;  2AFF A;  1DMZ A;  1YT5 A;  1UHT A;  1MJS A;  2AN1 A;  5EJF A;  5E50 A;  3VZD A;  2P1R A;  3UNM A;  3AFO A;  3UNN A;  5EJI A;  3V7U A;  1FHR A;  2XT9 B;  3FM8 A;  5DHS A;  1FHQ A;  4JIV D;  3V8N A;  4WRR A;  1GXC A;  3V8R A;  1SUW A;  3I6W A;  1LGQ A;  4WER A;  2QV7 A;  3KT9 A;  1MK2 A;  3GMJ A;  1QWT A;  3VPY A;  3VA4 A;  1Y3H A;  2BON A;  2FEZ A;  3VZB A;  2I2C A;  3I0N A;  5JEO A;  1R21 A;  5JEL A;  2A0T A;  4R9P A;  2KB4 A;  3HX1 A;  3MDB A;  3POA A;  5JEJ A;  1Y3I A;  2JPE A;  4D9V A;  1U0T A;  1DD1 A;  5DHQ A;  2FF4 A;  3V7W A;  5JER A;  1J4L A;  2JGR A;  4QCJ A;  2I2A A;  1J4P A;  1K3Q A;  1UJX A;  4V24 A;  2JKD A;  1K2M A;  2Q5F A;  4HAO A;  1K3N A;  3ELV A;  2PIE A;  3DSH A;  2CSW A;  2I2F A; 
#chains in the Genus database with same CATH homology
 3HUE A;  4H87 A;  1U7V B;  1J4O A;  4JON A;  1U7V A;  1K3J A;  1U7F A;  1LGP A;  5DJO A;  3GQS A;  2QVL A;  1J2F A;  3ELS A;  5JEM A;  4EGX A;  3PO8 A;  1YJ5 C;  4EJQ A;  3VZC A;  2KB3 A;  1WLN A;  2KKL A;  3A77 A;  3UMZ A;  1WV3 A;  3HUF A;  3I6U A;  4G2S A;  2BRF A;  1G88 A;  1KHU A;  3UV0 A;  4A0E A;  1MZK A;  1U7F B;  3S40 A;  3I0M A;  3OUN A;  5A8I A;  5JEK A;  2G1L A;  1G6G A;  2EH0 A;  2JQJ A;  1MR1 A;  2W3O A;  1DEV A;  2LC1 A;  1J4K A;  1K2N A;  1KHX A;  5C4V A;  1ZOQ A;  4A4Y A;  3VA1 A;  3T5P A;  1J4Q A;  1YGS A;  1YJM A;  2JQL A;  4JIW D;  4KU0 D;  1QU5 A;  4L02 A;  2XXS A;  2JQI A;  3UN0 A;  2KFU A;  3UOT A;  5BVI A;  3DIT A;  1G3G A;  2AFF A;  1DMZ A;  1UHT A;  1MJS A;  3VZD A;  5E50 A;  2P1R A;  3UNM A;  3UNN A;  1FHR A;  2XT9 B;  3FM8 A;  1FHQ A;  4JIV D;  4WRR A;  1GXC A;  3I6W A;  1LGQ A;  4WER A;  2QV7 A;  3KT9 A;  1MK2 A;  3GMJ A;  1QWT A;  3VPY A;  3VA4 A;  2BON A;  2FEZ A;  3VZB A;  3I0N A;  5JEO A;  1R21 A;  5JEL A;  2A0T A;  4R9P A;  2KB4 A;  3HX1 A;  3MDB A;  3POA A;  5JEJ A;  2JPE A;  4D9V A;  1DD1 A;  2FF4 A;  5JER A;  1J4L A;  2JGR A;  4QCJ A;  1J4P A;  1K3Q A;  1UJX A;  4V24 A;  2JKD A;  1K2M A;  1K3N A;  3ELV A;  2PIE A;  3DSH A;  2CSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...