3UNXA

Bond length analysis of asp, glu and his residues in subtilisin carlsberg at 1.26a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
b'AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Carlsberg
publication title Protonation-state determination in proteins using high-resolution X-ray crystallography: effects of resolution and completeness.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 86
structure length 274
sequence length 274
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3unxA00
1A2QA 1Y34E 3LPDA 1ST3A 2Z2YA 1NDQA 3VV2A 1TM5E 3WQBA 4WOBA 1TM7E 1WMEA 3EDYA 3GT3A 3VTAA 3BX1A 5FAXA 1SCBA 5JMOA 1SCNE 2X8JA 2XTJA 2B6NA 2G4VA 3I2YX 5B1DA 3BPSA 4M1ZA 1ST2A 1SELA 1PTKA 1GT91 2SICE 2PKCA 3GCWA 4ZOQI 4KB5A 1KE2A 4H6VA 5AVKA 1Y3CE 1WSDA 3WIUA 4B5LA 5JXGA 3D43A 3D9QX 3HJRA 3H42B 1MEEA 2WWTA 1EA7A 1S02A 4FONA 3LPAA 5ARDA 4OMCA 3QMPA 3DE2X 1R0RE 4NE7A 5ARBA 4LVNA 1KDZA 1GNSA 4C3UA 2ZWOA 1BJRE 2SNIE 1SVNA 2Z58A 1WVMA 4CG0A 3VYVA 1R6VA 1P8JA 2WV7A 3I30X 1YJAA 3DDZX 5ARCA 1Y33E 2QTWB 1Y3FE 3T41A 1WMDA 1TM3E 2W2QA 1AQNA 5SICE 1SBCA 3TI9A 2DUJA 3EIFA 3TI7A 3DE4X 3Q5GA 1SUCA 4RYDA 1S01A 1GTL1 1R64A 2Z57A 2X8JB 2W2NA 3VSBA 1SCAA 3WHIA 3ZXYA 1GNVA 2PMWB 3F7OA 2W2MA 1SBIA 1Y3DE 3SQOA 2W2PA 1OYOA 1GA4A 1Y1KE 2SECE 2ID8A 1TM4E 3PRKE 1AV7A 1BFUA 3WIVA 3F7MA 3BGOS 1ZVJA 3A3NA 5B1EA 1PJ8A 4AKSA 4C3VA 3I37X 5FBZA 4HX2A 1TECE 3DE7X 1C9MA 3GCXA 1C3LA 1TK2A 4Z2AA 3CNQS 2ZRQA 1NLUA 3DVSX 4H6XA 3EE6A 1Y4DE 1BH6A 2TECE 3DW1X 1HT3A 1SUPA 3AJ9A 2GKOA 3I34X 2SBTA 4DWWA 2Z56A 4NE9A 3DE5X 1C9JA 4J94A 3DE1X 3ZXXA 3DYBA 2PQ2A 4AKTA 1TMGE 3LXUX 1S2NA 3L1KA 1IAVA 1SUBA 1TO2E 1SIOA 5AVJA 2PYZA 4KPGA 3TECE 3GT4A 4HVLA 1ZVKA 5JXJA 1Y4AE 3P5BA 5AMXA 1PFGA 5I9SA 1DUIA 2DP4E 1YJCA 3AFGA 5JXHA 1P7VA 3F49S 1AF4A 2WUWE 4KG7A 1T1IA 1GA1A 4JP8A 1Y3BE 2HD4A 1SUDA 4ZARA 1SN7A 4CFZA 1SPBS 2DQKA 3QFHA 2P4EA 1IC6A 3LPCA 5FFNA 1VSBA 1BE8A 1THMA 4I0WB 1P7WA 3DW3X 3A3PA 1UBNA 3A3OA 2PWBA 3PTLA 1SCJA 2ZWPA 5K7SA 1EGQA 1OYVA 1SCDA 5AQEA 1SUAA 1YJBA 1Y9ZA 4LVOA 4OMDA 1GCIA 2ST1A 1KDVA 4BWGA 1SIUA 1OT5A 1NDUA 1SH7A 4K8RB 1BFKA 2V8BA 1PEKE 4MZDA 3VHQA 1KE1A 4CFYA 1GA6A 2IY9A 1CNMA 1T1EA 3DE0X 1AU9A 1AH2A 1SBHA 3DVRX 1MPTA 1GTJ1 1TO1E 1SUEA 2IXTA 3DE6X 1AK9A 1Y48E 1V6CA 2Z2XA 3DVQX 1T1GA 5JXIA 4DJ5X 2W2OA 4YN3A 3SICE 1CSEE 4OV6B 4DZTA 1SIBE 1BE6A 4H6WA 1WMFA 2Z30A 1LW6E 4GI3A 5CW1A 3DE3X 2PRKA 4NMXB 2E1PA 1XF1A 1DBIA 3UNXA 3OSZA 1GTG1 2ID4A 1V5IA 1KDYA 3Q40A 1TM1E 2HPZA 2WUVA 4WOCA 3QTLA 1SBTA 1Q5PA 2Z2ZA 2PWAA 3VV3A 1YU6A 1JEAA 3CO0S 1AVTA 1SBNE 1C9NA 3AJ8A 2XRMA 3DWEX
chains in the Genus database with same CATH superfamily
1DWQA 1A2QA 2FAXA 3KO8A 1UC9A 3QVKA 4P82A 5CLGA 1W8DA 1IPHA 3GYGA 1OU0A 3OX3A 3G5LA 1W5SA 4IR7A 3T7EA 4AY5A 1U80A 1FDUA 2WD7B 2G6TA 2Z2YA 4D4LA 4FYVA 4OXIA 4CMJA 1M0WA 4GEKA 5ALJA 4TWRA 5BWLA 3DEHA 3QLJA 4PRYA 4DNPA 3QPWA 3AHIA 1GPJA 4G0ZA 3VKFA 1HDOA 3QQ5A 1GV0A 3NCHA 4D9BA 4RCZA 1O3YA 1Z8DA 1V6AA 1A71A 4NFSA 3BK2A 4QG7A 4EI2A 3DM5A 2FF5A 4CM8B 3R0VA 4GIBA 2ATEA 3VU9A 2R8RA 3JWPA 2R2AA 1VLHA 1YDWA 1F6WA 4G5OA 3ETNA 4M55A 4N3CA 5FAXA 4YCCA 3WYAA 1L5HB 3ZWVA 3BWEA 1I5RA 4ZQBA 1BMQA 1Q92A 5TDHA 3PEFA 4UKDA 4BX0A 3TTSA 3AL3A 4L57A 3OF2A 2PLFA 2JFWA 821PA 2H7CA 2IS4A 1XTQA 4H0NA 4EPWA 1ZJYA 1D03A 5J43A 2IYZA 1LWNA 4RA9B 1HDCA 1HE4A 1N4DA 1N1MA 2E87A 3WMRA 2FPXA 4B7AA 2IYYA 4GE0A 2ZWVA 4UPVA 5FJJA 4BVBA 4KGVA 1GU1A 4B35A 4XAQA 2B6NA 3NKVA 1IY9A 4J8PA 3KOZA 2YWEA 3AQIA 1OREA 4H4CA 4KX3A 2G4VA 3RR2A 1LPPA 5KDDA 1NXXA 2C7BA 5A1TA 3TLCA 2D1SA 1ZU5A 5IDYA 3H9BA 4TSKA 5GADl 3NEPX 1FMLA 1JG3A 2YUIA 4GKBA 4M9RA 3KZNA 2JI4A 3RU9A 1RQXA 3HB7A 4GAEA 2OAEA 3USES 4CT0A 3THWA 3DV9A 1C7RA 2OQIA 3W2FA 3WL8A 2Z04A 2QM0A 3K32A 1JPUA 1NLZA 3L7DA 1LX6A 3TYXA 4AXBA 2QTTA 5JSYA 3VR4A 2VSXA 2V7BA 1S3IA 1KEEB 4D6PA 1RJDA 2XI4A 3DDNA 3ZVRA 3DD5A 4EM6A 4YWHA 3G0GA 3VOAA 1P1FA 1F2TB 1EE1A 4IP0A 2ZTHA 5E1DA 2HQ1A 3ZIUA 5ICCA 4MDEA 3D43A 3EA4A 2IF2A 1ECFA 3RVSA 1RXSA 3KLPX 1IY1A 4I1RA 5J5CA 2CMHA 5BUQA 2HXSA 4F4CA 4F2DA 2PVCA 2XXAA 5J2TB 3V1MA 2CZCA 5CH3A 4H9GA 5DBGA 2ZRDA 1JX6A 4JB8A 1W1WA 4DKJA 1Q2XA 4NVRA 5CITA 4BO3A 3EEQA 3VISA 4QO8A 5KSWB 2R85A 3UJHA 4Q47A 2GM4A 4UMFA 3TL2A 4LPKA 2WVHA 2Z0MA 1K97A 4GP6A 3UUFA 2CF5A 1NY5A 3RSZA 1VG0B 3TRDA 3AUFA 1KYYA 3FCEA 3VAYA 1LD3A 3GXBA 3TPCA 1U1FA 3OIYA 3VNSA 4X7MA 1KR2A 2DJIA 3A11A 2OP1A 2PQMA 1RJWA 3IDFA 3UPDA 5EIWA 5EYPA 3P45A 5EXXA 1N8NA 2NZXA 4FNAA 3AKCA 3BMQA 3OJXA 5DTRA 5IKOA 2DBZA 4ZHSA 3UUEA 4XM1A 4P4UA 4C4OA 5FJIA 2WQZA 4EUSA 3ZHQA 2P2DA 1DJMA 4DV3B 2OHIA 3R5TA 2FDRA 2ZB2A 1BS1A 3V1TC 3W6PA 1WP4A 2VNSA 2QNIA 3EVEA 1H6DA 4REQA 2XA1A 1YRHA 2GBLA 1RYEA 2P8SA 3LCCA 1IWBB 1FTGA 2FB9A 2VRBA 1C9YA 3CKMA 3H8JA 3OCUA 3SE0A 4QLBA 3GLFB 3KVYA 1TCUA 3CU5A 4G37A 2QY9A 3LDHA 5EUCA 1M6NA 1GRQA 2I6FA 3BGSA 3H5RA 3N8GA 3SBXA 2DR3A 1MUUA 4LNUB 3AXTA 1QG2A 4XE5A 1UMDA 4MB2A 1H9CA 2IT1A 4JL6A 1U2GC 3OMLA 3CLRC 2JKVA 3FPKA 3OZRA 1FDSA 1Z5WA 4F7WA 1NX6A 4NZZA 5ADVA 3BMCA 5L4SA 4KRYA 1HO3A 3BN3A 4MA5A 2YWBA 4M8KA 2G4CA 2NV6A 3Q9LA 3TCXB 1EGAA 