3UNNA

Monomeric structure of the human mdc1 fha domain in complex with an mdc1 phospho-t4 peptide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
SNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Mediator of DNA damage checkpoint protein 1
total genus 22
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3unnA00
3UOTA 1LGQA 3VA4A 1UJXA 2KB3A 2FEZA 1WV3A 2JPEA 2KB4A 2KKLA 4JONA 2BRFA 2CSWA 5DJOA 2JQIA 1J4LA 2XT9B 3POAA 3VPYA 5A8IA 1MZKA 1YJ5C 2W3OA 3I0NA 3UNNA 1K3NA 1YJMA 2JQJA 2JQLA 2PIEA 3MDBA 1FHQA 2AFFA 3I0MA 3I6UA 3KT9A 2A0TA 1DMZA 3ELSA 3FM8A 3UNMA 4A0EA 2EH0A 4QCJA 2LC1A 1LGPA 1K2NA 1FHRA 1K3JA 1J4OA 3VA1A 3HX1A 3UN0A 4D9VA 3PO8A 1R21A 3I6WA 3ELVA 4H87A 3OUNA 2FF4A 2G1LA 1K2MA 1J4PA 4G2SA 1G3GA 1G6GA 1J4KA 1J4QA 2KFUA 3GQSA 1GXCA 3HUEA 3HUFA 3UMZA 3UV0A 1K3QA 1QU5A 5E50A 4EJQA 4EGXA 1UHTA 1WLNA 2JKDA
chains in the Genus database with same CATH superfamily
3UOTA 3DSHA 3VA4A 1UJXA 2FEZA 4KU0D 1U7FA 2KB4A 1U0RA 3POAA 2W3OA 3DITA 1Z0SA 5EJGA 1FHQA 1KHUA 5EJFA 1DMZA 3FM8A 1U0TA 4A0EA 1Y3IA 2LC1A 1FHRA 1K3JA 3I6WA 4H87A 3V8NA 1J4PA 4G2SA 5DHPA 2I1WA 1J4KA 1J4QA 3GQSA 1GXCA 2I2FA 3UMZA 1K3QA 3PFNA 2I2AA 1U7VB 4WRRA 5DHQA 4WERA 4V24A 3VZCA 2KKLA 2I2DA 4D9VA 2XT9B 1J4LA 4A4YA 3UNNA 1K3NA 1MJSA 1Y3HA 2JQJA 2JQLA 1DD1A 1KHXA 3MDBA 3V8RA 4DY6A 3I0MA 3KT9A 3V8PA 2QVLA 3UNMA 1ZOQA 4QCJA 1K2NA 2I2BA 5DHRA 3GMJA 3V8MA 3VA1A 3PO8A 2Q5FA 4HAOA 3OUNA 1DEVA 2FF4A 1K2MA 4JIVD 3HUEA 3S40A 5DHSA 4EJQA 1WLNA 1SUWA 1LGQA 2KB3A 1WV3A 2JPEA 4JONA 4R9PA 2CSWA 2JQIA 3VPYA 3VZDA 1MZKA 1YJ5C 1U7VA 1YJMA 2PIEA 2P1RA 3AFOA 1MR1A 3I6UA 5JEJA 5EJHA 3ELSA 5JEKA 2I29A 1LGPA 3A77A 1J4OA 4L02A 3HX1A 5DHUA 3UN0A 3T5PA 1R21A 3V7WA 2G1LA 1G3GA 2QV7A 5JELA 1QWTA 3HUFA 5EJIA 2XXSA 1YT5A 3V8QA 1YGSA 2EH0A 1UHTA 2JKDA 3V7UA 2BONA 4JIWD 5BVIA 2BRFA 2I2CA 5DJOA 1J2FA 5A8IA 5JERA 2JGRA 3I0NA 3V7YA 2AN1A 2AFFA 5JEMA 2A0TA 1G88A 5DHTA 1Z0ZA 5C4VA 3V80A 3ELVA 3VZBA 1G6GA 1MK2A 1U7FB 2KFUA 5JEOA 3UV0A 1QU5A 5E50A 4EGXA 1Z0UA
chains in the Genus database with same CATH topology
