3UNXA

Bond length analysis of asp, glu and his residues in subtilisin carlsberg at 1.26a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Carlsberg
publication title Protonation-state determination in proteins using high-resolution X-ray crystallography: effects of resolution and completeness.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 86
structure length 274
sequence length 274
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3unxA00
1GTL1 3A3PA 3DE2X 3WIVA 2W2OA 1GCIA 2Z58A 1ST2A 2B6NA 3DVQX 1AH2A 2Z2YA 4RYDA 1P7WA 2PMWB 1TM5E 1AVTA 3VTAA 1SUCA 5JXIA 4FONA 1DBIA 4DJ5X 2PQ2A 4H6XA 5ARBA 2WV7A 1KDZA 4BWGA 4CFYA 3TI7A 3D9QX 5ARDA 1WVMA 2ZWPA 1R64A 1UBNA 3EE6A 3VV3A 4CFZA 1SCAA 4H6VA 3GCXA 4NMXB 1PEKE 3AJ8A 2ZRQA 3VYVA 4OMCA 3QMPA 1YJAA 1WSDA 2IXTA 5AMXA 2WUWE 2ZWOA 3I34X 1BFKA 2Z56A 4NE9A 1S2NA 1S02A 1PJ8A 1SH7A 3DW3X 2G4VA 1SPBS 4C3UA 1OT5A 3DE7X 3L1KA 1Y4DE 2Z30A 1GTG1 2W2NA 1GNVA 4WOBA 1C9MA 1SUBA 2IY9A 4ZOQI 3I30X 2E1PA 3BGOS 3CO0S 2WUVA 5B1DA 1SVNA 3CNQS 1Y48E 2PKCA 3EIFA 5K7SA 2PRKA 2PWAA 1R6VA 3DVRX 5ARCA 3ZXXA 1KDVA 2Z2ZA 3DVSX 1XF1A 4KB5A 3WHIA 5I9SA 3DWEX 3H42B 1SELA 2WWTA 1GT91 1Y34E 3DW1X 4H6WA 4C3VA 1CSEE 1CNMA 1BFUA 2SICE 1SUDA 3TI9A 1Y3CE 1SIOA 1SUPA 1ST3A 1AU9A 4J94A 1HT3A 1C9JA 1EGQA 3QFHA 3DE6X 1TO1E 2HPZA 1V6CA 1EA7A 3P5BA 1PFGA 1T1EA 3VSBA 3AFGA 1TM7E 1BJRE 5B1EA 4YN3A 1Y4AE 2DP4E 3LXUX 1BH6A 3OSZA 3D43A 3I37X 1WMDA 3F7MA 4GI3A 5FBZA 1Y3DE 1A2QA 3A3OA 3Q40A 2SECE 4LVNA 3LPAA 1TM1E 1AV7A 1P8JA 3DE1X 3F7OA 2Z2XA 3A3NA 1NLUA 3DE3X 3BX1A 5FAXA 3LPCA 1KDYA 5AVKA 2W2PA 2DUJA 1AF4A 1TO2E 1SBTA 1YJBA 1KE1A 3PRKE 1SN7A 1SIBE 1SUAA 4DWWA 4JP8A 2W2MA 4KPGA 1VSBA 1C9NA 3EDYA 1SBIA 1IC6A 3WQBA 4ZARA 1SBCA 4CG0A 1DUIA 1OYOA 1GTJ1 4K8RB 4WOCA 1C3LA 2PWBA 1NDQA 2SNIE 1GNSA 2PYZA 3GT4A 2ID8A 4LVOA 1MEEA 3VHQA 1YJCA 3TECE 2XTJA 3AJ9A 1SCBA 2W2QA 3WIUA 1ZVJA 1GA4A 3PTLA 4DZTA 2ID4A 1Y3BE 1P7VA 4I0WB 1IAVA 1SCJA 1SCNE 1TMGE 1T1IA 1R0RE 5JMOA 4HX2A 2Z57A 3DDZX 4M1ZA 4AKTA 3DYBA 5SICE 3VV2A 1SBNE 1PTKA 1THMA 1TK2A 1AK9A 1Q5PA 1MPTA 3DE0X 1ZVKA 4AKSA 4KG7A 3ZXYA 5JXGA 1GA1A 1AQNA 3HJRA 5JXJA 3DE4X 3UNXA 1KE2A 1SBHA 1TM4E 5JXHA 1BE6A 1LW6E 2X8JB 1JEAA 1BE8A 4HVLA 1Y3FE 1T1GA 1V5IA 4NE7A 1SCDA 3Q5GA 1Y9ZA 4OMDA 2SBTA 3T41A 3GT3A 1WMEA 2P4EA 4MZDA 1WMFA 3DE5X 1S01A 3F49S 2X8JA 5FFNA 2V8BA 3LPDA 2DQKA 2HD4A 1TECE 1Y33E 2ST1A 1GA6A 4Z2AA 2TECE 3SQOA 1TM3E 2XRMA 3GCWA 2QTWB 3QTLA 1YU6A 5CW1A 1SUEA 1SIUA 1OYVA 2GKOA 1NDUA 5AQEA 1Y1KE 4OV6B 5AVJA 3SICE 4B5LA 3BPSA 3I2YX
chains in the Genus database with same CATH superfamily
5C3MA 1LZLA 5EP4A 2F1RA 3OX4A 3TW4A 5JNSA 4ETNA 1QHEA 2ZYGA 4WTOA 3W7VA 4CRWB 1U8TA 3G89A 1HDEA 5A1TA 3UAXA 1CP2A 2BJHA 3IUPA 3KKNA 2R60A 4IYRA 4H7IA 5I8WA 4R3NA 1QBKC 4TYMA 1UM9A 2ZP1A 3MCTA 4NBVA 1NQXA 3SX0A 1D7AA 5G02A 5MN4A 3IL2A 1XZLA 2R8EA 4ZVSA 1EVQA 4KOAA 5A3JA 3L7LA 5IUJC 2PCJA 2NU8B 1P4RA 1DAOA 4XWWA 4P22A 4BOYA 5TQ0A 2WYIA 2Q5HA 1DS6A 4JH0A 3SIWA 2C5EA 1T8RA 2B83A 1E1CA 3O83A 4WFQA 5JCZA 3IVGA 3T4UA 1EGVB 3ZN2A 1NQ5A 2UUPA 3TMYA 1P7CA 2J46A 2PGJA 2HBYA 3GFBA 5K3FA 3NV7A 4B75A 5JZVA 2WWGA 5JSHA 3K31A 1A5BB 4L0DA 4TOIA 1CDOA 4L5JA 1TNDA 3NWBA 1W4AA 2FQYA 4HYQA 1XL0A 3A9SA 4LCBA 1XRLA 1UPTA 2EKPA 3MLBA 4LYDA 1IY0A 1OBOA 3LVBA 5AVVA 3HA7A 1Z4PX 1B6RA 1XJCA 2G4LA 3HJTA 1F2UB 5LPNA 2VQ3A 4HDSB 1AT1A 4MMXB 4E1AA 1BCSA 4XCQA 5FFFA 1QNLA 2PQ2A 4M7OA 1PO7A 3KOXA 3AXSA 3H9EO 4G36A 1EB9A 1XB2A 3R6TA 4WK6A 4M8IA 5LMCA 1MHTA 2E89A 3A2KA 5A4KA 1RQXA 1SQFA 2LBPA 4DMFA 4C7JA 5KZMB 4MKZA 1P2VA 4KE8A 3LECA 3G0BA 4HUTA 4KO8A 5DBFA 3M6VA 3QMWA 2FZWA 5EE5B 3WGKA 1WOMA 4CIWA 3MAGA 4UD6A 5HILA 4OHYA 2NP7A 1GV1A 3UAWA 2BC9A 1RAAA 4HQLA 2D4AA 1JQBA 1BWQA 1IK4A 5LD2C 4RCZA 2YZ2A 1UBNA 2V7EA 2ZBUA 2BE9A 2GI4A 4PY2A 5EKSA 1TEZA 1V35A 3H04A 2D62A 1IPHA 3IEIA 4GI5A 5HUHA 4Q00A 4RTJA 4BO7A 2ZIVB 1HDYA 4HVTA 4LSMA 1T3TA 2NG1A 3BHMA 1SCAA 3HDYA 3OMLA 3V46A 1ZJ4A 4BEWA 3UBTA 1OJ7A 3OCXA 5CFZA 4MULA 1R8QA 5KNLA 2QTHA 1NT2A 4MI1A 4WY8A 5GWXA 5FPKA 1BU8A 3AB8A 1O5TA 3ANYB 4E5PA 2PQ6A 3X2SA 3VKFA 2BM9A 4DMRA 1PEKE 1R9NA 4FN5A 5AXCA 5EHXA 5LQAA 2DR2A 1FFBA 1C14A 1RABA 2X5JO 2I29A 2QXTA 1L5ZA 1MXHA 4CN8A 3AEUB 1F2DA 1JZQA 3DVLA 1Q74A 2WP8J 4TSFA 3WR5A 5BOSB 1IDN1 1A8QA 1U02A 3GRFA 1QP0A 1MEOA 1TI7A 4R5MA 4O1IA 5LKRA 1BA2A 1DIAA 4J9VA 1OX5A 3EAGA 4JXZA 2FN7A 3E48A 4O4HA 3HXKA 4YWHA 5A6VA 4MGIR 2A9JA 1XZKA 3FIJA 4GQAA 4J90A 3B6IA 3NNSA 2PBRA 1JJFA 2PL1A 2YW2A 1CXZA 4Q4HB 5DIZA 1LQTA 5CA0A 3VOSA 1ZVQA 2PTGA 2VRBA 2GTIA 2XQVA 4QBTA 2QMEA 1X7YB 3NWEA 2NO9A 5TJ9A 1SKUA 1B6SA 3B48A 2BI7A 4WNIA 3VHLB 2OGUA 1MVLA 4LK2A 1SOUA 2LVBA 3D59A 2XQFA 1VE3A 4LSZA 1QYWA 3H3JA 5F2EA 2H7VA 1MLDA 5EN4A 1VKHA 2ODTX 3EZ6A 1WW8A 3THOA 1SUBA 4AT1A 1GUBA 3SJAA 3DVAA 2G7MC 2W4QA 3TM5A 3A70A 2Q49A 3IR6A 4P2BA 4J2TA 4QICA 5HM8A 4G1UC 1KS2A 1QONA 4J1SA 4WLFA 2P6PA 1TLLA 3OLZA 4G5QA 4F9GA 2WUDA 1M54A 3O1JC 3FPCA 1Z6XA 4X7MA 1U98A 4X8HA 2I34A 3IE2A 3T5DA 1L7RA 2C4HA 4BMZA 3O4HA 1DCKA 2AUMA 4K1XA 2PE5A 4GNRA 4WXMA 3DLHA 2ZSHA 2H7XA 3SZRA 2QBYB 1N25A 3FXAA 