3PHJA 3NIFB 3EIFA 1ESZA 3TI7A 3ER8A 1DWUA 4DADA 4ZXPA 1FQKA 3EX7C 2DECA 3OZAA 3U0BA 1DIRA 4DSNA 4EW6A 5LR6A 1Z2PX 3C6YA 1IHPA 2XUAA 3BFJA 1ULZA 5BQ3A 3CA8A 1DG3A 5DYYA 5EWMB 3E3OA 3QA3E 2P40A 1SK9A 3L1VA 3RS4A 2ZUEA 2QUAA 3D1VA 4OGFA 2WR8A 2D8MA 2Z8YA 1ATZA 3BBLA 3ES9A 3NOQA 4KMRA 1JG4A 4U9IS 1CUFA 3CNEA 3X1JA 4H7EA 3BRWA 2TYSB 1OWLA 3B52X 3SNHA 4N48A 1CJKC 2D1YA 1FOEB 3F7OA 4OHBA 3STYA 1X9GA 3L43A 1OXKB 3K0CC 3QXSA 3H65A 3DBRB 2A88A 1ZAYA 4Z4CA 1VBKA 1EGMB 3NRBA 5B7QA 4ITUA 1PN3A 1GLVA 4RYLA 5IAGA 2CBZA 2GO7A 2Q99A 3OEYA 5FULA 3QPCA 4F6RA 1WZUA 2BJHA 3PNOA 3RYFA 1VPVA 4A0HA 5LYYA 1KJIA 5CEEA 1MNQA 3BRCA 4ENQA 3N2KB 4NBTA 2EQ5A 4IQ4A 4WZBA 1G5HA 1UZUA 2BGMA 3BB1A 4MVJG 4FE4A 3VSDA 1L7MA 3UC5A 3PYXA 4KNWA 2PKEA 2I1VB 1GQFA 5UKDA 4Z4FA 3LP6A 1SG0A 4LZPA 5AI8A 3RTAA 5JCJD 1E3JA 4HP8A 2YXPX 1NE7A 3LC0A 2VP2A 4WVLA 4X20A 4QSHA 3WYNA 1Y4SA 4BV2A 3AY3A 3M6WA 1YZYA 2V9PA 1UMCA 3GRPA 1GPLA 2HIAA 4AULA 3A6JA 3CVJA 2QUJA 2V7QD 3I0ZA 2PANA 3MMXA 4HC4A 3SZGA 3CEMA 4Q9AA 1HLGA 2IX3A 2N47A 4LK2A 4R8VA 4E6PA 4CTJA 1QQAA 2VPTA 4Z2AA 2P5UA 2X0DA 1WTCA 2OFPA 2Q3MA 1YE5A 3C97A 3ICWA 4KIJA 2ZJOA 4GC5A 4H6XA 5A4FS 3TM5A 1MFPA 3TLBA 4RSRA 2M6RA 4ZXFA 5C8XA 2TECE 2DXIA 4N1AA 5HSGA 1MLDA 1KC3A 5H5JA 3GRVA 4EKDA 4DCUA 5LQCA 1QR6A 5THKA 2PJRA 2HH9A 1T15A 5FOSA 4DJJA 1DQZA 4EKGA 4XOUA 5EE1A 4WK4B 5HIAA 2B0JA 3RARA 4J94A 3VPSA 1VPWA 1YNSA 1WB5A 2QU8A 2PV7A 5LMZA 3MRTA 3RKUA 2HF9A 2ID7A 4G5GA 1YUBA 2WHPA 3AVYA 4KVFA 2B5WA 1OR8A 4NBRA 1ICEA 4OM8A 4MRMB 4V2IA 5K0NA 1ZNYA 1U0FA 3DAFA 3P7MA 4TLEA 1AQUA 4OUDB 3BILA 1WD5A 2GN4A 3FE2A 3ZWDA 4K5QA 5JDIC 1XN4A 4HDNA 1UXGA 1WXHA 3HR8A 4QECA 4IFBA 1NSTA 1L1RA 3A6DA 3PPYA 4I9UA 4MI6A 4RABA 1DDGA 1ZK3A 3HEBA 3O1LA 1Y6GA 3D8NA 2Q6OA 4JEHA 4MPRA 5ENVA 5LMUB 1E69A 4D74A 3PDIA 4PLCA 2RHCA 2ZXUA 1U1CA 2I71A 4B40A 3HUEA 1UH5A 4J03A 1NYLA 3NHFA 1NVTA 1D5CA 5AKHA 2O1XA 4F92B 4BV3A 3QIAA 4PPNA 4V0LA 2IV7A 3LKDA 4IQFA 5C0OE 1JBEA 4BV9A 7AT1A 2J5RA 3QEMB 1COWD 1AHNA 2J9FB 1JI0A 1S2OA 4UE3S 1ENPA 3ZZNA 2W6JA 4CGYA 2HYDA 4W5WA 2YNMD 4KZPA 4U2EA 3BH7A 1ZIOA 3LC1O 4AY3A 2FVXA 1S8AA 2H1HA 2PLRA 3U9TA 3TKYA 3QYFA 1Y1SA 3PB3A 4OHZA 3K1TA 2ZI9A 1DUSA 3HP4A 3AIIA 3R7FA 5T6MA 3LUFA 2L42A 1SPXA 1Z2CA 2AGVA 3I42A 2O8EB 4L9WA 4RDHA 2C1EA 2IV3A 3WOVA 3UGJA 2NSJA 2J9XB 4J76A 3WLRA 4C4RA 1UXIA 1PFKA 3C5CA 2P3OA 2HCFA 1W73A 3IAAA 1OZAA 1QPGA 3CBGA 3GX1A 4OHWA 1RT9A 1MOQA 3M5CA 4Y6LA 1JJIA 3LUHA 4PC6A 3RREA 1NNI1 2IIBA 2W2TA 3NV9A 4P5PA 3IOEA 5HIKA 1DSSG 5JYDA 4G3XA 3P71T 1GYRA 2VP3A 2YN4A 1NVWQ 1SQ6A 3B3QA 2XCOA 3DCYA 4RENA 1U6JA 2WKWA 5AXBA 5LXTF 5C5IA 1OB2A 1RQPA 3UAYA 2JAUA 3K6JA 1SK8A 1RZUA 4MLZA 1NW7A 2I2AA 1LFAA 1XL0A 5I7FA 1O94C 2JIPA 1DQSA 3MYYA 1FXWA 4H27A 1XN1A 4U2CA 4W63A 5DGTA 3Q41A 3UQYS 3GA5A 1CDEA 1I5EA 3E4CA 1AKTA 1SEPA 2QLLA 1Q7TA 2B94A 3NPAA 4S1TA 3RUHA 2PYIA 2VWHA 4F3KA 2C2XA 5IKPA 3G0OA 3NONA 5FORA 1KAMA 4Z3DA 4RH1A 1DVRA 1IY2A 1KKLA 1RE1A 1RWWA 2G1UA 2E5WA 2NSLA 1NN1A 3NRJA 4MHOA 2AKEA 5FV7A 4URWR 2JG3A 1KPGA 3OU6A 3COSA 5DYTA 1OLUA 1KH2A 1PFYA 3RK0A 1ZUWA 4QJIA 3GMTA 1TC1A 5HE9A 4TZ6A 3GB9A 2JFXA 3TJRA 4BWGA 4OYRA 2Q5QA 4HTAA 1G98A 2RAPA 3GZ4A 3IIMA 1QS0B 1WXDA 3PGLA 4UARA 4YO8A 4Z4EA 3DZHA 2XOKA 2Z3ZA 2WU4A 4ANFA 1WBBA 4MUNA 1W29A 2Q9CA 2YC4C 3C3PA 2QOEA 3E3LA 3L0BA 2I8LA 4XWOA 4CF7A 3MQ2A 2ODTX 3DCNA 3OQPA 3PIRA 4FYKA 1KC1A 5F21A 3CR8A 5IJAA 1KE1A 4BVFA 5D6NA 3W5AA 4XJTA 3WHLA 1T4CA 4BRUA 1QE0A 3IXMA 2FEOA 1QZZA 1VJ0A 3MZ0A 1EVZA 2VRCD 4CKEA 3H5VA 3AJEA 2PBFA 3CH6A 4XCVA 5FB3A 2CB9A 4Z4HA 1UMBB 1ZK0A 3PFNA 4X3CA 1YV9A 2JZOA 4MKHA 3CE6A 1MEJA 3KQVA 2ONKA 5C1PA 1OPXA 1VLVA 4KPUA 1M1YA 1SBHA 3F67A 2OLJA 4RWZA 3ZJTA 4YHHB 3LU1A 1NPTO 4QPPA 1C14A 5GM1A 1UBMS 1BCSB 2E7ZA 4OY3A 2FJ0A 4BRWA 5T7BA 3WGZA 1Q57A 2FE4A 1X92A 1NFRA 3R3HA 4RL4A 4HPXB 4MUEA 4MSUA 1EFKA 1DXYA 4WTOA 2PA3A 2QMUA 1UQTA 1P9OA 4PRZA 3RJTA 4ENUA 3ZBPA 2ZCJA 1W5AA 4X6YA 3EA0A 4QFMA 4Q18A 3WNBA 3G5TA 2IOHA 1GFWA 4FYMA 3V4RA 4I8XA 2X3YA 1DHTA 1H0RA 2XJ4A 1KAQA 4YMSA 4DV2B 2X9GA 3LH5A 4OP1A 1A04A 4HAOA 4HMOA 1TJNA 2BCEA 1OZ0A 4E5DA 4WUTA 2CBXA 3CWZA 1A9OA 5EJ8A 1I7PA 4EG3A 1QZUA 1KMIY 2A94A 5B37A 5JANA 5KINB 4GPD1 3K92A 1A8UA 2X5KO 2WSLA 1QHIA 4TS4A 3X1WA 2E3JA 3V46A 5C7YA 1YFZA 1IHXA 4FGSA 4LXYA 1T3HA 3PEEA 3WB2A 5D7BA 2BTQA 1EUDB 2DHQA 1VTKA 3LWNA 4BZZA 1ARZA 5JOQA 2EW8A 1YB6A 3VAAA 1NRIA 4HGOA 4BLPA 1UKEA 1Z88A 1PNTA 1Z0AA 3DBLA 1N2SA 4FWBA 4TGLA 2VATA 4CW7A 3FUVA 4Q4HB 4B2YA 4L4SA 3V1NA 1V4NA 2Y1LA 4P3KA 2P6PA 2ZRIA 3VJRA 4EAAA 3WAKA 2BWJA 5IN5A 3KAKA 4MCAA 4QAQA 1JFLA 3T52A 1N6IA 3TNJA 4F9TA 5HUQA 1JLMA 3KVVA 4A1FA 3DHVA 1YIOA 5A02A 1A95A 4Y2VA 1GL6A 5IKXA 2IA5A 2JIDA 3A6ZA 3ASUA 4GX5A 3U7JA 4GVXA 4EGSA 3LUCA 3T7DA 5EQJB 2NYVA 4ROTA 4LJYA 3HE3A 1XYYA 1G5QA 2N46A 2FSUA 2XA9A 2YH2A 3TJMA 3TE7A 4MVCA 1BC5A 4LBWA 4JDPA 5KSPA 3HR4A 4LYEA 1KXJA 4A92A 4ZZIA 2QYSA 3QRWA 3CINA 4KSYA 4MVJD 1DKOA 3ESCA 5E9JA 3EVGA 4IRMA 4JX9A 1EFRA 3A3KA 4JC8A 2IP4A 3MBIA 3UK1A 3LWZA 2YOHA 5FOXA 2R6GA 2RONA 2VL7A 2OY0A 3B53X 3ZJUA 3B51X 5E4JA 3B2NA 3UWOA 1XTRA 1E3SA 4M9UA 5FTWA 1GCOA 3WGMA 