3UO1L

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uo1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uo1L01
1TJHL 3W0WE 2OI9C 3PG2A 3U0PA 2V9TA 4NP4H 1NUDA 2VLJE 4CN4A 1ZHLA 3T1WA 2OR9L 3PXJA 2CKBB 1X6LA 3BWAB 3MBXH 3IGAB 4GLRH 4OGXL 1BREA 4L9DA 4KKCD 2Z93B 1FL6B 5GRVL 1I8KA 5LGJA 1I7ZB 2VR5A 1UH4A 3GJEA 5DHYA 3QUXB 4YFDB 2AABH 3KYAA 4M9PA 2ZUWA 4QRUB 2JIXB 1OGAE 3S88L 3HRZB 3F6LA 3MGOB 4OUOA 5ID1A 4Y2DB 5IJVA 1GL4B 2G2RB 5D1ZB 1ACYL 1KIQA 3OAZK 2NZIA 4WW1A 5KAQG 4O51B 3JWOC 3IDIB 4NWTL 4AENB 5JXAH 2R1XA 3KYNB 4ZFOA 3T2PA 3V8CA 2BVTA 3VXNB 5I30H 1DBKL 4HZLA 4NQVA 4NJ9L 2G2RA 2NMSA 2ID5A 3C5JB 4G5ZL 1FNSL 2XTJB 1CE1H 4Z8FL 1VDGA 3VXPB 1N6UA 4HZLB 3MR9B 4JRYA 4RMTA 4QF1A 2O5YL 4JKMA 2OSLB 4RZCB 5EA0H 3RIFF 3HE7B 3T2QA 5DS8A 4MJIB 2V2XB 2RJMA 5KS9A 3MODL 3GI9L 3N50A 3CK0L 3O3EB 2ENYA 5E9DB 1D9KA 3B9KC 2G9HA 1QACA 4PJIE 1PKQA 1RAMA 1WTLA 2Q86B 5L2KE 3HMXA 5I15L 5T1LD 3OG6B 4TVPL 1B4RA 5JLZA 5E9DA 4N0YH 2BVOA 3CVHH 3S4SG 4NQXA 1CFSB 3UTPD 2DQGH 4Y0GA 2X4SB 5C07B 5JW4N 3AXLA 5C2BL 3P9MA 7FABH 3MC0A 4XMKH 3OZ9L 3MBEA 3NN8A 2IH1B 5DK2B 3GMMA 1MJ7L 3T65B 5DSCB 3AXLB 4LLDA 1RK0A 1YNLH 3TVMA 4NO2B 1HI6B 1B2WL 3HMXH 3ARFC 1LVEA 2DQJL 4G8GA 3RIFK 2JJWA 2O5XL 1ZLWK 2R15A 2VSDA 1LO5A 4NQEE 5E00B 4HPYH 4NCDA 2X6MA 1YZZA 1W0VB 2AGJL 3JV4A 4HMEA 4M6ML 4IRSB 1MNUL 5CINL 2QHRL 3UROR 1MIML 3KG5A 5C08E 1N6QL 1SM3L 2C3XA 4KY1H 3BHBA 3SEPA 1I7RB 1NCBH 4N1CA 3RPIA 5IHZB 3H3BC 2JJSC 4P2OC 2MMXA 1UACL 4KTEH 4NN7B 2V17H 1KN4H 3MMEB 1G7LA 2BJML 1YN6B 2OX5A 5E7FA 1FYTE 3LEVL 2QL1A 1KCUL 1T2QH 3GKWH 1FIGH 1MFBL 2VITA 1CFTA 4PV8B 1M6OB 1MF2L 3SCMB 2BFVL 3HZMB 4JFQB 4JZJB 4YIQB 1DN0A 2D03L 5F7EH 2D7NA 4TQEL 5JORB 5CGYD 3STLB 1KPRA 2CGRL 2QR0B 5K9KB 3Q5TA 4XWGH 4YIQA 1FPTH 4HK0A 2R1WA 1QSFA 4MWFA 1GIGH 5DEGB 4U6VH 4MD5A 3WFEH 2WWKT 4Y8DC 1JFQH 2Q8AL 5FGCB 3RU8H 4X6DB 1J5OH 4UTAH 1PX4A 4UV7L 1G7JA 4X8XA 4CN6A 1MELA 5SWZA 4H88L 5BVJB 1OF2B 3IU4H 1TQCB 1T0NA 3SJVE 5DJ2A 3QEQB 5KAQF 1HHIB 3LKQB 1YMHB 2NY0D 4DFHA 3CMOH 1BMGA 1MCOL 4LCCC 4HLZH 4OD1L 3FN0H 3WFCH 3O6FD 2UUDH 2WIMA 1AGDB 3CLFH 4NQEB 2R0WL 2EDHA 3HFMH 3PP4H 2KH2B 3KPNB 1DP0A 3GSUB 1WBYB 2KQMA 1EO8L 5MEND 3MLWL 4LOUD 2CDEB 3FT4B 2RGSA 2MJWA 3G6AA 2YC1B 3V5DB 1YYML 2QLVB 2HTKC 1CD9B 2VZSA 4LEOA 4OZIB 1YECH 4YDKL 2B1AH 1K4CB 3DX8A 3RRQA 2ATPB 4Y89A 5JPNA 1BVZA 3ZHKA 3LN5B 1UEYA 4X7SL 3TZVA 2DJSA 2YPLD 2YD2A 5HI3C 5IVXF 1UVQB 1LEGB 1I9JL 3VXUA 4GRLD 3FFDA 1YJDH 4IMKC 1JHKL 2HT4C 1D5ZA 1DL7L 5D8JL 3RGVD 2DWEB 3BGMA 3KWWA 4JKWA 5IJKA 4LAJH 4X9GA 3V2AR 3S4SA 4JANA 3ZKMD 3FO2B 5DMYA 2DWEA 1S7RB 4X9HA 4MNQE 4XH2B 3L3DB 1QOKA 5GIRB 1JGLL 3S4SB 4L4VD 4PJDE 2YHGA 1MQKL 3D39E 4O4YL 1JI1A 5EUOF 1DDHA 5BOZG 1Z3GL 4PJDF 4M43H 1LWRA 2JIXA 2F8OA 4JDVB 4ZFZB 2I26N 4HF5H 2DIBA 2YK1H 4ERSL 2FDBP 4P9MH 4FTVD 3O2DH 5TDPB 2P5EA 1NCWL 3IDMA 5TPWH 5GQBA 5IFHL 1MHEA 2YXFA 3MRIA 3JV5A 3QQ4A 4Q74A 4KPHL 2NXZC 2X4PB 1GAFH 3QCTH 3EDDA 2P5EB 4MD0B 2QQLH 5ITBL 4O00A 4GJTB 4QGTA 1NCNA 2WQRA 1WC7A 4AEFA 2X41A 1UWEL 4R96B 2Y06L 2A74A 2DQDH 3GMPB 3L95B 4H5SA 1RUML 3DV6A 43C9A 3O11B 3MV8B 5A3ID 1FV1A 2IADA 1IGFL 2FEDC 3ZKXC 1CDIA 4LHUG 4CMMB 5CSBA 3MJ9H 5DJ6B 3VWKC 1A5FH 1EPFA 4RFOL 2GIYA 4UQ2A 5ELIA 4PR5B 4HJ0C 1U92B 5GGVY 4U6XA 4QRPA 3OTTA 3RVVC 4LDOB 4J2XA 4MLIA 1Q0YL 2IBGA 3SE4C 2HA1A 4WI3A 3HNVL 3WKMH 4HGWB 5HVGB 5GS1C 1OPGL 3FL7A 5J57B 3EHBC 5DD1L 4CAGA 4R0LC 1P53A 5DRZA 3VFGL 3NACL 4XXCA 4D0CA 3NN8B 5DK2A 3MJ7B 2VQTA 3ZE0E 1FDLL 3O3BB 3D39B 4YXHH 1BGXH 5J0BA 3SE3A 1NBYB 2CGRH 4MQXC 4ENEC 2NY1C 3NPSC 4OZFA 1IAKB 2RHEA 5EUOA 1VEMA 1H5BC 4JN2A 3IETB 4GQ9L 3MLYH 1KTDB 4PJHF 4JRXD 2VO5A 4L8SA 4X7EC 2PR4H 3KXFA 5F1IA 3KR3L 2BNUA 4K7PL 4NNXA 3QXAB 4YHPA 2VLLB 4KI5C 4UZGA 4NHUA 1JNNL 4M1GL 1CFQA 1C5BL 4YDVB 3EFDH 4JPKH 1CICA 1N6QH 2DQCH 3LKNA 3K2UH 1Q9OA 1M05A 3IDGA 1LO0H 1BIIA 5HGDB 1EHAA 5CD5D 4Y7MA 1S9YA 3MROB 5F9OH 2X4OA 2BC4A 1C8PA 3IJYB 1NEZA 1NMAH 1OARH 3GSXA 3LMJH 4RRPA 2G75B 4YHNA 1KN2H 5HXMA 1JPGA 3X3GH 3LQMA 5DUPH 5BRZE 5CGMA 