3UNXA

Bond length analysis of asp, glu and his residues in subtilisin carlsberg at 1.26a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protonation-state determination in proteins using high-resolution X-ray crystallography: effects of resolution and completeness.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Subtilisin Carlsberg
total genus 86
structure length 274
sequence length 274
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3unxA00
2ZRQA 1SELA 3D43A 1PFGA 1PTKA 2ZWOA 3UNXA 4Z2AA 1TECE 3DDZX 1CSEE 1Y3BE 2Z30A 3DVRX 3I30X 3VYVA 4BWGA 1GA4A 1KE1A 1OYOA 3OSZA 5CW1A 1P8JA 1OYVA 1GTJ1 1ST3A 1AV7A 3BX1A 4LVOA 1BFKA 4AKTA 1OT5A 1BFUA 3LPDA 2PMWB 2G4VA 5K7SA 2PWAA 3DVSX 5ARCA 1SUAA 2PRKA 1SPBS 2WV7A 2Z57A 3DE4X 1ZVJA 1SIUA 1SBNE 3DW3X 1TM5E 1SUCA 3F7OA 3SICE 2HD4A 3TI7A 3Q40A 3ZXXA 1GTG1 3VTAA 2W2QA 1GT91 1ZVKA 1C9JA 2XRMA 3I34X 1KDZA 3TECE 3VV3A 2WUWE 3WIVA 2W2MA 1HT3A 3LXUX 1LW6E 5B1EA 3EE6A 1WMEA 1Y3DE 2DP4E 5AMXA 1R0RE 4AKSA 3A3OA 1Y9ZA 1BE8A 1WVMA 2PYZA 4NMXB 3GT3A 4DJ5X 3VSBA 2PKCA 1MEEA 1P7VA 2DUJA 2IXTA 4ZARA 3DE6X 1KDVA 1Y4AE 1BE6A 1GA6A 1T1GA 2PQ2A 2X8JA 4CFZA 4CG0A 2WWTA 1V5IA 1YJCA 5ARBA 1GCIA 4JP8A 4DWWA 3PTLA 1TM1E 1XF1A 2QTWB 1YJAA 2Z58A 4NE7A 1T1IA 4B5LA 1GA1A 3I2YX 2GKOA 5JXGA 1R6VA 1NDUA 2ID4A 3H42B 4MZDA 2W2PA 3P5BA 1NDQA 4J94A 5JXIA 3PRKE 3VHQA 4C3VA 1SCJA 4OV6B 1TMGE 2B6NA 4LVNA 3VV2A 1Y3FE 2SNIE 3CO0S 3A3PA 1Y1KE 1Q5PA 5ARDA 4OMDA 5JXJA 4KPGA 3DE0X 4DZTA 1SIBE 1SUEA 4FONA 2E1PA 3QMPA 3HJRA 1GNVA 1SBTA 3DW1X 1SCAA 1GNSA 4GI3A 3LPAA 1SBHA 4M1ZA 4WOCA 1KDYA 4CFYA 1AH2A 1DBIA 1R64A 1SUDA 1WMDA 2Z2YA 1Y33E 3DE2X 3ZXYA 1CNMA 1TM4E 1SH7A 4K8RB 1SUBA 1UBNA 5AVKA 3T41A 3I37X 1ST2A 3L1KA 1JEAA 1YU6A 3GCWA 4RYDA 5JXHA 1EGQA 3CNQS 3AJ9A 3AJ8A 1PJ8A 3BGOS 3BPSA 3A3NA 4WOBA 5FFNA 3WIUA 1Y48E 3DYBA 1V6CA 1AQNA 3QTLA 1IAVA 1TK2A 3DE1X 3WHIA 3EIFA 5I9SA 4ZOQI 1SCBA 2W2NA 1GTL1 1EA7A 2HPZA 1SBIA 2ST1A 3AFGA 3F7MA 4H6VA 2WUVA 2Z2XA 1Y3CE 2X8JB 1SVNA 2ZWPA 3GT4A 1Y4DE 2SICE 1A2QA 2Z2ZA 4I0WB 1SN7A 1SBCA 2DQKA 2SECE 1T1EA 2TECE 4HX2A 4C3UA 1P7WA 1S02A 1SIOA 1NLUA 3GCXA 1DUIA 1WSDA 3SQOA 1PEKE 4KB5A 3DVQX 1AK9A 1SUPA 5FAXA 1TO2E 1AU9A 4YN3A 2V8BA 5B1DA 4OMCA 1C3LA 1TO1E 1C9MA 2Z56A 1AF4A 1SCDA 2SBTA 4H6WA 1BH6A 4NE9A 5AQEA 1Y34E 3TI9A 4HVLA 1BJRE 2IY9A 3DE7X 5JMOA 3QFHA 1IC6A 1SCNE 3EDYA 4H6XA 3LPCA 5AVJA 5FBZA 3Q5GA 3F49S 3D9QX 1S2NA 1MPTA 1S01A 1VSBA 3DE3X 3DWEX 1C9NA 1THMA 2W2OA 2XTJA 1KE2A 1AVTA 1TM7E 1TM3E 5SICE 1WMFA 2ID8A 2P4EA 4KG7A 2PWBA 3WQBA 1YJBA 3DE5X
chains in the Genus database with same CATH superfamily
1VDMA 3N39C 3S29A 3D8HA 4Z2AA 2EFYA 1NFRA 3LY8A 2XTZA 3KB1A 1JQBA 1Z5OA 4L75A 1JN0A 4RA9B 2VHQA 3EQZA 1OXMA 3G0GA 3IPLA 3QWAA 4LSZA 1EBFA 4WLUA 4R8RA 4L4UA 3ZGXA 4DQKA 4IHJF 4QAQA 3K6RA 4IIUA 5CDYA 5ECWA 1CQXA 4BNXA 1PNTA 3ZLUA 1UBHS 3KKOA 4HZUA 3TMKA 1G21B 2CK3A 2BFWA 3GUVA 4C4YA 4EJSC 4CQLA 2XQFA 3OJLA 1C4KA 3S1AA 1PJ3A 1B1AA 1LBHA 2VWHA 3AFNA 3EXAA 4H08A 4DM4A 1YC2A 4E1BA 4BVEA 3C1AA 4UOEA 1GADO 2ZRNA 4E70A 4OJKA 5C7IO 2IS2A 1WR8A 1XCLA 4FYPA 1IZZA 3O21A 1RWOA 5IKPA 5K8TA 3W9BA 1U7UA 2HHLA 4RH0A 4C03A 3RYIA 4KI7A 1LY1A 4BJ3A 2C2ZA 2ZAOA 3FOFC 3VC7A 1NVEA 1EM8A 1H65A 1X80B 4AECA 3AUFA 2ZIAA 1NJ5A 2PX5A 3A1WA 2C1EA 4PANA 2NUBA 4Z4IA 4EF6A 4R6WA 1BMQA 1GAWA 4DFDA 2A5GA 1LK0A 4U8HA 3TKAA 4B45A 3FBGA 4AY5A 2D2EA 3JQPA 3D3WA 4WXRA 1MKYA 5HOEA 3ZV7A 4MQEA 2RCYA 3DZJA 3VJRA 3IQHX 1WTCA 3G6WA 1GTMA 1YF3A 5IZCC 2W98A 4P4SB 2W2XA 1G5QA 3VH2A 3ZZ1A 4MB0A 2ATXA 4Q1AA 2BCJQ 2CYBA 5ALPA 5EE0A 4XUCA 4F60A 1LSUA 1Y6JA 4XVRA 1P9NA 1SHZA 2QLFA 3ZQ4A 4YJ3B 2QMYA 5CA1B 3PLAE 2OFPA 4L3OA 4J43A 4TM7A 1DKPA 4TGLA 3AF3A 3E2MA 4MPTA 1K86A 3GH3A 3BSSA 4K9DA 4WLNA 5FWYB 3OTQA 1YFZA 1Z6XA 5H3CA 2R4QA 1UIRA 3W3AA 2PZMA 4L9RA 3K16A 1U7XA 2HUNA 2ABWA 5FTJA 1HTWA 2BFDB 1AY0A 3S6JA 3HV2A 5DBEX 4M0CA 5FWYA 3DWIA 3CRNA 5B58T 2VA8A 3X2EA 3MD9A 2X0JA 3SZLA 4X1KA 3PFCA 2Z4RA 3ESCA 2PO5A 4RKYA 5BNTA 1ICIA 4P5PA 3TQHA 2AOTA 2XI4A 3FLBA 5B2EA 4REOA 1J22A 2HMYB 1MO2A 5JG7A 3O2JA 5DOVA 4QASA 3P19A 5JYBA 1BS2A 2FF5A 1OXSC 2BBOA 2DERA 3OE7A 1EUDA 2DUWA 3NVMB 3GCXA 1Q7CA 3V46A 4GKAA 5ES3A 2Y67A 4B0OA 1ZN7A 2BSQA 1JFRA 1OX5A 3I1FA 1QDUA 1WW3A 2B2CA 1L5YA 1C9MA 4QLAA 5EKDA 2IF0A 1D09A 3CMCO 4EW6A 1N2OA 5K20A 2VP6A 1WETA 2BI8A 2ZJ1A 5JSHA 1QLHA 1N5DA 1Y6RA 2P2NA 4MUXA 2V4UA 2I3ZA 4DLKA 2CLCX 4NDAA 4ZCRA 5HKOA 4PG8A 4CCWA 3DWEX 2Q07A 1TCBA 1Z5GA 1J8YF 1GU1A 2J4FA 1DIBA 1X1QA 1ONNA 4U8GA 3BCHA 3GZNB 3EH1A 3UMVA 4LF5B 4WV3A 1CB7A 1CNFA 1Z26A 1Q74A 1QPGA 1NJFA 2AH5A 2H1RA 1ZWLA 2R6FA 4IY1A 4RVSA 4D0NA 4FGZA 5E7JA 3CVYA 4EA6A 2X15A 1EKXA 4IIEA 4FKZA 4CG3A 4H2DA 4NFSA 3TEMA 1DARA 5KQSA 1NM5C 4G85A 3TEFA 1DMRA 4D9HA 5AICA 1QG6A 1TIKA 2R1TA 4Z1MD 4G86A 1XFDA 4IKOA 2O8NA 3COZA 4M1WA 4GM0A 4QUAA 2H06A 1UJ5A 5L3QB 1AKMA 4GE0A 3TM5A 3AUKA 2WP0A 2PNJA 1GQQA 1CCWA 1I14A 2HDHA 1LI5A 3K09C 4FMCB 4O59O 3WNCA 5ICMA 2H1WA 2Z1DA 2WSLA 2XBLA 1S4QA 3ILYA 1ORRA 1FFCA 1DAOA 1JSRA 1YOBA 4EQ6A 5HX7A 2FK8A 3OKPA 3GWZA 5HKKA 4PGAA 3VNUA 1K3TA 3FH0A 5CMLA 1XTVA 