4R83A 3A9TA 1GZHB 2HY7A 1U04A 4MO9A 1FMJA 3FPGA 2QX7A 5IC4A 4LOHA 1IPFA 5K01A 4XYLA 1T2DA 2HMAA 5K0GA 2ZSIA 2QQ5A 1QE5A 3C7TA 4PYNA 4PZ0A 3F6RA 4CIXA 5B58C 4BPBA 2JCXA 1GPYA 3FGZA 2P67A 2FTKE 5BT9A 3PQ6A 4C4AA 2CHGA 5KOHA 3TZHA 4UHKA 1DBWA 2WIDA 4OQMA 1N2OA 4GWGA 2VBGA 3A4IA 4HWKA 5F3RA 3SDSA 1B0UA 4CIVA 2HRBA 5DI3B 4EYEA 2D2VA 2F3UA 1XPRA 2ZYUX 3DWEX 4AKHA 3ZVNA 3T1YB 1PP4A 2IH4A 2IOFK 2DFVA 2PL1A 3UCFA 3LOPA 5A3RA 3FFXA 1MIOB 1P3Y1 4Z0PA 4L51A 3JZMA 4H6PA 5F5LA 3T5CA 3WWOA 2ZU6A 4DDMA 4QFCA 4DPKA 1S1MA 4JLVA 2OBMA 1WU8A 4XKJA 4WLOA 3DAGA 3EPJA 3QOXA 2C88A 2ZE8A 3IJRA 2P3QA 3QMVA 2WE8A 4IHKA 4RDXA 4N8EA 2WM9B 2DFTA 4PICA 3DZFA 4EELA 3GJ5A 4Z2YA 1A69A 1DX4A 2FPWA 2GAIA 3JQFC 3GEIA 3O8QB 4ZQHA 1R0XA 1ZGHA 1Q0SA 3W9UA 2BPOA 3PC4A 1RI4A 4YC7A 3URKA 1W30A 5DCYA 3GT3A 2BJVA 3HU2A 1EXMA 1W94A 1FDRA 1RWNA 2XWQA 4YP5A 2SCUB 3ZUGA 4D2IA 2C2WA 4EY3A 5L3QA 4RTNA 2YC2C 3BL8A 4E2ZA 3KYBA 3U5TA 2JGIA 1I7QB 4I4TB 2WJIA 5LSAA 4HRYA 3IQWA 3PRHA 5JXWA 4N47A 3BXGA 3JQGB 5F9MA 3I61A 3ZY5A 3O4JA 3C8UA 2PT6A 3RC1A 3KWLA 1OAOA 4G36A 3UC9A 1D9XA 3HFSA 2ODNA 3HY3A 3T7KA 3W5SA 2WT4A 3IQIX 4HAYA 5CGZA 1NM5A 3NYIA 3QW2A 5AHWA 3TBFA 5HFJA 5KVVA 4DS3A 5H0IA 1F9AA 1KWGA 2QDXA 3EYWA 3WBJA 1CYEA 1VKRA 4E32A 4JB3A 5JAHA 3LQ4A 1XD2B 3T4PA 1FC0A 1SXJB 1MO5A 1T5HX 2D74A 2C8JA 3WE7A 1ZA2A 4ZYXA 4RM2A 4DABA 4M54A 2Q3BA 3WLMA 3U1BA 2KWIA 3D8BA 4XB6B 4DILA 1FDOA 3DWGA 1XRSB 2LW7A 1O5OA 3QNWA 4AL4A 4FLFA 4J16C 5DLQC 4ACAA 4N76A 2X5XA 1XEAA 1E2GA 1O4WA 4ENPA 3PLAE 4CV1A 2Z3WA 3I9OA 3MJ4A 2YZNA 3WIUA 4BB0A 1KEVA 1P5ZB 2IY8A 2QTVB 1VHQA 5FBWB 2XGOA 4I5IA 2BZ0A 3LUGA 1RAHA 5E9WA 2WJGA 4NARA 3U3ZA 4F2WA 3KB8A 4FE3A 1NURA 1E3MA 3K9FC 1PGPA 1JECA 1R7RA 5BY2A 3MOGA 5EHXA 3IVCA 2EIHA 2RGCA 3PXEA 1JQAA 2QTAA 5FT9A 3TVTA 3ZDFA 5CX4A 2O4CA 4N9QA 4YMWA 2VPXA 1R9JA 3IUPA 2P4HX 5D6OA 4XI9A 3RG8A 1IUNA 2GOYA 3B6MA 3AR6A 3OT5A 3Q10A 4FXOA 5MFPA 1NQWA 4DCGA 3C48A 3G7NA 2FF7A 4D8VA 1UDBA 3OCZA 3DLTA 4QJ3A 3ICVA 5FD8A 3RUAA 4BZPA 1QX3A 5HIMA 2EWWA 3UJ9A 1H3NA 1XZDA 1TTQB 1G63A 1MJGM 3GPDG 3GR6A 1G0NA 1KNQA 4NG4A 4OK6A 4TTRA 4BFUA 4D0RA 2YY5A 2R8OA 3AF0A 2UYYA 3GZTB 4UREA 1CZOA 2G72A 4WXYB 1RLJA 3E2PA 5A7HA 2G9VA 5TGZA 3R6LA 1W2WB 2CXQA 3O3OB 1LBSA 1W5FA 1SQ0A 1JYEA 1NQUA 4JHXA 1OMOA 2RG7A 1QZTA 5BO5A 1L5OA 5H83A 3T1QA 4DWOA 3U16A 2GKSA 3GRKA 2Z09A 4LMRA 3SQWA 4XGIA 2P1ZA 2I91A 2HBZA 4CM5A 4RGVA 4OUKX 1BWRA 1NW8A 1JAZA 2OYRA 3A2LA 3KPUA 2PUHA 3KE9A 4DMFA 1H4SA 1LSSA 1IN8A 1SUWA 2IPAB 1T9AA 1U1DA 4GXQA 3H11A 3BA6A 5U9CA 3RH0A 2FMKA 2PZJA 1SM4A 5AK6A 5GGYA 2Y76A 4KQ9A 4KGZA 3HL0A 1BYIA 1G2OA 3N7TA 2BFDA 3Q5GA 3QPUA 1QG4A 1X3SA 3BZBA 1GPMA 3H5TA 3OOWA 5TNXA 5TS3A 3SHOA 4KO4S 4CT4B 3F7TA 2J3JA 3HRKA 4C3ZA 2O59A 5K03A 1S01A 3L8YA 2NT4A 2QAIA 1RYMA 3FPJA 4FXPA 4NH4A 3M34A 4WPGA 2XMSA 4WV3A 3IP5A 3T95A 1ZOSA 1XNHA 2J5XA 1M0TA 1YB2A 4LI0A 4R7ZA 4O4HA 4WRRA 5KTTA 2DG2A 3ET4A 5ALLA 5G0TA 3AUSA 4N03A 3AF4A 1SA0A 1BA3A 1UJBA 5TQ0A 3DUWA 1KDOA 3TSCA 1EX9A 3WHIA 1WNFA 1CY7A 1IONA 2P68A 4C0AC 1RZRD 2C5SA 1LPAB 2AZTA 2G3YA 4JJKA 4AZTA 1T2AA 3THWB 1CPYA 1I24A 1FTWA 2W2MA 1ODSA 2A2ZA 3A58B 3B6EA 3FKSD 1R74A 4QNMA 4L28A 5SY6A 4AF6A 4G41A 4MEJA 4XVCA 3FRHA 1M2JA 3CGWA 3OP1A 1XDGA 4NU5A 5GONF 3QPBA 2ZWIA 1DOHA 2FZWA 2G76A 2H08A 2RBGA 2VJQA 2ZYWX 4P4SA 4NEHB 3B9BA 4XPIA 3VOTA 3WIEA 5K8TA 2A0FA 3EDMA 1QMGA 3JQEA 1I0IA 4IPTA 4OQZA 4HDKA 3RVJA 5BN4A 2PWPA 3ND8A 1Z07A 3QVUA 2J30A 3FNEA 5DWVA 2XXAB 4PYRA 2Z9DA 1ZXBA 1G8SA 3D59A 2EW2A 4YECA 1YVPA 1E1RD 4K9KA 5B4TA 3COVA 2GBPA 3W4JA 1RWPA 2HWYA 4YRNA 2P65A 3ZZMA 1GFIA 4BFSA 2X13A 1SVMA 4D8WA 5KVSA 4R9RA 1VBNA 4G97A 4AKSA 2MYTA 2A58A 1DXHA 1I4TD 4IVQA 4TLDA 2INGX 3RC9A 3TQTA 3ZGLA 4DGQA 1EUZA 5CHEA 3EDCA 3EK2A 2HZBA 1ESNA 4HX2A 4LRXA 4O2LA 2OB1A 3TSOA 1U9IC 2JBAA 5EIXA 2WTEA 3I58A 1YKFA 3DE7X 3EXFA 2J6CA 3OZSA 1K2WA 3FWZA 3HM2A 3KTFA 5DLDA 1O0BA 4RD4A 2X15A 3CLTC 5CW2A 2PUAA 1UBOS 4FEEA 1M34E 3GPBA 3ABQB 5D5PA 3LCVB 3H5WA 1JNYA 4GBED 3JD4A 5PGMA 1P4HA 2ACKA 1UBSB 3DO5A 2ZUVA 3VTFA 3UOAB 1HEUA 2P5YA 4REQB 1NBMA 3H2ZA 1KK3A 3UW1A 3CF4G 3LA8A 1B15A 4BEBA 2V3CC 3F7NA 1XU9A 4H7IA 3RFVA 4KYVA 4M7PA 3CNLA 4DG5A 3RAEC 1LBIA 3TQRA 3CEJA 3CRW1 4NHOA 3KKQA 1JIUA 3UJ3X 4EBFA 1QVWA 1LPBB 4R2IA 5AKLA 2NAFA 1UBHS 1UOQA 3I9V6 2ORWA 1KEUA 1HXHA 2HNAA 4XOIA 1V1JA 4QODA 3I6MA 1LBTA 2JI6A 2R6AA 4FBMA 2IHBA 3TLAA 2D06A 4QYSA 5BNIA 4HDSA 4WXHA 1N4AA 2PZ8A 5AVSA 1PL8A 3OIWA 4NCIA 3B9RA 2DJ5A 4QDKA 2NUTB 5E7IA 4BFLA 4OMUA 2FPUA 3VHRA 3GVXA 5GONA 4AN0A 1U65A 2J7PA 3NTLA 3ER9A 4CDMA 2DR2A 1G7SA 1KORA 1B6GA 1TM2A 2IUFA 4J3FA 3AETA 2PD4A 2AYXA 1GKIA 3U4QA 4JKIA 4NV0A 3L8FA 4ERNA 3KSAC 4AIIA 1IXKA 3TECE 3Q88A 2GNPA 2IKQA 2Q29A 4KLAA 1A9XA 2ZI6A 4LSWA 1T1RA 1VHDA 3CSDA 3GJ4A 3ZE8A 4D41A 3OQVA 2NPFA 3EH2A 3GFGA 3PICA 3IPCA 4BN0A 3PNLA 1P3DA 2DKFA 4IZHA 5CLFA 5EIFA 4PAMA 4HB4A 3NW9A 3BHNA 3ZGOA 4EFDA 2I4OA 2BMFA 3GP8A 1M2HA 1PJTA 2W58A 4KBGA 5CT8A 1U11A 4ER3A 4J2TA 1YIDA 2ZSEA 1ZOOA 1SHLA 3IE0A 4L8GA 1T3LA 4LHWA 1Z0JA 4K8OA 3F49S 2YDYA 4GLFA 4XCQA 4MGYR 5IAKA 2X1VA 2EZTA 5JRZA 1T1IA 2IXFA 1ZRSA 