3UOTA 3DSHA 3VA4A 1UJXA 2FEZA 4KU0D 1U7FA 2KB4A 3POAA 2W3OA 3DITA 1FHQA 1KHUA 1DMZA 3FM8A 4A0EA 2LC1A 1FHRA 1K3JA 3I6WA 4H87A 1J4PA 4G2SA 1J4KA 1J4QA 3GQSA 1GXCA 3UMZA 1K3QA 1U7VB 4WRRA 4WERA 4V24A 3VZCA 2KKLA 4D9VA 2XT9B 1J4LA 4A4YA 3UNNA 1K3NA 1MJSA 2JQJA 2JQLA 3MDBA 1DD1A 1KHXA 3I0MA 3KT9A 2QVLA 3UNMA 1ZOQA 4QCJA 1K2NA 3GMJA 3VA1A 3PO8A 3OUNA 1DEVA 2FF4A 1K2MA 4JIVD 3HUEA 3S40A 4EJQA 1WLNA 1LGQA 2KB3A 1WV3A 2JPEA 4JONA 4R9PA 2CSWA 2JQIA 3VPYA 3VZDA 1MZKA 1YJ5C 1U7VA 1YJMA 2PIEA 2P1RA 1MR1A 3I6UA 5JEJA 3ELSA 5JEKA 1LGPA 3A77A 1J4OA 4L02A 3HX1A 3UN0A 3T5PA 1R21A 2G1LA 1G3GA 2QV7A 5JELA 1QWTA 3HUFA 2XXSA 1YGSA 2EH0A 1UHTA 2JKDA 2BONA 4JIWD 5BVIA 2BRFA 5JERA 5DJOA 1J2FA 5A8IA 2JGRA 3I0NA 2AFFA 5JEMA 2A0TA 1G88A 5C4VA 3ELVA 3VZBA 1G6GA 1MK2A 1U7FB 2KFUA 5JEOA 3UV0A 1QU5A 5E50A 4EGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOT A;  1LGQ A;  3VA4 A;  1UJX A;  2KB3 A;  2FEZ A;  1WV3 A;  2JPE A;  2KB4 A;  2KKL A;  4JON A;  2BRF A;  2CSW A;  5DJO A;  2JQI A;  1J4L A;  2XT9 B;  3POA A;  3VPY A;  5A8I A;  1MZK A;  1YJ5 C;  2W3O A;  3I0N A;  3UNN A;  1K3N A;  1YJM A;  2JQJ A;  2JQL A;  2PIE A;  3MDB A;  1FHQ A;  2AFF A;  3I0M A;  3I6U A;  3KT9 A;  2A0T A;  1DMZ A;  3ELS A;  3FM8 A;  3UNM A;  4A0E A;  2EH0 A;  4QCJ A;  2LC1 A;  1LGP A;  1K2N A;  1FHR A;  1K3J A;  1J4O A;  3VA1 A;  3HX1 A;  3UN0 A;  4D9V A;  3PO8 A;  1R21 A;  3I6W A;  3ELV A;  4H87 A;  3OUN A;  2FF4 A;  2G1L A;  1K2M A;  1J4P A;  4G2S A;  1G3G A;  1G6G A;  1J4K A;  1J4Q A;  2KFU A;  3GQS A;  1GXC A;  3HUE A;  3HUF A;  3UMZ A;  3UV0 A;  1K3Q A;  1QU5 A;  5E50 A;  4EJQ A;  4EGX A;  1UHT A;  1WLN A;  2JKD A; 
#chains in the Genus database with same CATH topology
 3UOT A;  3DSH A;  3VA4 A;  1UJX A;  2FEZ A;  4KU0 D;  1U7F A;  2KB4 A;  1U0R A;  3POA A;  2W3O A;  3DIT A;  1Z0S A;  5EJG A;  1FHQ A;  1KHU A;  5EJF A;  1DMZ A;  3FM8 A;  1U0T A;  4A0E A;  1Y3I A;  2LC1 A;  1FHR A;  1K3J A;  3I6W A;  4H87 A;  3V8N A;  1J4P A;  4G2S A;  5DHP A;  2I1W A;  1J4K A;  1J4Q A;  3GQS A;  1GXC A;  2I2F A;  3UMZ A;  1K3Q A;  3PFN A;  2I2A A;  1U7V B;  4WRR A;  5DHQ A;  4WER A;  4V24 A;  3VZC A;  2KKL A;  2I2D A;  4D9V A;  2XT9 B;  1J4L A;  4A4Y A;  3UNN A;  1K3N A;  1MJS A;  1Y3H A;  2JQJ A;  2JQL A;  1DD1 A;  1KHX A;  3MDB A;  3V8R A;  4DY6 A;  3I0M A;  3KT9 A;  3V8P A;  2QVL A;  3UNM A;  1ZOQ A;  4QCJ A;  1K2N A;  2I2B A;  5DHR A;  3GMJ A;  3V8M A;  3VA1 