3ULVF 4OD2B 1CE6B 4HIJB 1UZ6E 1TVBA 5CWSA 5E99H 2W9EH 5ACZA 4OTXL 3QDGA 5FHAL 8FABB 2OQJB 3DI3B 5HDQL 4HKXB 5I8KH 2DQTL 5C1MB 4PGZA 5D93B 4APQB 5KVMC 1AKJB 3HFML 4K9EC 1JRHI 1UWXK 1PKOA 4UILH 2F8XC 5HHOB 3MFFB 3O2WH 3TC9A 2R0KL 5DI8A 2JJTC 4HK3J 4F7CB 1FCCA 1YJDL 1DEEA 3TF7C 1PKQE 1XFPA 1INDL 2ZG1A 3LDBC 2WINB 2V2WA 3QIWC 5DJCA 4P2QE 1MCOH 1ZHBA 4WVRA 1ZTXH 1A6ZB 1FQ9C 3FB8A 3IYLW 4GUPA 3MSPA 5KANI 3VXOA 3FT4A 1I75A 5FF6A 5FHAH 2A73B 1TTFA 4LGSB 1DQMH 5B38G 3ME0A 1GC1C 3NZHH 4KRMB 4LQFL 4K07A 4OZIA 3QWQB 2GK0A 4KRPD 5GSVA 5JHDE 5D7KD 1KEML 4P9HL 1CLYH 5DA4A 4OJFL 4NWTH 3PP4L 4JQXA 1D9KC 2E5EA 3C6LD 4JCMA 1EFXA 2EDEA 3KJ6H 2EDRA 5GZNC 4NKQB 1HNFA 4HFUL 1F4AA 5CKAA 4WW2F 2WZPD 4HKJA 1D7FA 5DYOA 1CVRA 3SQOL 3BZ4B 2FGZA 5GS2H 4PGJA 5BRZB 3LIZH 4ZD3L 1AGFA 5I74C 2ARJB 2ARWA 3L6FB 2EYTA 3GSNB 3I75B 1CWVA 3K3QA 3KLAB 1XGTA 2OR9H 3W9EB 5KVGH 1EX0A 1ZWIB 1UWGH 1MLBB 3IFLH 4FQCH 5D7IA 4ELME 4JFFE 4UQ3B 5L6YH 1ZAGA 1SMAA 4LHQB 3EKCA 1FFRA 2JTDA 3GMQB 3KPLB 5MP6L 5CILL 4YWGH 5DHYB 4G8GE 3X11A 4OF3A 3FQWB 3JWDC 1N64L 1N59A 1KCSH 4BM7A 5K9QI 4PGDA 3HG1D 2COQA 3KPOA 2Y36H 4QGYA 2JELH 3MRLA 4P2YA 5DEFA 4FRWA 3B9AA 5C6TL 4PYGA 5I74B 3VXNA 4ZYKA 1NUFA 3UBXI 3IFPB 1BJMA 3DSFH 2VDQL 2ERJC 1WFTA 3DMMD 5I15H 1RFDH 3U0WL 1A7RH 1NSNH 3H9SA 3RFZC 3KYOB 2FJGA 5H35B 1EVUA 4I0PB 2E7HA 1IEBA 3LCYA 4Q6YA 3TBSB 4P3DA 3BZFB 4LSQL 4L4JA 3OR7B 4Z0BL 1QZ1A 3X3FL 5C0EA 3BPNB 3KYOA 1U3ZA 2XTJC 2O5XH 5SWSA 3TYFA 1CFSA 3KPPA 2AJVL 1U41A 3OGCB 5C6TH 3R4DA 3D0LB 2HP4A 3TYFB 4RRPG 5FV1L 4NZUH 4S11A 5C6PB 1S8DA 2QSVA 3E3QC 2CXGA 3O6KH 4ZPTB 3TVMB 3D0LA 4HWBH 5D7JC 3UXFA 1NCDH 1WLHA 1J1XH 4JR9H 4S1DC 5D6DA 2XXCB 3QFJA 1OQOA 4WI2A 4UT6H 4YNYB 1H15B 5B39A 3P4OB 5EU5A 4XP9H 4M5YL 3TFKD 1L7IL 2C3GA 3GMOB 5DWUL 4JFFB 2IH1A 1WVZA 4XWOC 3VGHA 3QWRD 5F96L 4Y4FD 2PW2B 3CC5B 4UOW1 1OSPL 1N0LA 1IAIL 1JPSL 4PYHA 5KVDH 1F90H 1U8MA 4WTWA 2J6EA 3D69B 1H3XA 3DOSA 2Q8BH 3FCTA 3BI9X 1HN1A 4HPOL 2UWEA 4PGCA 5CEZH 2PO6D 4ZFGH 3TESA 3QXAA 5DD5L 5C0BE 1AIFA 1CFQB 5IB2B 4XPFH 4XVSL 2N7BA 3VXUD 3QQ9D 3MRNA 1WFNA 3UTSB 1LK2B 1KJ2L 1KJ2H 2J6EH 1UCBL 3KJ4C 3VFRB 3SE9H 2VIRB 3FQXB 4PRNA 2E9JA 3L3KA 3WS3A 4NQCA 1Z5LB 5CUSL 4IMLA 3HZMA 3LPFA 3VFRA 3DRQA 3VFOB 2V7HB 2VDLL 3CDGA 3L3KB 4DCQB 1OF2A 1BVLB 2XTLA 3EJYD 2B1HL 2VQUA 4HT1L 3T0EB 4DN3H 4B7LA 5CGYC 3O4OB 4GG6F 1JFQL 2Q8AH 3RTQC 1KN2L 3TLRA 5KSVA 4JVPA 5A3IC 3T0EA 2CJUL 1IL1A 4F58L 1INDH 3BVNB 1A47A 4G80B 4U4BA 3K74B 1ZS8B 1MI5E 3PWNB 1J0IA 3O3AA 4X4XB 4F7CA 1SBSH 1FNGA 1IGYA 1IL1B 3RI5K 2BNQA 2YZ8A 5FUZH 4PJEE 1NAMA 4L9LA 4MQTB 4JHZA 1LNUB 2DM2A 4KKLC 5DJDA 5FB8B 3V4VH 4PREB 2X4QB 3BRGC 4QXGH 1J8HE 5C09E 3FQUB 5E5UB 4GUPB 3WFHB 3AU1A 2HVJB 1H3PH 4MAUH 1W8NA 5EO1A 4IIQA 1NMBL 3T0WA 5E2TL 4P46C 4OGAD 2XY2A 4BYHA 3FQUA 3KPQA 5C0IA 4W4OA 3H0TB 4WWKD 1DQQA 4I2XA 2FJFA 3ARGD 3RIAK 5CJXA 3PUCA 4KK6D 4LSPL 4KKAC 5T33H 4QYOA 4BQ8A 5HGBA 3H6JA 1MHHB 5TF1H 5BZDA 1F42A 4NQTA 2UY7A 1IRAY 1QNZL 4JVWA 4L29B 1FGVH 3ULVE 1EIBA 3HN3A 4UIMB 1I9EA 2HKFL 3B9KB 3L3JB 5TFSL 1HILA 4HUXB 3PIQB 4HXBH 4RWYH 3OB8A 5AUMB 1OM3L 3W82A 5FM5O 3WN5B 3QUZC 3LHPH 2M2DA 3L5WA 1FN4A 1MCIA 5GIRA 4LRNL 5EO9B 1RHHA 1QBLL 1AD9B 3CDCA 1MVFA 3DVNB 3F5WB 3OAYH 4YH6A 5SV4A 1QBML 3BWAA 3U1SH 4Z7WF 1TJGL 2GCYB 5CILH 5EU6D 3QRGH 3VXTB 4K3EL 4JDVA 4ZFZA 5L0QC 1I3GL 1EAPB 2B5IB 3DVNA 3HLAB 4HIXL 4KTDH 3TBTB 1JNLL 3VCLA 1F58H 4X5XA 3C6LC 3WFDH 1KUMA 5IFJA 2ESVB 2X09A 1WK0A 4Y4HD 2ITCB 1FNHA 2OCFD 5BXFA 4P5TD 2BSRA 1C1EL 4PJXA 5ABDE 3NACH 4QTHA 1NCAH 1MFAL 4NUGH 2XFXA 4LLAA 1YDPA 4YHOL 1NFDA 1CE1L 2R1YB 4Q2ZB 5E5MA 5I18H 5IFHH 3DMMB 5TPWL 1U42A 4NKIL 4RQQA 3IF1B 1EBPA 5K33A 1OPGH 4LDLB 1C7SA 3C5JA 1RUAL 1TZGL 4HAFA 5JQ6L 1MFEL 5C0BD 3F7YA 4L4TA 3GSNH 3VFSA 3B3IA 5DRWA 5CBEB 4PJ7E 4QTIL 1Y18B 3WNKA 2CRZA 2IPUK 2CUHA 5CBAB 3BN9C 2OR8A 1VFBA 4PJ5D 3BH8B 4GSDH 5TE4L 4I9WE 1QG3A 3MUJA 3ZHDA 1EHLL 1PG7H 1WZKA 4K7FA 2QSCH 1DBML 4JM2B 1PKQB 4HK3N 4JZNB 2ZSVB 3OKOB 4UNUA 2ZCHL 1CG9B 1TJIH 4U6XB 3LZFL 1J1PH 3V4PH 1P4LA 