1V8PA 3EXHA 1FQJA 5AW6A 5K0EA 2RI1A 3IAM6 2IDJA 3NDIA 2X5OA 3GJ6A 4R1TA 3WP1B 3AGQA 4IDGA 4OHFA 5B1HA 3H5NA 4W1QA 1AA9A 3KPJA 1KFCB 3HZOA 2XNCA 4KNWA 2Q3LA 4MARA 4X60A 3DUFB 1EE1A 2GAFA 3EOZA 2QM7A 2BSXA 4MWOA 3WB1A 3CGGA 3FCEA 1Z7BA 1GKKA 3P9NA 3D5QA 3WBKA 1QKJA 1R3UA 5B3JC 4MZDA 5ALDA 1XWIA 1K97A 2FR8C 2FEWB 3O75A 2N75A 4WXPA 3CZQA 3ZHUA 5L7WA 5IC5A 3LUPA 4G5FA 2E6UX 1JHMA 4HAOA 4WFKA 4YECA 3HXMA 1BMFD 1Z2EA 3BEDA 1QNFA 4OMDA 4ZKDA 1ISFA 3CV3A 3LFTA 4RAQA 2ENWA 2QUBA 1Y1RA 2B21A 3MGBA 4JBLA 4PC2A 4WERA 5FNZA 3RUIA 4R9VA 1D2HA 4IJVA 4OCZA 3UC9A 4MGYR 4X7PA 2QK4A 2IQIA 1GT6A 4F96A 2YH2A 5KTSA 1Q0ZA 3ULKA 1RWBA 2AHOA 4OJTA 4XJSA 3RTBA 3A9SA 1EMDA 3BBLA 1FU4A 1R9GA 2FHPA 3DYVA 3UA3A 1IBKB 1WUJS 1XU7A 4OU5A 4BO7A 4NABA 3GPCA 2IEAA 2WUDA 3OT1B 2Q0XA 1QFYA 5CX4A 2JLWA 3E2IA 3FMPB 2XUKA 1NQ5A 2Q4RA 4PNPA 2I5PO 4F8YA 1LWOA 3FZYA 3HG7A 4PSUA 2YJ4A 2C7VA 3O84A 4C4OA 4CLHA 4D6YA 4DC1A 3D8SA 3HABA 3BJMA 3SX4A 1E96A 2VH2A 4B6OA 1O0SA 3GU3A 4RH3A 2UZ1A 4DCGA 3E0XA 4C14A 1CHDA 2V54A 3PUIA 2WMOB 3BTUA 5AJZA 1W59A 3ANSA 4LXQA 4Q3OA 3KO8A 2ZITA 4HR7A 3VTFA 1RPTA 3SDBA 2SBTA 3D3EA 1Z83A 4M8NE 5JTTA 5FT9A 2HU2A 4MA4A 3R8XA 3DMHA 3RS2A 1RLIA 2QYSA 2UYCA 1JGTA 4DUPA 4EB6A 3S81A 2JCSA 1PQ4A 4LYJA 4DC9A 2Y1OA 1RXUA 3NUGA 1RYFA 4GRAA 4INPA 1T2FA 1RIFA 2GZDA 4PCUA 1E2GA 2DKNA 3VDNB 2WYUA 1KRWA 1NI4A 1S89A 4ZU3A 2ZT5A 2YIVX 4RELA 2CBGA 4REQB 2Y05A 1U9YA 3I1IA 3KQSA 4R2KA 5FOSA 1JHRA 5TJ9A 2Y0CA 4IMJB 3ND8A 4RF5A 1HNNA 4LF8B 3MD0A 4OJQA 2NSYA 2Q5LA 1KU0A 1FRQA 1XVVA 3OJCA 4ISCA 4QXQA 5JSYA 1N8TA 4KLAA 5EINA 1W4ZA 2IVFA 4I5IA 4FE3A 3AL0C 1N6RA 5E4FA 1KSJA 4GDFA 1EAMA 3RG2A 1VKRA 1LBQA 4QQRA 2C5BA 1EUDB 3WIBA 2JPDA 4QJ3A 2Q1TA 5C34B 5LIPA 4KRFA 3H3XA 3D59A 1PIWA 4Q05A 4QU9A 1RZRA 1GR1A 3QE2A 4GBGA 4BZWA 1GPLA 4UZEA 1U0BB 1ACJA 2YQ4A 3F90A 4RSMA 2VYCA 4KXFB 4QHSA 4EVSA 3REGA 2BFEB 3G0OA 4UUAA 1NXSA 6GPBA 1TU3A 4UTRA 2XMCA 2VHCA 3GN1A 4FOLA 2OORA 2V3WA 2HA0A 3BIOA 1CUWA 1VE5A 2PUEA 3VAAA 3ORFA 4J3JA 4O4HA 1A98A 2OCGA 1B8OA 4BBPA 2JFPA 1IBMB 4P3KA 2AEEA 4IKEA 3ZY6A 2H1IA 1IONA 4J0GA 5IM4F 4CQMB 4LOIA 5DXJA 4TLDA 1XVTA 3SYTA 3UCXA 1ONBA 3K0EA 5FUMA 1VCIA 1P72A 3H2HA 4W63A 3ZWOA 1WPXA 2G83A 1GNSA 4YREA 1THTA 4U1RA 4TXMA 1O6ZA 3LVBA 1CUDA 3REOA 4Z1OA 1SD1A 3ZK7A 1UBKS 3FSRA 3HYLA 2YJZA 3MMXA 3G85A 2QORA 2G1AA 4JCCA 4HFNA 3RU2A 3L06A 3PPWA 3UENA 3V4SA 3A1CA 3P9SA 2GEUA 2VJOA 3BXHA 2WVAA 4K3UA 2XVAA 4Y7DA 1UZAA 2GBPA 1WZNA 4HNAA 4IQFA 1Q6YA 4ER5A 4F4UA 1L6IA 5DN6A 4EAQA 4XX0B 3H05A 4ZO9A 4C1NA 3QU9A 1L2TA 3HBJA 2XSZD 1V3QE 3DZ8A 3WYAA 3CG0A 4B9EA 4BNDB 4C07A 3OQHA 5LQNA 1M10A 4PYJA 5HA5A 2FMTA 1G9SA 1AMOA 4A5OA 3O1JC 3CWZA 5GV7A 4NS4A 3EQ2A 3KXLA 4U6QA 1GPDG 4FBGA 1N2ZA 1EH5A 4EYQA 1TO2E 2ERYA 4EB6B 2Y66A 3GL9A 4ODIA 3TRDA 4W9MC 3KZMA 2NWQA 3O4GA 2GDJA 2F90A 4I14A 3D8UA 1F8GA 1FYWA 4P4UA 4RZ3A 2B8TA 2CXPA 1K3UB 3UATA 4W7SA 4QYWA 2WY2D 1BH2A 3MYRA 2G77B 2WYIA 5AW9A 3RV3A 3F4LA 1MPTA 2R8PA 2X8LA 2YOFA 3TOSA 5I7HA 1OB2A 2X22A 4XDYA 1QIFA 1SCQA 2CMDA 2P6NA 1KJQA 3CRMA 1O97D 3EZ2A 3FSGD 3HB5X 3WC4A 2GLXA 2A94A 1TUBA 1S3IA 2QSUA 1AQ6A 3WYNA 2N0SA 4D80A 4XQGA 1W0JD 2WKSA 1WP9A 4Z9BA 3WB9A 3TG8A 3GRCA 4Q4HB 4G81A 2H7YA 3LK7A 1RLJA 2BEVB 2WTAA 1C0LA 1OYWA 5KTPA 2PHZA 4GPBA 1SUAA 2ZJ0A 3F7OA 1ODKA 1CR4A 3V9PA 3AY3A 3QE3A 1W88B 4UHBA 5AJWA 1SZDA 2JVJA 3UHJA 5JW6A 5KYTA 4J07A 1PZMA 3ZDXB 1E5TA 4DMHA 2F8SA 2VYQA 4YO7A 2FE1A 2JH9A 5BWOA 5ICEA 5KC9A 4UEQA 2IEGA 4C7XA 2YCBA 3MJSA 2PXCA 2GHIA 3OJEA 5F9HA 2ZSHA 4DYVA 5B6JA 5AOAA 3OTHA 3AR8A 4NVRA 2IV2X 2JGFA 1C5KA 1X7YB 1VJRA 2B3TA 2K7ZA 4TLCA 1LLUA 3RWOA 1NW6A 5K4AA 1QFZA 4L76A 1G3QA 3I8OA 4KZPA 4YY3B 1VG0B 1P4GA 1QNLA 3DLCA 2R7AA 1X1BA 5EIWA 3O4VA 3ZX5A 5BMVB 4ZXFA 3ED5A 2CDBA 1SVMA 3GO4A 3L1JA 4BNTA 4QATA 1ZN2A 4BJ5A 2DGDA 1DEHA 4LGYA 5EJ4A 3MVEA 1PJQA 1VE3A 5GTDA 2C0CA 2B94A 1WU7A 3Q1LA 4G56A 4X8MA 3ZGYA 4AQ7A 4B3SB 5H7XA 2H1SA 4PXSA 4D9EA 1NQWA 3KQUA 2VPXA 3I23A 4MW1A 3UT0A 2PRJA 4WFQA 4ACBA 1RYDA 4WOPA 2GARA 1FMCA 2E82A 1OI4A 1OWMA 3DEHA 3L1VA 4OYRA 4BTEA 5F7ZA 3FUUA 2AOVA 4H3HB 1R9JA 3BGWA 2P68A 4FONA 3JQAD 2GN0A 3I05A 1A77A 4WXHA 2BBSA 1Q77A 3W78A 2XQKA 4OXKA 3NYRA 2JEYA 2F3TA 2IFTA 1SA0A 3HR8A 3TQFA 4C3ZA 4DV0B 1N9GB 3AHEA 3EA5A 3HB0A 1SC9A 3MF4A 2JD0A 4AWAA 2HM7A 1P0QA 1WU8A 1KH1A 5LBIA 4LBZA 4AZ3B 5JXHA 4E5SA 5KTNA 1G3MA 1BSVA 1L8LA 4PAOA 2JGDB 3TPFA 4BLVA 2YJTD 1Z5WA 4MKXA 2XA1A 1XWWA 1F7UA 3RC9A 3UWDA 3A6EA 2D5IA 2XSZA 2Z4SA 1OD6A 4MS4B 2ZI7A 2GD0A 5BOSB 3N6RA 4GMFA 4DIKA 5BOVA 4C0QC 3BIJA 1R0WA 1YHNA 1H6BA 4DZRA 1MZVA 5JZVA 5F2OA 4HDSA 3B6ZA 3F71A 4CM4B 2OHJA 5A6SA 1CF9A 1P4HA 4HSGA 4N1AA 1QORA 4G1BA 2QE7A 4MWZA 5JE8A 4D3YA 3LXXA 2WIFA 2OT3B 3JWEA 5LMUB 1RBMA 3BRSA 1NXPA 1Q17A 1KSGA 3IE0A 3UGJA 4J2OA 2J46A 3BMOA 1E4OA 3QELA 1THMA 4BEJA 2P91A 3H2KA 4JU9A 1R88A 5DH9A 3UYKA 1E0KA 2G40A 4FX5A 4M36A 2WIDA 3MCUA 2C9BA 4R1QA 1PT9A 1PLLA 1D6JA 1SRQA 1HXHA 1MX3A 4Y18A 2HBRA 1O7JA 1UBLS 2FW6A 3I6MA 1TT7A 3HVRA 2PRZA 3RKUA 2GCPA 3V32A 1SFRA 3EWNA 4KZKA 5IUJC 3PLNA 2BFCA 2H5IA 2NUAB 3WK7A 5J4VA 3WAJA 3GG2A 2BV3A 3HL4A 5KMGB 