3LT1A 5HIIA 4HTFA 1G9TA 2WSBA 3ZLUA 5BW8A 1XF1A 3TJMA 3SEQA 5CB4A 4A36A 3S5UA 3ONFA 4YDHB 2WWTA 1H3FA 2I8AA 3O90A 3QY9A 4JMLA 2EFCB 2Y0CA 3CKLA 1ZN8A 4NH0A 5KEIA 3ICQB 3P2KA 2PK3A 1WHTA 2EZUA 1CQIB 4QBIA 4BO4A 4UE6A 3ZWBA 1IZ8A 4MQEB 4CM5A 1FL9A 2P6NA 4K9QA 1GRVA 4D96A 1E8NA 3PFFA 1CJCA 1OXXK 3B9PA 3T3DA 3L5OA 1DKOA 3QBEA 3I23A 4KQ9A 4ARVA 1KYXA 4AWBA 3K70B 1T36A 3U31A 1N6RA 3GVIA 3N2GA 1H8ED 1Y3CE 4RYLA 5DWVA 3DR5A 4FNGA 2PU7A 1CY7A 1RYZA 1E9DA 2BGJA 4JXXA 3FOWA 3RD5A 3GP8A 2YXPX 4DM3A 3IVMA 3MJDA 4PCLA 4B3RB 1JZSA 1ZMOA 3WNBA 1M1NA 2GN2A 1AGYA 3L8EA 3Q7PA 2OQ2A 2JCSA 3X1JA 1Q0LA 4A0HA 1PJSA 4PAOA 3TDNA 4CU2A 1IN1A 1XN1A 1MABB 5EUCA 3VR2D 4JLBA 3WSWA 1OA0A 1RNLA 3TK1A 4BP8A 4IBOA 4OJTA 1GKIA 2OV3A 4ENTA 1NAIA 1O4WA 2VJQA 4C4XA 2OCAA 3FN4A 3QPUA 5KKCA 5BQ5A 4ZTZB 4EWLA 1GDHA 4FR0A 4OI2A 4RS4A 3VDRA 3KR2A 3PQ4A 1LZKA 4M0PA 3RO7A 4HAZA 3VYUB 5ES4B 2C9DA 1KWGA 4B79A 2MTBA 3ZHRA 2HJSA 4G0UA 2QR3A 2GEUA 3ZCRA 3II6X 1WCYA 1UEJA 2AXEA 4RD6A 5ECDA 3T5AA 1E7RA 4PZZA 3ZCTA 3BIXA 2XCSB 2BZSA 2HO5A 1G6HA 1VG8A 1K66A 2REQA 2YOFA 3CGGA 3D7NA 1NJ8A 3HYRA 3OVMA 4C5CA 5JFGA 3NHMA 1YJXA 3ENKA 5EXEA 2WV9A 4RPGA 4CMIB 1QGAA 2BFOA 5ALMA 1JIUA 1TAGA 4N54A 4E7PA 1SVUA 1ZA1A 5IYZA 3FKQA 4YJFA 5CT8A 3IO3A 5EPUA 5JIBA 1EBFA 2E5LB 1BH6A 2CNWA 1A96A 1U3FA 5DLEA 2XH8A 1LWNA 1RZVA 4TTAA 5DXJA 2O4CA 3URKA 1GZDA 1WO8A 3I37X 1QVVA 2VS1A 4DKXA 3KYBA 2VNHA 2Z4TA 4M0KA 3DMTC 2ZM6B 1ITZA 2AEFA 1GGHA 2Q5IA 1RJWA 2OCPA 4XPIB 3TX6A 2GBPA 4FD2A 4KW7A 4OAOA 3SCZA 4F72A 2OWDA 1RRCA 1I3OA 3MS7A 2YWFA 8MHTA 1PGOA 3GU3A 4WV3A 3B6KA 5IN5A 3WDKA 5K0TA 1XSEA 4JUFA 3EY9A 5H80A 3DMTA 1HT2E 3DO8A 3I0ZA 3KJNA 3UC5A 1TA0A 5AP9A 3DE1X 4UULA 3DBLA 3Q7SA 3RYIB 1QHYA 4NPCA 3RS9A 1DT5A 2G0NA 2P67A 2CFRA 1ZVVA 2G0AA 1WE2A 3D4BA 1HKUA 2KLBA 2XIJA 3HVUA 1N2SA 1NLUA 1M6NA 1X8JA 1YBFA 1HLFA 1N75A 3GEBA 3GYGA 4BRWA 5K0GA 3DAPA 4B74A 4BP3A 4OX9B 1WSBA 1R4MA 1VE5A 4PYKA 4BVBA 1M34E 4ZI2A 3VJRA 1D0VA 4IWXA 3NUGA 3FHOA 4R31A 4YCJA 3UT6A 2JVJA 1OUMA 3LKDA 1YVPA 4BY9E 3AJEA 2O19A 3S70A 3IQFA 3HU3A 1K6IA 3INYA 4QA9A 2I2CA 2BKUA 2V6GA 4XLZA 1GG8A 5B5SA 4R1SA 1LPSA 4YCBA 3PUJA 1VI2A 3LFHA 5AYVA 1SBTA 1YOVA 2QTVB 5JSFA 5CEFA 1XBTA 1R00A 3E7XA 3ZW9A 3QKSA 5J2TB 2ZOSA 3ASZA 3AIMA 4ZZ2A 3RHTA 3GBPA 2BSAA 1FXWA 1VRCA 2QTGA 5JG7A 3W4KA 2D7CA 3F8WA 1UWKA 2FMKA 3H5OA 2OG2A 3AYXB 4FTWA 4ZEOA 2B34A 4EELA 5EHQA 1IC6A 1KKLA 4ON9A 4L15A 1QPGA 2AKAB 2G9RA 2QRPA 4UEOA 4ND6A 1BKSB 1SBCA 1R4NA 2A0XA 4OJMX 4ZYVA 3NLLA 4J4TA 2BBTA 4RPLA 3AF1A 2AEMA 2IEZA 1G64A 4G86A 3U56A 1AHNA 1SURA 1Z8HA 2P1RA 3AUSA 4J0DA 2CXUA 4P4SB 4RTLA 3EWIA 3C74A 1ZY2A 3I6MA 2F43A 1VPWA 3B9RA 4CEJB 3PFBA 3QE4A 5JW6A 1G4UR 1REQB 4RZQA 4DWJA 3PYLA 2Q4RA 1WXWA 2EATA 2B1JA 2QG4A 2N46A 2BR3A 4X63A 1PJRA 2DBZA 2FSPA 4UM7A 5CW2A 3W5DA 1GQQA 2ENWA 2N9UA 3O2NA 2IF2A 3SDZA 3BMNB 3GZNB 2QG6A 1MEEA 1S3GA 3H2KA 3LCUA 1COWA 3BHIA 4QHSA 4WECA 3PXGA 1T5TA 1Y6JA 1MIHA 2DFKB 2VSOA 2EBWA 4RF4A 3UCEA 3HCBA 2PWPA 2NNWB 2G06A 3KQWA 2IIPA 1VE7A 1X7WA 1GLNA 3MCAA 4NATA 3KZKA 3V34A 2NU9B 9GPBA 1QKJA 4OQQA 1OLOA 1XXHE 4XTCS 3OH8A 5GOZA 2GD0A 3KVYA 2OB1A 3VISA 3CF4A 5KWVA 3BCRA 5UKDA 3WBKA 2VWGA 3N75A 4FXPA 1FRVA 1QLWA 2IXGA 1HY3A 4EKYA 1QQ5A 2PLRA 4BFWA 1XA4A 3MWKA 1Y8AA 1BGVA 2W37A 3PGXA 4YP0A 4GKVA 3RGGA 3IHTA 4DHWA 1XL1A 1RFGE 1PJLA 1VE1A 5GPBA 2AFHE 2YXNA 2IITA 2WKSA 1AKTA 1MVNA 2V98A 3KS9A 1M2OA 3NYIA 4HXEB 3AUFA 4MV1A 4E5YA 5DNYB 2HJGA 5A03A 1IBLB 3HUFA 1UF9A 4TLAA 1TKAA 2F3RA 5FP0A 5BVGB 3GF4A 2BWJA 4UNPA 1RC1A 2ADFA 1FJHA 1FEZA 2Y1CA 3RUPA 4ABTA 3PUVA 3SMQA 5EJIA 2NU8A 1THMA 1Z4OA 1E3LA 2VCEA 1JDPA 1R7RA 1T9HA 3F9RA 3IGFA 4YMUA 1NXQA 4BE9A 4BECA 1E2PA 1ZXBA 3BL6A 4YY3B 1EX7A 3OLVA 3WMWA 1A3CA 1SMKA 3SKYA 2Q8PA 5K4AA 2SCUB 2VP3A 2Z1NA 3EXHA 4ZEMA 5IU6A 4Q3CA 3I72A 3W4JA 1L3BA 4OXNA 2A1UB 3CRZA 1N6KA 1YTUA 3F8TA 1CP3A 4RM2A 4YFVA 2FSUA 1KZGB 3EEIA 3WMFA 1ZSNA 1SC9A 4Q9NA 4ZV9A 3KKMA 3ZTYA 3RUHA 1DNPA 5F7ZA 1GT6A 1J70A 3BVPA 3CUSA 3JRXA 2M1ZA 4W82A 2PSSA 4U7PB 4DWOA 1EFHA 5HKAA 1O3YA 4KVZA 4M7PA 2WM3A 2C3YA 2RGEA 2YYSA 4JLVA 4MPJA 4HVLA 3ZVKA 1HG1A 2HX1A 1T1GA 3PNOA 1XXLA 2B25A 4W5QA 1T1JA 3WWEA 1VBMA 1ZK3A 1Y9ZA 4YGXB 4GEKA 5JT1A 2BKVA 3GJ4A 1PR9A 5HGJA 2GZ1A 4CEHB 4FFDA 3PQDA 4FGLA 4H3VA 1T5SA 4O4IA 3EVBA 3NP7A 1R3DA 1ECLA 1QC5A 1YCGA 2VH1A 3CX4A 2IWRA 4EO7A 2IHKA 1Q0PA 4B4VA 2EFYA 3V1YA 3B9BA 2CLFB 1A7AA 2CE7A 3AVTA 2ERYA 2PRYA 5TGZA 2YWHA 2OXTA 2YMLA 1G41A 1SNYA 2WBLC 4A4DA 1QK4A 2C04A 1VHWA 1S01A 4MV4A 5I6DA 1TJ5A 1PFYA 3NVMB 3ITKA 2GRUA 2RONA 2CZCA 4D46A 3LP5A 5IJ0B 3A11A 1H8HD 3AMVA 3D7LA 3EGWA 4A27A 2AHRA 2I7VA 1R15A 3GHHA 3KQTA 1ISHA 2HD4A 4ID9A 1L9KA 4KXXA 4HVCA 3FH0A 4DY6A 3HXOA 1K6XA 1QZ3A 2MWMA 1J20A 1W9HA 3NBUA 5I7RA 4AF7A 4OFBA 1H2AS 4W8OA 2XB2A 3E1SA 3GLIB 5DT9A 3DFUA 3PNVA 1QU2A 2G0TA 2BGMA 3F74A 3M89A 4FR2A 5AW1A 1NHWA 5K3CA 1N92A 1KJWA 2AJTA 3P9YA 4OXQA 1KEVA 2Q0QA 5E1MA 2VF5X 1DRVA 1E99A 1UC9A 2VJKA 1QANA 2H92A 1EMDA 3NBYC 4XYGA 4OUDA 4QSHA 5AM5A 5TVKA 3UUFA 1KOLA 2HH9A 1KYZA 2O8FA 5KYYA 4B34A 3EW7A 1XO1A 5KTYA 2WAOA 2ZREA 4C1NA 4F6CA 