1FRGH 4N90E 5HI5C 4JZNA 2ITDA 3LMJL 1U8IA 5I1EH 3TJHD 4WHYG 3WO4B 5JXEA 4HF5L 4PJ8B 5D7SH 5T1KB 1A6UH 4PJXF 2VSCA 4Q7DA 1RK0B 4PLKC 2RR3A 2AJZB 4N0CD 4UOJA 1H3TA 4PTUA 2BVUA 4ZFGL 3MPCA 1AGEA 5IV2B 4S1SH 1REIA 2AJSH 1OTTD 5HDQH 2FR4B 1ONQA 2J5LC 4KKBC 4I77H 3QDJA 3D48R 3BT2H 2NY1D 5INDB 4E0RB 4X6FA 1JMXA 5IV2A 4N90D 5LJYH 5EUOB 1F90L 4PJ9D 4HWBA 5FGRA 1YEFH 3RWDA 1NKOA 1BFVH 1QFWH 3F7QA 5DFTA 5IB2A 1ZGLM 5E8EB 1QYGL 1N7ML 4YHNB 1K3IA 1KB9K 2O26U 1YEDA 3V6OA 3EJZD 3K2UL 2AK4A 4K7PY 3W5MA 4G8IB 5TJWK 2VAAB 3HE7C 4KZEL 2D4FA 1M05B 4NQCB 3STLA 3QEQD 1S9YB 3MROA 2ZCKL 5T1MB 1C5CH 3DRQB 4X5LA 3GBML 4XNXL 5DR5H 5F9DC 3RJQB 4MA3A 5ITFB 2YRZA 4LARL 5BZWA 3UTSD 4HKXA 3GJFA 1CT8A 3MXVH 1O7SA 5DF0A 4L8DB 1I1FA 1IQDB 3GUTA 4X0KA 5EH1A 1NC2B 3RWEA 2AK1L 3WYRA 1VACB 3VFVA 1X3DA 3X12B 2X4NB 4HC1H 1LE5B 4ZUWA 3GUTB 2V2WB 3VXRA 1B9ZA 3V6FB 1I1AB 4HUWA 2UZIH 2FD6H 3MFGB 2OL3A 3N1GC 3ARBA 4Z7VF 4EOWH 2VB5A 2W59A 2IQAB 2W07A 1MRDL 3F7RA 2OM5A 3LRHA 3WS6A 4OGAC 2XWJB 3ARBB 1AY1H 3O8XD 2BHZA 4URTB 1Q9KB 3UMTA 3ECBB 2MKWA 3UO1L 1F3DH 2UZYB 3SGJA 4XNUH 5T5FH 5FA3B 1F58L 4A6YL 5DO2C 4WUKL 1OVZA 1JF5A 3IU3A 2EKJA 3HMWH 1BZ9B 2F5BH 1RZ7H 1Q9LB 3MRKB 3QHFL 4NJAH 5I1HH 1Z3GH 1PEWA 5BZDB 4PRBB 1U3YA 4FQ2L 2J8UB 4S0TD 5EWIL 5D1QA 3HRPA 1S3KL 1H3PL 3PF2A 2HFTA 4EN3A 3OV6A 2YD6A 2Y6SC 4YDLC 1IQWL 1J11A 1VB9A 3RA7H 1J12A 3MOBL 5B4MD 1AXTL 3DX7A 5EN2A 2XXMB 4KPHH 4OZHF 1JGUL 4OZHB 1FLRH 2C5DC 4M7LH 1BJ8A 5DFVD 2ZOKA 1CXFA 5A40E 1XCQB 4M6OH 2EXYC 4S1QL 3IS1X 4WWKC 4KI1A 3RGVC 3N85L 5T3XH 4HQQH 5A2FA 3ES6B 6FABH 2EH7H 3BGFB 2VC2H 4X6CA 1NDMA 4JB9L 4OCNC 2OJZL 4KK9D 5EBMA 4X9IA 5ADPH 3DROA 3HG1A 4RMVA 4D9LH 4F9PC 1RZKH 2BVQB 1KLUA 4WGVB 1ZE3C 2Z93A 4Y8AA 1X5IA 2VDOH 5KG9B 3TT3L 2BSRB 3WEXA 4MB4A 5JHLH 4Z7NE 2AJSL 1RZIB 1NFDB 2R1YA 4OM1H 4Q2ZA 3I50L 3WNNA 1T1YA 5E56A 4WWID 1HQRA 1CXKA 4HG4K 3RI5F 1CDHA 4JFHE 4OM0H 5I16A 4P4KD 1NGYA 4Z5RA 1JNHB 4S10A 4NQVB 3OXRB 4KV5F 4L4VA 2IGFL 4U1IB 4JO4L 3T2NL 3AROA 1AHWA 3L5XL 2XQBH 3VD5A 5EC1B 1FO0H 2WW8A 1AC0A 4JRYB 5GGVL 1AGBB 1OAYL 1VADA 5EA0L 3V4PL 3D2UA 2YD4A 2B20A 4WNQB 3PV6A 4CU6A 4ZNEA 2B39A 2O5YH 1YECL 4YDKH 2J88H 4K7FB 4WWKA 1LO3H 4FTVA 4P3DB 2DDQH 1W72A 5I75B 3NVQA 5KSAB 4AT6B 5LVEA 2VDPL 1S9XA 1DTUA 1JK8B 5DJ0A 1HXYB 1PG7L 3NABL 3OKKA 4HDIB 4P57B 4PGBA 5GPRA 1JWMB 2QADD 1FG2B 1T2XA 2I9TB 3NCYS 4GOSA 1P9MC 4AIZA 1ED3A 2F5AH 1RPQA 1A0QH 2Z92A 4KMTL 4EN3D 2WBKA 1NDGB 5JIPA 5TQ2H 2F58H 3CXHJ 1W72L 3VRIB 4NYLA 4XT1C 1N5AB 4YFLI 4FQXA 5I71C 1IM9B 2PW2A 4OD1H 1A4JA 3B9VA 3IB4A 5I1JH 4AIXA 5E2WH 4R4BA 5FO9A 5E6IB 3FZUC 5HHMB 4Q6IA 3GSOA 3GK8H 2HN7A 4YNYA 1RHFA 3L3GA 1MCBA 3K7UA 3PNWA 4EDWL 1U8JA 2NYYC 2EO9A 2NX5A 5F72S 3ZDXE 1X5LA 1JGEB 4IRJC 2A0LC 4M6MH 4ZAKB 3PP3K 2J4WL 1U8JB 3NCCB 3NFSH 5DD6B 4NNXB 2FBJH 3PGDA 4KZDL 5GJTL 4U1NA 3RWJA 1J8KA 3QIUA 1GOFA 3K1DA 4ODUA 5GS0L 4WEBH 3MV7E 1J1XL 4JR9L 4GW4B 3GSVB 1MVUB 3VXME 4PLKD 1H8OA 3AVEA 3ARBC 5HPMB 2APWA 2YPLA 3VWKA 1FHGA 3WIFA 5SX4H 4KC3B 1KYOK 1U0QA 4PJFF 4PRPD 5C0FA 4GW4A 4XMLH 3ZKXB 2HTLC 2IFFL 3EYUH 3I6LE 4WFGE 3O6FA 2XNAB 3NH7L 4Q9QL 1P4BH 1R5IA 1T3FA 2EO1A 1SM3H 4IMLB 4M61A 3L7FB 4B41A 5HYJD 3MRGA 2KBGA 3GIZH 2PUQT 4MNGA 3EDEA 1WJ3A 4YDIL 3L7FA 3I6GB 5ICXB 4FFWD 3VMPA 4DVRL 4R0LA 3SHSA 3QUZA 1LDSA 4PREA 4ZXBD 4KUZL 4L8BA 2JK5A 4YZFE 1PW3A 3LKQA 1V7NH 3EGSB 1PD6A 1RJYB 3GSRA 2G5BA 4FQJH 4YUEH 2EIZA 3RKDC 3MLSH 2IEPA 4Z95L 4JKPH 3SKMB 2P8PB 3H0TA 4HUMB 3NBNA 3NA4A 3E6FB 2JCCA 3OKEA 1A9BB 4LHJB 4CVWA 1JI2A 5J13B 1BFTA 4G7VH 4ERSH 5I6XB 1CLYL 3C6SA 1I85C 1G7PB 2A6IB 1KBGH 1A9BA 4XVTL 4QRRB 4W68A 4Z0XB 4F7MA 3KPRB 5FCUL 1KLFA 5IKCB 4PRPA 1S9WA 5HHQB 5CEXA 4KKAD 1OAYH 4PRPB 2FEEL 4I4WB 2FHFA 3U2SB 1WZLA 1IAIM 4NZRL 4LSSL 4V1DD 3T3PF 4HULB 5I66B 4XCCL 5IVXA 3L3JA 2J8HA 2VXTH 1A4KB 1KNOA 4X5WA 5I1IH 2AJUH 3VD9A 3SJVD 2NPLX 5AUMA 2R8SH 5DC0A 5MERA 2KDGA 2IAMB 1V3KA 5BW7C 1CDGA 2R2EA 1L9NA 4X5XB 1ZWIA 2AS5M 1LP9E 5IFJB 5LWYH 2R69H 5D7IF 3GKZA 2KKQA 5D7IB 4Q9BA 2AABL 1IT9H 1NJ9A 3EYQC 3LEXB 