4JNCA 4J9VA 3A4NA 5C7LO 3QF7A 2P6MA 5AM2A 3H5VA 1IOLA 4ER3A 2PFKA 2WW8A 4Q4HA 4KL8S 2XV1A 2YL2A 2BEVA 4TTVA 4QWWA 3RC2A 4YC7A 5CXSA 4BV3A 1D7OA 5KNBA 3PXCX 3QEKA 2EYUA 2HX1A 3B85A 1M6VA 4C0JA 4DOMA 2WF9A 4ROTA 2IUYA 1F2TB 3DO8A 4P3YA 4R3NA 4FOTA 1BE8A 1P2BA 2GASA 3GRAA 5HR5A 2WIAA 4C5CA 3AVPA 5DGDA 5FA8A 4K81B 5DNDA 1CS0A 1SG6A 4E2FA 3G89A 2XUPA 5KVAA 2FFBA 4M60A 2PU7A 1DG3A 3I01M 2RONA 3CZ5A 4CTMA 5M34A 1HNXB 4RPLA 4D9FA 4C4TA 1QF6A 1QG2A 3GZ4A 3M81A 3CUYA 2DBQA 4DBVO 2G9VA 4DHEA 4OGGA 4PW0A 2NVWA 4GG1A 3RVPA 3QQPA 5HFNA 1FXUA 2CFRA 1XRNA 2WAAA 1HG1A 2FK7A 4C7BA 4R7GA 4PG4A 4E5UA 3VYSB 2F3PA 4DIMA 1FQWA 2PE5A 4PZAA 2IV3A 1Q1BA 3JARA 4K6OA 2IL1A 4P3OA 2E48A 3A6GA 1UC5B 2QAJA 4LJ7A 4US1R 4D9GA 1O0CA 4JVSB 1IN1A 1QO9A 2C7RA 5L4SA 3X1JA 1E2KA 3WK6A 2G80A 4UFPA 2I3AA 3HKDA 5CFRA 2B61A 1U3FA 3G68A 4JDPA 3RQSA 1J8MF 1I2MA 3L07A 2NU6B 4FQ7A 4QT0A 1NP3A 2I91A 3G8DA 4I9UA 1FQOA 3H5LA 2WQZA 2DEUA 2PMBA 4TV9F 4ZZ2A 4C7VA 2PQ0A 4KTVE 1QHXA 3D0OA 1M75A 3TZBA 3CVUA 3EYAA 1NBME 3A25A 2O48X 1RTKA 3ROEA 1WKBA 2JK1A 1JVSA 2R6CA 4Q01A 4F9FA 4O2RA 4FZRA 3R4CA 4BO5A 1QIJA 2O4CA 1LJUA 1QH8B 5KX5A 2ZE6A 1RQ7A 1NY5A 4MWGA 4ZVLA 4AJ2A 4NIMA 2R8OA 4KQWA 1QRTA 4RTOA 2H2GA 5DI3A 4A9AA 2XGSA 4EG3A 1AQLA 1CUCA 2XGGA 3PD1A 3QI7A 4HX2A 5EN4A 3M49A 4JLNA 3SI7A 4LFBB 4Q9LA 4E09A 4R2XA 5JHGB 3V4ZA 1XZMA 2WVHA 3EXHB 1S4MA 1WZCA 4YV0A 4MV3A 2HMWA 5EIAA 5K03A 4F3NA 1H6AA 1OWLA 4NJMB 3KCQA 3JVEA 3ABQB 4N6OA 3TCXB 1K0UA 2H59A 3PC3A 4U2BA 2PMEA 2HDOA 3F3MA 5HIAA 2C9ZA 3LUGA 3ZG6A 1XDBA 3E03A 2BF4A 3OPYI 4N39A 2BFEA 3ZHYA 2XCSB 4G5OA 1M2FA 1KS9A 3DZGA 3RWBA 2NYUA 1HKHA 2VHJA 3CQ9A 2JHFA 1HFWA 3EIWA 3ITEA 4U2DA 5TPWA 1XMIA 2QYOA 1E1NA 2AC7A 2VFAA 3NUZA 3EN0A 3IOYA 3PTAA 3HU5A 4K40A 1SUSA 3C4QA 2ZJ3A 2H3HA 1NLZA 5EMLA 5K8JB 3BERA 1GYPA 2M6LA 2NTEA 3SX2A 5HF9A 4AZ0A 2NPOA 5MGBA 4HPJB 4P54A 1EB9A 1AZLA 3GQBB 5LU9A 1PAUA 2X2PA 4FHZA 1DUSA 1IBLB 1SCUB 4NJEA 4MR7A 4DWOA 1TUEA 3Q41A 4TZ0A 3EDMA 2WYHA 3KHSA 4R1SA 2R6JA 2QRUA 1QS0B 1P1KA 4MB6A 4Y9TA 5FA5A 5H9VA 3P4YA 3HYSA 3TECE 1PKXA 2AJCA 1O03A 3KYCA 1Q83A 5TF4A 6Q21A 2VJDA 4HWKA 3VNQA 2GRJA 3D4BA 1JXAA 1D0SA 5CLHA 1Y7PA 3KEGA 1IM8A 1NQTA 2G06A 3DPIA 3EBLA 3FAKA 4OXYA 3CH7A 4D3ZA 3PD7A 3Q9NA 5KNDH 1JIKA 3IL2A 5B1IA 4BN5A 5FV4A 3G59A 4WVFA 3HDJA 1M66A 2Y1FA 4HP8A 5BR7A 3E70C 4GP7A 4E3ZA 4G0PA 3ZYZA 5KSYA 4OP1A 4RTKA 4J4HA 4M8SA 4BFCA 2VDQB 2UYHA 2Q4OA 3O8OB 2XX3A 1TZMA 5FUVA 1VXOA 1G42A 3RRNA 1KVQA 3KJXA 4UQPA 5LSAA 3HXPA 1O8CA 4J94A 2AJDA 1YK1A 4NMMA 5SZJA 1CUSA 4Q3KA 3UTDA 4B40A 1JA0A 1KWKA 4EZBA 1PWYE 3EB9A 4GX5A 5BR4A 3GUYA 1RQ2A 1F60A 1SKAA 5E1DA 1SUEA 4P2BA 2IYFA 2AOTB 1HTTA 2EEZA 2O1XA 3RNLA 1WXDA 3CE6A 1L7EA 2HJSA 4FMDB 1ZVMA 2ZULA 3TLKA 1TEVA 2NYVA 4ISBA 4YJHA 3R7SA 4BVLA 3KU1A 4MOWA 4FDLA 3K53A 2IHZA 1Z13A 1TQHA 1MJFA 3IOEA 1H8ED 4R0VA 3FVTA 3JAMA 5JR3A 1YMUA 4U7DA 2ZROA 5AVTA 3EODA 5D86A 2WEKA 1GRVA 3PKJA 1HDGO 5HBGA 5K6RA 3NIDB 2R8EA 3Q8KA 2MHCA 3K92A 1M34B 1U90A 3SXUA 1O96A 4ZVUA 3U3MA 5JO0A 1K68A 4DGQA 4ND8A 3W6OA 4FLFA 3WLSA 2PV7A 3ORSA 4BWYA 4RPJA 2I0FA 3R9XA 4J7CA 5KBYA 1CG6A 1KSFX 4L16A 4EG7A 4ME6A 5F51A 1H0RA 1O96B 2KWIA 3OHSX 4QELA 5AJXA 4F92B 2QI9F 1UUFA 1SXHA 1ZD2P 3H5AA 4W4TA 5GZ3A 2ZQ5A 5J3JA 2CL7X 4NHOA 4YCCA 1A8QA 5HS6A 4E21A 1G6Q1 2FLWA 4KGVA 2GXAA 1EFDN 1HDRA 3GFRA 2AFIE 5JVDA 4X65B 1QPZA 2FYTA 3PFHA 4YJFB 1PWHA 4YUVA 4XWWA 1I3OA 1J09A 1E6CA 5E2AA 2IIPA 1H2EA 4WK2B 4XZ3A 3LM8A 2ZIUB 1YZFA 3AR6A 3RS8A 1Q7TA 2IXGA 4U5XA 5AW4A 1VP3A 2PSJA 1ZSNA 2QX8A 3KTFA 4KH1A 1QXSA 4UATA 4ID9A 3ZCUA 3K5HA 2H0AA 2WICA 2R6GA 4QO8A 3OZXA 3BH6A 3GJYA 1G5HA 1AKVA 2PBLA 4M22A 4EHIA 3L8EA 1TVMA 2BGIA 1ZRSA 4J0DA 4C1BA 3EPHA 3UGTA 4A2CA 2A78A 2POQX 4MKZA 5ADVA 1NZJA 2Z6QA 1KMIY 4D98A 3JZFA 5I7RA 3F1KA 1SU7A 4XUGB 1AD2A 1JI3A 2CMHA 3PGA1 1RMYA 2VZ9A 4CUZA 2C1XA 3MELA 3NVDA 5D5PA 3GLTA 3OTIA 1P9LA 3ZVLA 4MMZB 3OT1A 4J7UA 1VRCA 1C14A 1F0KA 1AZSC 1M1YB 3QU5A 3IV7A 4HPWA 3FTPA 1Q0SA 5JCZA 3AVVA 1QIMA 3I0ZA 1E2QA 4C20A 3PX7A 4B3MB 3SJBA 3CNLA 1JRLA 2MOKA 1FYFA 2V0CA 1DINA 5HRAA 3RC1A 3I0MA 4KV7A 1NONA 1I4EB 3WYGA 2FZCA 4OIMA 7YASA 2WWYA 1YGPA 4ZYVA 1UC8A 4M1YA 5JYDA 3I39X 1EE9A 2AWNA 3F6RA 2PZBA 3GGPA 3TR6A 4EWLA 1C7RA 1JDNA 1YI1A 4Q1EA 4ENWA 4WZAB 1IXSB 2QUKA 2QF7A 5AH0A 4QUJA 4KR3A 2EL9A 4QFBA 1FDUA 3WLMA 4CF4A 2Q0QA 2AB0A 4EPXA 3RFCA 5BRNA 2F9MA 5CYFA 2BONA 2FPGA 2AX4A 4X41A 5ABPA 1DIHA 2RIRA 4ARBA 2B5WA 1KXJA 3N8NA 1JNXX 3PGLA 4I1UA 4MX8A 3ZE9A 4C04A 3MBOA 5AK6A 4CLOB 2XAUA 1HI9A 3H8VA 5JFGA 4GXTA 1TMGE 3M3DA 4FFBA 1RXCA 3ZTTA 2I71A 4BQPA 1M8JA 1LI4A 2QN9A 3SZUA 1CY0A 3FOEC 1UWLA 3CUKA 4UTZA 4FJ2A 1THZA 1SIBE 3IVCA 5JQGF 2QUHA 3QMPA 1JZSA 4EZIA 2IH4A 2P5SA 5EHGA 1UFRA 3DMGA 3QF4A 2RH5A 2QN1A 2DPMA 1H8HD 2GNPA 1QAOA 3QNWA 1FNBA 2XCOA 3FPEA 4MUEA 5GJCA 1Z3IX 5KCMA 1IWOA 2R8RA 1Q44A 5IKEA 1RNLA 5FPSA 1N2SA 1O4VA 5EXXA 2WJHA 4JYCA 4V02A 4PAGA 2CYCA 4GVPA 4ASUD 5I7EA 5K99A 2AQKA 2A5LA 3WWZA 4TMYA 4IPTA 4UULA 1L7VC 5SZIA 1WWKA 4GMHA 5BRJA 4Z54A 5F5XA 5EJ6A 2AJTA 2JFXA 3E0QA 4EL0A 4Y8VA 4DMLA 3KFLA 3E5MA 2AN5A 1TT5A 1KJNA 