3N6RA 4OLBA 2VNSA 2P9GA 4C4RA 4CEIB 1XMIA 2QTTA 2W58A 2JBHA 3SAJA 1L1FA 3HDQA 2IPMA 3O4VA 3EPKA 3ED1A 4RPHA 1KTVA 2QI9F 4Q3BA 3W6PA 1UXKA 1WP4A 4Q4HA 2GVDC 3RGWS 1S9HA 2ZYHA 3BILA 1M6VA 2WZDA 3U17A 1X7YA 4WJKB 4ONEA 2RI1A 4EX7A 1P9NA 1FQOA 4Y2RA 5IJ9A 3EUFA 1ANKA 1Y5NA 3JVUA 3MB8A 4IIEA 3UXEA 5JH7B 3A3PA 3H1FA 3U7FB 3K0CC 3IVXA 1OT3A 3GFGA 1NN0A 3QQ5A 1AO3A 4HH0A 4TYPA 4XD7A 4KK3A 2ALJA 1K0UA 1IWBB 1UT6A 2GCEA 2VHZA 3CSDA 3WWCA 1ZAYA 4DV6B 1C9EA 3I4LA 5H68A 4N6NA 3Q7QA 1PE0A 2PD4A 1Q12A 4G1VA 4YJGB 2I2XB 5TY0A 5TQ2A 2UVDA 5CFLA 4D4GA 4CG3A 5L7WA 1V26A 3U3ZA 4ZT3A 2OWEA 1U0OC 4M1KA 2Z58A 3K0CA 3KQMA 1C7QA 4BQSA 3K4QA 5A3VA 4CMCA 3A2NA 4HFNA 1X70A 2B6NA 4D0LB 1N78A 2HFKA 4IDNA 1NVDA 1BVYF 1NQVA 2OV4A 3LGAA 3S1LA 4I9UA 2I54A 3X1ZA 2UKDA 1DC8A 3ONDA 1AQIA 3LUFA 5EKDA 4K3UA 3I4FA 1PX0A 3TD9A 1C8VB 1TZ2A 2OBFA 2Q0HA 3QLJA 5IXJA 1BGXT 2VHJA 1N2ZA 5BQPA 3JQ7A 5COAA 5FPTA 3HZZA 1J1UA 3WGTA 4JBHA 5E38A 4X1IA 4YIKA 3K70C 3O7WA 3QA3E 2RAPA 2BMDA 4NBSA 2WV7A 5KNCA 1CQIA 1G66A 1G7RA 1XLUA 3KEMA 2H7YA 5DYNA 1BJKA 1Y82A 4Z54A 2VTBB 3SDBA 4EITA 2VDWB 4ARUA 4BNNA 5CAEA 5KNBH 1NNUA 1V8PA 2C0QA 3CKKA 4FLMA 4B3IA 4A03A 3EGEA 1EFRA 1N3IA 1W36D 4ND5A 3R7BA 2C2XA 1FXWF 3GGOA 2ZRIA 4M1WA 4PFKA 3RJMA 1FQJA 2W22A 1XU4A 4M1TA 3ZHSA 3ZWQA 1WVMA 4JBGA 5DT2A 1W8IA 4PPQA 3PFKA 4XWYA 1R9MA 4BNZA 4ZI7F 3AHCA 5B53A 1LDEA 1PRYA 3CVYA 1Z75A 4DE5A 4NCJA 4UHFA 2N1MA 3WRXC 2FW0A 2HI0A 4Y9UA 3VV3A 1AQLA 4C76A 5JO9A 3KJFA 2IHYA 2H1HA 4R3WA 2CFOA 1T8TA 4JI1B 2NTVA 2O1XA 1HX7A 2HLHA 4G37A 1N3YA 3DFZA 4NCNA 4W8GA 1JDBC 3WRXA 1KGDA 3FPLA 2PYDA 2VNJA 4MAFA 5LMUB 3AJ8A 2F2TA 4KUHA 3V1LA 2J3QA 3EGOA 3HA5A 3R7WB 1UEXC 2V6IA 4LC0A 4PFJA 5BUZA 3FJYA 5DTEA 1TYEB 5FWNA 4XX0B 1VHTA 4Y1RA 4N3GA 3EZXA 1BE1A 3P32A 1UOQA 4MRVA 4ZAZA 3VMMA 4CMKA 1P2UA 3Q2OA 2WF5A 4RMGA 2AN5A 2BUCA 2NVUA 2I1LA 1KJYA 1G20E 4ZEVA 4QDOA 5CM9C 4H6PA 2Z8YA 3GAFA 2FUEA 3JASA 3A1VA 4H7KA 3E7DA 3RC2A 1FDTA 3U80A 3DEIA 4N01A 3JAWA 3ZHTA 4ECEA 5AW7A 1TFUA 2YJ6A 3ASVA 4URWR 3OJEA 4Q3NA 3MT7A 1DBRA 1G3MA 2IDZA 1CUEA 4C3UA 3L4KA 4RKFA 4EJFA 1R6TA 1XQYA 5CIWA 2JLVA 2VHQA 3QWBA 3W90A 2ZANA 1JHPA 2R47A 2TMKA 1NTOA 1NZJA 3K4HA 4RF5A 1KZYC 1YAHA 4RIHA 1PJCA 4FFOA 4F45A 4W9RA 4IX9A 2VSQA 4I50F 1Z28A 1WP9A 3VVMA 4EG1A 1IEWA 1JHDA 3K0HA 1KI7A 2W2NA 3GRAA 1YL5A 3AUXA 2QJWA 4WOBA 5EZSA 2HQSA 2J32A 1DJNA 1XKTA 3MJFA 4D9GA 2ZVDA 4X1KA 5EMHA 2AN3A 5KJ1A 2HIMA 2XE4A 1G6OA 2JGEA 3GGSA 3Q9LA 3BGOS 3RYIA 2FGJA 4K28A 4Y6QA 5DNWA 2H06A 2JH9A 2CLLB 3G2KA 5FLXA 3L6RA 1KNXA 2C7RA 4W1PA 1LQUA 3OMXA 1KAQA 3NCTA 2JRCA 4J2OA 3ME5A 1HE4A 1I2BA 1H1TA 4JSYA 4K87A 4CCAA 1S5PA 3PIRA 2AJ8A 2FPWA 2B92A 2GGSA 4LMAA 2CHEA 1RMQA 1NFQA 2I8CA 5FOTA 3VC7A 2PWAA 5JVDA 4PC6A 3LW8A 3I9MA 5FHQA 3TTVA 4L51A 3SI7A 4QEDA 1ILWA 2HPVA 3A4NA 2HJRA 2CCGA 4FWIB 4D3FA 4S05A 3GMIA 4HAYA 5HBRA 3U7JA 4JUBA 3LRPA 4I1RA 5KJ6A 2JCBA 2PRJA 4BS9A 2M6KA 4O4LB 1EM6A 5P8WA 4CXMA 5J2TA 4G56A 5C53B 3QEAZ 1FDVA 4X65B 1OZAA 4KDRA 4BFSA 5EJ6A 2DC1A 2AJCA 4LZJA 1EVZA 1UR5A 2A5YB 2YHIA 5EEHA 1I4TD 2VWHA 4BNVA 1XV5A 4OFZA 1C4KA 1DIOB 3LVQE 4F11A 1TDJA 3QW2A 3B1KA 1Z6AA 1DWPA 1A9YA 1LBQA 3LK7A 3AEKB 3JQ9C 4YO7A 3SHTA 2JIQA 2FDRA 2EJVA 3IDSA 4H7EA 4O4IF 5LMNB 2BPOA 3ESZA 3QKWA 5DMHA 3OQMA 1JR3D 2PMFA 2HJ9A 1GGFA 3GLUA 1T8WA 2DHQA 3OEHA 3Q1KA 3DEKA 2P2YA 3DDWA 4JLNA 4EYKA 2E4ZA 1DXYA 2GPWA 5AXDA 5CPBA 3JQ9A 4URFA 3OTGA 2XBMA 1JDJA 1U9ZA 2RHOA 4OL9A 3AW8A 4GPIB 3RAPR 1BVUA 3ZS8A 1TE2A 2Q99A 1LEHA 2ZRHA 3AR4A 3GP5A 2WFLA 5LCXA 1O9BA 2OO5A 3ETNA 1N6NA 3OZEA 1U2TA 3TW8A 2R4UA 3PJGA 1UJMA 3AF5A 1II8A 3GFQA 4QYIA 3K15A 1CC1S 1IB0A 1ZWLA 2HPZA 1MF7A 2LTAA 1KEPA 3L6CA 3RRYA 3T5GA 4IIJF 1RHRA 3I04M 1EA7A 5ALLA 3AERA 3P5BA 2C1ZA 1ZNXA 4AY6A 1W581 4BO3A 2HLPA 4ROSA 2JL1A 2Q07A 2NU9A 3BORA 1MC8A 3G9TA 1UC5B 4M0UA 5EIHA 1JU9A 3PS9A 1WXIA 4J0FA 4B84A 5LZ4A 4C87A 3BGSA 4L16A 5DHQA 3CZMA 4GM1A 1OX4A 3EIUA 1U5BA 5J4LA 4NG4A 1RXWA 1JA0A 1VJCA 3B1ZA 4CT0A 2FV8A 3WI7A 1Q0RA 3RVQA 2Q3MA 3SZGA 5HIAA 5ICSA 3KQOA 2RJNA 1H0HA 4LHYA 4RWEA 5DK4A 1TYCA 3SF8B 4X45A 1UKVY 4J91A 3FNGA 1F5SA 4QECA 2FEAA 2GTPA 2XT0A 5HBGA 1IBKB 2YRFA 2ODEA 1RDFA 1V16A 1KRWA 5BVGA 3C39A 1J2YA 1GLGA 3GLRA 4MUYA 1U0BB 2O05A 3PHLA 3V80A 4EG3A 3PPWA 2P69A 1GL6A 2SECE 3MQFA 1OKKA 2J30A 3ZW8A 4D4IA 2Z5GA 1XZMA 4LZPA 4CCSA 5CXUA 5LP6F 2IUUA 1N2EA 1WNTA 1ZN9A 5E9AA 3ZTTA 4CYMA 2VF4X 1O6CA 1RS0A 3GEIA 4J0QA 3RREA 1KEEA 1Y37A 1B43A 3GLHB 2WIBA 1I9CA 2QVGA 1GPDG 2ON6A 4JC4A 3ZYCA 3SQMA 4JR2A 4UEWA 3IVAA 2ACEA 1LS6A 1XMJA 4G97A 3L06A 4JSTA 4MQBA 3JD2A 1BGWA 4Y2PA 3SC3A 3ZY6A 2FR1A 4H1VA 1KPHA 1KI3A 4QOSA 1H4SA 2DWCA 1SRRA 1R5OA 4DGSA 2YINC 3O21A 4MS4B 3P2JA 4I5IA 1TK9A 5KTKA 1C80A 1SVMA 2PHZA 3EFOB 1I51A 3UJ6A 1IMJA 4IPTA 2DCUA 2ID9A 4DLAA 4R3UC 1DBSA 3C1OA 1WD7A 3F7TA 3K8YA 5CRIA 5CYPA 3AVWA 3CF0A 2UXDB 2DTDA 4U2GA 4E46A 2AOTA 4ZCPA 5BN4B 1JN0A 3QEOA 2WTXA 4GKJB 2UU9B 4C4SA 5C46F 3I5YA 4E0BA 4X85A 4INAA 3CO5A 3L0DA 1Y7TA 2JI7A 3VDXA 1V5EA 4DIKA 1BRTA 1C9NA 4NAUA 5C32A 3R4VA 3UVEA 1XZPA 3AI2A 1QBGA 3DOEA 3K96A 3SM9A 5JSQA 2GS9A 2REOA 3EIXA 