A;  3PO8 A;  2Q5F A;  4HAO A;  3OUN A;  1DEV A;  2FF4 A;  1K2M A;  4JIV D;  3HUE A;  3S40 A;  5DHS A;  4EJQ A;  1WLN A;  1SUW A;  1LGQ A;  2KB3 A;  1WV3 A;  2JPE A;  4JON A;  4R9P A;  2CSW A;  2JQI A;  3VPY A;  3VZD A;  1MZK A;  1YJ5 C;  1U7V A;  1YJM A;  2PIE A;  2P1R A;  3AFO A;  1MR1 A;  3I6U A;  5JEJ A;  5EJH A;  3ELS A;  5JEK A;  2I29 A;  1LGP A;  3A77 A;  1J4O A;  4L02 A;  3HX1 A;  5DHU A;  3UN0 A;  3T5P A;  1R21 A;  3V7W A;  2G1L A;  1G3G A;  2QV7 A;  5JEL A;  1QWT A;  3HUF A;  5EJI A;  2XXS A;  1YT5 A;  3V8Q A;  1YGS A;  2EH0 A;  1UHT A;  2JKD A;  3V7U A;  2BON A;  4JIW D;  5BVI A;  2BRF A;  2I2C A;  5DJO A;  1J2F A;  5A8I A;  5JER A;  2JGR A;  3I0N A;  3V7Y A;  2AN1 A;  2AFF A;  5JEM A;  2A0T A;  1G88 A;  5DHT A;  1Z0Z A;  5C4V A;  3V80 A;  3ELV A;  3VZB A;  1G6G A;  1MK2 A;  1U7F B;  2KFU A;  5JEO A;  3UV0 A;  1QU5 A;  5E50 A;  4EGX A;  1Z0U A; 
#chains in the Genus database with same CATH homology
 3UOT A;  3DSH A;  3VA4 A;  1UJX A;  2FEZ A;  4KU0 D;  1U7F A;  2KB4 A;  3POA A;  2W3O A;  3DIT A;  1FHQ A;  1KHU A;  1DMZ A;  3FM8 A;  4A0E A;  2LC1 A;  1FHR A;  1K3J A;  3I6W A;  4H87 A;  1J4P A;  4G2S A;  1J4K A;  1J4Q A;  3GQS A;  1GXC A;  3UMZ A;  1K3Q A;  1U7V B;  4WRR A;  4WER A;  4V24 A;  3VZC A;  2KKL A;  4D9V A;  2XT9 B;  1J4L A;  4A4Y A;  3UNN A;  1K3N A;  1MJS A;  2JQJ A;  2JQL A;  3MDB A;  1DD1 A;  1KHX A;  3I0M A;  3KT9 A;  2QVL A;  3UNM A;  1ZOQ A;  4QCJ A;  1K2N A;  3GMJ A;  3VA1 A;  3PO8 A;  3OUN A;  1DEV A;  2FF4 A;  1K2M A;  4JIV D;  3HUE A;  3S40 A;  4EJQ A;  1WLN A;  1LGQ A;  2KB3 A;  1WV3 A;  2JPE A;  4JON A;  4R9P A;  2CSW A;  2JQI A;  3VPY A;  3VZD A;  1MZK A;  1YJ5 C;  1U7V A;  1YJM A;  2PIE A;  2P1R A;  1MR1 A;  3I6U A;  5JEJ A;  3ELS A;  5JEK A;  1LGP A;  3A77 A;  1J4O A;  4L02 A;  3HX1 A;  3UN0 A;  3T5P A;  1R21 A;  2G1L A;  1G3G A;  2QV7 A;  5JEL A;  1QWT A;  3HUF A;  2XXS A;  1YGS A;  2EH0 A;  1UHT A;  2JKD A;  2BON A;  4JIW D;  5BVI A;  2BRF A;  5JER A;  5DJO A;  1J2F A;  5A8I A;  2JGR A;  3I0N A;  2AFF A;  5JEM A;  2A0T A;  1G88 A;  5C4V A;  3ELV A;  3VZB A;  1G6G A;  1MK2 A;  1U7F B;  2KFU A;  5JEO A;  3UV0 A;  1QU5 A;  5E50 A;  4EGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...