3JZIA 3KSUA 4YRNA 1CX9B 4MS3A 1R6UA 3MILA 2HHCA 3KYDB 1TEHA 2ZJYA 2DRIA 3FCUB 3KQQA 3W5BA 2EHDA 1QYCA 1H4TA 3JYLA 2H4ZA 2R1TB 3EW7A 3LCMA 3QLEA 4XGIA 3PXAA 2MIIA 4C7OA 4W99A 5FLYA 3C6XA 1KZHA 3W6PA 1KQGA 1Z7YA 4PR3A 1R8SA 2G09A 3WYFA 4AAYA 3OBBA 2WB2A 4WT7A 2FP4A 3LC1O 2PM8A 3MZ0A 1KKMA 1UKAA 2I8AA 2D8AA 2R8XA 4DG5A 1H69A 3H9JA 4KR0A 3ZWVA 5KHOC 3SG0A 4PPFA 2ODAA 3LPMA 3NIGB 4V2UA 1JIQA 3T8YA 2AG6A 5DE3A 1C30A 4OK3A 3AR9A 4P0TA 3IVRA 3NJRA 5IW8A 3QFHA 2HHHB 1KMHB 3V1UA 3VTZA 1TTTA 5BSGA 3JQAB 4YAFA 1R66A 2QDXA 4Z2YA 2ONYA 2X4GA 2JI9A 3K2QA 3NTQA 2ZTVA 1YCGA 2L2QA 1GPUA 1V9CA 2OZLA 2CKMA 2R1ZA 4LYEA 1E2BA 1ISJA 3QEMB 3U6BA 2XQIA 1F6WA 5LQDA 2H4YA 2OQIA 3HYRA 3H9GA 5JDIC 3U7HB 1Q0RA 1Y3BE 3IUPA 1HGXA 2RFLA 3M5PA 1PWEA 4IXWA 2A92A 3CVVA 1LD3A 3BX1A 1MRSA 1BFKA 4YDSA 3HXKA 3P52A 3ZU3A 2XKJE 2Y8EA 2P7IA 1GITA 4M7RA 4O4JF 3L4JA 3A1UA 2NPFA 3TQOA 4UBNA 3PCRB 1ESZA 3DPSA 2YIMA 4M4SA 4OFWA 1BVYF 4R4JA 4BNKA 4CKBB 1YS9A 4YMSA 1V26A 3AB3A 1S2IA 5GGYA 2GPSA 1VYVA 4DABA 2QQFA 1W4RA 1ES9A 2DXIA 4BRZA 2YXLA 2AWOA 4QDZA 3I34X 4XFJA 1REQB 1X38A 3OBIA 2ZGVA 4HAUA 1X8JA 2V7GA 4K6CA 1N1GA 2C4HA 4QGHA 3DKIA 5ALYA 5FL7D 5IDYA 2HBYA 3WBJA 3LL7A 2PUWA 1NBMD 3BCUA 2FX3A 4MYCA 5H9WA 3FPSA 2I1QA 4ZCQA 2G82A 5H3HA 1I0LA 3WG9A 2GK6A 3NM5A 1IMJA 3ED1A 3QX9A 5IAJA 5TMDA 3VSBA 3ZTWA 4C87A 1MEEA 1JLKA 3RHZA 2X1VA 4B3HA 5JATA 4JBXA 3KD3A 3LA6A 5AHOA 4D4GA 4DKJA 3ZJUA 5DI3B 1M1XB 5ALXA 3OX3A 2IPAB 1VL8A 1M9NA 3SVTA 2C5GA 1PZXA 1YASA 2ZUVA 5HCUA 3RU9A 2JAQA 2ZQYA 2WJPA 5EWMB 2QGZA 2UZ0A 2VRCD 3V1YA 4A8TA 4DR6B 3L0IB 2UVPB 1NLMA 4NJMA 4F2PA 4EFMA 1YIOA 5JU6A 3STYA 3DXYA 2ZB7A 2YQZA 5CIWA 2ZWIA 4QU8A 2JIDA 2F1HA 4Q9KA 3BL5A 1JYFA 4I1VA 4INOA 4IIGA 5ARDA 3S3TA 1ADGA 2CDNA 3PHCA 2HJRA 4KPEC 4BO2A 1GWNA 3EXFA 3ZJYA 2BVNA 3G17A 4MUFA 1FX0B 3PVSA 4YRFA 4IYRA 5DOZA 3V97A 3MRXA 1S3SA 4B76A 2Q1SA 3ZXIA 1UFKA 2GCOB 4L50A 1BNCA 3RLFA 5HTOA 3G9TA 4K9QA 3CBQA 1VJTA 2O5CA 5FFMA 5F9MA 1BN6A 1ZGGA 2Z8YM 1G8YA 2C99A 3GRYA 3QBJA 4J0KA 4OQ4A 4XLLA 3WK4A 3X3HA 1AUVA 4W1RA 3A9TA 2PX0A 4ICIA 2GK3A 4BVBA 1L4KA 5BW5A 5I47A 4ZMSA 4CM4A 5F3WB 1A95A 2V7TA 4HZUB 4EUNA 1SCUA 4NJEB 4P7KA 1M8PA 2E55A 2OE2A 1ZSVA 3AFGA 4TUYF 4OB6A 5JWHA 3M6LA 1DKUA 3O82A 5H02A 1HF3A 3U1VA 4F4JA 2P2GA 1XTKA 2X23A 4Y1EA 2D13A 3LGSA 3LW8A 5AM1A 3TIVA 2OFFA 1RAIA 1NLUA 4MYDA 4Z8XA 1DUIA 1XJWA 1ULHA 3NOVA 2HFJA 2EW1A 3VO1A 2EFEB 3ITKA 3VR6D 2P30A 1T6YA 3KVNA 4M1EA 4EITA 1YRWA 1E2UA 2QN7A 2WHPB 4JXKA 4TSFA 5E6SA 5FULA 6PFKA 2NUPA 5JSUA 1ZC3A 2ZB8A 3NATA 4HC4A 4O2AA 3UK2A 4Y2JA 1I9CA 3VH1A 4ABTA 1WTAA 3S28A 1J9GA 4W5QA 4CV3A 2WJGA 3QKIA 3S5JA 1STOA 1AGYA 2B5OA 1CJBA 1HQCA 2DFNA 1ZX1A 4QFDA 3I53A 1NC1A 2PA3A 1LKZA 1HOXA 3K70D 3ZWYA 1CZKA 1JHXA 2H2HA 2VHEA 1SCKA 2QMUA 3DTYA 1R3DA 4B09A 4BLSA 4QJ4A 3NQ41 2C5LA 1OHHA 3FYDA 4AY6A 2XMSA 1J90A 4R54A 1H2AS 3ER8A 1CS4C 1QPBA 2SCUA 3AM5A 1ZLYA 4I5EA 4G4GA 3RC8A 1QRUA 2J33A 4RHCA 2XLBA 5KOHA 2LPMA 3QVWA 3H4IA 3WB0A 2PX2A 2CYAA 2Q99A 4BBJA 2H9IA 1VMEA 1XTRA 3HB9A 3NW9A 3H1GA 1ISPA 1H6DA 2AD5A 1JKJB 1T2AA 4L0QA 4DIUA 1EFHA 4XYMA 3SJUA 5IUNC 4B6RA 3SR4A 5C5DA 4B3RB 1MH1A 5K8LA 5FTMA 3H2JA 2H2FA 1NASA 3Q6NA 2W6OA 4M7OA 3V8BA 1W35A 1O58A 1QU3A 2D7JA 2WA2A 3OPYB 3AV3A 4RXUA 4YR7A 3VR3D 1KZYC 3RGGA 1G6KA 1PD1A 2EG9A 1MP0A 4OP3A 1FFHA 2EU8A 4PG5A 2IOYA 4HZIA 2VXYA 1RXEA 4LDAA 4XLZA 4P82A 3L0DA 4PVCA 4U9IS 1DV2A 1GA6A 2HF2A 3D8NA 3ZH9B 5IF9A 2F64A 3NV9A 3GPBA 2BMVA 5CM2Z 2Q4EA 1Z4NA 2J59A 1VBFA 1E9VA 1OPRA 3DG9A 2GTHA 4OX9B 1YKFA 2H4FA 4XX0A 1R4NB 4IDCA 3OLVA 4HKTA 2XCRB 4GGOA 3WMEA 3C8HA 3DDOA 1HQYE 3K8OE 3F46A 2N1MA 3WLAA 1G0OA 4GDMA 4OEHA 1VYUA 3P5BA 4ZZ0A 1C7ZA 2G7ZA 3D5EA 1IM5A 2W8BA 5F5NA 1D03A 2OMKA 4BVJA 3Q3JB 5JNTA 1DUVG 1P2TA 4F7WA 3G8YA 4EKIA 1APBA 3D7NA 1PZHA 7REQA 1GLVA 3IJRA 5KTYA 2X3YA 1B3BA 2OXRA 1LSOA 5HNKA 3B1JA 3KLNA 1ZGJA 3NZEA 2QMHA 5AK3A 3U3JA 4LZJA 4Q3DA 4HS4A 1E1QA 4JC8A 4RDCA 4RPIA 1LPSA 3QLJA 4XWYA 4ZPXA 7REQB 3NMUF 3PDJA 1U8FO 3DM9B 3ZHCA 5IJ9B 3GJ5A 1KI9A 4I6JA 4OAPA 3W6ZA 2JLSA 4DNPA 2YW9A 4ALLA 3T1NA 4G0VA 2OQVA 1JEQB 1ISSA 1P5JA 1PZEA 4QL3A 4EFNA 2ZP1A 4LF4B 2PJUA 3VFDA 2ZIFA 5CGZA 1ZPDA 3IB3A 1NVUQ 1PP4A 3BQNB 5IPFA 1NXVA 4MPRA 1QIGA 2B4AA 3TGLA 3DHNA 1X7ZB 3QIVA 1KDRA 5BWLA 3EQ9A 2G07A 4G1VA 4N9WA 3HACA 3ZOZA 1XOIA 1PEKE 3C8ZA 3F9IA 4PRKA 4X6LA 3RVNA 1X39A 2ZE8A 3H9UA 4TWAA 2VHZA 2FUKA 2GDZA 3FDZB 5J4KA 4LC1A 1NC3A 5CLLA 2H00A 1QGZA 1ODCA 1WZEA 2JS7A 4TMZA 3DR5A 3OD5A 2GF2A 4K87A 4L3VA 5DHAA 1KFJB 5IBRA 4CHGA 3B6KA 1IM2A 4R01A 3IQWA 3EDYA 1NJ2A 2BMEA 5BSUA 1CEQA 1KTVA 1OLUA 2PZLA 3OECA 3E9QA 2O8FB 4TXHA 3GF4A 3HKBA 5FTNA 5I8WA 1QV6A 2IP2A 3I01A 4XIJA 5H1YA 4EPYA 2HNKA 5SICE 2IYXA 2JKYA 3W1WA 3ELDA 4Q82A 1M73E 4Q48A 4MUYA 4CLRB 3VYVA 3IP6A 3PNQA 2D74A 4C9BA 3FJ1A 4JELA 5LXTF 1CD5A 2DE0X 5AKZA 1PTJA 2IU0A 2RJOA 3T0IA 2H11A 2QA5A 4XXHA 1IBCA 2ZBDA 1GZ7A 1Q2XA 1OT5A 2B92A 3P0JA 1RQRA 4GR5A 5K6TA 2QXTA 2J9YB 5KVVA 5JY6A 4MHSA 5SZKB 4MS4A 4OYYA 2LZ0A 4RJ2A 1TI7A 2OAEA 2QX9A 2Y9PB 3AM1A 2PAFA 1X1RA 3GXBA 2OL4A 3OFNA 1NNEA 2VT2A 3DEYX 1XCGB 3SPXA 4HQFA 