3DROB 3HG1B 3O9WA 3C9NA 5GRJH 1ZHNB 4P2OA 4OD3H 3Q3GB 1UQSB 5ID1B 1KCLA 5HDLA 4O9HH 5JZ7D 1IGIL 2AXGA 3NFPB 4KVNL 3OG4B 4YR6A 1WBZA 4WI8A 1BX2B 9CGTA 4WI6A 4HQQL 4XC3L 3BZEB 3EW3B 1VKXA 1U2CA 3SOBL 3B3IB 2IGFH 2FL5A 3UPRB 3DVFA 3JV6A 3HZVA 4R8WL 5KZCB 4G8EA 2IG2H 2NY3C 1L4IA 1Q8MA 2AJ3B 1NGPH 2QHLA 4UT6L 3QUKB 4P2OD 3PWVA 3ULVL 5C8JB 4GO6B 4P48A 1CF8L 3OB0K 4TYUA 2D7OA 3DTXB 4X6EB 1MCQA 4X7TB 1SBBA 3G5YA 2GTZB 1JHLL 2V2XA 2P44B 1D5XB 2BOBB 2P42B 1BBJA 4MYWB 3B6SA 1AFVH 3CFKB 2IPTH 1T7WA 3O8XC 5HGHA 4NGHH 3RX5A 2AK4E 3GHEL 5I17A 5JZ7C 1YEIH 3HR5A 3JWOH 3ZYIA 2X7LA 4NBYB 1A8JH 2CDGA 3O41A 3F8UB 5H2BB 2VYRE 5F1NA 4RX4D 3CFKA 3MLUL 1U8IB 5F21B 5D1QD 5IM7B 2E6JA 3DX9B 1HE7A 5ALCL 4KI5D 1GSMA 5C9KA 2V5TA 3ARDC 4LF3A 1MREH 1HDMA 3GMMB 3ARZA 3V95A 5IW1A 4LLDB 1OGAB 5I1AB 5EU5B 5L2KD 3B2UD 4NO2A 2EXWD 3MRBA 3NFNA 4XBGA 4M03A 2HT3D 5IK3A 4RA3A 3FOLA 5L8LB 2P45B 5EORL 3BKJH 1TETH 3ARUA 4MA8L 1AO7B 2Y72A 4N0UB 1EK3A 3MA9L 4Z7WB 4OLYH 3TBWB 4D9QD 1KLGB 4MSWA 5DLML 4PD4K 3V0WH 5LQBH 2W0FA 4ELMB 1QFOA 2BXZA 1T5XA 4XPAH 3SDCB 1TIUA 2XT1B 1YUHA 4R7DB 1CXIA 4P23D 4FZ8H 4PTTB 3GSQA 1N4XL 2FH6A 2NW3B 1NKRA 4KJWD 4PJ7A 4R90H 5H94B 4LP5A 5DHVA 3FQNA 5DZLA 5ICZB 5D7LE 3CH1A 3MYZA 4MJIE 4MXQC 3SGDI 1S5IL 4JFEE 1FORL 1AY1L 5A2IH 3NA9H 4HKZA 5KW9H 3U82B 5I2IB 4U1HB 3S9DB 3UYRL 3CH1B 5SWZD 2DICA 2GSGA 1JF6A 1ZV5A 4YC2B 2GI7A 4OCXL 4GG8A 1I4FA 4OGYH 3ARVA 1I3RB 2C3WA 3LKPB 5SWSE 2VAAA 1HQ4A 5EU7E 5JR1H 2Y9RT 4GG8B 1YY8A 1YEFL 1T03H 3OHXB 4LLUA 3ZE2F 2ADGA 3P3YA 2CH8A 2D0HA 3WHXB 2DQUL 3S36X 2FNBA 4HWZB 5IB1A 4L8DA 4TPRL 1JVKA 1UYWL 1KIRB 4KV5E 1A1NA 3QDGD 5FYJU 1J0ZA 1X4ZA 1NC2A 3EBAA 1WCQA 2APBA 5GRZA 2B1HH 1XGQB 1L0XA 3FO1B 3A6BH 4XC1H 1PG7W 4A6YB 4NRXB 4M00A 5DVOA 5EOTB 2VZVA 4J8RB 5DMKB 2CK0H 1IGJA 4GXVH 1DEEB 3STBA 1AI1H 3QI9C 4HG4J 5IVNA 2HH0L 4A6YA 5K59F 3AU1B 3IU3B 1MAML 3UTZB 4R2GD 2H1PH 4J8RA 5B22A 4IIQB 4KKLD 2YC1A 4NC1E 1MEXH 3P40A 5GRWA 1DQJA 3FOMA 1V3LA 4L8CA 2WBJD 2HVKB 1FFNA 1R3HA 3LVEA 5LCVL 2ZUSA 3D9AH 3O6MH 5I8KL 1BVKA 4NZRH 3AMLA 5JPNB 4ZSOA 4PRAB 1CU4L 2LAGB 2QADB 8CGTA 4OGXH 2O5ZL 4IHOB 4QHMB 3QDJD 1X5ZA 4ZSOB 1OB1A 4NHCL 4GBXB 1MAJA 3IAQA 1KBGL 4BSWB 3VFPA 2M26A 3WN5A 3SKNA 4KXZI 4HH9B 15C8H 3OX8B 2PYEE 1C16A 4H0IA 3TIEA 1FN4B 2H32B 4LDEB 1H5BB 3KPSD 1PYWB 2Y6SD 3LEYH 1HHGB 2ZG2A 4ZUTA 2X4RA 4X6CB 5A16B 4DTGL 2X42A 4Z95H 5B3JE 3VXMA 1L0YA 2NY2D 3UJJH 2YKLH 3QA3B 4XP6H 2Y25A 5GGUA 35C8L 4L4TD 1OW0A 4P4KB 4XNMA 1PSKH 2D7PA 3IGAA 3MNZB 3QA3A 1Q72H 1UXWB 3H9HA 1MLBA 5C0AE 5HYSB 4KHXL 5DVKA 4ETQA 4P4KA 5JMRA 2UZXB 2H3NB 4RDQG 1HQRB 5TGBA 3FO0H 2MPAH 1SYSA 3KPLA 3T4YB 1N3NB 5F9JB 5F9WB 3FB7A 1WICA 3SO5A 5KG9A 3OXRA 4FQXC 1U91B 4NQDE 1CGSL 4ZTPL 3PP3H 1E4WL 4ZS6C 3INUL 5E8PA 2CIIB 2EE3A 3KYNA 4ZFOB 5MI0C 2AJ3A 4FFWC 4DZBB 3C8KA 2I24N 5IHUH 1DUZA 3SDXE 1T4KB 4LLQA 1QR1A 3M45A 4F33A 2Y36L 1BQHB 1KC5L 1BD2E 2W38A 1W72B 2CO6B 1MCWW 2DTML 2IQ9L 3OAUH 1F3RB 2FATL 1UKTA 1KULA 1B88A 2YMXH 5EC1A 4AM0A 4IRSC 3FT2A 3HNVH 5HDBE 3VFMB 3WKML 4YWGL 5LAXB 1AGBA 4ODTL 4GRLB 2DQEH 2I9LB 4FZ8L 1T6WA 4X6CF 2C4FU 4L3CA 3I6KA 4XVJH 3OGCA 4OF8A 3NMEA 4X6CE 2DS4A 2HMIC 3I3BA 1JK8A 4EDWH 2LFGA 3BSZH 3MOAL 4L3CB 1S7SB 3OZ9H 3QHTC 1RIVL 1CL7H 1QLRA 4G3YH 1A3QA 1HINL 2ED8A 3LS5L 5TF0A 5C0DA 1QBBA 4S1SL 2V17L 5E2WL 2OTWA 5BMFL 5BQ7A 1LDPH 3HUJE 1BWMA 3MZTA 1A22B 3RWFA 1KIPA 1KTKE 2A0LD 4X6DF 5ENWA 3C60C 4CVZB 1MREL 4GAYA 1FC2D 2Z4QB 4WFGD 1TTUA 1UKSA 5GS2D 3D5OF 4F58H 3DXAA 4GS7B 1RIHL 2VDRL 3LN4A 3NABH 2DQFB 4IOFD 1A9EA 1CICC 1MVUA 4JG1H 3VWJB 1V7MH 1PY9A 1QSZA 3JWOL 5IUSA 1XGUB 4Y5XA 4IRZH 4U2ZA 5ETUB 3KJ4B 1F8TL 3C08L 2BP3A 2ARJQ 2DDQL 1FNEA 1FFOA 2K7QA 3L3OB 1Y6MR 5HGDA 4HKZB 4LRIC 1CZ8H 2FECL 1PX3A 4LIQL 1IARB 1UH3A 4BFGA 4ODUB 4KKNA 3D18B 2BHUA 1R5IB 3V0VB 3FB5A 4Z7VA 4KKCC 4JFQA 4J23A 1KPVB 2XV6B 4PJGF 4D2NA 1ZLSH 3L7EB 4QRTA 3SDXA 1NGQL 2DLFH 4UB0H 4EUPB 2BNQD 3QEUB 4GG6E 4P59H 1G0DA 4HIHA 3QUZD 3FT3A 5DD5H 3NTCH 1X44A 3UDWA 3DO3A 1IE5A 1UM6H 3L3HA 1VACA 3J8F7 1KG0B 