2VSYA 1T15A 4KIJA 5EI5A 4CNBA 4F1WA 4IHKA 4ZARA 2YWEA 1P4AA 5E1OA 1J6UA 1KQNA 3SLKA 4M8LA 5KX5F 1T6ZA 1BD3A 2WTNA 1XZIA 3IBCA 4WFKA 1ECBA 1XEWY 2QT9A 4EW6A 3G49A 5CTAA 1GTJ1 4I08A 5BSGA 2B3TA 3DB2A 1E6WA 2Q50A 3KJEA 4JLDA 1I3MA 4JEIA 2JBAB 4RLSA 4NZOA 2NSHA 3GA0A 3PGJA 3STTA 2MMGA 4J03A 3GLIA 2G80A 4RZHA 2ZUEA 5AVTA 1F6BA 3TSYA 2WSIA 4XUGB 5B1YA 1C9DB 3JVDA 1ZH4A 5BN5B 2PR7A 4P8RA 3MTIA 4ERNA 3JD1A 3LXXA 4PW0A 2Y0BA 2AK3A 4A2WA 4C0SA 2FMTA 2EKQA 3JYPA 1A82A 1LI4A 2HWUA 2OBMA 4KO4S 4PC2A 4H1HA 1RXYA 2YVLA 3JCZA 1FB5A 1VPVA 3AUJB 3PD7A 4OLAA 2DMRA 1OV4A 1P0MA 4YJ3F 1V37A 3BG5A 3U3MA 2P6MA 1MG5A 3OU6A 3A28A 4DA0A 3LUJA 1II0A 4FGSA 5EE3A 3CPEA 4DZTA 1UAGA 1GPBA 3LBAA 3GEDA 4FHDA 4EPWA 2I4RA 1D2GA 4LDPA 2QQ5A 3PHJA 1T9ZA 3E3AA 3UMFA 3U7RA 4X97A 1TJYA 1Z0FA 4JUCA 2GZSA 1L4KA 1UC8A 4U7TB 1S7CA 4BQEA 3KT0A 4B35A 2W8ZA 4L8LA 2LXNA 3C4JA 3QNMA 2WSSD 3RK0A 4GPTA 1TA4A 1XK6A 4N12A 2R5FA 2WB4A 1YR1A 1HNWB 2WQ6A 4DEYA 4GL4A 3MCUA 4RDXA 2DTXA 1FUIA 3DMFA 5REQA 3EFHA 4D0SA 2WNSA 3BXFA 5E2BA 3N8IA 1FX0A 2LCFA 1OBHA 1Q83A 4WIAA 3CUVA 1C0PA 2HSEA 3L0PA 2G4CA 2IPOA 3C7TA 4H4EA 4KVFA 4EAAA 4Z4CA 3U44A 3HM2A 3L41A 1FNDA 2B98A 2O8BB 2ZROA 3ACCA 4FIDA 2Y99A 1T35A 1SZPA 1VKJA 3KB2A 3KWLA 4QAJA 3EWNA 2FWPA 2Q6TA 4YRFA 1T9GS 1KE2A 3K0BA 1TM4E 1NUAA 6REQA 4RTKA 1NBHA 3H5TA 4B8WA 4PFSA 1W85A 3E3MA 1UKBA 4YBRA 2FW6A 1BE6A 2DUNA 2QP3A 4FYKA 4AJPA 2HTEA 5ALOA 3MTBA 1R8XA 1S2IA 1DAIA 1QHHA 2B1IA 4H4DA 3STYA 2Q8QA 3OPYA 5FNZA 2EDCA 3OT5A 3UJAA 3W77A 4NR0A 3KZXA 3Q5GA 5L9AA 3KJXA 2WU3A 2KM1A 2HJWA 1QYCA 2I4LA 2UZ1B 4AIIA 3PIDA 3U3OA 3IOMA 3AIKA 3GMTA 1RAGA 4YPOA 1QAQA 4NULA 3WAJA 4TLDA 3OX1A 2XCQA 2WWHA 3GJ7A 1N0IA 2YQZA 4J7UA 3VI4B 2BHNA 2RGBA 4DA4A 1QVAA 3IVCA 1EX6A 3JTMA 5C8YB 4BO0A 3EDOA 3F5MA 1JDVA 4AX4A 2CHFA 2QL7A 3FZEA 1UP4A 3Q72A 4HQ0A 3B2QA 2YZNA 1S1MA 3EVNA 2D2VA 2VYVD 3OJOA 4GW3A 3HB5X 1U2PA 3UB2A 2F62A 4ZCLA 1OROA 3DT8A 1T9AA 3LC2O 4ILKA 2G36A 3VR4H 4GRIA 1HQCA 1PL7A 2H1LA 2IXBA 4MQ4A 3G3EA 3MQ2A 5IKMA 5D3KA 1KARA 3I4CA 1IFXA 1PLKA 4JUDX 3H8JA 5CHEA 5HQ3B 1JL3A 1FUKA 3VGPA 4DMGA 1QMGA 4L7QA 3QU7A 2RHGB 1ULBA 5DDIP 4MJXA 2I87A 4KX5A 4DDUA 1OX6A 2ODNA 1V8BA 3HKBB 1WV0A 2WVGA 5JADA 4OJKA 1DZ3A 1RCUA 1TM3E 2HMVA 2ZRJA 5AM1A 5LBTA 4D0GA 3R3YA 8AT1A 4XGRA 2FH5B 2VOEA 1V8ZA 2X22A 2EWWA 1XVAA 2Y68A 3CH4B 4LHVA 3DTVD 2QTWB 4AICA 2GM4A 5CYGA 1FUUA 1GUZA 1IMOA 4WNAB 5IXSA 1NVUQ 2AI1A 3HR4A 7ADHA 4IIFA 3X1XA 1C1XA 3W9SA 5JAOA 5M29A 2V0GA 1PR6A 2XBLA 2QLLA 2HHCA 4Q7EA 4TXNA 4PRYA 1JHAA 2MSKA 1HK7A 2O07A 2ECOA 4K6MA 4PHTA 1MGPA 5GY7A 3I2YX 5DHTA 1SBQA 2Q3LA 2OCDA 3H2ZA 1EFDN 1WZUA 2FSSA 5LWHA 4Q39A 2NO6A 1KOJA 2WR8A 1ISJA 2WINI 2UUAB 4NXNB 3RU7A 4WLUA 2PS3A 3IAM6 1J0BA 2JRLA 1C2TA 3UPUA 5EHGA 4M46A 2Q4TA 3EEOA 1CULC 1PWYE 2FUNB 3KV1A 1AD2A 4QQFA 5JV5A 4IXMA 3SR4A 1WA5A 1Z35A 1TW2A 3LA6A 1K3UB 2A58A 4HZGA 5CBPA 2FPPB 4J0GA 2Y1EA 3DMPA 3V1NA 1XJQA 4ZYTA 3G0CA 2JAXA 4ZVVA 5G1NA 1E4OA 5IKXA 2VCYA 2HSDA 1Q1QA 2NXNA 2OHFA 4LMRA 4L72A 1Q20A 4OQDA 4Y67A 4F8YA 3O8OB 4KR0A 1QGUB 2FR8C 2DERA 2I1WA 3IAHA 4OHRA 4YMSA 4RTSA 2EJUA 3W2FA 1DAHA 4KU4A 5AHXA 3DVQX 3TQIA 2QK4A 2MMCA 1WQ4A 3OOHA 1IHPA 4M3NA 1LA2A 1N9GA 1DO0A 4FOPA 4LQ4A 3RC9A 3QU4A 3TIGA 4XCXA 3H87A 5HK8A 2WHXA 4GBGA 2JAPA 2JIZD 2DOKA 2NV0A 3C87A 1PVVA 1NNLA 3FX2A 1ZH6A 5DX1A 3GNLA 1NX9A 2FR8A 3B8HA 3FMVA 4HEA6 4RY2A 1GZ4A 2ZSBA 5DCYA 1ODSA 3IMCA 1SUCA 4BO6A 1EKXA 5IXYA 3L43A 3MERA 3NWJA 5AW9A 1MH9A 4OLHA 1Z15A 2I6GA 5CA1F 2G5GX 1RPZA 1YBAA 3C3DA 4K2AA 3SXUB 3LNCA 1BN7A 3VBCA 4NWIA 4DMKA 4EABA 4WNCA 1Q6ZA 2WYUA 4HDAA 3VNBA 3GQVA 1JRLA 1YZ3A 1R9GA 1R3UA 4P54A 3OX2A 3DOIA 3QLEA 3R0JA 5CLHA 2BM8A 3UH0A 3GNQA 3IP7A 2YUIA 3EG9B 5CJJA 5KYVA 2ZXFA 3CLRC 1HSZA 3PA8A 3DKIA 1EQUA 1E3JA 4G9GA 4DSUA 2BD0A 4IDHA 1M5UA 4LIPD 4C29A 1FYVA 4UZEA 3TRIA 3HE3A 4F71A 1SRQA 2C9OA 3DDNA 3ZIAD 4E30A 3LRTA 3ADDA 4V3BA 2WNHA 3KLBA 3DM9B 3VH3A 3CRMA 2BAGA 1T5OA 4MB0A 3D9QX 1M73E 4B1FA 3NGLA 3CVJA 4GOMD 1QIKA 1NTRA 3C70A 3LGSA 4H15A 1M2VA 5BSEA 2CXNA 1G0OA 4RQTA 5G0TA 3EIHA 4C43A 4RAOA 3N86A 4AXXA 3K16A 2QVLA 2M6RA 3O8QA 4LI3X 4QDKA 2IYLD 3OZBA 4BN0A 3HV2A 1ZK4A 1UBEA 1T9KA 3R6LA 2HFJA 3HDHA 1UZAA 2YWBA 3OECA 3RIYA 1RWMA 2BMJA 2B30A 1GU1A 3AM3A 4FX2A 4NVRA 5IKOA 3ZI7A 4B4OA 4OQ4A 4F3CA 5M04A 1TIKA 3UK6A 3NJRA 4Q9KA 3OBBA 2I6SA 3VH2A 4PQEA 4MNTA 1JLMA 2C2HA 2FSVC 1Z3IX 4EO4A 2DFDA 1JLKA 2HA7A 3MTGA 1G5TA 5JRDS 3S8YA 3TQOA 1O97C 1NOIA 2VPPA 5AJWA 5T4HA 1XPRA 3V33A 3KBBA 1KHTA 1PNQA 2OCBA 4MYUA 4KHPB 1MNAA 1J5XA 1O57A 3V8BA 5I45A 1KMMA 5IUKC 1XFDA 4TZKA 3KVOA 1NM5C 4IOLA 1R0ZA 5B6IA 1PL6A 1PZNA 5FBRB 3LKZA 1MJGM 4FB5A 3S4YA 1B2LA 1PNOA 4RHUA 5JZOA 1ZXXA 4KZKA 1A95A 1U0FA 4XYMA 5JJKA 4BBZA 5JSYA 5LQCA 1NM5A 3E9DA 4JR1A 3KR1A 3E9RA 3N8KA 4RW0A 4DQXA 2Z8XA 3B1VA 4OUKX 1RWOA 3G0HA 2Z43A 4FCCA 3RB8A 3DZGA 1QAOA 3OQNA 2IZOA 1NUTA 2B35A 1OXTA 3DGEC 4MUJA 3LBFA 2VUIB 3QRWA 1W2GA 2NSDA 1XRJA 2BONA 4XFDA 2GAIA 1A4IA 2IYXA 3EIQA 3TOXA 1LU9A 2B8WA 4Q66C 2IS4A 4ZOEA 4AS2A 3BM5A 2HA3A 1CJTC 1LFDB 1EEXB 2VJBA 4BBJA 1RPNA 4G1EB 4MW4A 1CE8B 1GGJA 1MXFA 