3E7DA 1RZVA 1EESA 2EDAA 2WSIA 4WNAA 3TNLA 4Y2RA 2X3UA 1QO0A 1VLLA 2K7FA 4G63A 1I5EA 1N9GA 3O3CA 3DFUA 1MXHA 1RRCA 3MAGA 1QGED 2P8JA 4FKMA 2DCMA 4QC2A 3DDNA 2QMZA 1Q6ZA 3TLBA 3ISJA 3BAZA 4DLVA 2VATA 4W1SA 2Z3ZA 4MYUA 4IIJB 5FEMA 3AUSA 3NS7A 3GAFA 1PJ2A 5JAQA 4A8HA 2QTMA 1P7YA 1VJDA 3LDAA 2YJGA 1XYVA 4ZMBA 1BMFA 5KU1A 1OA0A 3GGDA 1YUNA 5C4GB 2HXSA 3FTEA 1CULC 1OAAA 3KPUA 5A3SA 3K3PA 1Y6FA 2BHRA 2Y1XA 3U0VA 2CL6X 4RIFA 1QHGA 1J7JA 3TQTA 5JXJA 1Z74A 2XTNA 1NUHA 1D8TA 1E3TA 2CVZA 2F7SA 3Q4GA 5J2TF 5BR1A 3K9NA 5CG1A 3PPXA 2CFCA 2GILA 3ZKWB 4F4CA 4HFMA 1U7PA 4DTIA 4MEBA 4FYJA 2ECQA 5H59A 3WLOA 1JR3D 3EVDA 1IY1A 1Z18A 1AOXA 3B70A 3BE4A 1QOZA 3FGPA 1FLVA 1ONOA 3K0FA 3MJHA 4QYIA 4RMNA 2FWNA 1ETUA 2PH7A 4HQKA 2JGDA 2ZB3A 3T35A 4CM1A 1LV7A 1M6NA 1XKTA 4MP3A 4PNHA 1H2ZA 1QO0D 1UT6A 2X2OA 3M4JA 1VM6A 2FETA 5AO9A 3RS7A 4EJ6A 1AT1A 5HJEA 5MGNA 1I7SB 1FP4A 2EZ4A 1F1BA 4DR2B 2DSNA 3M9LA 3TMYA 1O5OA 2OVFA 3UWPA 3WE7A 3WL5A 4XWTA 1H85A 1LZKA 3EC2A 2H1VA 4WA8A 4IS2A 4KSYA 3WV4A 3L5OA 1O95C 3NGMA 3OEWA 3L43A 4W5NA 3PI7A 1L1FA 4AVYA 3AI7A 2DUNA 3DV9A 1ZD1A 2FVXA 3LUJA 2ZVPX 4GYJA 2ONJA 3VDQA 2A1UA 2DR0A 3TR0A 4ZJZA 2CMKA 4NNPA 5I9TA 3QE0A 1HWYA 1J0CA 4GP6A 1JE0A 4I4LA 1IY2A 3B2NA 4MK4A 2JHPA 1XU9A 3DL7A 3OKFA 5YASA 1H8HA 2D0DA 5BW8A 5BY2A 4D56A 1XR3A 3T95A 1AHHA 2EVWX 4X3OA 3OQOA 2B1IA 3HO8A 3T3OA 5FP0A 2PJRA 1E7QA 3PDUA 1VGRA 5KNDA 5FOWA 3UBTA 3OZBA 3L04A 1QVRA 3O8LA 3TGWA 1V7QA 4ESOA 4MCJA 1E0AA 4A8JC 3DCYA 5HRUA 2H5JA 4HQ6A 3FWZA 1EFTA 3DM5A 2C0QA 4R83A 4XYGA 5T5QA 2ZZNA 2WD8A 3RAFC 5JCOC 2FSVA 3Q85A 4OM8A 5ALVA 4QU0A 5IH3A 5IWCA 3TTVA 3PEUA 4J2HA 3UFBA 1OUMA 1XZHA 4C01A 1F9AA 1DLJA 1TGVA 2BKEA 5JH7B 4EUKA 2XGOA 1T6BY 4EM6A 4XCVA 5FI1B 1AV6A 5K3FB 4V3BA 1F3LA 3PA6A 1VFPA 2ZB4A 3M2PA 2WV9A 4MUJA 1MH9A 2HQRA 4URFA 3VPAA 3VM6A 2XCTB 2Q4DA 3AEZA 3ZHOA 2QVLA 1LW6E 1RFGE 1FTNA 3HB7A 1QK3A 1DWPA 1MC4A 2AI2A 3T5BA 5JCOA 3ITDA 3JQRA 1XHLA 2PKYX 4TKZA 1PUXA 2VPTA 3JASB 2JLAA 3PRHA 4KK4A 1EFUA 1CUIA 4WZ6A 3IKJA 3OFSA 4ENVA 1KJIA 2UZ1B 2V4MA 3INNA 4KYVA 5FJJA 4LFAB 4S1TA 3L0YA 5A7GA 3C8DA 4R9RA 3ZHXA 4GOOD 1LV8A 4W5JA 4UTNA 3FRJA 4CQMA 3U09A 3G8CA 5AQ1A 2IOFK 3C8UA 3A32A 2ZJ5A 2GAAA 4R51A 1G8FA 4OHMA 2D7DA 1YZQA 3BWCA 3CLSC 1WLSA 1AGRA 4BCCA 5BQXA 1ZESA 3FR7A 2FF7A 3HYTA 5BYJA 4FFSA 1EP3B 3D1LA 4HDOB 4J6FA 5JC8A 2YZGA 2XUOA 2BBTA 2ZATA 1ZIDA 2IEZA 5EMMA 4FHDA 4C4XA 4BFUA 1D5CA 2P9JA 2QTBA 4KIWA 2PZFA 4TX1A 2Z9BA 3J7TA 3C7AA 3H2SA 5TVGA 1TLLA 1YL6A 4DLZA 2D6FA 1XZEA 1SBTA 4OYHA 2QVGA 2BT4A 2GZRA 1G9XA 3WLQA 1DKMA 1YR6A 4PBRA 4P9NA 4XCXA 4K0KB 3SGLA 2D1YA 4RDXA 2BFBA 4ZAYA 5G40A 3FB1A 1KS2A 4Q15A 4UAUA 1RQXA 2E4WA 4RL6A 5IAGA 2Q7OE 3Q7EA 3COJA 2CF5A 5KNCH 2FNAA 2YXDA 3PHJA 1FUIA 2IHYA 5HM6A 4CXMA 4WI1A 4BXOB 1M1NB 1BD3A 1VMIA 1CUFA 3R75A 3T1VA 4L0MA 1DOHA 1X9HA 1VI2A 4MUGA 4D4LA 2C78A 1VHWA 2Q4BA 4B6GA 5EA2A 1F6BA 3QFSA 1ZDMA 2QEQA 1SKQA 1FE8A 4ND8B 2QR5A 1P0PA 3KFVA 3R3XA 1K8ZB 5CVJA 5LQUA 3IEXA 4B71A 3N86A 4ZAWA 4HNRA 4ERXA 1L8QA 1AK9A 3CRRA 2GESA 2AXEA 5C8VA 2AFHA 2CNKA 3DOIA 1MXFA 1VRWA 1T9AA 3DTVD 3LKBA 4FT2A 4OKNA 2CUZA 3EGXA 3V00A 3NFYA 1OKKD 3LQFA 2Q3MA 3WMGA 4YRBA 5AESA 1Y34E 3V6LA 3GUCA 1UPCA 5L3SB 2IWRA 4PYNA 1O6CA 3CW8X 2BFFB 1PQYA 1W4BA 4NBKA 3TUZC 2NV2B 3X1ZA 5FLKA 3JWGA 4UHDA 3RC3A 3D2LA 1G2OA 1M2JA 3SIXA 1JKXA 1DRJA 4C2TA 4LYGA 2YBEA 1EM6A 1WMSA 3FKSA 3Q7QA 2FSIA 1SXGA 2ID7A 4HDKA 1R6AA 2FPPA 3EFEA 3QV1A 1GR0A 3H4MA 4RA9A 4HNVA 4OSPA 5BUSA 4NYIR 3TW8A 1GY8A 2LWIA 3T0GA 5K9ZA 1L4MA 2E37A 4B46A 4B82A 1N33B 4D9CA 2XJ9A 1MGOA 1D4FA 1UODA 4XYBA 4DNQA 2WQ7A 1ZVVA 3PEYA 1SHUX 4UEWA 2P90A 5JISA 2VP0A 4CKWB 2C4MA 1C1DB 2WKQA 2DPXA 2XRYA 1XQYA 4KR9A 1BMTA 3RFVA 3BD6A 2AZMA 3L4EA 4N9QA 5IBCA 1Z3CA 2OHOA 4WPGA 3HJUA 4C6TA 2ONZA 1ZVKA 4UBJA 3QVXA 3RYIB 3ITNA 1T9GS 3TLYA 1R5NA 4JR2A 4X6XA 5AKYA 2H16A 3PQDA 1UH5A 1YBMA 2FPKA 4QGBA 3H2ZA 1H6CA 1LTQA 1PJCA 2DBYA 2OYCA 1U3VA 1TU4A 3GRPA 1XTSA 4WNIA 5JYCA 2HH9A 1DBSA 3WRVA 4UDXX 1A8SA 3CLSD 3QZUA 4LRUA 1FCJA 5CNMA 1JT9A 3ZHTA 4EW1A 2BHLA 3CIOA 3BREA 2C83A 4V0OA 1II8B 2ATCA 4JOCA 4V1CB 2I6FA 1JLSA 3MN1A 4NZZA 2JHAA 1NN0A 3SXUB 3UEOA 2PUVA 2Q5QA 3EZGA 2PO7A 1J8QA 2QYTA 3GJ4A 3C4VA 2XB4A 1XLTC 3A4YA 1GN9A 4PLTA 4QHYA 1CR2A 5FD8A 5IN5A 2L18A 4EA8A 4UM9B 2O50A 2VK1A 4QRDA 4CV0A 5CCBA 2VHVA 3DCJA 1JPVA 4AJ1A 3R6GA 2DG2A 2B82A 1O8BA 3I5AA 5DNEA 2CLFB 2QB5A 2W22A 3WGOA 2QOEA 3E23A 4ZT5A 1NJSA 2GSWA 5D6NA 2R5FA 3UV7A 3ZD8A 3IEPA 4JI8B 3PWTA 4HYTA 2HXYA 4AWBA 1NXWA 1USKA 3EY9A 4QE3A 4B7XA 1BZYA 2BEWB 3DMDA 5FBWB 1DG1G 4S1NA 4G4IA 2BFDA 3I6IA 4M55A 4EB3A 3U56A 3OLYA 4MHOA 4L5BA 1TYBE 3TLGB 1BXGB 1IHXA 1B43A 1E7WA 2ACKA 4QXOA 3AP3A 3CB4A 4U7GA 1TK2A 1ZH6A 1UP7A 3PQ5A 4TLBA 3O8OA 1B6RA 1X92A 4HF7A 4KACA 4I3FA 3ZE7A 1B42A 1Y4ZA 2X58A 1KZGB 3VMMA 3OEED 1OYYA 2CLLB 1P73A 1VGVA 4XM0A 2XYHA 4E4TA 2N46A 1Z8NA 1DAMA 3AUTA 1ZUHA 1W8IA 4BMCA 1E9RA 1YCFA 2R00A 2FW1A 4WNAB 1F2TA 3INYA 4GSKA 2PKQP 2JGIA 3DC2A 3R41A 3V4VB 3THYA 4IQ8A 3ZEAA 3ESYA 1QE3A 4LF7B 5LQCA 2YHIA 4Y9UA 1IVSA 1B6SA 4AKGA 3QUBA 4JJ8A 3KC2A 3LY7A 2CUKA 2WLTA 1P2SA 