5EZLA 1Z2KA 2HLAA 3HR6A 1RUQH 2P49B 1OGAD 3IRZA 3DYOA 4CL7A 3SDDA 1LP9A 5CZKA 1CYGA 4PPTA 2OJZH 5L7XL 1G7IA 5CUSH 4OCYL 4JLRA 2I25N 4G80A 4ODHL 2DIJA 5EOTA 5C0CE 1RURL 4TNWF 4RMUA 4FFVD 4GRWH 1FZJA 3BMVA 2EDBA 2G5BB 1ZXQA 4DN4H 5DMIH 2LAAA 4R7NA 1RULL 1BFOA 5BVPL 2DKUA 4PRDB 5DDHA 1IEAA 2HVJA 2NR6D 2VXUL 1SY6A 2NY4C 2HVKA 3V5KB 5EO1B 1A7QH 1Y0LA 5E8OA 5JW5A 4NKIH 4NKDB 5FK9B 4C4KO 4EI6A 1CR9L 2R0LH 1J0KA 2AW2A 1EGJL 2HFEA 1T7XA 1QEWA 4X4YB 3RL1A 4R26H 1FGVL 1K9TA 4NKDA 3ROOB 5T1LA 2YEZA 5HHPA 1NFIB 4QHUA 4JG0H 5E9DD 5DD0L 4M7KH 1UJTA 1LEGA 4JKLA 1EZVX 1H5BA 1SVZA 3MUHL 1MPAH 4Y5VB 2YBRB 2MTPA 3MLTB 3LKRA 4WI5A 4GXUN 4IS6B 3F12B 5A16A 3VRJA 3MLVL 3ISWA 2FRGP 1IM9D 3B43A 3ESVF 4TSAH 1E27A 5J1SC 3CUPB 5DURB 5HHOE 4M02A 5CD5C 3MLTA 1XF1A 1NCTA 3FO2A 4OV5A 1S7RA 5IHLB 5EBMB 4C56E 2EKSA 1YYLL 4KQ4L 1F45A 3O2DA 3L3IA 5IESH 3AREA 4PJCF 4NUJA 3T1FB 1XGPB 5E2VL 2EZ0D 2EC9U 2OP4L 2R1XB 4RFOH 1UWGL 5CSGA 4OLVL 4S2SA 2DLHA 1G0YR 1VFUA 2C4FT 1MQ8A 1FE8L 2M8XA 4YBHA 4QTHB 2XYCA 1IGFH 4HS6A 5E24E 1NLBL 1ADQH 4P5TA 4ZO6A 3TA3D 4WY7H 4X7TA 2VZTA 4QOKA 2HRPL 2JJSA 5DO2D 1YEGL 1DFBL 1TZHB 3U4BL 2PTTA 4LLVB 4D8PA 3UJJL 4F33B 1U3HD 1GAFL 1UJ3C 3WFBH 1JHLH 3QUKA 4F9LC 3CCHA 4MA1B 1QSVA 2F74B 2EE6A 5I30L 3WD5L 3GMPA 3L95A 4QXTB 2FO4B 2OMNA 3PHQA 4X6EA 3FT2B 2R2CA 2F74A 1GOGA 2Z31D 1VCAA 4YEEA 4LP4A 3QXVA 3QXUA 4P5KA 3OR6B 1IKNA 3PQYE 3S35H 3W5NA 2R4SH 3WNLA 5E2UL 3T0DA 2EDDA 3BKYL 5TE6L 4KJQD 5L88L 4ZXBB 2DYPB 3GK8L 3WUWA 3GNMH 1JPSH 4NP4L 4X9BA 4ZOBA 3RL2A 5CJ5A 1BIHA 2R4RL 1Y6NR 5ICYA 2XACC 3O45A 1B0RB 1DBKH 4PJCB 3VXSB 1A6UL 3T3PE 2ICWB 2DLFL 3MYJB 5FGSA 1W72H 3VFWA 2PW1A 4U0RB 5JO5A 1ZVSB 3FHAA 5ANMB 5HPOA 1XIWA 2RQ8A 4WGWB 2WAHA 3N1PC 4R4FH 4ZUVA 4Y5YC 3LKSB 3N1QC 4ZAKA 2UWEB 3A6BL 4LCYB 3CNKA 4WUUB 4G6JL 3CFJB 4TSBH 5KSUA 5INCB 1HKFA 2QV2A 4TRPL 1KLGA 1IZKA 2EDXA 2W0FB 1XGUA 2NQCA 4Y5XB 4ELMA 3KHQA 5E99L 2GFBB 4U1HA 1I8IA 1MJUL 4N8VA 1HH9A 2BRRL 1MWAH 2XN9A 2R9HD 2Z35B 3TBYB 5EBWA 5JHDA 3DJ9A 1MFCH 1F4YL 3C8DA 3TJEH 5FO8B 5JW3L 1E4KC 3O6LL 1NMCC 1DBJH 1P2CA 2FX8H 2WP3T 2XZCH 5JORA 4NT6A 1ZT1B 3OAZH 3ARBD 1L7IH 1PAMA 4FOMA 3GSXB 4H8WH 2OS7A 2W60B 2XNAA 4UILL 4ZO8A 1BVLA 3WL9A 2GJZB 4ZQKB 2A83B 2DF3A 3O4LB 1JPGB 4HIHB 4OFDA 4LBEA 3CDFA 1KEGH 3H9YA 2PR4L 4MZ3A 1KJVB 1MRCH 2GJZA 4O02H 3UCRA 2XWTA 2Y23A 1T0MA 5BW7A 4R97B 5CHNA 1V7ML 1UH2A 3BUYB 4NN5C 3MCKA 1JTTA 1RZ7L 1AR1D 4NJAL 3BP6B 4OAWA 5I8CB 4JHWH 4RBPK 1FJ1A 4DZ8B 1LNUA 4J3VA 3EGSA 3UTZA 3VXSE 1KFAL 5MEOA 3GIZL 4Y4HC 3SE8L 2IH3A 3BP6A 4RGMB 3ZKNC 3FO1A 4P2RE 5HYSG 2CDEA 4DK3A 3V5DA 5IWLC 5JDJA 4WUUE 3ILQC 1CR9H 2R0LL 4HJ0D 3BIKB 2D31A 2ZUTA 1BQUA 2AJYH 3VXOB 3FRPG 3NCBB 3SO3B 3BE1L 2HKFH 4NRZA 5LKNA 1N64H 1MCDA 4HXBL 3QRFM 1OT1A 3LQAH 1BQSA 4LLWA 5GSVB 5A2KH 2OTUA 1MPAL 4KK8C 1KFAH 1S5HB 3HUJF 3U0TA 3VGEA 3Q1SH 4OJFH 4WO4D 3O3UN 2OTUB 1OGTB 3GHEH 3BGMB 3BKCH 4JFDD 3VXMB 3L5WB 2EEAA 3V6ZB 4UDTA 5IB5B 3VG0H 2FATH 4C57C 4QHLA 5KSBF 1RUKH 4UIKH 4F15C 3CFBB 5GS1A 3MBED 3SKNB 3O4OC 1AGFB 2ZP0T 4F80A 1C16B 4QXUH 2F19L 4OZHA 4UBDC 3OMZA 3JBG7 2YKLL 5T1KD 5HGGS 5HYSA 1HHGA 2J3SA 1LE9B 1GC1L 2DYPD 2VWEE 2CXKA 4OV5B 2BHYA 3LEXA 5CEZE 5IJKC 3HC4L 4RWHA 1VHPA 3FN3A 4IDJH 1CD8A 1HSBB 4FXGA 3VE0A 5AG9A 3BMWA 3EJYC 2CLVB 3PV7A 4H8WC 4ORGB 4YXKL 1EZVY 4CDHA 1Z9OA 4G42A 3MXWL 1QUNA 2XFXB 1PY4A 4FFZL 2Z31B 4MDJB 4I13B 3V6OC 3VE0B 3BH9A 1HXMB 4OD3L 2YRPA 4LSRL 3TPKA 4OKVA 4EN3C 4UNVA 4D3CL 4TVSa 1AP2B 5ESQB 1YPZF 1QQDB 1P5VA 4D8PB 1U8OB 1F11B 4OZGF 4DZBA 1AH1A 1EFQA 5DJ6A 4QHNB 2VDRH 5IP4A 3MRCA 1Q1JH 1U8OA 4PUBL 4ONFH 4HXAL 4POUB 2B2XH 1KCVH 5D72H 4K23L 1K5NB 5KS9B 4Y5XC 1WV7T 3SGDH 1AQDA 1X4YA 1TJIL 2Q20A 2EZ0C 4UU9A 3AREC 5I19L 1LDPL 3CDYA 1JGLH 5T5NG 5L88H 5L9DH 1GYAA 3P0VH 4BZ2H 4LCUA 3BT2L 4MXVF 2ITDB 1R3KA 4U0QB 4BJLA 2Q8BL 2P5ED 5FKPA 4BELD 4PGBB 4BZ2L 4JZJC 4YDJA 1BFSA 2FSEB 2DQUH 3EZJB 5C0AA 3VJ6B 3VXQB 4WHYH 4I5BA 3D39A 4Y1AE 4O2FB 1QO3A 4PRHE 1QSEA 2CSPA 3HNTL 3KDMB 3QWOA 4OF5A 5IHBA 2BK8A 1MCRA 3DI2B 5CIPH 2H6PB 