1QGZA 2IGBA 4D8TA 2F3QA 1Y3BE 3Q0IA 4M6WA 3GIWA 4AY6A 1Z8HA 3MINB 3FFWA 4LEIA 3K09C 1JEOA 1MORA 4F6RB 1E1LA 1P0QA 2NU6B 3RRZA 1SPBS 2QXUA 3D0RA 5EVCA 3CF0A 1XDZA 4TVKA 1OBFO 2EDAA 3W77A 3PVZA 8AT1A 1TEZA 2R7LA 3QUSA 4B3MB 3N6XA 1J1ZA 2HPAA 2PY6A 4CKYA 2HIMA 1SD1A 2G08A 4UBKA 3RROA 2FRVA 3MAJA 4EPVA 5JD6A 2YIMA 3OHSX 3V4SA 1ESMA 1JEEA 3MM4A 2VAPA 4J6FA 4DLLA 4Q3AA 3WWYA 5F23A 1IWOA 2QZ4A 1RHRA 4CQMD 1AQYA 1NTOA 1UMCB 2NZUG 3R3ZA 2FFBA 1HLDA 1VRWA 1VECA 1U5BA 3R9IA 3MGBA 5HQTA 4HATA 4R1MA 2W00A 1H23A 4DSUA 3ZR4B 2QEQA 3ASVA 3IKMB 3L3BA 3RM3A 4KWIA 4ME6A 5K7SA 3IEVA 1FFYA 1UZLA 1OYVA 4FOLA 2GEVA 1UC5B 2FEKA 1QQTA 2XCIA 3HG7A 3N8HA 1RBYA 5FUMA 1G21E 3KLNA 4M0KA 5A5EA 2C94A 3GG2A 4KN5A 3INNA 4JYZA 2ALJA 1DEOA 2ZJZA 4I4IA 4IRUB 3BMOA 4LJ9A 1YJBA 2B1JA 3CNOA 5BURA 4MPDA 4C2TA 3ZU6A 1Y5RA 3QENA 3HJUA 5K8IA 2ST1A 1KDVA 1DWOA 5L7WA 2PX5A 3KOWA 1FVOA 2OV3A 3NEYA 1A7UA 1PEKE 4UMDA 3GUCA 3UWDA 3GJ8A 1G20E 3NHJA 1KL7A 1KMNA 3H7IA 4FW9A 1ZR2A 3TIIA 3LDAA 3G68A 3VO2A 2Q1UA 2WHPB 1DFHA 3IE1A 1NF2A 4FR2A 5ALVA 3VHLB 4F38A 1L3BA 4NZPA 1IQUA 4WKGA 2H4YA 1WD7A 4RM3A 1BX1A 1WXIA 2FSPA 1RBMA 2GMWA 1OVMA 4TPKA 5DBIA 2CLFB 1NXPA 2IY9A 2R6R1 5HQ3B 2ZBEA 1VG8A 5FNZA 1FMCA 1QKKA 4HDNB 1ZJ6A 1OYWA 2ANBA 2AZMA 2YN0A 3DFIA 1WLSA 5EERA 3ORFA 4KQKA 6YASA 1FX0B 1WXEA 2OO5C 3T7JA 2QAGA 3GRFA 3NVKI 1ZZGA 2GTPA 3ECAA 3H8SA 1XQVA 3HFGA 1PNVA 4DMLA 2ODQA 5K3AA 5CBPA 3DZBA 5JV5A 2PIDA 3I2IA 4G8CA 3WQHA 1Z47A 5M2QA 4YCDA 2PAFA 1SUIA 3D1LA 3SEZA 1P1KA 4YMVA 1JHZA 2GPAA 5JAIA 4JT2A 4CL8A 1JLHA 3NVAA 3RIMA 3RRBA 4ID9A 1A8HA 3RYIA 4EQ6A 3NATA 5BRNA 3LX6A 2AN4A 1G8HA 1LBEA 3C4VA 5BP7A 3TQCA 1LTKA 4IMPA 5CNJA 1PL0A 5BW6B 4I6EA 3HJAA 1O0CA 3VSAA 5HKBA 2ZTSA 3M5PA 2WNIA 1PI3A 2FZVA 1HQDA 1G41A 1JW9B 1PJRA 1SIBE 5DX8A 3TFQA 3ZJ5A 1Y80A 3RS8A 2V7UA 2VI5A 1W59A 2IEBA 3AX6A 2J59A 5HCNA 4NR0A 2MMGA 4TL6A 2AOTB 3VYUB 5GVRA 1DPGA 1FP6A 4BWVA 3F3MA 2F1IA 4NESA 2HSJA 3SJAA 5AW9A 1M6VB 5CIYA 1WWKA 5JBQA 2XB9A 1OXSC 2O5RA 1T0UA 4I2NA 1DEAA 3DMFA 3F6CA 3OVMA 3X44A 1HE3A 4BUZA 4H17A 3NFRA 3X43A 3K35A 4W99A 5DK4A 2A4MA 1UP6A 2CNLA 1SHJA 4NTZA 4BVEA 4LZNA 1H2HA 4EX7A 2G25A 2BR3A 4PGMA 1XF1A 2Y1GA 2DERA 3GL9A 3L82B 2OHHA 1V8FA 2J4FA 2QBYB 2PL9A 4FM9A 1OLSB 2C3MA 3HN2A 3SS8A 3JWEA 4WKBA 4JLUA 2HEGA 5LFAA 3BJMA 2WM3A 4BQPA 5JNSA 4JY7A 5DFAA 5TMBA 2B2NA 2FG6C 3Q2KA 1JJAA 4W5TA 1NOKA 1U0SY 4Q1FA 2QD3A 1UDWA 1XB2A 1Z5PA 1YRQA 1RHJA 2NM0A 4KZKA 1L1FA 1N3LA 4E7OA 1JNXX 5BQFA 2RH8A 3EVFA 3HLYA 1W76A 4L0DA 4G5HA 1B6SA 1I4EB 3DOOA 4TTVA 5F1YA 4EGJA 3G7SA 1HEYA 4HWSA 2XODA 3FA2A 3FB1A 2HMWA 3QTLA 4HXYA 4IZOA 4OP2A 4REOA 3TXAA 3U61B 3N87A 4LRWA 2XWBF 1KFKB 1UFOA 2F55A 1KI6B 2XE6A 4R3WA 4KFSA 3JW8A 2RH9B 4A2QA 3L8GA 4C78A 4YCLA 4HVCA 1VL0A 1SVIA 1M10A 4LYGA 4OQQA 1KFJB 5BMVA 2A1TS 1RABA 4LZZA 4DCPA 2C0QA 1P2TA 1D4ZA 2G40A 3AESA 4G65A 3ZXUB 5LM3A 1IIBA 1SG9A 3GJQA 4IDOA 5EXEA 5CRIA 1TMKA 2J0VA 1B00A 1MA0A 4Q93A 1YWGO 5AK0A 2X8BA 4OHOA 1VRCA 1QGAA 1P17A 1FSSA 2FHSA 2WT9A 1U2PA 4KPUB 4KW7A 4F2HA 3IO5A 2O7VA 2WPDD 1W1IA 1E3TA 5DNAA 3I8SA 5HUJA 2BUAA 2A59A 2X42A 4CM1A 1W2GA 4KRXA 5AJHA 3DAYA 1Z17A 1D1TA 3B89A 4XM2A 3RBZA 4MLPA 5LQNA 1A97A 3PL1A 1XDSA 4MYSA 5C5EA 5C4IA 1W19A 1R00A 2QX4A 3WGNA 4RBNA 4X0EA 5DGXA 1AO3A 1J42A 1JPNA 5JMPA 4U2KA 2FA9A 3PF9A 3SYNA 4NAVA 4MP8A 2ECOA 3S3TA 4CMIA 4NBLA 3VRHA 4H08A 3GLSA 4GGMX 3HHEA 1EZ4A 3TLGB 5ALMA 1LLDA 2Q4RA 2OB2A 1NMSA 1TA9A 3ZJVA 2FPRA 2NO1A 1OX4A 1P6UA 2ZJ6A 3G5AA 4ZU3A 4DUGD 2HUNA 1NFQA 3THYA 1BW9A 5EKDA 2CDBA 3D3EA 2JZNA 4KVZA 1NASA 4LQCA 3BX1A 2ZI7A 2ODBA 3A0UA 2VTDA 4K88A 3D4IA 4CEIA 4X62B 2BHRA 4EECA 3JU3A 4P34A 2GH1A 2K5UA 2X76A 2BTQB 3KEQA 3D2AA 1FP4B 2AD5A 4OQYA 1SOAA 1CJMA 2X8JA 5JALA 4JU9A 4X97A 3ZJYA 4DTIA 5K51A 2DE0X 3WK5A 4G4JA 5EA2A 5EXTA 4FGZA 2GF2A 3ADDA 3QEJA 2VAMA 2IZ1A 4JVOA 3GH3A 4CKWA 3CSSA 5JQGB 2JFGA 1Q2UA 3TNYA 3WNDA 3FNFA 3DR3A 3DPIA 1LJLA 1TIBA 1JU3A 1C4KA 1N1EA 4RESA 3BGVA 1BXZA 1CJSA 5EXPA 2E4UA 1D4AA 1U28A 3N76A 3VU1A 4UZEA 2PGDA 4B3FX 2AKAB 1SUFA 2ZW9A 4BMXA 1QQBA 4JA2A 1JR6A 2I6XA 2AFHA 3ORSA 1NBIA 3KLOA 3OM9A 1CULC 2WTBA 4CETA 1Z68A 4V2UA 1XXLA 4RADA 4NEGA 2QE6A 5I5GA 4HAZA 2BGKA 5K3FB 4ARZB 5SYMA 2VAXA 5TEWA 3S99A 4BHTA 3AWDA 4CQJA 1HRKA 1DJPA 4QDUA 3T0IA 3OCYA 2J3IA 1WB6A 1NE2A 3A9CA 1CUSA 3CIOA 3P2OA 5JROA 1XRMA 4EFKA 3HDQA 2KB0A 3IPXA 3MQFA 2VP4A 3E0QA 1M76A 4O63O 3H8WA 4UHJA 5J4YA 4BIMA 2Z9BA 2LZ0A 1R0SA 2B30A 1VMKA 4FFBB 4MQFA 4ERXA 2J3HA 4HWPA 1UBFA 3E22A 3IXLA 4OGKA 4RQBA 2DWOA 4FD3A 4PXYA 4Z51A 3A36A 1SQFA 2XTMA 3SXUA 5DU2A 4ZDKA 4DLNA 1L9KA 1MQAA 1YUMA 2Z2JA 3CF6R 4MS3B 5REQA 4EFMA 4B3IA 3S1SA 3W5BA 3KQNA 4HDCA 4CR6A 1WMSA 4HWOA 2Q2VA 3ITDA 2VLIA 3LDGA 5K6AA 2SNIE 1UKVY 2Q0XA 3R2JA 4M4SA 1CVLA 1VA4A 3O75A 5KWJA 4LMBA 2ETVA 1KFEB 4ZVNA 1AF7A 2FFAA 2YWHA 4N12A 3ULKA 2O1EA 3KWMA 2X9QA 5TPZA 4X90A 3VR2D 4OBWA 1AN9A 3GBPA 2RB4A 1X8JA 2YV2A 5IASA 1L4NA 1Z18A 4CDNA 1GDTA 1FE8A 1QO9A 2QB5A 3OOHA 3G0CA 2TMGA 5ER6A 1OI7A 3WZLA 3EGWA 4RZ2A 2BGGA 5AW1A 1Y3FE 1UM9A 2ZJ1A 3SNKA 2P2NA 1HV8A 1X7WA 2XUOA 5AKJA 1N7IA 1F12A 2PH3A 3TTUA 