3CEMA 3NHFA 3WWCA 3GVXA 3ZI4A 4AT1A 5ALTA 4IHJA 4LZPA 4EP1A 3U7GA 1LLCA 2XTJA 2Q8QA 3PXUA 1H23A 3ASVA 2F1OA 4ZDKA 1MOSA 1PR5A 3LLSA 4IAOA 4HOYA 1H2BA 4E30A 4MH0R 4AZ0B 2CDRA 1JLLA 3JARB 1FDVA 3C3JA 4FR0A 4X44A 2GD6A 1TJ4A 4I8XA 1E9SA 1W2WB 2P5UA 1FDRA 1XZNA 3NGXA 2A1IA 1TYCA 4XX1A 3W1VA 2OM2A 1SVKA 3EXHC 2H52A 4FNOA 3COPA 4BP3A 5EUQB 3NAZA 4NCKA 1NMSA 5KYVA 4HNTA 4WEQA 4D97A 5I7VA 1S6YA 4ZT7A 4D5GA 5JVDF 4LXXA 4LF9B 4KXUA 1H2RS 4J0EA 4XM1A 4YJ2A 4K26A 2WF7A 3B7PA 3SCZA 1Z4IA 3B3QA 2R68A 3KQMA 3OEHA 4FGKA 1X1EA 4G5YA 2CVQA 3I9V6 1R0RE 4HDSB 1WX1A 3UXYA 4L73A 4OLHA 3USZA 4FNGA 1E64A 1WVMA 3C3YA 1ZM3A 1L9XA 1UMDA 3B52X 3R2JA 3WL6A 5E9QA 1U9IC 2G1UA 3ORYA 2A30A 2AE2A 3FKJA 2QU8A 1XZFA 1KDVA 4F2WA 4L07A 1ENOA 2P62A 5CT9A 5BN3A 1RWKA 1U0RA 1DAKA 3FNRA 3SSAA 1H93A 3W4JA 2QTWB 3WXBA 4D8YA 5B4UA 3M82A 2JZNA 3AFIA 3M6WA 1SULA 4Z0TA 3V8RA 3U62A 2VAVA 3ENKA 2GQ0A 3Q98A 2BLLA 4HTFA 3PJEA 4ZQCB 1ZHHA 5C0OE 3B6IA 4AZ3A 4YCMA 4JENA 1KZ7B 4JVNA 3PUZA 4JJ6A 3PSHA 4IUCS 5CYOA 5U4QA 4F4FA 1WF6A 4BNYA 2PFGA 3EDRA 4GL2A 3HDHA 1A9QA 1UJCA 2F1JA 1M5UA 5D7BA 1L5VA 3ILXA 1LQUA 3QK7A 3EG5A 3HZRA 4URUR 1E6EA 1HUQA 4XIFA 3M6UA 3ZCXA 5IWAB 2FA9A 1M7BA 1SNYA 2JBAB 1Z16A 2O0LA 3H3JA 4P33A 3KSMA 3T38A 4ESVA 1CY1A 1KI7A 3R7WA 2WHYA 5AVKA 3LT2A 1EGQA 1PZGA 4HWPA 4MR8B 4G5XA 2JAPA 2YHUA 4UE3S 4WCDA 2N3ZA 2R86A 4EUHA 1QFJA 3AVYA 2QROA 3PC2A 3WR5A 2FR0A 4E11A 2FX5A 2PS9A 1NF8A 2UUOA 4HLCA 4LSGA 5DHTA 5JJKA 4DM3A 3E1KA 4H17A 2GCIA 5E9WA 2VK2A 1TRKA 3AEKA 4NLLA 4D25A 3QVUA 3K9FC 1CZUA 2FMFA 3NTVA 3G0HA 2PGXA 1YI0A 1YKGA 3KPWA 4BTLA 4CU2A 4QLOA 2XZLA 1G5TA 1JR3A 3IDZA 5HCNA 4YUWA 3IE2A 2QU7A 4ARUA 1L7OA 5EVJA 1X7WB 4BE4A 4WBNB 3N2GB 3U4QB 2V7BA 3IRUA 4FW9A 4XDZA 1QHNA 5GQSA 3EUWA 3AO0B 3OMWA 4QRHA 2VJYA 4BDTA 1GN8A 5TVKA 5BWBA 4LY9A 4GGMX 4B85A 3ANLA 3O6VA 2QJFA 3OWHA 3CR3C 4M89A 1D04A 4NU8X 2HA7A 5AHWA 4B7CA 5HDQA 3R5TA 5HKBA 4OB8A 4KPFC 4D41A 3KZOA 3WTBA 3JSXA 1CEXA 1JEJA 2A6PA 1SXJA 1GPBA 3V7UA 3WL4A 1CERA 3HP4A 2HR1A 1P1BA 5TT1A 1CJSA 4JI3B 2II6A 3ZIUA 4KRYA 5FWAA 3H6HA 2BELA 2R4TA 1MQ9A 2BW0A 2CHUA 1U0EA 3HVHA 3L8HA 3VGJA 1U4NA 1X1TA 4NYMQ 4N3AA 4LCJA 5A0VA 5KEIA 3KQPA 4MQBA 3TTXA 1KBZA 2R7NA 3O74A 4G1EB 5TGTA 2OENG 3WWYA 4O5OA 1JKJA 2FEOA 3FJYA 1Z12A 2H4XA 5AI0A 3ZW9A 1U2GA 1MC8A 1EI9A 3CKMA 3OEYA 4EDHA 3CH4B 2F1KA 2AW3A 2WIJA 1V3UA 1XDDA 1RR6A 4CFSA 1HT3A 3HNOA 4HYEA 4RJTA 2TMKA 4E4RA 4HV4A 1VG8A 5B36A 1CEYA 1CF2O 2OWDA 2PA0A 4LS3A 2EFDB 3DV0A 4ENPA 1SOMA 3FUTA 4JQOA 1YS6A 4S1VA 1I4DD 2FZWA 3QVOA 2IXTA 2OOSA 4QVKA 4L2IA 5LM3A 2WILA 2J85A 1XMQB 2QTGA 1YJCA 3EGDB 2BGJA 3QKSA 3F3KA 1AUXA 2IOQA 4GQBA 4P3NA 5JJ5A 3L6BA 1HQDA 1T2UA 1NN5A 2IDZA 4B35A 2VTKA 1HQKA 2Y9MB 1QLJA 1RI4A 3WK9A 5ALGA 1NDQA 3FR8A 2O2DA 1DBRA 2VQSA 4BUJA 5HRCA 2B25A 4IO0A 4B3BA 1I2AA 3CCCA 3NM6B 4RS4A 3OC0A 1ZH4A 3VV2A 4BKRA 5C5IA 5CB8A 2CBXA 1UDWA 2RSLA 4S1PA 4PYLA 1JDJA 3PDCA 4NF2A 4NDZA 2DBRA 3VKUA 1AXEA 1XI2A 2PGIA 3K9HA 1OLXB 1U98A 5G0VA 3I04A 4BWFB 2XECA 2ZT7A 2WOJA 3NC0C 3ANTA 3V1KA 1JSXA 1NNSA 1YZHA 4F4IA 3EVNA 1SVIA 2F43B 1ZFNA 1N7GA 1DP4A 3T9FA 5BT8A 1DT5A 3JRNA 1XZKA 2IX9A 3QPBA 3T9DA 1VLHA 2WU4A 5EE9A 1ST2A 2V5UA 4BNLA 2QTAA 5JCPA 3FY4A 3SQXA 3WKBA 1WVGA 5FL7A 4FFMA 3R6LA 1R9NA 2VK4A 1PJRA 3ME5A 5A9SA 4FPXA 5DB4A 4MVJG 2HZBA 3PUJA 4ZO6A 2WUVA 1DC6A 2EZTA 3EARA 1FF9A 4RV9A 3UK6A 4A92A 5CXUA 2BE9A 4GPEA 2IZ6A 1J9ZA 4QULA 1DAIA 4Q4JB 1Q0LA 4A2QA 1OCEA 4S1OA 3UT5B 5DMHA 3D6NB 4OY3A 4PYMA 1F6DA 1V4NA 2GPTA 2C3YA 1PS8A 3OZIA 4IJ5A 5IEJA 2R97A 5HQTA 2GYWA 1DJPA 4HNAB 3MBKA 4OMCA 1XZCA 3TNYA 3R0ZA 4RV4A 1PV1A 5I7WA 3O0DA 2GCEA 4MGEA 2Z6UA 3CSDA 1K8QA 3DFIA 2JJ8A 3WAGA 2ODPA 5REQB 3M5DA 1UT5A 4LZAA 2EX4A 4JYAB 5CVVA 1OZ0A 5I3ZA 1TW2A 5KSZA 3PFGA 3D9QX 3TJZA 1R4ZA 2QJTA 1Y4SA 2RGYA 3U4CA 5KKNB 3ASUA 5FJIA 1BX0A 3DYIA 3E81A 3KZNA 1K6IA 2NAFA 3PXBA 2A0KA 3JZMA 3R3WA 1W1UA 4I2NA 3UM9A 4KR2A 1IQUA 4EG0A 3D2BA 5FKJA 3BCSA 4UAVA 4XB6B 4KITB 4KGZA 2G17A 3NH6A 3QU2A 1O87A 3A1DA 3Q7SA 4JLPA 3ZDBA 4K28A 3ZE1B 3KUUA 3G8BA 1QKKA 1GCGA 3QLTA 1E6WA 1DFHA 1E79A 3MTBA 2XT9A 1CR1A 4CDRA 4F9GA 1JKFA 3GJ7A 2IUTA 4NTZA 1WQ3A 3ZNPA 2W0SA 3JVUA 2G6BA 5G0UA 2M6SA 3SICE 2CHFA 2P4QA 3MLBA 5DLPA 4D4JA 5EEHA 3HCEA 1PLJA 1XAHA 2XRMA 1C9JA 3G9UA 3H9QA 4KQCA 4JB2A 2XBUA 4M86A 5GOTA 3FNFA 4MQFA 3UCEA 2HSWA 2OV2A 1LCIA 3W5IA 3HJFA 2NZ8A 3JAKB 4CKEB 2ZUUA 1N6LA 3GT0A 2AK2A 3IAS1 4WKGA 3KZCA 4KU4A 1V45E 4DILA 4DPLA 1E5QA 1QG0A 3KZ1E 3NETA 3ONNA 3R3HA 4CYMA 3Q8LA 1N78A 1USVA 2DUJA 2OZVA 3KS9A 3KG2A 4ZEVA 1WPRA 3LT1A 1SJ9A 3O9ZA 3RBZA 3WO1A 4HRVA 4E07A 1E2FA 1PS0A 3IP5A 1T4MA 4HH0A 1G5FA 1UCFA 1J2YA 2C7BA 3N5KA 1SG0A 3EK2A 4MRNA 3V1LA 4D43A 1JG3A 3NHRA 3ZBPA 5BUCA 2VTBB 4ACAA 3HJNA 3T15A 1E8DA 2I1WA 4BX3A 4C4AA 2PZ8A 1LSSA 1P17A 2E4YA 4PCVA 4QEDA 5TPZD 1C30B 2YTZA 5ITVA 2YHIB 1QH1A 3A6HA 2IYQA 3BWDD 1QTIA 3I6BA 4XCQA 3EH2A 4HN4B 5C5CA 3CO0S 3GCGA 1Y5IA 1VYHA 3DMTC 1FFXA 2PDAA 1DCFA 5J5CA 1FX0A 4AIIA 2ANBA 1XN4A 2CFSA 1P1HA 1KH2A 2ZSBA 3B2EA 3HADA 4I3GA 1ZJWA 3DW1X 4N6GA 1ZMOA 1JHAA 5EXPA 4CM9D 5JAMA 5LNK6 3GLGE 2CT8A 