5CJ8A 5DSCA 3VFUB 2Y5TA 5MENA 3MYJA 4ODTH 3IRPX 2E7BA 1R3JB 3LKOA 5BQ7B 4P5MA 5MHSD 3PABB 4FMFA 3DUUB 3V52L 1ZLUH 4PP2A 4X6FB 4ZUVB 5IMLA 5E00A 4X7FC 5B3JF 4GW5B 1JHTA 2E27H 4LCYA 4R97C 5KW9L 4BA8A 5INCA 2F54B 1XF5B 3FKUS 3DXAB 1DANT 4NQCD 1WUNT 2GT9B 5IMLB 3P30L 1IGTB 4ZS7L 1BECA 1OAZH 3QNYA 5HTSA 1ZLVH 3RGVB 4I2XE 4Z76B 1FZOB 4OCRL 1KB5B 5I1LA 3CJJA 4RCAA 4L1HA 4R4NC 4DKFL 5DUBB 3HAEB 2W0LA 4LHUA 3MLPA 1AE6L 4LSQH 2GITB 2LTQC 1KB5A 2F53D 1ORSA 1RMFL 4LVNC 2PO6A 5C71A 4MNQA 2YPLB 3LH2L 3RX7A 5IEKB 4PJ9B 2Q3AA 3NZ8B 3GSWB 4M7ZC 3TZVC 3K1KC 3DGGB 1KCUH 1T2QL 5I73B 3C8HA 5F7NC 3REWB 4HWUA 2NY1B 2SEBA 2A9NH 4CRPA 3GRWA 4OGZA 4WHTA 4JPVH 1OD9A 5F1SA 3DGGA 3QDMD 4NO0A 1WEJL 3W11C 3WHXA 2XZAL 4PJBE 1R3IL 1MIMH 4FXKA 4WEBL 4YXLH 2NCMA 1GIGL 4WTXA 1KG0A 5EZLB 1YMMB 3BDYL 4FXKB 1T1XB 2X5PA 4NRXA 4FP8H 2VE6A 4X99B 5FUOL 3QUZB 3WE6A 4TULH 1MCCA 5EUOE 1H3WM 3IFNL 1WAAF 3N9GL 4L9LB 5IEHA 2ZNXA 3DIFB 3G5VA 5KJRH 4PRHA 5DJDB 5FB8A 1Y0LB 1FCGA 1V3MA 1NL0L 1RK1A 4UTBH 1D5BA 3RDTC 4CGTA 3BESR 3D9AL 4L8CB 2WNGA 2GYSA 1DBAH 2NW2B 4EVNA 4HWEL 3GIVB 3W39A 5FYJH 1NCWH 2RFXA 2RIKA 1PLGH 4ZNCD 3CFIC 2WLYA 1RURH 2AERT 5FOBA 5AYUH 3SCMD 4LQFH 1P1ZB 4EBQL 4Z18A 1Q0XH 3D25B 3RUGB 5KOVC 4FQXD 1E27B 3G5XB 4AG4H 1U6AH 4UDTB 3VMOA 5IB5A 3VW3L 4JFDE 5GS1B 2ICCA 3QFJD 4X5WB 4JM4L 2ESVD 1D5IL 1ZKAA 4Y5VA 1ZLUK 4XVUD 4I18C 1UM4L 2HKHL 2YD9A 5LGJB 4YXKH 3S5LG 3PHOA 2DL9A 1F3JB 3ULVC 1R3LB 3VXTA 1UXWA 4XPTL 1YMME 3U9PL 1KIUA 3RBGA 3QAZC 2Q7YB 3UYPA 2YPVL 4YX2H 3QNXA 4JRXE 1HSBA 4FXGB 4XZUB 3MODH 1K3ZA 3QCVL 5ID0A 2P4AB 3IDIA 4AENA 4U6TA 4ZUSB 2ESVA 3RNQA 1HYSD 4O9HL 3FB7B 4NOBA 4DVBA 1U3HA 4EQ2A 1R0AH 3MBXL 4O2CB 1WFOA 4PJXB 5LGKA 5HBBA 2ICES 1C1EH 3AY4C 1WBZB 2A6JA 3IDNB 4P46D 5HGAA 4GKSA 1KJMB 1T21B 4KI5F 1TQCC 5DQDH 1GZQA 4FG6D 2ADJB 2UUDK 4RSVA 4M7LT 1IKFH 4O2EB 5C8JA 2XN9E 2X05A 3MRCB 2AEQH 3PV6B 3ARGB 1PG7X 3ARED 4LRIA 2FEEI 4MVBC 1UB6A 4MD4A 4WWKB 2BY3A 4MJ6B 3UPCA 4AM0B 2G9HB 2J7LA 4LOUC 1TCRB 1T22B 3KPPB 3R06A 1DN2A 3OXSB 1ZMYA 4QXTA 4UU9B 4YK4B 2LABA 4GBXC 4MJ6A 4NQXB 1F6FB 1T22A 1JGDB 5C07A 1TLKA 3RWIA 1S8DB 1P7QD 2HJLB 4ZPVA 2Z92B 5LXGH 4L5FH 3S35L 4E41B 4XHJC 5I0ZA 4HWNA 1J88A 1HK6A 2AJXH 4YAQA 1OCWL 2KL6A 4JREC 4NO3B 4BKLA 1NCUA 4WIQA 2EDYA 3N1FC 5F6HI 4CBPA 4R4BB 2NY2B 4JFFA 4XP9L 1ZVSA 2EDKA 4NSKA 4WDIA 1FIEA 4Q6IB 2FBOJ 2DQJH 1TQBB 2ERJB 2DRUA 3CC5A 2Y5TB 3HS0A 4MDIA 5MENB 3ZKQD 3MV9D 4CVZA 5I1AA 3OKLA 5IMOB 3M8OH 2Z4QA 3KPSB 4YXHL 2HT2D 4ODSL 2GTWB 4OLYL 3O45B 3DHJA 3DVGA 1MCEA 1I7RA 4QOKE 3RPIB 5IHZA 3C6LB 4NQDA 3QDJB 1RZKC 4KUCF 2GT9A 4Y16D 4KH2A 5J6HA 4H8WL 3GSVA 5K9JL 3DMMC 5ISZD 1X6NA 5HPMA 4RGNB 3WIFB 3LD8C 3NIGE 2F8VA 3BXNB 3S37H 3Q0HA 4NNPH 2BNRE 3GEWB 3MJ9L 3CU1A 2VDQH 2Z35A 3TBYA 3CVIH 4MCZB 1JF1B 4HIIB 3ARWA 4HK0B 4Z7OF 3SDXB 4PY8I 4QCIB 3HE6A 4MJ5B 4DN3L 4FQPA 3PQYD 1GJIA 1U95B 3MA7A 1BD2B 4MXWL 2CDFA 2DI8A 3PWLB 5C0ND 5SWQA 1TITA 4CADA 2APFA 1P69B 5I1JL 2XRAH 1RZJL 1VPOH 2IALB 1T0NB 3QUMH 1QRNA 2VLME 1CDYA 3IDUA 4E41E 5HHME 5EOCH 2VABA 3JTTB 1H0DB 1K8DA 4X0KB 1E28A 1SBSL 1INQB 1TVDA 2KPNA 4DK6A 3HCVA 3L9RB 1RZGB 3X12A 1FNGB 4H1LG 2XWTB 1GGUA 3BIAX 4O5LL 4P9HC 3DBXB 3RNKB 4L3EE 3BEVB 1DLFL 1XH3B 1KF9B 5DI8B 2X4QA 3BDBA 4NQDD 4CVXA 1IGIH 1N6VA 1NUNB 2BRRH 3BN3B 3G04A 2O93L 3SY0A 4W4NA 3BOVA 2ZOLB 2FO1A 1JV5A 4FQQB 2NZ9C 1DQQB 1BLNB 4WHCA 3MV9A 3BPLC 3C2AH 2E9WA 5FAAA 1P9MA 4W4OC 3FTGA 4JPIA 3BKMH 4NDMA 5E8NB 3ILQD 5GGSB 1TZIB 5CEXB 4H25A 4FHBD 3BKML 2R0ZH 3BW9B 3G08A 5T1DL 4Y1AB 3EYOB 5T1LB 3VD7A 4P23B 3BEWA 1BJ1J 2JKXA 5HD8D 3MLRL 3ZE0F 3LRSA 2J8UA 3EO9H 1LK3L 2W65A 4MCYB 4NRYB 3RVWC 4XP1H 4QHMA 4XGZB 4MQSB 1HWGB 4FABL 2PYFA 4V2CB 4D9LL 3SDYL 3WO4C 5L2KA 5EO9A 5HHMD 4X98B 2IANA 4DWHA 3VRJB 1SY6H 4L1DA 4I3RL 3DUSA 5E9DE 3CIQA 4E42A 2ARJA 3ZSTA 4AH2A 3N0PB 4DGVL 1PZUB 5L2KB 4TUOB 4K23H 4WCYH 4K2UH 4PJHE 1EAPA 1X5FA 4LGPB 3GSNL 3FN0L 3CLFL 4JFYA 3RTQA 4ORGA 1MI5A 1R3LA 2YSSA 1NANI 4GAFB 3B2UC 3C5ZC 3RVTC 4HUKB 1KCKA 3RWHA 2FIKA 1XF4B 2EDWA 2DM3A 2V9RA 