5LA6B 4WCFA 2C07A 1NU8A 4RDHA 4QLAA 2HEIA 3RSGA 1YV9A 3LUAA 4MS4A 5DGDA 2H8KA 1KDVA 4MDHA 1G63A 1OIVA 4C01A 5KNDA 1NBMD 3KYJB 1XEXA 3JQAA 4V1CI 2BFPA 1MQAA 1RZUA 1TMOA 1LI7A 1NZDA 3AHIA 3FTPA 2V6FA 3KJHA 2HGSA 3V8NA 3HBMA 1V41E 3H8VA 3CF2A 1V71A 1S89A 121PA 4JGGA 3ZYZA 1E69A 1LRJA 2JI8A 3C48A 3ZV5A 1KYYA 3MGGA 4U7FA 1ZCAA 1G98A 1DB3A 5K0FA 1EJ0A 5EMKA 1G8GA 3ANLA 3ZXUB 4A5OA 2GJ9A 4XWKA 1KBOA 4CTOA 1I3KA 4EB3A 2BR4A 3RS2A 1KK3A 2QZ9A 2WE8A 3LHSA 5C4GB 1Z26A 2G5PA 4H4CA 4LJAA 4RCVA 1EVEA 4FDUA 1LNQA 1SD2A 1P4SA 2HAEA 4B0PA 2KYRA 3O82A 5IULC 1FMLA 4W9NC 2QL6A 4JGBA 3UK1A 1P6XA 1P5HA 4C20A 2IXAA 3A7EA 2JBAA 4G8BA 4XTRA 4AY4A 2RCNA 2GDJA 3NU1A 4E11A 1STOA 3OY7A 4D4LA 4K26A 5F23A 1I6MA 1A7JA 2QLNA 1W5BA 5D3QA 3INRA 2MYNA 4W9NA 4Y1FA 3EGXB 4UPDA 2PSDA 5EZ5A 4OYRA 2PNFA 4II2A 4PGGA 2W6ID 1T2EA 3WLFA 2DHCA 3IQGX 1M8GA 1XUOA 1PDOA 2IHUA 1H4VB 2CNLA 3K05A 4UBLA 3H5AA 1GNTA 1C0EA 2WM8A 1FFDA 1QUEA 1A77A 1NR5A 3I45A 3PT5A 4JX8A 1BJRE 4LDZA 1SXJB 4M0LA 3ZWAA 2GLUA 2X8LA 3CVOA 1QH9A 4WUTA 3RK4A 4ETWA 5AD1A 1S9DA 2J33A 4BQQA 5I7VA 3LIIA 2GCOA 1LX6A 3ELDA 4MVJG 2X8BA 2PNJA 2OENG 4V0MA 3H5LA 1UMBA 2WQ7A 3QITA 4HNSA 4NKRA 4P7FA 1EE2A 1TEHA 4KX3A 3V7FA 3ZEAA 4R05A 1N8NA 4G5OA 2E48A 4MQLA 5BV1A 2LIPA 4JC5A 1UK8A 4QG7A 5I9IA 4IGKA 1R4AA 3TR5A 2PS1A 5A0VA 3N70A 4NOLA 1PG5A 2QPLA 2QHXA 2Z08A 1NBEA 3D5QA 3D8TA 1JBKA 4K05A 4B46A 2AUNA 5HIJA 1CJKC 3JYNA 3U19A 3AUAA 3I6ZA 3UK0A 5B4UA 4NCAA 4AI6A 3AP2A 5BSVA 2GKSA 1TEXA 2VZLA 4A8TA 2PFSA 1LPNA 2FRXA 1A8PA 1R0SA 1RPAA 5CR9A 5CVEA 3U7QB 1O95D 4AC9A 5K3EA 3TN7A 1O9GA 5IEBA 1IOLA 2DF8A 3MUFA 1Q77A 5ALWA 5SY6A 1FFCA 3TIXB 2O59A 4PAWA 1EVKA 2NXCA 3AILA 3AQIA 4UASA 2JLBA 3MELA 1C3OA 3AU9A 4B45A 1TVKB 2DT8A 5DXAA 2FDCA 2CK3D 2Z2XA 3K3PA 1XE3A 2Q2OA 3K92A 3FPKA 1RXCA 2YTZA 1FMTA 1KMHB 1EX1A 4BCCA 2GEKA 5BYJA 2OGTA 4ZU1X 4Y9DA 1ZH2A 3NH9A 4NX2A 2IJGX 2OYSA 2RC6A 1JW9B 1RPJA 4MW9A 1KQGA 5B1HA 2RAFA 1YB2A 4AYXA 1AF4A 1D07A 2OO7A 4G1CA 1B4DA 1BZYA 1OGJA 2UZ1A 4MQFA 5F2NA 2J7PA 1P62B 2PMEA 4DIOA 2QL5A 3LUHA 2ZUWA 5TQJA 3NGMA 2WZBA 4EG4A 2R5WA 1BX3A 3PQCA 4RSMA 2QTCA 3QH4A 3NBKA 3KSMA 1Z25A 3COPA 4CLXA 2IYEA 4HB2A 1HMPA 1FSFA 2C4KA 3AKDA 3B36A 1ISMA 1YCHA 4MUFA 4NOJA 5CT5A 3ZU5A 4NFHA 4CQMA 3IEMA 1EAMA 3AIOA 1H2YA 4W7IA 4P0PB 3LA8A 3G13A 3IERA 4LX8A 3WL8A 1ZKMA 2ZI7A 4JT9A 1KJ8A 2DX7A 2J5KA 1DFIA 3OE7D 1IPEA 3E22B 1HM5A 4BDSA 5LQJA 3R77A 1H9AA 3O26A 4S12A 5F33A 3DXXA 3PYMA 2Q2WA 1ML4A 2YHAA 4XIGS 4EPTA 1YONA 4MH0R 3S7ZA 2ZJ1A 2JLCA 3B8EA 4G26A 1PBNA 4IV5A 2QMZA 2QN2A 4LE2A 1P7YA 2IKQA 3WYCA 1YJ5A 1QR2A 4HAIA 2A8YA 1NDQA 4BV3A 4JELA 3L79A 4UTRA 2GA9A 2OZLB 4U2FA 5FO0A 1W19A 2MHCA 3QHAA 4EGCB 5HKKD 2B2NA 5J63A 2JIMA 1HWYA 1JXOA 3NZEA 6YASA 5EP1A 2ZRGA 1NQOA 4HNGA 3TF5A 4JN6B 1L4LA 2P75A 2VHTA 4IH1A 4M0FA 4F1KA 1G3QA 4ZGGA 1ZGZA 2PIDA 1T0PA 5B4TA 3TECE 1PZMA 5G0VA 4NH4A 3SIXA 4KN9S 4UQLA 1D4ZA 1P1HA 4BB6A 5G4KB 3S81A 4GYWA 3RROA 821PA 3FVVA 3RTCA 3LBNA 1NMEA 4RKRA 5K51A 1KAOA 2R6JA 3NEAA 4U2CA 4W6ZA 4EF5A 2NP6A 2OEPA 4QU8A 4GBMA 1Z33A 2FA9A 3VC3A 1CZKA 4DLTA 1E3MA 3HFGA 4EW3A 1E92A 1UZUA 1YB7A 2GD1O 5A4MS 3QFSA 3T35A 2X6TA 1OB5A 3CH6A 4CETA 4NSNA 4H7HA 1T2UA 1Y8QB 4GZ5A 4I46A 2ZR9A 1IBRA 2CVHA 4LSWA 4CU5A 1E9EA 1AMUA 1JH9A 3IAM1 1O89A 3PRHA 3AO0B 5DTIA 4A0RA 3L05A 2W42A 1H9CA 3X1WA 2RK3A 1M66A 2VQDA 4KMSA 4CIVA 1E18A 3CVUA 8ADHA 1V7ZA 3K35A 5HMMA 1M67A 3T12A 4NYMR 2X0DA 1CY4A 1N2CA 4OHMA 3BRWA 3OKCA 2Y0PA 3FSGD 3QJYA 2OXRA 3BJZA 1N2HA 3HBNA 3IQWA 3M5PA 4XH9B 3HPQA 4L8VA 5T3YA 4EGAA 4FHGA 3BQMB 4IIDA 1I4WA 3IP1A 2QQEA 1E3IA 1TZBA 2ZJ7A 2B9VA 3O8OA 1LB1B 4HGYA 4KG7A 4N1AA 1CUVA 4NV1A 1I01A 2Q2QA 3V9PA 4MVJA 2Q1TA 5F7JA 5EGSA 2FMUA 2JJYA 4AJNA 1KY5A 2PS0A 3M6WA 3OJXA 2AQKA 2Y4NA 4YRTA 4XIFA 5DX0A 4REQB 4BUCA 3IEVA 1ZWKA 2WSMA 4HEA1 4P2GA 3I01A 4E2XA 4JQOA 3EG5A 3ZDBA 3KLNA 4NYIQ 5LC1A 3IIMA 4L8FA 3ABSB 1WF6A 4JBYA 1E2LA 2BFCA 2WYOA 4N49A 5IMSA 3WKBA 3JAMA 1QCYA 3I42A 2KS6A 4RVFA 5EQFA 3SXUA 1CYDA 3TRKA 4ZQHA 5LYYA 5KKNB 4OMDA 2IPAB 3EA0A 3SYNA 2Q45A 1ZLXA 5SYMA 5FOVA 3IODA 2PUJA 1DC6A 2ANCA 2R87A 3SYTA 3AR9A 4Z53A 3K71B 1U63A 5LIRA 2ZG6A 3UWMA 4HGZA 5C1DA 1IZYA 1WMEA 4ZZ1A 4QUDA 5I9LA 3C7CB 2VUHB 4RHTA 4RZ2A 1SQSA 3MWJA 1PJQA 1ZHHA 1IVNA 3O03A 1MJFA 3EDQA 5K20A 1G7TA 3B5JA 3DE5X 1ODIA 3A1CA 4WCVA 5AKYA 3WV4A 1JEEA 2ZETA 5F52A 2XOXA 1XVTA 2OQIA 2RGNA 2QVBA 2V58A 2VSFA 2WD7B 4HDNA 1ONNA 4QFMA 4ZHQF 4LFAB 2ILVA 2XUOA 4Z4EA 4WZBE 1Z0AA 3W3AH 1EWQA 1DE0A 4WKOA 1UXJA 4C0KA 1E2QA 3A3KA 4E5UA 4ER7A 3LX5A 2VJAA 3Q1LA 3NFRA 4R9NA 2PA3A 2C2GA 4CL0A 1MRZA 2YCBA 1GPUA 2E18A 3JAKB 4BFCA 2QYHA 4W5OA 2PZAA 4M4SA 1QHGA 3SFZA 3OIFA 1SUWA 4QXMA 1GFZA 2ONYA 3HU1A 2UZ3A 1I33A 3Q7IA 1X92A 4MV7A 3LQYA 1Q17A 4XX1A 4I55F 3TL2A 2Y27A 5E6SB 5FL7A 2Q3CA 1DBVO 4EKDA 1WKBA 1Z39A 2YYZA 1MIOA 3CNHA 3ZOKA 1P0PA 1ZW6A 3INGA 3HR7A 2R25B 3ZBUA 2QJFA 3FG9A 4KIGA 2JKVA 5FCDA 4EA6A 3RSLA 1DPGA 3TZEA 2CHUA 2W0SA 4IHQA 1NI4B 3NPAA 4UQOA 1KGSA 2JLZA 4CKXA 2G8LA 2JGDB 3JQFC 1VP9A 1YUNA 2PVCA 5H02A 1TJ3A 3RYHA 1YR3A 2PSEA 2FPXA 2V03A 4F3RA 5FQNA 4MUEA 5BSUA 