1MAAA 3QYPA 1ZXLA 3L06A 2BCGY 5AVYA 1ZN8A 2HSWA 2F00A 2GYUA 2R7NA 3I9V1 3BM5A 3QX7A 1EZ1A 1FXUA 2GJ4A 4FKZA 1V7ZA 3W3AD 3BOSA 3ETGA 3W04A 1T0BA 1L8AA 3V2UA 5L3QB 3HRIA 1V11B 1QAOA 3K8ZA 4W1QA 1MRZA 4BASA 1MH9A 1L4LA 3KFVA 4G9EA 1NI4A 1JA9A 4RYDA 1W88B 3OCWA 1EB9A 4AMZA 3KP1A 2QIOA 2Q6TA 4GF5A 5CM9C 4LJ8A 1OVGA 1PJ3A 2A8YA 2Y0BA 1F5NA 2BF4A 3N28A 2BVNA 3K8YA 3P9XA 1X74A 2PUTA 3RF6A 3S7ZA 2YHIA 4I9HA 1N77A 2J5KA 2V7PA 1PGJA 1RWBA 3HCDA 2XEDA 4MWSA 4NYIQ 5DCWA 3AUYA 4UU7A 2XTAA 1NKTA 3OD1A 2JD2A 4QXAA 3MB8A 3V48A 5I7EA 1EG7A 3U7HB 2CJWA 3SXPA 4CKBB 4R8LA 3A28A 3RUFA 1ZIPA 4A91A 2CXNA 2H9IA 4OH1A 4ZAGA 1Z6ZA 4KBYA 3OEHD 4NOMA 3VXKA 1Y3DE 1KK1A 2WAMA 1TQDA 5CIQA 5FI3A 4UHHA 5BNFA 4KQEA 1EHCA 3FOWA 4K05A 1Y9DA 3KB1A 4OHRA 5GY7A 3ZIAD 1IBLB 1R37A 521PA 1YR6A 4MUBA 8GPBA 2QU7A 1YE3A 2KI5A 1ZK2A 1ECPA 2ZYHA 3COYA 4PVCA 5TSDA 1FFXA 2C42A 2OO3A 1U3UA 3K0FA 2XE8A 1SKQA 5HWSA 5ADUS 5FBQB 3GJ6A 4YJHA 4D9CA 3VJMA 5IT4A 3EDQA 3C1UA 3H5AA 3KJHA 4ZVRA 5EEGA 3FLAA 3KQUA 4BLQA 3T9CA 1U8YA 1X1QA 3H84A 3KYJB 4FP9A 4MRRA 4EYGA 4NNOA 1EWTA 1PJZA 2IPMA 3DQQA 1L7NA 1VKNA 2DQYA 2XA2A 4QXQA 5C35A 3UT6A 2R60A 2J0SA 3PGXA 2YV4A 2QGNA 1X7ZA 1Y1QA 3P0EA 4GICA 3NDIA 1CRZA 2QF7A 2FSVA 4HLNA 4N01A 4Y2SA 5ANRB 1K86A 1QYVA 3U4GA 2OPBA 2GEFA 1C9MA 1COZA 1YOBA 2M98A 3I5AA 4Q4DA 4V0ME 3X2FA 3BXHA 3FR7A 1NLUA 1OFIA 3ODGA 4BN4A 2GXAA 4E08A 1U81A 4IX1A 5CCBA 1U3CA 1MIHA 3HS3A 4WA7A 4UNSA 3MRSA 1XA0A 1BH6A 5K4AA 3L1JA 4MVJE 4YDRA 3TUIC 4IIXA 5TQ2B 4Q9DA 4Z7QB 2EP7A 4D9HA 2ZVJA 3HL4A 4MRAA 4R51A 3DEAA 1D09A 1E2UA 1RKVA 2LKCA 5H3CA 2AB0A 2FSFA 4D97A 1KKUA 5JAQA 1ENZA 1BS2A 3ABSB 3FSJX 5DNUA 5KHOC 3WYFA 3I12A 2YOGA 2GAFA 2Q46A 3CWQA 5F7ZA 5JLJA 1YCGA 5IBCA 2X0IA 3A0RB 1WUKS 3T3IA 5KTMA 1MRSA 3HKCA 3LGAA 3ECCA 3H11B 4P5EA 5T6BA 2PKXA 2AUMA 4AKTA 1ISGA 3HKBA 1LKZA 2CJYA 2PGLA 3A4TA 3BICA 1WSBA 5IMBA 3ESYA 3H5LA 2QVXX 2WAOA 3O26A 1S2NA 3P27A 4EZIA 3EPHA 1IAVA 2XNCA 1VZ2A 1PCXA 1SIOA 2NZYA 3EOAI 1C50A 1Z4LA 3O3MB 4RLQA 4C01A 3D64A 2Q45A 1ZY2A 2VLBA 1YL7A 4G1BA 4O4HB 3YASA 2I6QA 3CPEA 2WSMA 4OLJA 4ZU1X 1F8UA 1QHXA 4HVLA 2B4QA 5KYXB 3ABOB 3M2TA 3OX2A 4NHEA 1PG5A 5FOTA 3RSQA 1IN4A 3IAM1 3WGQA 5CA1A 3GOQA 4UQOA 3ZV4A 1UOPA 2JBWA 2WSSA 4GDFA 1X70A 1LZLA 3QH4A 2FSIA 4IKOA 3SMQA 2Y67A 3MWFA 1XJ0A 4H0FA 2F4NA 1T9GS 2A9FA 3KS9A 4YFVA 1WDTA 4LY6A 4CMCA 1XLTA 1D1PA 4W6ZA 2XKJE 5DULA 4EI9A 3FLMA 3OCCA 4KWHA 3GNLA 3RC3A 3LFTA 4C3OB 1A5AB 2NVWA 2YINC 4P0TA 4FOSA 3LL4A 4XPIB 1NMQA 2PKYX 2HMTA 4HN9A 4DM7A 4E2WA 1JLRA 4L08A 1OIXA 1JMKC 4LRUA 1ZWKA 4PONA 5EZQA 3V7FA 5LUAA 2B5OA 1PJLA 4HDKB 3G2MA 1TA0A 1Z15A 1KQNA 1GL9B 1KYIA 5FP0A 3TW4A 4C0KA 5CBKA 2ZUCA 4DA4A 1L7PA 2HBYA 2I03A 3SBOA 2PPVA 3T9AA 1M54A 4TV9F 1MRNA 3CHYA 4MR7A 3SC4A 1POWA 1CZHA 4KACA 3D3WB 4LWQA 2EAUA 5ITZB 5TB5A 1YS4A 1ZCAA 4KN8A 3MELA 4NJMB 3IO3A 2NYUA 1YS6A 1WY7A 4E5KA 3KQKA 1LA2A 3AKDA 3HI4A 5EEHA 1RD4A 3BGIA 5TT0A 4XUDA 2JBAB 2O8FA 3EXFB 3BSSA 3DFMA 1PR4A 4GXNA 3WOHA 1QU2A 4Z0HO 4OJYA 1XG5A 1USVA 4WOPA 3OTQA 4GOOD 1NVKA 4DIEA 1ZCZA 3FI9A 1LDBA 4BNTA 1VI5A 2AOWA 2PSEA 4MQUA 4LFCB 1AUOA 1UOEA 3LRTA 3ROPA 5JAZA 4XWAA 1RRVA 4ZVLA 3PXCX 4QFBA 1NOIA 1GZSA 1J39A 4FCVA 1CUBA 2IW3A 4Q37A 1GCIA 2HF7A 3ZCTA 4Z3OA 4PAGA 1MPXA 1QLJA 1TMYA 2EJTA 4JBGA 4UOQA 4ZYUA 5BYKA 5TMDA 1D2MA 5JPCA 4AY4A 1G18A 1I1QB 1L7DA 4JGGA 1GU7A 3M8KA 5FI1B 3U7FB 1RPZA 5EKTA 1YASA 1QCCA 1N6HA 4JI6B 3SXJA 4CDRA 4BNMA 3EARA 4KO3S 3I45A 4DREA 1LRLA 2MHCA 1LQ2A 4EG0A 4YO7A 4O33A 4WEQA 5MGNA 4KE7A 3R9WA 3FGPA 3PNKA 1U7TA 2X19A 3C3WA 4ZJPA 3TGPA 1C3XA 2RHTA 5AKIA 3WY9A 621PA 2H92A 2QMYA 1C3JA 4EK9A 2X4LA 3HBJA 3L5KA 2JLSA 4BNGA 5ICFA 3LK7A 4NYIR 3TNFA 1VE6A 1JXQA 2A1IA 5JG7A 2B8TA 4DGSA 3KXPA 4P3NA 3MUFA 4I8IA 1AH2A 4F56A 2O8NA 2WZQA 2GI4A 3IGFA 1JE0A 1K7YA 1P1HA 3RSOA 3UMFA 1LDMA 3E3AA 3SZRA 3B6ZA 4P38A 1Q7RA 1HDIA 3SYTA 3THXB 3UKOA 2A7XA 3GBVA 5DHTA 2VCYA 3WRYA 5EMLA 1EP9A 2YUTA 3EODA 4TTSA 4DXAA 1Q7EA 4L9RA 2KYRA 2C2BA 4RHYA 3NH6A 3I8XA 2GUWA 3IQFA 4FYWA 4XIJA 3R0IA 1WP9A 1ZEJA 1M9NA 2HWXA 1G4HA 2ZAIA 4O2BA 1Q7GA 2VJDA 1KZHA 3T34A 1E92A 4JUFA 1CEXA 1CUCA 3O4IA 1VJ5A 5HFAA 5CDHA 4JT8A 3SSAA 3ZWPA 5K3EA 3F8TA 5IXYA 2EFHB 3ZLJA 2D1QA 1QJCA 4M6WB 5FFFA 1WMAA 4EUKA 4KX5A 5AIAA 4EA9A 2R1TB 2CKDA 3SC2A 2ZAOA 1QV7A 4D57A 2B8NA 1Q11A 4LN1A 1PTJA 5TC4A 1TYCA 4JX8A 3RVPA 1ADCA 1IOVA 1K5GA 1N7HA 2QORA 3GEGA 4TN1A 1QGDA 3HUDA 3F5QA 4KQMA 4H1VA 4EY6A 3WKEA 2D7CA 5CEFA 4IWXA 1I2ZA 1PK7A 2CCGA 1PGQA 3L4BA 3JASB 4FFNA 4RPHA 4S05A 2O0LA 5TGTA 2COEA 4R8SA 4X8LA 3RHFA 1HQYE 3L0OA 5DYWA 1UUFA 1F3LA 4IH1A 3I39X 3K20A 4TV8B 2PVPA 1YRLA 1W8IA 2ZRJA 1G3QA 1K92A 2E82A 1CR2A 1ONNA 2ZBQA 1KI9A 2HI0A 3IJPA 4UBNA 1RKQA 1DBIA 3QXXA 4HHEA 4B6GA 5IXJA 1U5BB 3NT4A 9GPBA 3DC7A 2W4QA 3UNXA 5IULC 5JMTA 4M89A 2B8WA 2I33A 2W2XA 1RLTA 3TZBA 1XIVA 4L22A 1WMBA 4I7EA 1XZEA 1EK6A 1RAIA 1U7HA 3QELA 1XAJA 1B14A 1JHVA 1T8UA 5E6RB 3EJ6A 4ACBA 2IRWA 1TD1A 3KJIA 3VU0A 2ZIUB 5T57A 3EMDA 3WX0A 4B4UA 3TBHA 1YQGA 1PL7A 5I9TA 5EQDA 5HF9A 4IDFA 4ZPXA 2F8LA 3E58A 4HAVA 4IIYA 4IUCS 4YMGA 3LM8A 4AUNA 5EE5B 1G8AA 4JYAB 5DHRA 