1A69A 4TTAA 1MG0A 1DRWA 1JUDA 4JJZA 3DPUA 3ZZTA 3HA2A 3RSLA 3DD1A 4CM8A 1N6IA 4HNQA 4ND7A 8MHTA 2Z6VA 5BVHA 2WNSA 4WY8A 3AILA 4ESEA 4OHVA 5ADHA 3MWDB 3JYNA 2FZVA 3RCBA 5G0WA 1QF9A 2GZ1A 2XCQA 1M2VB 1ANKA 2EDCA 2C4VA 4KIFA 3B3JA 1OXVA 4L4YA 1MAWA 3IRVA 1Y1QA 1YS4A 3TOZA 3HCOA 2P9EA 4PN7A 1L8XA 4D9NA 2QT9A 4TN5A 1NKVA 1J0XO 1J5XA 4RCZA 3IR5A 3DMPA 3IXMA 3R6DA 4K5QA 3RVOA 4M3NA 1PJZA 1RRPA 2DOKA 2P2ZA 3EGWA 4FNMA 3JVDA 2IYTA 3U7RA 3DLBA 1NW4A 2OSBA 1C7JA 3CSUA 4ZHQF 4DV3B 2FOXA 2RG1A 5LOVB 3WL7A 1YDWA 4ZPJA 1WP4A 2HREA 3P2YA 5DNWA 2RHBA 4OKIA 4L02A 4W1PA 2PG3A 2ZXUA 4CT0A 1A04A 3D6AA 3MTJA 3I9OA 2CUNA 3VSEA 4BKMA 4WVLA 5I45A 4HLQB 1DKNA 4XOUA 4V1CA 2X0IA 3ZWQA 2LGJA 1AVTA 4E33A 1RRFA 2Q6KA 2ZUBA 3QSGA 4YP1A 1NNLA 1EJBA 4GM1A 4O4IF 1RJEA 2R3SA 3AY0A 1VMKA 3DDZX 5CLGA 4YRCA 4UCXA 4DIBA 5B7NA 1JFFA 3QVGB 2E4VA 2WKPA 4N54A 2NO7A 4E46A 4NWIA 1CUYA 2A0YA 1ZCJA 3MB8A 2BGWA 1COZA 4DCMA 1W94A 2C59A 2HDWA 2NO1A 2RH8A 1VIDA 1KDOA 1Z2CA 3NYQA 1EUZA 1KTIA 4QM7A 1EUCB 3STHA 4KHZA 3Q40A 1QG4A 2HSJA 4UHKA 1S2MA 4WFIA 5KDDA 2M1XA 1C0KA 3QJ5A 3PC7A 3RF6A 4Z0NA 4KWCA 2OO5C 4W9NC 4DE5A 1J42A 4DF3A 3SKYA 1V11A 4EBBA 2IHKA 5IF3A 1WMEA 2OEPA 2X0NA 3WS7A 4WQMA 1S2LA 2ARKA 5ALOA 1CF4A 3CX6A 2GXUA 3ECAA 2HMUA 5BSMA 4BLTA 1XG5A 4YCJA 5EJ2A 2R9VA 4DLYA 4MW7A 1GEEA 4OI4A 1ISRA 5L6MB 4LJ5A 2GM5A 5INTA 2P41A 3ODGA 3E5NA 2A5JA 4PO1A 3LXRA 4W8GA 4G0UA 4Q16A 1G5PA 1U3CA 1ZRNA 2FWMX 2HT6A 1V95A 2RGBA 3U3RA 2R4UA 2P3LA 3WQSB 1W4CA 1ZM9A 1G17A 1MVLA 3VNRA 4EEXA 1B73A 3F5QA 4TZTA 4AF7A 1FTGA 1NBEA 5L3SA 3I9MA 4BJ1A 2YJ5A 1J06A 1P5FA 1VC2A 2CXQA 3BXZA 1JIXA 1FXWA 3EIOA 3CY6A 3Q7RA 4YDRA 5E6UA 5BYKA 1CYEA 1BEZA 4O25A 1DELA 1PL0A 1OSNA 1NQXA 1OXUA 1XVUA 1YQTA 3LKDA 4M0PA 2VNHA 1UJ6A 2RHRA 3GZNA 3KKPA 1PFWA 3QYAA 5GP1A 4ZEXA 1X1DA 3TSAA 1OWNA 1CQJB 1ECBA 3RT7A 2BC9A 4JJEA 3SR0A 3ND7A 2XMBA 3GJTA 3N2LA 2OHIA 3B6JA 3L7JA 5FWDA 2XKBA 1N0WA 4A26A 1JAZA 4RJKA 3R24A 1ZK0A 1MJ5A 3GNQA 5TIIA 3ERCA 4LWOA 1V1RB 5LMZA 1P62B 1NPTO 2XW6A 1N3YA 1GL7A 3GT7A 1F20A 3A3NA 4CM8B 2UU9B 3EHDA 1WMBA 1YRBA 3AEUB 3PBKA 2JATA 2VJLA 3IQEA 3NDJA 4KXYA 4MRMB 4X84A 5G0SA 5B1SA 4EKGA 3OJFA 2MDTA 3H6GA 4Q9JA 2VNAA 3FI0A 3ICOA 4JLWA 2R11A 4A6PA 4EPTA 1A9PA 1FSFA 1PFUA 2IXDA 1O94C 2AR0A 4QDOA 2X4LA 4QHTA 4DRZA 3CNOA 5K51A 1RCUA 3IODA 3IAEA 3QFRA 3PR1A 4WECA 4ILEA 4FDUA 3LO5A 3KYCB 3AEQB 4JSRA 3VJMA 3WTCA 1AMNA 1VIYA 4C0BA 1A9ZA 3KUXA 3W8DA 2XB6A 3JPWA 5D3QA 3QX3A 2WTNA 1G6OA 4WZBB 3UJ3X 1N0VC 2PIDA 2Y2VA 3OPMA 1KZ1A 3RYHA 4EA7A 2D2VA 5B53A 4OVKA 1IHDA 4FHGA 3Q8WA 1RCFA 4CKZA 1GEGA 3CNHA 2VQ6A 4IVQA 3ZWKA 5HW0A 3DHYA 3B1FA 1X0VA 4P0PB 2PZEA 2MINA 4Q4CA 4U00A 2O07A 2ZXEA 4F21A 5CK5A 1RPAA 4RQUA 1LDMA 2YQ5A 4FHCA 4IGEA 1RQLA 1EFRD 3RABA 1MV8A 3IAXA 4XB2A 4ZA2A 2DY0A 1Z15A 4Z6KA 1T8YA 1Q14A 2I1LA 4DLLA 1PGNA 2C9OA 4IXNA 1O5IA 5HM8A 3O0TA 4GAEA 1PVVA 3PNPA 1NUUA 3SEZA 3V5NA 3BVPA 3TI7A 1PL8A 5DASA 1DU4A 5K0ZA 4M0MA 4XSVA 4HNSA 2GZAA 4WD3A 2F8MA 1NPDA 1R50A 2RGEA 2VUUA 1UBUS 3AW8A 1U7WA 1FNSA 1MVNA 3N75A 4WK0B 2Y93A 1X7XB 3R3YA 1XMPA 4HDRB 3SZGA 2FLVA 4AFNA 2I7XA 5A7HA 3MT9A 4FC6A 2QRMA 5SV2A 4OQNA 5DTQA 1WCIB 4Q4LA 2HGSA 2JARA 2IYNA 3ZJ4A 3LRTA 4BYMA 1X14A 4GVXA 4YRAA 3NVKI 2K5UA 3LIIA 3E48A 1PQUA 2RG7A 4TTSA 2KYRA 2XADA 3HJAA 2C3MA 4I9HA 1JU9A 4UDNA 1LF5A 1Y8AA 5CIQA 4EARA 1FIUA 3U44B 3PFNA 4O5AA 3LTNC 1IPHA 3QW2A 2A0XA 4UOQA 1I3CA 5BVGB 3KQHA 4TYWA 3ZWAA 2Q50A 1D6MA 5A9TA 1DCKA 1DWOA 2W6ID 2GYUA 3BEOA 5EUMA 5GAJA 2Q0SA 4FK8A 4ECAA 1GNLA 2O5VA 5IM5A 4CPDA 5LR6A 1O6FA 4RHEA 5BV1A 3GLIE 1V9LA 3V34A 2IHNA 9MHTA 2JJ2A 3L40A 3STUA 1KRHA 5T41A 4DDVA 4DIOA 4XD2A 5F98A 3AFMA 3I52A 1NVDA 3DXZA 1GV1A 4R2MA 3FYUB 1DO8A 2YDXA 4BDSA 1YQWA 3UJAA 3ZWNA 1EU1A 3HCPA 2VJKA 4Q02A 4RDHA 2XE7A 3OZVA 3VNBA 3U19A 1BQEA 4MV0A 2PT9A 5LZ9A 1AXGA 3O93A 3OZCA 1FW8A 2B34A 1E99A 1CUVA 1J8VA 4O4LF 5A3RA 2GTPA 3U80A 3GFGA 3S4YA 1EXVA 4YH1A 3GXOA 1G5RA 1FYDA 2IJGX 4PGFA 3FDIA 1NIJA 1XGKA 2GXQA 1SZCA 3P32A 3QOXA 4PZPA 1CUZA 1D2AA 3Q2KA 1K8YB 1KKUA 3IA7A 3I04M 3QEJA 5I9IA 3C1OA 4R6XA 4ENQA 1CS0B 4KLCA 3WAKA 3VNVA 2VC2B 1R8YA 1VZ3A 3CZPA 3LP6A 3KLBA 1XZJA 3ZKWA 5LP6F 4AY2A 1QGOA 4QDXA 3JQBC 3BL8A 4WLFA 3A06A 3NO4A 1Z68A 1J39A 4AP6A 2DHQA 3ZDEA 5LMNB 1MW8X 3BCRA 3OQ6A 1RFLA 4NAVA 2XNKA 3COVA 3UN1A 3KQLA 4G5SA 4PPQA 4QOHA 1BDIA 3CBGA 3HWRA 4U0KA 5CNIA 1KHTA 2ZPTX 4INAA 3WLPA 4AF8A 5BMOA 4UTXA 3BF7A 1VSTA 3THWB 1WEKA 3IIEA 3DZDA 4WUVA 2ZU6A 1RXSA 2JFVA 3M5WA 3TG2A 1K0FA 2UZ4A 3QVTA 4JLAA 2ZWMA 3OJ0A 1P4JA 1E3WA 2ZWOA 3HDTA 3SOPA 4U4AA 1KJWA 4IILA 4D92A 3PUHA 1CXZA 2V7EA 3HDQA 1KE1A 4WADA 3EPRA 3HR4A 3VPGA 1N2GA 3ABSB 1ZGCA 2Z8ZA 2NZVG 3DAOA 1IIRA 3CN7A 2HY7A 3NI2A 3GJ8A 4CUKA 1N25A 3E22B 1GU7A 3EEQA 3PDIB 3MINB 3EMKA 4R05A 2B1JA 3KV1A 3PNLA 3G0DA 5CFNA 4FYMA 2JFGA 4YK7A 3UW3A 5ALWA 3NOOA 1RDFA 3MTQA 4LHYA 1PSZA 2ILTA 5F12A 4TZKA 3WFIA 2GUGA 3OQIA 2AYYA 1T2EA 1V43A 3B5IA 3PNBA 2NVUB 4PZCA 4F4HA 4TS3A 1FMFA 1MB9A 4IH9A 4JLBA 5EPOA 2ZIEA 2ORWA 4MVJE 3MOIA 3T34A 3TVDA 5CLQA 5BYAA 2LKDA 2G9RA 3ZCRA 4KO8A 3SHWA 4BC1A 2EZUA 2X8WA 3V4LA 2XUDA 