1GSHA 3FPSA 2PX4A 3JV7A 3A6DA 1DP4A 4H0FA 3TQHA 4YHHB 3KQNA 3LX4A 4JMPA 4EJMA 2PD6A 3U81A 1LBEA 4JI6B 1T4CA 1XU7A 5FPPA 2EWMA 1UMCB 1ULHA 4TRJA 3IJ5A 5H59A 4CN9A 2H1OA 4JGIA 3LYLA 3CRNA 4MIYA 4HNRA 2A9FA 4NZNA 2DQZA 3RNOA 2BEVA 3LCMA 3H2BA 3JVVA 2ZB8A 4Z7JA 2RGDA 1X13A 5BN3B 2X9LA 2IXDA 2W2OA 1Z5GA 4RTRA 2NUAA 4LG1A 3RVBA 3EPLA 1PJTA 2I03A 3COWA 4QYSA 3EIOA 5HOEA 5MN5A 3GWGA 1QO0A 1Q0HA 1W7AA 2EG9A 1PFKA 1LW7A 4TKVA 1LRKA 3O1LA 4MI6A 1HRDA 1JIXA 2LR0A 3NTRA 1CZUA 3L3BA 5AKGA 4RYDA 2IV3A 4DFDA 3KQKA 1DKPA 3ANSA 4WLOA 4ZTBA 5H3CA 4PNEA 2I7XA 2QN6A 3LP8A 3MLEA 3PQEA 1WBJB 5EZYB 4JYPA 1CE8A 1MX1A 2ZAIA 4TSFD 1GUFA 2V7PA 5BMVB 5A9SA 1DLJA 3M6XA 2FN3A 1A1VA 2LP4Y 1EWKA 1OXMA 3RV4A 4BNXA 1EFLA 1SPXA 2V45A 3IH5A 3Q88A 5DEIA 5JZ9A 4K1LA 3REQA 3ZY4A 4CF6A 3VDQA 5HE8A 3K0AB 4D43A 1HYQA 3GQBA 2WIGA 3R3UA 2FEPA 4H6XA 4N5NA 1BQ4A 3HCRA 3GT0A 3NI2A 1C7ZA 4KH0A 2X58A 3H99A 5ERXA 3D7KA 4K9NA 5FI3A 2PRIA 4DAEA 4TV8B 4AKHA 5DTQA 2HN9A 4D9BA 1FFEA 3TAUA 3W2GA 1YK0A 2IHJA 4O0MA 5EWJB 3MBOA 1IWPB 4MO9A 5CDGA 4FHEA 4U4AA 4XM1A 1CY6A 2ABWA 5LBIA 2VBIA 1DU4A 2EOAA 4FVTA 1O6GA 3NW9A 4M49A 2DPMA 3BH0A 3GEPA 4MINA 1TYDE 3BWXA 3J7AC 1QO7A 3N7TA 1T29A 5IBQA 1NW5A 3ONWA 4MP8A 3AZOA 4X6XA 2NTNA 5LOVF 3ML1A 1QB8A 1ACMA 4RMHA 2F59A 4MGEA 5E3IA 1KDRA 5ERYA 2D5LA 2IHVA 3K9BA 2H52A 2ZIGA 3KKQA 1P80A 4OK6A 1GVNB 3L0SA 4F4IA 4IUBS 3I62A 1FNSA 2DLNA 5FBHA 5EYPB 2G72A 1P9OA 1X2BA 1D6SA 2I2BA 3HB0A 3SLGA 4B7ZA 1MKYA 4HBZA 1ZOOA 1WZCA 2OGZA 1YJAA 4CIBA 4KI0A 5CX4A 2WUWE 4D9MA 1PJZA 1GARA 1NHGA 3QOWA 1B93A 1SJ9A 2RK6A 4RE5A 1B2RA 2CBXA 3WL5A 3HB1A 4MEBA 3PDWA 5FO1A 5CHYA 4DDWA 4OFXA 5IP5A 3DDOA 5DHUA 3A36A 4F0JA 1OD6A 1N6IA 2A1TS 2C9MA 1UWVA 2H2WA 5FIUA 4JFRA 1FDWA 1WXDA 3K73O 2UYYA 4L8WB 3SBOA 3UUEA 3HDVA 1E77A 4LAFA 2J48A 6CHYA 5LNK6 1MAHA 2IVZA 3ZZMA 4RFVA 3DONA 2HDNB 3NHUA 3UMBA 2EFHB 1Z2NX 3EC2A 2BOVA 2ZAGA 2W2KA 2ZRCA 1H85A 3BUSA 3L1KA 4LGVA 4TT8A 1Q84A 1J0CA 3NTVA 2XCTB 2IOFK 3OWOA 5LU8A 4TM7A 3X2FA 2MSEB 2VT3A 3LXMA 3S8MA 1VIDA 2P0EA 4NBNA 1N0UA 4LZLA 4OHCA 1JQDA 1UDCA 3TXAA 3IEUA 1RKXA 3NYWA 2DVMA 4AG3A 4BTVA 5JCOC 3IDZA 3IDFA 3WS7A 1HBJA 2OZPA 1BXRB 2X1HA 1Y1PA 4AKGA 4Q12A 2VBCA 5FULA 5K2MA 1D2MA 4R1PA 4DA6A 3HK2A 2AWOA 7MHTA 2XSZA 3HI4A 4JU9A 2H1WA 4UE3S 4L76A 2H4HA 1TVKA 1E2DA 1KI4A 2H9IA 5F35A 1LRLA 2WZQA 2G7ZA 4G5HA 4LZWA 5GONB 4OH1A 4OATA 1E64A 5TS2A 2PJDA 1AJEA 3HZRA 5ED4A 4G9BA 4EVQA 3M1YA 2AJLI 1L4UA 2PKCA 3G6KA 1U04A 2P9FA 3CRRA 1V96A 2Q29A 4MVJF 1JF8A 2Q41A 1E9CA 5KYUA 5J9FA 1FLNA 2DH5A 2GB4A 5KQGA 3KKPA 1IM2A 2W43A 5E6UB 4HC4A 1TT5B 5AI9A 4LOHA 2BF4A 2O5RA 5ALSA 3CKMA 1NJ2A 2QRVA 3HJNA 1JG4A 4IL5A 4N6GA 3FNEA 3VKVA 1RRPA 3ZD9A 1U8EA 4X66B 2O2YA 5TMEA 3NONA 1Z2EA 2CNWD 5D3MA 1SC4A 1YS9A 2VIIA 2MT9A 1KO8A 3KVNA 1Q16A 4G89A 4QPPA 2XXAA 4JJZA 5BR8B 5AVYA 1F8GA 3BZWA 4G0PA 5FR1A 1JXQA 2XNHA 5DBEX 3PTAA 2WT4A 1FQWA 1O6FA 1X1DA 2HU5A 3IAAA 3MYRA 1URPA 5BW5A 1ETUA 3RUDA 3EQ7A 3U4QB 4OBWA 4Q9AA 2W98A 5I9TA 4A8PA 3EBLA 3VPSA 2E3JA 2P68A 2NZ2A 3LT4A 5F1OA 3ETHA 4DJAA 1RLUA 4F6RB 5G0WA 2A59A 2HMYB 5EJ8A 2DWPA 3QEMA 3PFCA 3ADPA 3VR5A 5LP1A 1KJZA 2OXEA 4IEEA 1NMQA 1R2QA 2QZ4A 1AHPA 5HDBB 1PSWA 4Q34A 1U0EA 1XZDA 4Q3KA 2JASA 1HT3A 1VA4A 5A04A 1NRIA 3NXKA 1SK8A 4HO1X 1CR2A 1W2HA 3OT1B 4AY5A 2X9NA 5K4HA 2MYTA 3WWPA 2E37A 2ZI3A 4UXIA 3ADOA 4FDTA 3WZLA 3R5JA 1XRNA 3JALB 3KHKA 3DBIA 3Q7TA 2YX1A 4IHJB 4GBED 1C8LA 3RIMA 4ZJZA 1OPXA 3WDSA 5KQRA 4D2IA 1D0IA 3AKEA 3PFWO 5D7NA 5AXBA 4M1SA 4RETA 4ZKEA 3NHWA 4O2BF 2HWXA 1DKNA 3TLMA 5AKXA 3G82C 5CG1A 2OCYC 1P74A 3PVSA 4GNKA 3TWOA 5JEDA 1U8UA 1P17A 2QSUA 1L8OA 5CG2A 1CLUA 2GHIA 4TSKA 3S68A 3LX6A 1O9HA 5LZ8A 3NO4A 1G5FA 3QPVA 1H6BA 1NF3A 2OR3A 4UUMA 2W7TA 3KZ1E 4FMBB 3CZ9A 3KEQA 3PWSA 1FW6A 4I3HA 3UJ9A 3GMDA 3C5CA 1X9IA 3JQBC 1TRHA 4RHFA 1CEYA 3IQXA 4KIUA 1Z4NA 4EFNA 2OFFA 2L69A 2RFLA 3THYA 3ZJVA 2V7QD 2M9MA 3AFMA 5EKXA 5DYWA 1E2NA 3ESYA 4E14A 4IDDA 4MYTA 4UNRA 5HTKA 2GK4A 2JARA 4QT4A 3ZWKA 2PRSA 4Q0MA 1OYWA 4K7JA 4ZI3A 3RTEA 2NVBA 3G1WA 3GUCA 3JQBA 3OPNA 4RZUA 3W8FA 4DSNA 2VJMB 5HQJA 3TLGB 3GPIA 4HX5A 2SHKA 4A8HA 5TX7A 3UMMA 4ZVRA 3RS3A 3Q41A 1R66A 2HBZA 3BMOB 5C5IA 3LRXA 4MI9A 5AI8A 3DE3X 5K8IA 4M1OA 3RK1A 4X41A 4P5PA 5HCNA 2PKRA 1SOAA 2DKNA 5K0SA 5LLTA 1COWD 3NORA 4MDEA 2FMXA 1T0IA 5EJFA 4DIFA 4RS3A 5KYTA 4IKOA 4JB8A 2PT7A 2MSDB 1XDZA 4JB3A 4LNAA 3D7MA 2WWYA 4J4BA 2DPHA 4TM8A 4B3CA 4GX1A 2XKBA 3WQQA 2DUJA 2OCGA 2PR2A 1FRFS 1TO2E 2D3WA 3E8SA 3NKVA 2BP7A 4Y6LA 4DIDA 2NQ8A 2Y1OA 3GFRA 3PRKE 4KN8A 4M54A 4E1VA 4K9KA 2C1XA 3A26A 4IIXA 4LOKA 5B57C 2C57A 1K1EA 4WFJA 3C3MA 3NP9A 2R62A 2C9YA 3LDUA 2PGDA 1U0NA 4OYHA 4KTTE 2IL1A 2AR0A 4QD3A 4WOPA 3HCEA 3USCS 4H35A 3STHA 3D4NA 3V32A 5K5EA 1P91A 1ZHFA 4LYFA 5AHWA 2XUHA 3TM4A 1I9GA 2WD7A 2NT4A 1YRQA 2WA2A 2ZZMA 5EPEA 3L4EA 3ZU4A 3BWVA 4Y1GA 3KQPA 3WA6A 4CMGA 2JLQA 5GIOE 4OIMA 3D4IA 3S7TA 2QRNA 2Y8EA 3NT4A 1QDEA 4HGRA 3CZ4A 1SWWA 3O9VA 1O0BA 4I1VA 4WOCA 1Z4LA 1DKMA 4LF5B 3E9QA 2R8ZA 4KQWA 2AEEA 1V11B 4X62B 2HNAA 4MKRA 2DG2A 1I3CA 3M49A 1W49A 4OP1A 4P5DA 1YQTA 2X9GA 2QDKA 4EUHA 1HL3A 