3ZC3A 2XMGA 5FA8A 5M04A 4TRJA 2DQ4A 5AW7A 1DDIA 1PDWA 2BMWA 2Y3IA 2DU8A 3E1SA 5IM5A 4EJ0A 5ALGA 4B2PA 2ORYA 3V32A 4QAJA 1EM6A 5IAOA 1WW3A 4AO8A 4EVRA 1JYFA 1T36B 4IG9A 1AKRA 1WZ2A 1IMJA 1U7UA 2HRCA 2ZJ4A 4P58A 3HVUA 3TLZA 6LDHA 4MW5A 1X38A 3RBAA 2VUTA 3D7KA 5IJ9A 1BGWA 4FQ7A 3SN6A 1KQ3A 2FPPA 5DN6A 3BIOA 5K0JA 2WKSA 1JHRA 3CZ9A 1L5MA 4QULA 2G8NA 5JLAA 3DUFB 2XRYA 3K2QA 4AJHA 2IHJA 1GQ2A 1VCHA 3E9NA 4X63A 4F6CA 3AEYA 4RU1A 1ODIA 3AFHA 1VIAA 1O5IA 2FXVA 3LYUA 3N2GA 4OSEA 1T4BA 4N41A 3N0RA 3ZK7A 3H5IA 2EKZA 4QUAA 5EJIA 3VPDA 4BNZA 1GR1A 4AS1A 5A9SA 2RH5A 2HSGA 4MW2A 5FTJA 5CBPB 1E3WB 4UM8B 2Z5GA 4OOEA 4CKZA 3AI3A 4LZLA 2BMVA 1QONA 4KR3A 1J9EA 2R4TA 5IC6A 2CHVA 1ODCA 3G8YA 3LCJA 5K6TA 2HNBA 2JD1A 1JU9A 3I0MA 3TZEA 1B2RA 4E6EA 3VMFA 3JALB 1E9CA 4Q3LA 5AKGA 5LJIA 4OHMA 4DPLA 4ALIA 4F5EA 4ZC1A 3ACCA 4Q4CA 1ZVVA 3CZQA 2FN7A 5ALNA 3NYWA 3OT4A 3C6MA 3BWBA 4DLKA 1P9LA 4EL5A 4F71A 1SXJD 5K0SA 4CE6A 1P1CA 3H2HA 3VNVA 4LC1A 4N5HX 3LI2A 1MABB 4HZUB 5DO9A 4HXGA 4JS0A 4DOMA 4NC9A 5KVCA 1XZFA 1OLXB 2AKYA 3BTSA 4EJFA 2W6ID 4XM0A 3DVLA 3C5VA 5A7FA 3U4HA 2FZKA 1QB7A 3A10A 1N25A 1U7WA 4CLRB 2BFPA 1Z35A 4L8YA 5B7GA 3C74A 5FH9A 3AHEA 4FFDA 5EXDA 4CR8A 1IIRA 1UJCA 2VHJA 4JXXA 1ZI6A 1WHSB 2DFLA 2TS1A 4QTXA 3BTUA 4Y30A 2I65A 4B09A 1P6QA 1V25A 4LYJA 1LDEA 1I1NA 4OXXA 3WLOA 5B3JC 3HXQA 4H4EA 1VCMA 4BRZA 3TRFA 1YZVA 2PCLA 4WLEA 3OM0A 4YT4A 3HB1A 3KQSA 3HTXA 4RSGA 2DLNA 3OCXA 5IHPA 1RJGA 3DKIA 4G67A 5L6LB 4GL4A 3EC2A 4I2VA 4YJ3B 4UEQA 4KPFC 1Y1RA 1U4SA 5DCLA 1GT91 2H0RA 2YNMC 3L40A 3DOCA 3BWVA 5JRDS 3G9XA 4XIGS 5KYTA 1SOVA 4D8XA 1Z5OA 4K9NA 3QHQA 4B83A 4X6UA 3SZUA 2UZIR 4PANA 4OQFA 2WU0A 3I9NA 5FEUA 1CR6A 2EFCB 3G0DA 3WGHA 4WOKA 4N3GA 5JU6A 4DRXB 1GPUA 3JVUA 4YP9A 3D9QX 1FVFA 1K0UA 3PC8A 4FIZA 4LJ6A 4ZO7A 3RUIA 4LZJA 6GPBA 2Y8EA 1O97D 4NFYA 5ER9A 4J0EA 2FCAA 1Q95A 3NGMA 4X84A 3E8XA 4I1VA 1BU5A 4Y9DA 3S81A 4BVGA 4RAQA 3L7BA 1TU0A 2GPJA 2QENA 3PNQA 1YULA 3F3KA 3G9ZA 4FZJA 4G0OA 3VU8A 3ZX4A 5BMVB 3IMGA 5FUVA 5LLTA 1T5IA 3BF8A 3S2YA 8OHMA 2QE7D 5FPKA 1SFRA 3L02A 2OTCA 4BFXA 3QVSA 3WTBA 3H87A 1OX5A 2FY8A 4QJ4A 1VSTA 1DCTA 1B3BA 4A8HA 1C0KA 2XUGA 2VHCA 3ONVA 3GU3A 5AHKA 3CUUA 3DZCA 3SOPA 5EE3A 1QNFA 2ZJBA 4UBOA 4MB6A 4INPA 5CJPA 2FETA 3UHAA 5K0FA 1EFLA 2BFBA 3ILSA 4I36A 4IHAA 5DMHA 4B44A 1IK6A 1WM1A 3A1VA 5C37A 1JDUA 2GARA 1GNQA 2WV7A 3CX4A 3I6ZA 3N2NA 3WMXA 1KO5A 1Z0ZA 3II6X 3EHEA 1XMJA 2VYVD 1PQWA 2ZRCA 5TF4A 4BC1A 2RAUA 3V7NA 4QWWA 3EFHA 1IZ9A 2BKLA 2UZ3A 3UGTA 3ZG6A 3L1HA 4PYJA 1OXUA 1LPMA 3REQB 1LLUA 3VNAA 2BBOA 3HFRA 1HYBA 4IUBS 4LMPA 2EL7A 1TC2A 3WWPA 5FA5A 5EUBA 2O2GA 4DUPA 2IBSA 1WMDA 4X85A 2C9DA 3IA7A 3FFBA 3PUVA 1JKJA 5MN5A 1P5FA 2O3UA 1CDDA 4O3FA 2NTJA 2LTAA 3KBOA 4LCJA 1GTVA 3JQ9A 5F5NA 3UJ8A 4BV8A 1A3CA 4NS4A 4ZI7A 1XZMA 3THYB 1K6EA 4GNRA 3INYA 4U7DA 4YP7A 4UMEA 4E51A 3GDFA 1V95A 4R16A 5J59A 2ZM5A 2O1SA 4ZI3A 2HO5A 2J0EA 3JXEA 4NCBA 3E8SA 1KAOA 4CEIB 2C7GA 1Q16A 3E23A 3LXRA 4LV6A 2PE5A 4FTWA 3H97A 5FOUA 1MH1A 3DOUA 3SHVA 2ZB4A 3AEZA 3AIMA 1OAKA 5AJWA 4EKYA 1GTL1 1JE1A 2X8JB 2C77A 3SSOA 1Q15A 3AUKA 4PLPA 4RE6A 4X1IA 2NYRA 4UQLA 1Y4ZA 3NHLA 3Q8XB 5CB4F 4J7UA 1R6BX 4N0MA 2CDRA 4Q21A 5HILA 3RJ9A 4EJ6A 3PCRB 1DOAA 2ANCA 1E0JA 3MS2A 2JKZA 3A7EA 2OM6A 4MGEA 4CKWB 2IOYA 1UBRS 2CVHA 2A4KA 2ZCVA 2XKAA 4WBNA 2YZKA 3F78A 3I64A 3NHYA 4PS1A 1TZJA 4HG2A 4PO9A 4K2HA 1JQEA 1P9NA 3CO5A 5AJZA 2CFSA 1GCGA 3GH1A 4DSTA 3K72B 4FUQA 1GGMA 1M7GA 1H1TA 1TKRA 1XNJA 2RGEA 3BXZA 4J1TC 4LDRA 1RYYA 2Y66A 3COWA 2ECFA 3I05A 4TMTA 2VUUA 3E9ZA 2FVYA 2HOQA 3TGWA 1C4XA 2CNOA 2PZBA 4IHJB 1IHDA 1XZNA 4YRKA 4LSMA 1A2BA 1MDFA 2PEZA 1Q1GA 4A27A 1TZ2A 5DP2A 2Y0EA 3U3KA 1PT7A 5KPJA 2MR5A 1T9ZA 2VK8A 3LDFA 4FEAA 4JQYA 5C53B 1H4QA 3V8RA 4YFYA 1IPEA 1IYZA 1V47A 4CM3A 2E6KA 4MQFB 2G1AA 1XWWA 3KTOA 4C1NA 2C3YA 4GD3Q 4YRZA 1JXMA 1XLUA 3E18A 5DISB 1MOZA 1OWOA 3MSCA 3RS3A 3QJYA 3VNUA 4DR5B 5B30A 1F5SA 1FLNA 2PO5A 3IIJA 3JY6A 4HNAA 4LRTB 1PWEA 4UW9A 3NLLA 4LQ4A 1FFBA 4RH0A 1KP9A 1XEXA 1IZYA 3WGTA 2CFCA 1O5TA 4YCNA 4JMPA 1GRVA 3HADA 3WO0A 2AZ4A 4F3YA 1NJ1A 3VSCA 3MK31 3SHTA 4F45A 1E1DA 1XTUA 4L15A 3RCBA 4CLOB 1KZ7B 5GM2A 1ISPA 1VMIA 3KC2A 3K4QA 1Y63A 2XADA 3FCXA 3LT5A 2IUUA 5IABA 1Z2OX 2CFRA 4HDMA 1XZPA 2ZJ3A 3GAZA 2GKGA 4J3NA 3W5CA 4AYTA 2CJXA 5CB4A 1E2LA 3MOIA 3G2HA 2CDNA 4HQOA 1PQYA 2H17A 2QN3A 1RI5A 3FUWA 1NONA 3ABRB 5C7IO 6NULA 1DXOA 1DMSA 2JIZA 2WIFA 1JLSA 3DE5X 4FHCA 2PZKA 4ETWA 5L9AA 4S2UA 4XEHA 3GGCA 4OI0A 1U8UA 4IQ0A 4FJ2A 2FZCA 1K7FB 4Z9YA 2XAAA 1NJGA 3CH7A 3N2EA 1KH3A 2RCYA 4HYTA 2Q7XA 4ND3A 4AO6A 3MSXA 5TARA 3RVNA 4CCYA 1DQRA 3TMKA 3PFCA 4LSZA 4OREX 1XX6A 1NRXA 1NVVQ 1NI4B 3TXYA 3CVYA 3FDZA 4L02A 3F74A 1T3GA 3C6QA 4HAXA 4FB5A 4WKCA 4M8IA 4JI3B 4BE9A 1QLHA 4NOLA 2HJSA 4EVSA 1TCBA 3H4IA 1J2EA 5D3KA 3W5HA 2J7KA 2JK0A 2QRKA 3CISA 4P98A 3ZHVA 4EHBA 2C2ZA 4KFTA 3ILHA 4LX8A 3RK1A 4RVUA 4GC9A 2CJWB 1M74A 3I52A 4AFNA 2J9ZB 1KSHA 4ZPJA 1SBQA 4GKKB 3W2IA 1JDPA 2NV2B 2PXXA 4H7PA 5JO0A 3PDJA 4ZVPA 4XVQA 5H7XA 4ES6A 4JSTA 3AUUA 4X1YA 4XYMA 4M8NE 4ZO4A 4WQMA 4DVGA 3OF3A 1ZD3A 4YXWA 3FTDA 4BO1A 1NL3A 