4ONHB 2NY5C 1ZGLP 1HSAA 1HINH 1IQWH 2VXSH 2AP2A 1NCAL 2ZUQC 2PCPB 5CMAA 1ZGLA 1OTSC 3BZEA 4NZUL 4RQQB 3X11B 1KIQB 2AV7B 5IGXL 2HRPH 4ESKA 1RZIA 4JRYD 2EYSA 4W6WB 3HB3D 4OFKA 1KPUA 5EC2B 3U9UA 5I75C 3WLBA 4R96A 2NR6C 1CQYA 1Y18A 5D93C 3TT1H 1CFVL 1N0XL 5D96B 3MTRA 4QHKI 5EUKA 3GM8A 5LG1A 1TDQA 1EMTH 3HC0A 2VUYA 4MHHI 5F7LB 4CMHC 4OI8A 2V2TA 4QRPB 4OZFG 3MV9E 4GRWE 2HWZH 3ZTNL 1VADB 3SKJH 2ZSVA 3VFTB 3RY6A 5I71B 4HGWA 4HGKC 3LS5H 3OXSA 3O3EA 1E6OH 3WKNA 4FN0A 4JPWL 4QHKJ 4HCRL 1NCCL 4O2FA 1JZ4A 1PQZB 2J2ZA 3RTQD 5T1KA 5SWZE 1I85A 1S78D 1HCVA 4WEMB 4HX1B 3TWCH 4JFED 4FQHA 2YD8A 4X6DE 1P6FA 1I3UA 4M4PA 4OLZH 3QDAA 3NFSL 2MKLC 5SX5H 4RBPH 4DGIH 5KS9F 1IAOA 2D9CA 2AJXL 1K2DA 3CLEH 2VDML 4LPTA 4JY4A 3RY4A 2DBJA 4F7TA 4GW5A 4JPWH 3SJVB 5FO9B 3KDMA 1B4JL 4UINH 1NGZB 3MRMB 1EEZA 1E6OL 1MHCA 2JE8A 1JL8A 3ARXA 4FQLH 1K2DB 5KVEL 3KS0H 3VFUA 2DM4A 4R2GB 3G6JF 4WRLA 3QO1B 4PJAA 4F7TB 4AEHH 1T1ZA 1LEIB 4JCLA 2VXUH 3GSQB 3SPVB 5F7HA 1CK0L 2ZJSL 1ULVA 4JY5H 1WIPA 4RAVA 1B90A 4UB0L 1CICB 1KJ2A 3PGCB 4K9EL 1WT5A 3IDGB 5F7DB 3KPRD 5D6CB 3S35X 3ZL4L 5I2IA 3TZVD 3GSWA 4AQ1B 1VSCA 4N9GA 4POZC 1CFTB 5F71A 3L3OA 3QQ3A 5D2LF 4XNYH 1J86A 1DLHA 1A6VL 4JHAH 5E2JA 4J4PA 1X5AA 1GGIL 1FL3A 1K4DA 2PN5A 3LPGA 3RZCD 4OBSA 4JRXB 4LQ1A 3GGWB 1B6DA 4BZ1L 4PS4H 1OAUL 5CGTA 5EIVA 1NGWA 2R1WB 2PTVA 3U30B 3DHMA 3RWEB 1I1AD 4LASL 3U7AA 1I9IL 2VLJB 4OQTH 4HWZA 5IB1B 3KNBA 5D2NB 2HTKD 4XPFL 5SWZB 1KIRA 4U1SB 1H0DA 3JTTA 1LO0L 4X7SH 1ODAA 4N8CH 4HHAA 3MLXL 2ED7A 2P8MA 4MNGB 1MY5A 3L9RA 3TBVA 3QNZA 3H3PH 2A77H 4EI5D 4N0CC 4D0BA 1KENH 5HYJB 4ODWA 4I3GA 3D3VA 2HJFB 2FIRT 5GRUH 2O5ZH 2XWJA 1IGYB 3G6JB 1EA9C 2B0SL 5KVDL 4UIKL 1MRFH 4UUJB 3R1GL 4M1CC 2CR3A 2Q3ZA 5MEQB 5HHNB 2V5MA 3EAKA 3MRRA 3ZL4H 3HE6C 3ALPA 1R5VA 4CVUA 2B5IC 3H42H 4QTIH 1A6PA 5C6WH 1B3JA 5DMGC 2B4CC 1EO7A 3MGAA 5CJXC 5ANME 3FTGB 2HT3C 3QULB 4FQIH 3WD5H 3QZWA 5AAMA 3P4MB 4N1EA 4PG2C 3BP7B 5IB4B 4OF7A 3S3PA 2W0KA 2CIKB 3ARDD 1MFAH 1S9WB 4GBXA 1MAKA 3LRSB 4ZAKD 2HJKA 4JJHA 2IBZX 1XR8B 3RL1B 4HUVA 4L3ED 2NXYB 4PRID 4LSRH 2R39A 1K8IA 1NL0H 4U3CA 3U4EB 5J06A 5FOBB 2PYFB 2XIDA 3AS0A 3U0PB 1HEZA 4JO2H 1NEUA 2PYED 4HIXH 4KTDL 3TNNA 4GSDL 4FQ2H 5EWIH 1F4WL 5E2VH 1YQ2A 5IVXB 2EICA 2DI9A 2YA0A 1OP5K 3BYTA 4TUOA 1RHHB 3LKRB 3QDJE 4UAOC 1FSKB 3TNNB 3QG7H 1QBLH 3LSOB 4J3TA 4UQ3A 3EOBB 2VR4A 3BKJL 5C0JB 3W0WD 1KLUB 2BSTB 5KBNC 1X5GA 5J7CC 3SQBA 3RUGF 3OWEA 3D87B 1MIEL 1RZJC 1VFOA 4RWYL 4QXUL 5C0JA 4JM2D 2BNRB 5CJQL 1N3NA 5F9JA 1JN6B 4HEME 4WU7A 4XP6L 5HGAB 5DD1H 2VLKE 1T21A 1EJOH 4LGRB 2GSIA 3EFFB 3WUZA 4IMKA 3BGFC 2XQYG 3O9WD 5FO7A 1N0XH 3HPLB 2IC2A 1HYSC 4D94A 4KHTH 4WJ5A 2I60L 2W0PA 3H9SB 2DOCA 4RX4A 4ZUUB 4D9RD 1AHWB 1CL7I 5FO7B 3Q5OA 1F4YH 4I0PA 1F11A 1RUPL 4L5FL 3B2VH 4UDUA 4OI9A 2EC8A 4LCIH 5J1AA 2A9ML 2RB8A 5IFAH 4QOKD 2D3VA 3DTXA 3WJLA 1MCFA 3ARDB 4MMZC 3K8LA 4M1DH 1G6RH 3BH8A 1XZ0A 4I3SL 5I1GH 3CVHB 4Y2DD 5I19H 5B39G 1UENA 5E0QA 5DS8B 4XP4H 1IBGL 3P9MB 5TQ2L 2AQ2A 4AIZB 4HXAH 3B5TA 4OLXH 4BFBD 3I3DA 4LPXA 1WWCA 4GBXD 3VRIA 5DXWA 4UV4H 5C0AB 5DRZB 3FJTA 5EU6B 5F9WC 2ENSA 1LO2L 2DWDB 3WJJC 3MV7D 3QUYD 4XXDB 5GRJL 3WS6C 3QXWA 2YD5A 3PNWB 4P5MB 1KTRL 4EDXA 3MRMA 3C2SA 1CBVH 4NJ9H 3FOLB 4Y2DC 1PVHA 4PP2B 4MS8D 1OAXL 3VFWB 3F7VB 1YEKL 3SDXF 1EEYA 3L1OL 4JKKA 1OHQA 4MSWB 3VWJA 3MLXH 4YBLC 4U1NB 5FGBA 3DARA 1T5XB 3SDCA 5EG6C 1IGTA 4NBZB 2NY5L 1NUGA 4E5XB 3IJHB 4NWUL 4Z7UE 3RZCB 1KYOJ 1ZEAL 5DUBA 3SGEH 5C0FB 4PS4L 1D5MB 5IEKA 3IJHA 1S7XB 1FORH 3ARFD 2AKRB 3E2HC 1LEKA 3VG0L 2C1PB 1DBMH 4MMXC 2YN5A 3REWA 2G75A 5DJ8A 5CCKH 5J3HD 3FT3B 3T0EC 4KU1A 1PJ9A 1NLDH 1LMKA 5T3XL 1B0GB 1OARL 5CAYB 1AGCA 1QFWM 5TH2B 3HI6L 2A2QT 4WENB 1OTUD 1T03L 1BD2A 3MA7B 2P5WA 1TVHA 4LU5L 3MRPA 2L4OA 4LSTL 2XZQL 3GI8H 5FIEA 2OL3L 5ESVB 4R0LB 5KSBE 3R8BB 2E7MA 1FIGL 1MFBH 3H3KA 2P8MB 1ZVYA 1P4IH 1U93A 1UM5H 1K8DB 2N1KA 4HPOH 3ZHLA 5I76B 5AWNL 5ESVA 4U05A 1A7PL 1LQSR 1QLFA 7CGTA 3HE6D 4LL9A 5TQ0L 1RZGA 1MUJB 2NZ9D 5TFSH 4YDIH 1DLFH 2ZUQB 1OT2A 3T8XA 3G5VB 5F96H 4IRJD 