3GFTA 3B60A 4FYPA 1NPTO 2AOXA 4B31A 1YHYA 4XSHA 4I4TF 3GT4A 5HTOA 1KBZA 5E6RB 1YS2X 3Q12A 5GZ6A 5CX1A 2RSLA 4B82A 2HV9A 4O0LA 2XUGA 1IZ7A 1GPKA 3BERA 4KE6A 4NCIA 4RY0A 1BNCA 1O77A 4YMGA 3BD8A 4G81A 1HEYA 2YY6A 3EPRA 1G8KA 4EW2A 3IE0A 4B32A 3FKJA 4V03A 3G9UA 1LSUA 1ZGGA 4YUWA 2UZ4A 3D6AA 4TLEA 4WLVA 1NVGA 4L9RA 3TIVA 2Z6VA 1PDVA 4F12A 5A5VA 3BKXA 5K45A 3DWGA 2FUKA 2E4AA 3ABQB 3NC1C 2OHOA 3W9YA 5FWAA 3T7TA 4D9NA 4QOGA 1Y9AA 1FVHA 3PTLA 1JKFA 2HY7A 3C8MA 3B89A 4R1QA 4DA7A 4RKYA 3LYUA 1PR0A 4EBBA 4QPZA 2V4MA 1KYVA 2XB9A 3E1KA 2VP9A 3R0XA 1C4OA 5ERGB 4EHFA 2W8BB 5JNUA 1FRZA 5GV8A 1EB8A 4HDMA 2QPAA 2YN2A 4Q05A 5M34A 1JFLA 3ITEA 1IAQA 4KAAA 3ZH9B 1JWAB 3VU0A 3E61A 3SSNA 3SOPA 2XYHA 1FLDA 1U2RA 3A31A 3IULA 3AZQA 3E9YA 3N2KA 2JLAA 1ISRA 1KO5A 4KQHA 2G71A 2XA9A 3EXAA 1PTKA 1TK2A 1XCBA 3COYA 3V4RA 4ZMBA 4HZUB 3EGIA 4JVMA 3TW0A 1JIJA 4RUKA 1RHKA 1U1EA 1TQDA 2CNKA 1XA0A 3ZE2B 1FP4A 2QMYA 4EKIA 2ZATA 5A5FA 4BO1A 2O20A 3PG5A 4KQGA 3BCUA 5LLDA 4Z3DA 3PC3A 3RHZA 1UIMA 5C8YA 3U3KA 3PD1A 1W1UA 4HMPA 4PAGA 2QUBA 5GM2A 2X2OA 4FSHA 4N8SA 3ISTA 4DNQA 2I91A 1TCVA 2FNAA 4Y7DA 5IBCA 1HFEL 2B82A 1UT5A 3LOQA 2GZ2A 2G9ZA 4JQYA 2WKRA 1QHNA 1QR6A 1AZSC 3D81A 4AVYA 1PJAA 1J2RA 1N8KA 3DNPA 1CF4A 1JT2A 3RSHA 5GJBA 4C14A 3GLKA 3QU2A 1AKEA 2D2FA 5KQMA 5IT0A 1L5OA 3IR7A 2ZI5A 2D2IA 4P3OA 1J24A 3VOTA 4COOA 2ZYAA 1V25A 2EX1A 3ORSA 3LY5A 4PLCA 2B94A 4O4JF 4NEQA 3F90A 4YXWA 4MITA 1B8PA 1E4YA 4IUCS 1JT9A 2X2PA 1BS1A 3VPXA 4G0MA 3FOEC 2INGX 4S0XA 5HCUA 4C4YA 3DOJA 1XDUA 2A5JA 4UTXA 3EB9A 4IIBA 5JAQA 1U2DA 3B1WA 3PNSA 3TBHA 1Z3CA 2DUMA 2EW8A 4DCUA 1OXSC 3K1AB 2BFBA 2WLSA 4OA5A 3WRWA 1M6WA 3F49S 3GEGA 3NETA 2CFSA 1UXGA 1G9XA 1SFRA 4XD7D 2EWVA 3THWB 2QVXX 5DLYA 1X3SA 2GUWA 3M9LA 4ZT2A 1Q1EA 1THTA 1KVUA 3G2QA 4RL4A 5KWEA 1CEEA 4QEZA 3E5RA 4ENRA 1BHO1 2QE7A 3HP4A 1XCJA 2NYAA 3W5BA 2KE5A 3SOZA 4ER3A 1Z7BA 5E2IA 1L7NA 3O3CA 4L1KA 4RF2A 4B6QA 4GL2A 1MAAA 1JDSA 3R5SA 3P2MA 2BCGY 4N0QA 4TWBA 1XMVA 1NXVA 1F4PA 3VPDA 4DB2A 2IZ7A 3GCDA 5FOXA 3EHEA 1XR3A 4BX3A 3RRMA 1MC4A 1KWKA 2NSYA 2H08A 2OFPA 2DY0A 5DBIA 2P11A 3PC4A 3RAFC 1VLLA 3MXTA 1CX9B 3ROQA 1JB1A 1IJBA 4YJ2A 4PTZA 4P6VF 3FCEA 5M3BA 2ZYWX 3A6EA 1ABEA 1X8LA 2GZMA 4WDRA 1N7JA 3HHEA 1SB9A 2GKOA 5HCIA 5D51S 1U0RA 1UJNA 3VDMA 3AG6A 5L3VA 3PNPA 1LUAA 4MIOA 4OQYA 5EESA 2A0KA 4A2QA 4YWJA 4AN0A 4D79A 3T4EA 3FWZA 1BTOA 2G08A 4EATA 2CN1A 2J7KA 4ODIA 5KNCD 1GAWA 2ZCVA 3QTTA 5DPMA 1VDMA 4RV5A 5LJLA 2JLYA 1F2TB 5LNK1 1AQJA 2C8JA 3I9JA 2I4IA 3UGJA 2P1DA 4M36A 3INTA 2ECFA 2NV6A 1OVMA 3KQVA 3B1JA 1EFRD 3ESDA 1LI5A 2R6ZA 5TMBA 4ZOAA 3MC1A 4BNWA 1NKSA 4MIEA 3USZA 5KKAA 1GTL1 2VYFA 4B2LA 4FMDB 3BBPA 2ZI6A 5AK6A 3KZVA 3GDHA 1L3CA 3PQ7A 2AC7A 4KWIA 4G1FA 5CT9A 3VZQA 4XGIA 5B2EA 1YVRA 5SYAA 2YIVX 4G41A 5IHXA 4YP7A 2IEAA 3ORQA 2OUKA 3LE8A 2EJWA 3BSSA 3CZQA 1K08A 2VT7A 2B2CA 4LY0A 3MUNA 1F17A 2HRZA 1GCIA 1KH2A 3L6DA 4RELA 2W00A 4W7HA 1ZM7A 4RZXA 3AX6A 1HE2A 4D97A 1JQ3A 3NXSA 4QEKA 2ADMA 3IR5A 5TLSA 1ST2A 1YMVA 5KJCA 4DEVA 5JAPA 3DV0B 3V2UA 2X19A 1EK1A 1TM5E 2UVPB 1V1RB 3P0FA 4N76A 1X7HA 1YE5A 5T67A 4ICIA 2C2OA 3BJRA 1QQAA 2RGUA 1N6LA 3C3YA 4F38A 1BMTA 2HJVA 4RGYA 4O2AB 4UTNA 1J99A 1RM3A 2GN1A 5HUQA 1LTQA 4MUIA 1H4QA 1OLSB 1L3IA 1IY1A 2JFPA 3DWFA 1N5RA 1WEKA 4XSGA 4G5SA 2WWIA 1G38A 1YFZA 1U0TA 5ALQA 3GFVA 4AP9A 3AI7A 3BCSA 3UQZA 3VC2A 2WYHA 1YC5A 2CXOA 3FYCA 2JBWA 4O5OA 4FFLA 1WXFA 1XCPA 3TLCA 3GJ8A 4Y98A 1FJXA 4ENPA 4FQ7A 3ZV3A 2YMQA 4KMRA 5A4DA 4NDNE 4JKYA 4BVAA 4F97A 1ZN7A 3D5TA 1KDPA 5CYOA 3GLVA 1RYHA 4IWNA 1EP1B 5IFKA 2RDMA 1QX4A 4HWKA 4MKXA 4MRSA 5DLDA 3W04A 4AECA 5G1PA 5B7NA 5FLKA 4QUGA 3PXAA 3QEJA 4ZQFA 2IYVA 1SY7A 5A6SA 3NOOA 1K9SA 3EA5A 5DKFA 1Z12A 1OZFA 4MWOA 4NC9A 4A10A 1V0JA 1J1IA 5MDHA 1HTWA 3U4AA 3V4OA 3GVPA 2YR0A 5GVSA 1DFGA 2JJ1A 4QO8A 1SQGA 3SS7X 3WL4A 4F5EA 4JI7B 2JHGA 1E96A 4JI2B 4IQ0A 2XDWA 4WESB 5AW2A 4FYHA 4R2IA 1CRQA 4DLNA 3GJQA 3HKDA 4B2YA 2CMFA 2PSFA 4H7DA 4R1TA 5C8ZA 2JFBA 1J0EA 1WAMA 1KMIY 2CL6X 1LJUA 4G9EA 1GDDA 3N53A 4HWGA 4NV0A 1EFPA 2H2HA 1OZ0A 3LFTA 3TLAA 3DA8A 2ZIXA 2O54A 4WKGA 1RMTA 4JWTA 5JYDA 4P58A 5DTMA 2YIDA 2XVMA 1YZFA 4NE9A 4CUKA 4KSYA 1DKUA 2C5LA 2HGZA 2IHZA 2QUAA 3BOSA 3A2MA 3R44A 4OBEA 2ACWA 3ZWCA 2QG9A 4DR7B 3DHEA 1RHQA 1ZMBA 3R9XB 3S55A 2C2ZA 1OIXA 2CSUA 1GRCA 3GD5A 3QBDA 4RTOA 2DB3A 3UMSA 1ZGJA 4ARBA 1DMRA 1XVIA 1WDLA 3JR3A 1OT5A 3KLMX 4JL8A 3RLFA 1EYZA 1YNSA 1BO6A 1MORA 4KO2S 3H6GA 3HVJA 3DP9A 4BV8A 1QH1A 3OEHD 5JPCA 2GH1A 5KTTA 1KAGA 4LYYA 2WPDA 2AZTA 5FBKA 1UDBA 1YH3A 1XU9A 3VR6H 3FOZA 4XM0A 3UEOA 2Z30A 3E27A 5DX8A 2LW7A 1CZRA 2NYRA 5A4IS 2ATVA 2PZGA 5JO0A 2WMNB 4V0KA 2YVUA 1YJ8A 1N9ZA 1JTEA 2QUIA 3PFIA 1MO2A 2QDXA 1WSAA 2IY9A 2WHEA 3CONA 3WYAA 1WBBA 3PC6A 3LDFA 4F5WA 3OF3A 5GGXA 5L53A 4K9PA 2BGUA 3FLMA 1ISIA 1LSJA 2NZUG 4RKQA 4QM7A 1CUZA 3FJOA 3OCWA 4O02B 3RYCA 3A9RA 4A0QA 1UKAA 4TUYB 4EG0A 1P6UA 5JQGB 4WZAA 3T1HB 1O6ZA 2GCNA 4BIIA 1RBQA 2H1FA 3P2EA 4AJ4A 2ZTMA 4NJMB 1E6EA 1TOAA 5F9FA 4Z0TA 2OHXA 3KEGA 1VE6A 4L8YA 1LD3A 8LDHA 5F51A 4QG3A 3T8YA 4TVKA 5FV7A 1CDEA 4AUEA 2O0LA 4PIMA 1JEJA 1L8XA 5FI1B 