3DFZA 3HO1A 3FGOA 3ESDA 3M9LA 3MD0A 4UXJA 3HWRA 1T3SA 2OE2A 4XGRA 1T6XA 1POXA 3GWGA 3O92A 3ZTTA 3O8NA 3GLUA 4G8BA 3RNOA 1W49A 1WXXA 3U7QA 4FSDA 2D4AA 2MSKA 1QHHA 2FUG6 3HY4A 3KUDA 1ECLA 4HS9A 5DXFA 1TGVA 5FOVA 5LZ8A 3DNFA 3UYKA 4ZIRA 3IVAA 1IC6A 5A03A 3OLYA 3GLGA 1J8MF 4F9GA 1I4WA 2BIFA 1E1QD 2HDWA 1OX6A 1ZX1A 3IRVA 5E6SA 5KHAA 4D80A 1VSBA 1F0KA 1ZG3A 3R3WA 3HO8A 1DQNA 4D5EA 2FG5A 4FK8A 4DA6A 3B6IA 4TYYA 5IZCA 4ZT2A 5E9AA 4F5WA 2G9QA 4R9NA 2A30A 1TEXA 2HAEA 2WKPA 4R1TA 2Y1EA 4TMVA 1VIVA 1JWAB 1RM3A 1E4YA 3PTLA 5A71A 3SIXA 1EIWA 5TVGA 2ZWPA 2ZG6A 1X6VA 4EUHA 1B8PA 1ZEMA 3BUSA 3OPNA 1YO6A 3GIDA 4DT1B 2P6RA 3QPAA 1EA5A 2V6MA 1IK4A 4DIFA 3HXPA 1P6XA 1RKBA 1U0NA 1GZUA 2E4YA 2FSSA 3D02A 2CVOA 5B3AA 2IYWA 3RKRA 1EEHA 2B1IA 3VBEA 2J3KA 2GETA 3LLMA 4U2BA 3FSRA 1DIOB 2IYEA 2R7KA 3R5FA 1E77A 2OAP1 1JAXA 4R8MA 1M6HA 4M83A 4I1UA 4A8TA 4ZZ3A 3ESRA 2DHEA 3H6GA 1OT5A 5K3OA 4DIOA 3UBTA 1XWIA 4CBVA 3GLFE 1BFKA 3PU6A 1Y6RA 1QDLB 2HT6A 4BATA 3OFKA 2P7IA 1HF3A 1KRHA 5EPUA 3I62A 5CYGA 4LDQA 1VLMA 3IJEB 4YLEA 3IV6A 3OLCX 4ZALA 3VTKA 4JI8B 2LIPA 1V9SA 4B4OA 5JNLA 3M83A 2E6UX 1CZUA 3FKJA 1G8FA 1X0XA 3HKBB 1LS6A 1ZQ1A 1V6SA 3RYCB 3HLTA 3BGDA 3OO1A 1THGA 5EKXA 4P3OA 2MINA 5B3KA 4ESHA 3FSEA 3GPCA 3B1VA 3LT2A 4XWGA 1MVOA 1QDEA 2OG2A 1M83A 4PO8A 3SG0A 5CM8B 5CJ2A 3AFIA 2WB4A 2WU8A 1FS4A 3R4VA 4QVIA 1KBOA 4PBRA 4F0JA 4EYKA 3VO8A 1OKKD 1YS2X 1WOYA 5DW3A 3ESBA 5LMCA 2XQVA 2DWQA 1E79A 4CJXA 3IX7A 3I5YA 4G0VA 1XDWA 3I5UA 1E9BA 5LYJB 2JGRA 3OTOB 1ULTA 3OQIA 3ON5A 3WYDA 4PGGA 1OE0A 4L1KA 4NCHA 4D42A 3OA2A 5CA1B 1E4EA 4L8FA 1FFCA 1L7EA 4MDHA 2XECA 2JASA 3SS9X 4F86A 2W48A 3T3MB 3ZEAA 3GGPA 1TIPA 4JLWA 3JARB 1ITZA 2VJYA 4MQBA 3OJCA 1BMFA 1Y5NA 4Q3EA 4DG9A 2IOFA 2GN6A 2C4KA 4HLUA 3GMIA 1XOIA 1IEQA 2PU5A 3BIXA 10MHA 2IHNA 5JYCA 1MO3A 5IWAB 3CPSA 1L6IA 4ROSA 2VFAA 1LV7A 3KKKA 1U02A 4MWDA 3NCTA 3V34A 3WFJA 1CHDA 4QPCA 3KUUA 1I01A 2Z30A 4CCSA 3K9LA 3BULA 4PZAA 5ALTA 4MWTA 4TT3A 4RY8A 1H5QA 2ZQ5A 3QBTA 2CD9A 3DO6A 4Y6OA 1G291 3TN7A 3KUKA 3GXOA 1Q74A 4A6XA 5TEVA 2A0KA 4V39A 1HH4A 3MG9A 5BN3A 1H05A 3HB4X 1BZYA 1LV8A 4Q7JB 4MR7B 4L9SA 4QOIA 1KA9H 3KOXA 4EMTA 4JSYA 2NUAA 2NXCA 3D6MA 3ZDAA 3PFFA 3VKGA 1TK3A 4DCSA 1R88A 2BBTA 3OQ6A 3QBEA 4KQ6A 3O3NB 4R1PA 4BJHB 3HJFA 2PN1A 3R8CA 5I9LA 3G2NA 3EQZA 3DCJA 4FKBA 3TTVA 4WZAA 2FMHA 3VDRA 4K6KA 4HAWA 3QWIA 4XGQA 5HS6A 1PVDA 1SEVA 4FYJA 3GEMA 1GEGA 4TKUB 1MB9A 5JD3A 1B42A 3KZVA 5GIOE 4GOLD 3FJYA 5GTDA 2VNKA 5KX5A 3QEBZ 4JDUA 4QGFA 5HHTA 1HEIA 3R76A 3WLKX 1P45A 1WDWB 1JFRA 3NBAA 4N0QA 4ARSA 4DEVA 1MZPA 3HA3A 4MUIA 1W6RA 4CF4A 3HGMA 5JADA 16PKA 3OI7A 1N6NA 3KUXA 3L6UA 2MCFA 2ZE5A 3VUFA 1B73A 3EGCA 2CXOA 3I4CA 4GLBA 4YRDA 2BISA 2H6EA 1RCFA 1EINA 1H6AA 2GHTA 2RCNA 3DAPA 1TADA 2PWAA 4JCOA 4O4JF 1RU3A 4Y8VA 4HI0E 2PXAA 1NVVR 5B36A 3F4LA 3O4HA 5ILGA 1S8NA 2CNWA 2IXBA 2IBMA 4HQRA 4JWTA 4MP3A 1YU6A 4MRNA 4OQEA 2P2GA 1UCFA 2HX1A 4NOKA 1AVTA 1W0CA 4MW9A 4RS3A 1UQRA 1WL8A 1RWKA 2AHOA 2OORC 3ZK9A 2P2LA 3OQOA 5JWOA 2QZSA 4Y6QA 4DR4B 3P1JA 1JSZA 4BNJA 2O3QA 4CUKA 3AU8A 1MV5A 3BE6A 1VL5A 2PL3A 3R6GA 3KR1A 1EFUA 1PFUA 1ZH8A 3NASA 4CQLB 1CIJA 1ORDA 4IIUA 4BNKA 5EKUA 3OUTA 3OMWA 4M7WA 3C7CB 2C1XA 2FN9A 5FF9A 4ER7A 1GG5A 5IANA 1HZZC 3W4KA 3LPDA 2FPIA 4N40A 5IT9A 5H4GA 3L05A 4MUKA 4RQTA 4KXVA 1XVVA 2A92A 4N65A 4I08A 2DUWA 3PPXA 1EDOA 4O2BB 1XMSA 3PWTA 4Y9UA 4AJ4A 3UV6A 4R2JA 3CWCA 2DGDA 3FZEA 4UXIA 4QJBA 3EVCA 1KYZA 5F33A 2QTFA 1TO6A 1RCUA 2F64A 2ATCA 4L4YA 2MU1A 1X0VA 1JDVA 2XYRA 3PFIA 1PUXA 3OEWA 4A26A 3G59A 1GPBA 5CAEA 1FTSA 2GB4A 3SJBA 1SCBA 1NVDA 4QA9A 2JB9A 4KJXA 3MJDA 5L3ZA 4U8GA 2PK3A 4KYIB 1G3MA 4D02A 5B4VA 2RHOA 2CUTA 1CS0B 1QP0A 2JI9A 1ELOA 5GGXA 5JISA 4PX2A 1UBGA 3PQ5A 3FMVA 4NMLA 4EH1A 3F73A 2XUFA 5DWDA 1S8FA 2FZEA 2G80A 3EMVA 3F4KA 3HXMA 4CPDA 3IUEA 2BEVA 4CIDA 4O4JA 5FUWA 1QTIA 3FCUB 3FHCB 1JIVA 4XJVA 2WINI 2OUKA 4NS1A 1KIFA 1RRGA 3HBAA 4HNVA 2DSTA 1SELA 2J9YB 1PTKA 1J5XA 4PTLA 4Q00A 2OXTA 1FX1A 2VQ3A 4G0XA 1KZ6A 1DTWA 1IFXA 1Y8AA 5JZMA 4G5FA 3N5KA 5ISMA 3OCJA 4L3VA 2B4RO 2GESA 1ZOIA 3THXA 3QWHA 4V3BA 1VZ3A 2I7CA 3AI2A 5AVUA 4V0OA 4KB5A 5AVKA 3EWAA 1R4NA 4AJIA 4F1WA 3O2SB 1IE3A 1T9HA 1P2DA 3DMDA 3EXEA 1E3LA 3FTPA 5HP4A 5ALZA 2OBNA 2G7ZA 4GMDA 2MSEB 3RS9A 1DHRA 2PX2A 3DC2A 3OKFA 2G07A 3HB9A 3LQKA 2R8EA 4JBLA 1MBZA 1N5DA 2FMIA 2PUWA 1B8UA 4RD1A 1K89A 3IR6A 5IJ9B 4JI4B 3QMPA 4DYHA 3KV1A 4ON9A 3TIVA 2E48A 2XNKA 3NJRA 5LP1A 3P94A 4NE7A 3MWGA 4Z7NB 3KEOA 1FP2A 1KIAA 3BXPA 5BVGA 1E62A 5I7UA 1TFRA 4K2AA 2BD0A 1GNSA 3MFQA 2ZRFA 3Q85A 4WESA 3N2GB 1KDZA 4IL5A 3W2TA 1JDBC 1VSVA 2Q5OA 1R5NA 1BJRE 3QOYA 4RTSA 3VOSA 1XQ6A 4LZOA 2OYCA 2J46A 4MULA 1EB8A 3QX9A 4WK0B 5GZ6A 4WGFA 4HRVA 4B0PA 1P0PA 2GCEA 3AEKA 3HUUA 5K3DA 2V55B 4Q19A 4LQDA 5KAPA 1K6JA 3X2SA 3K1AA 2DPHA 4GRAA 4MA0A 4RXTA 4D3YA 2CVZA 4Y1FA 3ESAA 3LXMA 4Y9SA 4WSOA 1RW4A 2G83A 4QPNA 5KI6A 4YRSA 3HVIA 1LBQA 4Y67A 3DV2A 5FI0B 2YFYA 3NIDB 5AR1A 2V45A 2D6FA 5P8WA 4UM5A 1O9BA 2W2QA 3ZE7A 5C8ZA 3GYBA 1G66A 2Y99A 1EFVB 4QO7A 3HQ4O 1SBCA 5CH8A 2RGXA 1V26A 4B5KA 1DG9A 1ZPDA 1KJ9A 3DFFA 2OAGA 4IIFA 5K6RA 