2ZW9A 2JI7A 5CD9A 3BZUA 4TS9A 5CFMA 2AZXA 2BM9A 3F6PA 1WZIA 2DQZA 3UTCA 4QYTA 1C7QA 3IAM1 3N6XA 4K9SA 4CMHA 5IJXA 5EC8A 3JXEA 2P9TA 4IX9A 1OLUB 2B7BA 2OILA 3QXGA 4S1WA 1BGVA 2ECKA 2V6GA 3AVTA 3TAHA 4HXYA 3I1JA 4FFPA 4JU8A 4AZSA 3LUFA 2HRDA 5F76A 5G1OA 4QPZA 3TNDA 3GIDA 5EXEA 1NX6A 2CLDX 1VPLA 2J30A 5D51S 4QOSA 3GROA 4ZAGA 4EKYA 4RTNA 2C2KA 1DTEA 4EG6A 4EYKA 4PZ0A 1FYEA 4QOFA 2VG8A 3F6YA 5K09A 4MDFA 1I4WA 2LW7A 4Y2GA 5BP7A 1CDEA 2VO1A 3EDOA 2EKPA 3MJEA 3OOHA 1R0YA 4O2AF 4OK6A 3Q7TA 1JH9A 1F8FA 3VR4H 4MIYA 2DLDA 1UMBA 3CX7A 3VC1A 4D9JA 3ZY4A 4RZ2A 3R7WB 3D6TB 3RD5A 3H87A 4GX0A 3WLTA 5KOYA 2HRRA 1M6WA 3OE7D 4G0ZA 2IYUA 1KAQA 2BSAA 3ASYA 3ROQA 1PSWA 5ESDA 2W2KA 2CV0A 4PC7A 4JLKA 4PBTA 5EKUA 3M8KA 3K32A 2XE6A 3ON5A 2VF2A 3FCCA 5KQGA 3U7FB 2GI4A 2K2QB 4LTNA 2CNDA 2TECE 1QH8A 4N0EA 3UK0A 1H5QA 2J7PD 3T1HB 3KX2A 3ESQA 4CKEA 1RVV1 4UDOA 3NEJA 2GEKA 4NP6A 4WN3A 3TNJA 3BOSA 3VKHA 2FZGA 4WRRA 3T9CA 1AXRA 3MXTA 1L7DA 2GZMA 3LC2O 1T4BA 3P0RA 5FPYA 2Z56A 4MVXA 1ETHA 4PLCA 4IW3B 4NE9A 3CLRC 3IIKA 3L8CA 4PBSA 5E0KB 2ZDGA 3WRYC 4CM9A 5CG2A 2F1RA 3ADCA 4G2NA 1IC6A 1SKYB 4S35A 4XB1A 4CZ2A 3GWGA 2PUDA 1U9JA 3HJCA 1RRGA 5FCDA 1IN5A 2RGXA 2EJWA 1SEPA 3PQCA 5E38A 5K3DA 4EH1A 1BA2A 1PYOA 3E35A 3GC6A 2C98A 2LCQA 5IZ4A 1BU5A 3Q2IA 2RDMA 3DE0X 3TSZA 1JV2B 3QFCA 2WU3A 3M1LA 2IOFA 3IUSA 4QVIA 2Y1CA 4WCFC 4B2LA 3RF7A 1QWOA 1VA5A 4JT4A 4NCBA 3GVPA 3WNQA 3PR2B 2AMFA 2I6GA 4BBAA 5JZBA 2B0JA 4LG1A 3JAKA 3PTZA 1KQFA 1BFUA 3BWMA 2HPVA 1D3AA 4MQFB 3JATA 4W9RA 2FJ0A 4D6PA 1WV0A 4EGJA 3HNPA 3SC3A 1XCPA 3U7QB 1WZUA 3FWPA 3KXKA 5K6AC 3HRHA 5TEWA 3SSOA 1OXXK 1CJVC 4GMKA 2D0OB 1UK6A 2I6UA 2ZIZA 1PR3A 2WKWA 2ZYUX 4BL5A 4ZQGA 1YONA 3TLEA 5EYPB 3T7DA 3ENQA 1QYIA 3D0RA 4H27A 5LA6A 2IUUA 1OXBB 1L7RA 3V7NA 4BX9A 4CKBA 5CD1A 1KQPA 4ZCIA 2BKVA 3FOBA 5ILGA 2Z8XA 5LQAA 3L02A 3GV0A 3QYPA 3DBLB 3JPYA 2I66A 5DP2A 2DQSA 2ZRPA 1GNQA 1WXIA 4H1VA 3IMGA 4ZCTA 2O8BB 3S2ZA 1CIVA 1L4UA 3HUDA 4CGYA 2Z58A 2XRZA 4PSCA 2PU5A 3L49A 1F12A 1GOTA 1BHJA 3EVCA 3Q5DA 2O8VA 1NM5A 1E8NA 1U1GA 3RIHA 5MN5A 1VHJA 1N5IA 4G01B 4ITRC 4QOEA 4XGRA 5DRTA 5AVOA 5REQA 3RVJA 1E18A 3RT9A 3NX4A 4BIIA 2CSXA 3KVYA 2OHFA 4LVNA 5LLSA 3UAWA 4NONA 2B78A 2WZQA 1ZW1A 4OHKA 1Y1KE 3T4XA 4F9EA 4CKCB 3INRA 3DMTA 3TQRA 1I1QB 3ND9A 4X7RA 2CXOA 5DSTA 5FPHA 4IXTA 2QW0X 3QELB 4ZI7A 4RBNA 2PLAA 2Q1UA 2IYRA 4Q3BA 3TL6A 5KB3A 4EG1A 5BV2P 1DVRA 5KYUA 2JB9A 4GL4A 2IX3A 1GZ3A 4XRGA 4KRXA 4POAA 1U2PA 3GP5A 3AWDA 3VKFA 5L45A 3B7GA 4WNYA 4X1YB 1GUFA 1Q1QA 2QRPA 3DDWA 3HXLA 4UZSA 1IZYA 3ZJ5A 3TZ6A 1ZBQA 3LYUA 1MA0A 5JWOA 4GLBA 4UMEA 5KHAA 4G0QA 1WXEA 4FFDA 3QMWA 2XMRA 5CP8A 4D9BA 5CFLA 3WGQA 2V58A 3WWOA 4BRUA 3B3AA 4ZZ1A 3F6CA 1G21E 2RH9B 1SBYA 1T0IA 4NH0A 5F33A 3URKA 3SSMA 4RY0A 1SXJC 1PTJC 5B58C 4PX3A 2CEAA 4C5BA 4W7HA 3RRBA 1UWKA 1LTKA 3FVWA 1B93A 3NRJA 3RIXA 3WNDA 4B87A 1PR9A 4C06A 2XQJA 1TAQA 3H83A 4IGKA 4UFOA 2NSDA 4MPJA 5LDGA 3MQ2A 3M6AA 3CF4G 4NYIQ 5IZCA 3GBVA 4CUJA 5K8VA 2ZBPA 3VO9A 1I13A 5LYJF 3OUUA 2C84A 4KYIB 3SJZA 4MAMA 4MI1A 2IZ0A 3BMNA 1E9AA 1YR8A 4IJMA 4NCJA 4P83A 2YOHA 4YONB 3SSNA 3E3MA 2AN3A 1SXJB 5CIYA 3WOVA 4BNMA 2QV7A 2RGAA 6YASA 1QHHB 4FFVA 4UU7A 3K70C 4HX5A 2DY1A 4Z3OA 2AMYA 2I29A 3WXMA 3KOYA 4X54A 2ZRMA 3QLUA 4RHXA 2NM0A 3QVJA 5HF8A 3RS9A 4LV8B 2YN4A 2GF0A 2PJDA 3SU8A 2YC2C 2I99A 2ZFUA 1NGSA 4MUBA 2OB1A 4LNAA 3BHIA 1XRLA 2QTTA 4JDUA 3RYTC 2C0PA 2ZWVA 3RU3A 2IVZA 4ITUA 4B2YA 1S2OA 4FE4A 4RXTA 3WMXA 3ZGVA 2QWXA 1AB5A 3ZHSA 4DBZA 5CLFA 1RM0A 4Q9IA 1T9ZA 5CH3A 5E95A 4BB9A 3EPKA 3QG5A 2NTVA 1QX4A 1MTZA 4E0BA 1BEUB 1RKUA 1T5IA 5EE3A 1V6SA 4KMSA 1OMOA 1FSPA 2DBZA 1BC5A 1E2MA 5AW5A 1OIVA 2WWTA 2Y0BA 5FBKA 3SLGA 4WSOA 2YR0A 4Q7KA 4DRXB 5LPNA 2QSJA 1E0SA 4UD6A 4QPCA 3JQAA 3EGXB 2JJYA 4C2AA 2NOAA 1KA9H 2D5BA 2GKOA 1AO0A 2NXEA 5HFAA 2IKSA 2Q28A 3N53A 4TTTS 1D6NA 3EEYA 3IQXA 4PHHA 5F3RA 4OREX 2IYYA 3FX2A 4RCYA 5DIFA 1W36C 4O2BF 5IS2A 1C8LA 1DC5A 5DSXA 5ISMA 4NOLA 1UM9A 5EHZA 1YDFA 2O52A 4YCLA 2JF0A 2QY6A 5SY9A 1Y9AA 4MRVA 4HFRA 1KZ4A 1PG5A 3ETGA 1E9EA 1NOKA 3TB6A 5CB0A 1GNVA 1KIAA 2GD1O 3TSOA 4WESA 1EFLA 2J3QA 4NMLA 1FUKA 3T5DA 3WV5A 4M88A 3WZ2A 1KNQA 4HYYA 5JQGA 3E5RA 1K89A 1XCMA 4BQRA 5AFSA 4PAWA 2I78A 2BCGY 3S1SA 5JSQA 5FI5A 4HUQB 4B3FX 3BPSA 2V9CA 1PX0A 1G66A 1ZU4A 2WPDA 4JUDX 4R8SA 1SG9A 2MU1A 3CZMA 3K9CA 1NUTA 3AHFA 1QHSA 2A7XA 3THOA 2RBGA 5K6AA 2YY5A 3UG6A 3VI4B 1ZITA 2FN8A 1ADCA 1EINA 1I6KA 4I1PA 1G3UA 2YVAA 3KYJB 4UC0A 4LSMA 5LVAA 1SU8A 1VE9A 2ZSKA 3A10A 1XF9A 1XRSB 3OPVA 2MYTA 4L5JA 1LNQA 4OXIA 2ILVA 4WCFB 4EGFA 3Q0TA 3TAUA 3U39A 2C4TA 2Z83A 3N2EA 1QVAA 3LWZA 3OHMA 3PK0A 4C30A 4D8TA 5LDDC 4RIGA 2GJSA 1VKOA 1TADA 2QPLA 1U0JA 3ELWA 3QKRA 1K5GA 3A1SA 3M1YA 1QIEA 5CEEA 2EF0A 1KK3A 1TVKB 2FPUA 3UFXA 2BY4A 4AU1A 5I51A 2Y92A 3FZGA 1AE1A 1NFFA 2GN2A 1SU6A 4MUHA 5JPIA 1YQQA 1M8FA 1WXFA 5I4KA 1UJMA 3J81k 1OF1A 2E87A 1K98A 4LSWA 3LI2A 1IN7A 1JQJC 2IYWA 4AY3A 1ZS9A 3A6ZA 3FTNA 2MSEB 4D4MA 5AVZA 1UL1X 1TM3E 1DJMA 3P7MA 3BE8A 1VHQA 1EWQA 4WTOA 3TD6A 2QVXX 1Y63A 1DS6A 3O3NB 2FW7A 2D2FA 5TPZA 4IGAA 1E2PA 5L4NA 4KUHA 3ADKA 1RW4A 3ZS8