4OGWA 3PNKA 1MW8X 4L6IA 1HEIA 3JYQA 4GM4A 1GAJA 2BUAA 1E9VA 3I8SA 1VL6A 1E98A 3KTOA 1OOEA 5G53C 3AEZA 4K0RA 4LC9A 4ND7A 5AKZA 2HM7A 4D56A 2W83A 2WILA 4EG8A 3B2NA 5GADl 3B6EA 1H2EA 1K8YB 1VQ1A 2CZQA 3M34A 4ER6A 2YC4C 3VO1A 3OU2A 5GIPE 1LC0A 5LUAA 2XCOA 3BD6A 1E32A 4L6CA 3NUQA 5DWDA 5TE9A 2D74A 2HCBA 4Z86A 1XXHB 1YXMA 4B6JA 3FTEA 2AOVA 3N3AC 1LF0A 1WF3A 1LV8A 2AFIE 3ASYA 3F96A 4NAHA 1MJHA 1BDMA 5EXDA 3WLEA 3IQDB 2XCLA 4MS1A 4RD0A 4PTLA 4WASA 4QJBA 1EK0A 1OKKD 3MJVA 5HA5A 4C0JA 5JPDA 1GSIA 1F60A 2TSYB 2AFHB 4F2PA 2O8EA 2HXSA 3E03A 5B2FA 1ZESA 3SP1A 1YRYE 4GI1A 1JX6A 3CWQA 1U81A 3FCYA 2K7ZA 1VIYA 1YFJA 4OHPA 1P2TA 2FG6C 2NZVG 1EGQA 3PXEA 5CPFA 3UW1A 2QA5A 4ALLA 1FDIA 2WYWA 4B73A 3DE6X 3DEHA 4MVCA 3QPDA 3DZ8A 3PYXA 1MENA 4DLZA 2VQFB 4ITUA 1CUYA 3OZAA 2QW1A 5ICMA 3B78A 3A37A 3LBYA 1HH4A 3AFGA 1PZXA 1SC3A 3A05A 3CZ5A 3LYAA 5F78A 3RU9A 2BGLA 5C7IO 1A7UA 1UAYA 2GXQA 1DARA 2XOEA 4YJ2F 2Q1SA 4EEZA 3TIFA 1WM1A 1MO4A 3R09A 1OYYA 3OZTA 4JHLA 2K7FA 2MINA 4PX5A 4JP1A 5CXXA 1K8ZB 3EVEA 4FYWA 3AVXA 4Q93A 4KR6A 3GJYA 1U6IA 1GIAA 2XYVA 3HU5A 4OY3A 4Q37A 4IJ6A 1R0XA 4OI1A 4Y6SA 4IZOA 4LWZA 4FGJA 4HSEA 5DSTA 3OSZA 3RVKA 4P36A 2W8BA 2AN4A 4KWHA 2TRSB 2HIAA 5BSRA 3VSEA 3T54A 3PSAA 4G5FA 2O23A 5L3RA 2RHMA 1AKQA 4CKBA 4DOMA 2EXXA 1AUQA 3KJGA 1R1DA 3ICOA 1P5JA 1B1AA 1EDEA 1FMJA 1X7ZB 2FQWA 5CFNA 3IB3A 2R1VB 4OKIA 5IC6A 3V1TC 2VF8A 3TUZC 2E4WA 3ANMA 4IJQA 2EP5A 3P20A 4J9UE 4PNZA 1TVMA 2HSZA 4G0VA 4J7XA 1M2FA 4LRWA 3GDWA 1QTNA 2HSWA 4PZAA 3ND8A 2O5VA 1AV7A 5KWIA 2P3QA 3RSOA 1BSVA 2R68A 4RULA 3UGTA 1KVRA 4I1UA 4LFBB 2HWWA 1JV2B 2ZBRA 2OQRA 2RB5A 3DPUA 2XQKA 2VT2A 4CMAA 2F1OA 3OJWA 5G2OA 2OXIA 1XNRB 2F48A 1GYPA 2CXHA 2ORIA 2RHTA 1LV7A 2VP4A 3JYOA 5IASA 1F7VA 3R3VA 2WF9A 2IXEA 2ZTVA 1RYYA 1UBGA 3QENA 3V8RA 2GSDA 1V4VA 1QIDA 1UZNA 1XQXA 5JLJA 3Q8KA 4IICA 3WYDA 1JH8A 2R48A 2P9YA 2X77A 3VO8A 3PXXA 2GT1A 3IV9A 2PKQO 4G8DA 1EUCA 3OTIA 4KK4A 3UWKA 1YRAA 3T3OA 2VYND 2JG3A 4HQNA 4WBXC 4TV9B 2Q4DA 2IYAA 2XMDA 1TD1A 2RKWA 2D00A 5JWOA 2IYPA 1G42A 2V0CA 1THGA 3EDCA 4L8GA 5EL0A 4GH5A 3HLKA 2XE6A 5I4KA 3HG7A 3O8DA 4BUZA 4C78A 1YQDA 1Z5VA 3V4VB 3ZHOA 4PYIA 1CVRA 1UKEA 1U1DA 4FI3F 2C7PA 1NQTA 1GPNA 3K1AA 2PL5A 3PEVA 1BHJA 1KY3A 2F3UA 4YRPA 3THXB 2QN9A 1QG0A 3FZNA 3GDOA 2C58A 4NZYA 1GDTA 3COZA 4TTQA 4CG0A 4GZLA 3BTOA 3C6XA 4M83A 2PMKA 5H9VA 4ALKA 2P27A 4QU5A 4K8RB 1PLJA 2D2XA 1UPUA 2CJPA 2VHCA 4DDTA 1TQ2A 1G2OA 2FRDC 4JJGA 4ZA2A 3V97A 2GBGA 1NP6A 3MJCA 3N6XA 3QYAA 4PXSA 3MAJA 1XYVA 4FDAA 3BA6A 5JI2E 3K5WA 1T3LA 5TF0A 1MOZA 3RJ5A 3X3HA 1M75A 5JS6A 4A7PA 5JJIA 2IBMA 2RH8A 4WT7A 3LT2A 4GSLA 4PGMA 3MTDA 2FRDA 1FK8A 3B3JA 2WD9A 2I2WA 1YQEA 3LVFO 1SQ0A 1N4AA 1U28C 4XJSA 5JC8A 4PLHA 4LDQA 4EI2A 5BWOA 4DUYB 4GDMA 4S3MA 2H4FA 1DJLA 1U7XA 1RYDA 1EXMA 1TYAE 1D9ZA 1G8HA 1O03A 2W2QA 3WIUA 4DCOA 4AZ0B 1C1DA 4C0WA 1HFWA 4O1HA 3X1YA 5KCZA 5K0JA 1IBCA 1U28A 1YRBA 5DYIA 5IFLA 1E5LA 4U63A 1J2EA 4XOIA 4D3SA 2Y0EA 3PKJA 4EMBA 2ZEJA 3EXIB 2JHAA 2FFQA 4KXMA 5HEKA 4C6TB 1PV4A 3NAGA 1P7VA 3ZG6A 5JALA 5EJ2A 5INTA 1X1SA 4LGCA 4UARA 3FWHA 4V0ME 4L2IA 1DT3A 1FDSA 4GR4A 4YACA 5AM3A 4V1CB 4XPZA 3QVJA 4P98A 1YA6A 2O0JA 2BLLA 3VVLA 1Z4JA 1H5UA 1X1QA 3HDTA 4ZODA 4D02A 1KYIA 1QRRA 3L0BA 4Y7CA 1W6RA 4C1BA 3KKLA 2B5WA 3PF8A 5T6MA 4AXBA 4D98A 1PVDA 1KFEB 3DGFC 3PDCA 3UHPA 5BPFA 3ADBA 4DNFA 3PVZA 3AV0B 3ZKWB 3EPJA 4NCXA 3HCDA 3IX7A 3KE9A 4TX1A 4CR7A 2NTYC 5DJ5A 5E95A 3FFAA 3PUXA 2BEWB 3QVGA 5IM4F 1V5GA 2IYNA 1KIFA 2FE1A 3KO8A 2ONZA 5KIAA 4CLRA 4GPAA 2EFJA 1U5AA 1RT9A 4R98A 4DBVO 1V7PC 2B69A 3MGBA 4D9FA 5JXHA 3LY7A 4G2TA 4DF3A 1H2FA 1N1EA 3F5SA 2CHVA 4U8GA 1NX6A 2HZBA 3ND7A 4DV1B 3AFOA 1KFJB 6AT1A 3FYSA 2LNDA 2O6HA 5B30A 1KXJA 1J00A 1F14A 1EINA 2NO5A 3KV3O 3MQ4A 4WAUA 1H2WA 3ZIUA 2EJCA 2I9PA 5KYXA 2RARA 2W6JA 3AWDA 3UAOA 4AY3A 2FG5A 3N39C 4D8VA 4KITB 3DOFA 3F6CA 4Z2YA 4P81A 1RWVA 1OA1A 1MJ5A 4N0DA 5ILQA 1CZOA 1PGNA 2QRQA 3T41A 4YT4A 3U4CA 2ZIZA 5IZCC 3QLVA 3T7IA 2WJAA 5ALDA 2IDJA 2NPFA 3USES 1L4GA 2BFDA 2P2LA 2R8PA 5C7LO 2P4EA 3C8UA 1T10A 1RC0A 2XUZA 1R6UA 2YHUA 1R50A 1F48A 4MK4A 4MJLA 5B7QA 1BH2A 1Z2OX 4G4SO 2BI8A 3RF6A 3ROGA 3SQNA 4P4LA 3TEFA 4HN2A 4C2UA 2YOGA 1YR2A 5A5DA 3H0CA 1DG1G 1H2XA 1XLVA 1JQEA 3ZGVA 3MMXA 1JHXA 4MJ7A 3ZC3A 4CV2A 3KUUA 4HNAB 1KP3A 1PR2A 2VTKA 1ZYUA 5FNVF 1RHMA 4FFNA 3IURA 5D87A 1P1CA 4EYQA 2DPLA 2Q1UA 4FMCB 2F3PA 3ZHQA 1YR7A 2IEYA 2L2QA 2ZI9A 4S1OA 3NDRA 4EB0A 3ZCVA 3GX1A 3OEEA 5B3JA 1FTGA 4DSTA 1IHDA 2CXTA 4WESA 1X8XA 1G21E 4EL0A 4FEYA 3ELYA 1V43A 2FZGA 4EFKA 4FX5A 4RPCA 5I8ZA 1IJEA 5U1PA 3R20A 2JD1A 1L5VA 2HL6A 3GV0A 4C7OB 3F97A 1U7WA 1WXGA 5U4XA 1MAVA 5JUWA 1JHUA 3O7MA 3H19A 3OLWA 2GN8A 4FPXA 5CW1A 1JA9A 4CR6A 3HB9A 1E7YA 4HXGA 1T5LA 3KL2A 4BO2A 4E5DA 2HCFA 3CXUA 4O3FA 4QOHA 5AQEA 4UFPA 1ARZA 2BFEA 3WQSB 2XDQB 1D1PA 3OESA 3I83A 1NP7A 4IEFB 4RZSA 1M34A 1LC3A 3UAZA 1GPJA 3O9ZA 3IAS6 3SICE 1W9MA 2XTMA 3R9XA 4QM6A 3K8QA 4Z4HA 2EEZA 1M83A 2R1TB 5FBVB 4V0QA 1QKIA 2OVBA 4F4DA 1H2RS 2C5FA 4E31A 1YZHA 4Q19A 3U37A 3IT1A 4ZEXA 1X94A 1XMSA 3M4ZA 5KQSA 4KR3A 2OFWA 3GBSA 1OR8A 1T2VA 3UM9A