3HCCA 4RY0A 2O5EA 3RTGA 2YXBA 1JZQA 4PFKA 4MYRA 1SUCA 1IXZA 4YDQA 3O7WA 2WLSA 2VWPA 4YAWA 4B17A 1YDHA 2YJTD 2ZPTX 4C06A 2B0CA 2L82A 1XJCA 2OZVA 4H1UA 7YASA 4JBWA 2GASA 3PJGA 4JNCA 4M9CA 5I4CA 4IS2A 3IP8A 3PFWO 1YUNA 1VHLA 1LNZA 4YV7A 1GGJA 4EUNA 5EJ5A 2NV0A 1GGNA 3ZGVA 2O7RA 3DDOA 2MTBA 5C31A 4DYDA 2IXAA 3ST7A 4RPKA 3BK7A 1FB5A 2X9VA 1QK4A 2OZPA 2GRJA 2ERXA 4C4PA 3CVUA 1L7VC 1MXHA 4B3GA 5E8JA 1R5JA 2VDWA 5DIZA 2PV0A 1UXOA 3DNMA 1NUQA 1GPWB 1CLUA 1SBIA 3FOBA 3R5KA 3LO5A 4QL3A 1F20A 3BQ9A 4UMVA 4BCDA 4CHTA 1Q1NA 2KM1A 4RX1A 1TLLA 5SZIA 4C20A 1D2HA 5THXA 3O8LA 4WFJA 1RYHA 1FNSA 2ODPA 1B4DA 4QDJA 5DDIP 3RS2A 5CFOA 2BFCA 1ULBA 1V8BA 1CUIA 4RMIA 2BN4A 4FC7A 3SZLA 5L4LA 3GAMA 4GX2A 5ESXA 2QTGA 1Z7WA 3IDQA 3OOYA 4Y6GB 4XTRA 2QSYA 2D7JA 3GMSA 4RELA 2V03A 4LXUA 1OHHA 5F98A 1QB8A 5AUOB 1E8MA 1HZJA 2QPOA 2BV3A 4LI3X 1Z38A 2YS7A 2BUCA 3CLRD 4MUHA 1P7ZA 4NCKA 4R84A 1W1UA 3KPYA 2C9MA 1AHPA 2GCIA 4OA8A 5KNBA 1AQJA 4KR7A 4URXR 1R0YA 1H4VB 4PC2A 3F9RA 1DIBA 4R5MA 3RAPR 3UTCA 4HEJA 4F3NA 4BYMA 3I2JA 1NDHA 4Q66C 1G4UR 1T35A 1MAVA 3IBYA 4FFWA 4AVYA 1OY1A 2N1MA 1YZLA 4KFRA 3VKUA 1TK2A 3UJAA 5AM2A 4RIFA 5KNDA 1HWYA 1AQIA 1S7CA 2Z08A 4H7KA 4BNLA 4CF6A 1KK2A 4DLZA 3M6MD 5BWNA 1ZJWA 5FX2A 4P3PA 3HDYA 3S0JA 1WULS 4MYUA 4WFQA 1H2EA 4GKJB 2BFBB 2IYUA 3LHSA 1GLNA 3OJOA 4ABYA 4DNQA 4RK4A 3IPAA 4QBHA 3DW1X 1G42A 4I9GA 3RT1A 3FYDA 4DEYA 3M1LA 5LOVF 5KYVA 1FS6A 4F3RA 2GKOA 3EAFA 3CG0A 5IM4F 1PV4A 3N39C 1Y9JA 3WIBA 1WQ3A 4G0UA 3A25A 3SQDA 1GQOA 2HQOA 3FPFA 4GWKA 3EGOA 3ZV6A 4BKRA 2Z4TA 4IO1A 3LHFA 2ZIAA 3H5NA 3D6JA 4RZXA 1KVQA 3IDAA 4IQ8A 3SQXA 1JKJB 4MPTA 1Y82A 3MTQA 2IYRA 1L0BA 3H1FA 3OTGA 3PK0A 4ZI7B 1TYBE 1G1MA 2EC5A 2YYAA 4C0QC 1F51E 2PGXA 2FG7C 5K0EA 1P77A 1KZYC 4JXZA 3DT9A 5J2UF 4BE4A 4G0NA 3FLEA 3Q8WA 4DLAA 3DL7A 1S3GA 4G23A 3VPFA 2VPYA 4TTJA 4PN3A 4YCBA 2D3WA 5FO1A 3O4GA 3DYIA 1B1AA 3KG2A 1ZM4A 2PYZA 1JT2A 4IIJB 5E7MA 3P9RA 2VT3A 3EEYA 4JVSB 4TS3A 5FFMA 2RC6A 2W6ZA 5D00A 1DX6A 4V0SA 3JYPA 3WKAA 1M0EA 1N5JA 5JBNA 1FSPA 1OCEA 1ZSNA 1CJVC 4X9XA 2H2IA 3ZH2A 2D00A 3PDCA 1LCIA 2HN9A 1WU7A 1NW4A 1JFTA 2FUEA 4OYLA 4X6XA 1PFGA 2X8LA 3HVKA 3LPNA 1XMXA 3HSYA 5GJWC 1J7JA 2DP4E 1O96A 2X0RA 2GK4A 2H1VA 4JT9A 3LZCA 4WBNB 4X3OA 3HK2A 1BKDR 3G8CA 2CCJA 5I7AA 5EJ6A 1SXJE 1YS1X 2EEZA 4N7MA 4YGYA 1VA5A 4YAGA 1K9SA 3K5PA 1DELA 4JZKA 1KOGA 2QL7A 1UZMA 1ILEA 3ZNPA 2GLXA 3K70B 5FPYA 2ZR9A 3W8RA 4Q3OA 2JGLA 5IJ0A 2QLBA 4P53A 3A1UA 3SFVA 4EGAA 1KETA 3QITA 4P4NA 3EC7A 1P4SA 4DR7B 1CU1A 1K8XB 5HRUA 5DT9A 1WKBA 1YRAA 1ZOLA 5LOVA 2XMPA 1NUUA 2A5LA 3L0ZA 3MYRA 2WYHA 3PZBA 4WK6A 3T5AA 1VGRA 3AF3A 1DRKA 3JR7A 1NBMD 1Q0PA 1R0ZA 4H3HB 4RS4A 3PVCA 3V8EA 3TL6A 5C2JB 1U8ZA 2PXCA 2Z4SA 3KZOA 1ZMOA 3ZE1B 1QGUB 2VSQA 3PYMA 3WK4A 4HNTA 3IR7A 2XMCA 4QUGA 5G3YA 4F9EA 4ODIA 3PNPA 3T0FA 1QAMA 4B73A 5TR9A 3VQTA 1BH2A 5AP9A 4B3TB 1Y42X 3JQFA 4Z5XA 2VDJA 4ZC8A 3VYRB 3PNYA 4RHEA 3RFFA 1FJXA 4OX9B 1VL6A 2EERA 3KJNA 1T3TA 4F8YA 4RKRA 3QUCA 4S1VA 4EENA 1GTMA 3D8TA 5LP6A 1E96A 5FBLB 1RYNA 4UFNA 3DMTA 2P9TA 4KR9A 3IQXA 3TNDA 4OO3A 4NATA 5KQLA 1SUAA 2YL2A 4B1FA 1MA3A 2EWVA 3K96A 4YRIA 2J41A 4KODA 2B3TA 4QATA 2F17A 4UM9B 2QP3A 3UJBA 4HDMB 4BNNA 4FCTA 3DLPX 4FGWA 4LDNA 5DBEX 4N7RA 3TQQA 3U9SA 1JL3A 5KWVA 4Q6BA 1VCIA 3DAHA 5DTJA 5GJCA 1N2BA 2EG5A 4YT8A 4XEUA 2AFVA 1Q14A 3PWSA 1LDGA 4EPXA 2GPWA 2XYPA 4OAOA 2W8BA 1T5BA 2G5TA 2XDWA 3HUTA 4GSYA 3F6PA 3THOA 5C51B 5MDHA 3GOHA 3G2JA 1PG0A 2CL5A 3PHGA 4Y98A 4AWBA 5KTSA 4MVJI 1P4RA 3T54A 4NCAA 1P2VA 4FDUA 4OFZA 4LC9A 5EJ2A 4NV1A 2UKDA 2JLZA 4G0YA 5ALHA 4B7ZA 1A5TA 4IEFB 4GI1A 3ELBA 3PFGA 5CNIA 1HA3A 1C1HA 4ZVTA 3WGKA 5B4UA 3JYHA 4LYFA 2O23A 5DF1A 4XFKA 1DJOA 1SNYA 1JBQA 2GTIA 1Z6PA 3SF0A 5H8WA 5DBOA 4Z49A 4MS4A 4B45A 1K5DA 2DKOA 3IMFA 4GZ5A 2Y0DA 3DTNA 4M76B 4FDAA 1GZ6A 1AKUA 2BELA 4LCEA 2CSXA 3T0GA 4OL0A 3L07A 4K9DA 4OK5A 3SLGA 4ARIA 3AV3A 4LOLA 4RFSA 5ULLA 5BNTA 5I51A 1W36B 2CUKA 3FHJA 1M2VB 1AK9A 2AG6A 3ICOA 4QX6A 1MT0A 3HBNA 4B9AA 4PNEA 4R6WA 1ZUD1 1KP3A 3EOZA 3H2KA 3PUYA 4HQLA 2H4JA 3EUWA 1IL0A 4HFRA 5FPHA 5DM70 3DVQX 2QRPA 3IVXA 3NM6B 3HDHA 3VPBA 5IN4A 1EHIA 1E6LA 2WSBA 3G0HA 4F4DA 4LYHA 1DMRA 5HE8A 2O0MA 4P80A 3U6KA 4DV5B 1A4RA 3B60A 1W4RA 4GQAA 1ZI9A 4HXFB 1PJAA 3R0QA 4YVFA 3RFUA 4ZDIA 2ACVA 3DKPA 5CX1B 3AQ4A 4RZSA 3RIYA 4A15A 3T1HB 1TJ5A 1X8LA 4FZRA 2VCEA 5E3JA 3DP7A 3F90A 3FPAA 4R2LA 4CL0A 3WJAA 4U9UA 2X6TA 5CFPA 3EXG1 2VF2A 2P7HA 3U39A 2GN0A 2HKIA 1DKLA 2PUGA 5BVHB 1XJWA 3PKJA 1AN0A 5CW1A 5AJYA 5J58A 3INGA 5A6SA 5D2CA 4NXNB 1P5RA 2I3AA 3I3SR 4MR9A 1RMQA 1RHQA 3O91A 1C41A 5JPIA 1QP4A 2IH5A 3UMGA 3CH5A 2QZZA 3AR2A 4D26A 3G2IA 1SC9A 4OQDA 3P0HA 1MT3A 1S4MA 2C2KA 3E3NA 3W8NA 3TW0A 4A16A 2QMEA 2H0QA 4BMSA 4XH9B 5J4LA 1E1YA 5BMOA 3E03A 1M33A 4HZIA 2GPBA 4ZREA 2QN7A 1IOZA 4BLVA 1EG2A 2AMVA 4E22A 2XD4A 2Q27A 4HNGA 1MAWA 1PRYA 3FDJA 4FYYA 1Y89A 1NRJB 3OKAA 3BBPA 1RPAA 4GI7A 4HN2A 3QWFA 5BOVA 3ZKWA 2UXDB 5KYWA 2VP9A 1GZ3A 1W6UA 2FWIA 5B1HA 4CL2A 4ZZ2A 2GBCA 4YTEA 1IN1A 2GXQA 4RH3A 3REFA 3W5UA 3AY7A 3KELA 1B43A 4FC6A 5JSUA 4JR1A 2NTVA 4GMFA 5FBVB 4PIMA 1JIXA 1TTHA 1FLDA