5J3HC 2AXFA 4KJQC 1GH7A 3IXTA 4XVTH 3G9AB 3DPBA 3ROLB 5T33L 3BISA 2W9LA 3ECBA 4H25B 5DQ9B 1AO7D 3UBXG 1DQJB 3QULA 1TJGH 2DTMH 3ROLA 4JKPL 5J89A 3ULVD 5TQ0H 1V5JA 3CFCL 1M71A 5L2JA 1MIEH 3MV8E 1S7WA 2D9QB 3DXAE 5B21A 3VFNA 2GY5A 5BJTB 4PRBA 5CP3A 3LHPL 1U8LA 4JFXA 3ZSSA 4Y1AA 4LLMB 3UC0H 1OB1B 5DHXB 4PD4J 4C59B 5DGQA 4YBQC 2OJEA 4NFCA 4FP8L 4JFXB 5EN2B 2Q7NA 5D1ZD 2DB8A 5E03A 2LU4A 2AAVA 2YR3A 5J56B 4OQ1A 3NCJH 1TNNA 1J8HD 1JPFB 4QHLB 1J87A 1L6XA 3OKDA 3I9GL 2FIKB 2H9GB 1YYLH 1J05B 4BH7B 2QQKH 3UP1A 3BYYA 2NY6C 1DBBH 2EKSB 5F1OB 1NDMB 2Q7YA 3WDHA 4EKXA 4JFYB 1LK3H 3WIIL 1KCSL 3FB6B 3V52H 5IHUL 1BX2A 5KZCD 1IEHA 2C7UB 2YK1L 2IAND 3CAFA 4TVPH 2EYRB 4HUUA 1IKFL 4G42B 2F5AL 4H0GA 3TP4A 3P9LB 2XQYK 2PCPA 5CMAB 4MDJA 3SE3C 3JSSA 1EVTC 5CSZB 4K94L 3BH9B 3UTQB 5DK0A 3BD4A 4WJ5B 3KPOB 5DEFB 1QBAA 4DGVH 4X7DC 2IADB 1NGYB 4Z5RB 1T7VA 3MR9A 5J1AB 1C5DB 1KGCE 4U1IA 1S9VA 5C0BB 4BK5A 3ZKND 3TFKC 3U7WH 3VXUE 5EUKB 2NY6B 2MNUA 4MNGE 2XQBL 3MUGA 2E3VA 1U8KB 2X7LB 4LLYB 2EDLA 4H5SB 4AK1A 4G6JH 2LV4A 5F1NB 3UTSE 3U9PH 1F6AA 4GKZB 4MAYD 3GB7B 3CGTA 4JFDA 4PLNC 4G6FD 4HAGA 4PJHA 4DUVA 1ACYH 5F89B 1FRGL 4WO4B 1WGOA 2W9DH 5EU6A 4NKOB 3H7BB 2JCCE 2VDPH 1JZ6A 3RUGE 1MJ8H 3S96A 3KYMA 4I3SH 4P3CH 5I1GL 4Y4KA 2NY3B 1G7MA 4YDJB 2FX7H 5IK3B 3U7WL 4PTUB 4EUPG 2AEWA 2DMKA 3ZLQC 5F7WC 2D4DA 3S96B 5BS0B 1HCFX 3IFNH 3TO4C 4G7YH 3DO7A 1XIWB 4NZTH 1KIPB 1FO0L 1ZSDA 3LQZB 2H6PA 2XA8L 5T5NF 1Q94A 1XGRB 1UJ3A 3O8XB 5JUEL 4R9HA 1E0OB 3W11D 1A7OL 1G9NH 3ZTJH 1ZT4A 4X6BA 1IKNC 2VN7A 5GGTL 1YEKH 5DD6A 2F54A 3NIDF 3O2VH 3SPVA 1BIIB 1KTDA 4XAWH 3LB6C 1YN6A 2X4OB 3DYPA 2PF6A 3CX2A 1JPST 3SBWC 4G6MH 3TN0A 2FZ3A 3VMNA 1FNEB 3VGAC 1DFBH 2GJ6A 1LK2A 1H3GA 2DKMA 3ARSA 1S7XA 5GGTA 3TO4D 2AKRA 4LKXB 1CE6A 4RGND 2P47B 4ZQKA 4KQ3H 5B4MC 5IWLA 3CFEA 3BDYH 3HNSL 4OSUL 3S37L 3O3DB 3WHE0 1PLGL 1KJVA 2XZZA 1AGCB 4P5TC 4RAUA 4GLRI 3IDXH 3LRGA 4LSVL 4Y16B 1CGVA 5F1KC 5HHOD 4C4KT 4IM8A 2XZAH 2J1KA 3TN0D 1NGWB 1LE5A 1AKJA 1UZ6F 4LCWD 5D5MF 1DVFA 2GJ6D 3REVB 2RAMA 4YHYB 1A7PH 3DVIA 3H8NA 4ZS6D 1I1AC 2DQIL 2OL3B 2WIIA 2YD7A 1GHFL 3FONB 2VXVL 5IMMA 3NAAH 1S3KH 4YHIB 4ZG1A 4P4RA 4TSAL 4B5EA 3S3SA 5FYJE 3LH2H 2XZQH 3GI8L 1U3HC 1FVCA 2BVEA 2C1OA 1QFHA 5ILTH 4NCC2 1RJYA 1FZKB 4XI5C 2NX5D 3UTTE 3VH8A 4XPBL 2X70B 2VLKA 4ONOA 1QD0A 5F8RC 1WAAA 1CXHA 3PDGA 4PV9B 4LAQL 4OIBA 1ZLVK 4R7NB 1R3IH 3C6SB 3GDBA 4U6YB 2CIKA 4TUKL 1NGXB 4TSCL 5T3ZE 3B9EA 5HHXL 2XPGA 1R0AL 4LCWE 2ADFH 4H1LB 5DMGD 4YQXH 2HFFB 4GRLC 4P2RD 1XF3A 1K8IB 4JQXC 4QRQA 1KENL 1UM5L 3I85A 2YZ1A 5D1ZC 1ZVHA 4DJMA 1S7QB 3VA2C 5T3ZD 4I0KA 1URLA 4RGNE 5CLWA 4ZAKC 5IIEB 1NQBA 4YGVA 3KLAA 2D0FA 3TV3H 1A4KA 1KNOB 2NLJA 1JZ7A 5D5MB 1T83C 4M3JA 3V6OE 4AH2B 3LD8B 4XC1L 1Q38A 1UWEH 4P2QD 3F12A 4I18A 1DZBA 2IAMA 3LOWA 1Q9WA 5B8CA 1XIWD 2ICWJ 1G7QB 5DVMA 12E8L 1FNSH 2EYTB 4XH2A 3GBNH 1PSKL 1N8ZA 2BVQA 3F7PC 1HHKA 4EBQH 3QIUC 2FB4H 5D7LA 5FDWA 1D9KD 4FFZH 5K59E 4WW1B 5AYUL 1I3VA 1E4KA 5EFIA 2R9HC 3MACH 3HPLA 3F62A 2CO7B 3SE4A 4OZ4B 5BXFB 4U3HA 5CD3A 5FHBL 5I1IL 2P5WE 3T1FA 1MCKA 1QFWL 4ZUUA 1YDPB 5DT1H 4OM0L 2HKHH 4QF1B 3VGDA 3JWDH 2HAZA 4LPCA 2X4PA 1QTYT 1T4KA 4LLQB 1QR1B 1OAXH 4RZCA 4X9FA 2FJGB 4NZJA 1MI5D 3RA7L 1H8SA 5DRNA 2R2BA 3HB3C 3HC0B 3VFSB 4QHNA 3WDIA 3ZYJA 1K85A 2R4SL 2FLRT 3D2UB 4XRCB 1S9VB 5C0BA 2P46B 2UWEF 1GVIA 3PWPA 4LCIL 2X1WL 3SDAD 2GAZA 1B6UA 4XX1E 4ZYKB 1JYXA 4G9DB 4UDUB 2LQRA 5EPMB 4U3XA 1P5UA 2OSLA 4Y4HA 5C7XH 5DJ0B 2V6HA 5HGHB 1KT2B 4V1DA 5I17B 4ZO7A 4I48A 5DVLA 4Y88A 3ZZ1A 4P2QA 1DCLA 2HLFC 3OPZL 3UPAA 4M7JL 1M7IB 1IILE 3B9KD 1MFNA 3EFDL 3BZDA 4RMRA 2IMMA 1M1SA 1QSEB 2DTSA 4Y4KB 1JWUA 2OYPA 5SX4I 1CXEA 1NMCB 5GSRA 3RWCA 5E6IC 4YAQB 1GZPB 3IKCB 2DJUA 3MJ9A 1VGEH 2V5YA 3OJDB 2L7UA 3INUH 5I1CL 4DOHE 3PABA 4PJEB 1HNGA 4UT9L 3GFUA 3EO1B 3TH4T 1Q94B 2N56A 1RFDL 3GMOA 3SKOB 4PGCB 4OLEA 3TYGL 1YEHL 4PJEA 1H3VA 4D0DB 3PWJB 1ZANH 3W2DH 4WUUA 5FYKE 4GQPH 4PTTA 1KJ2B 3D69A 3PGCA 3QNYB 5D70H 3DYMA 4LCCB 5FM8A 4JZJA 2MHAB 3IKKA 1RZFL 3U36B 2C1PA 3QG6A 4EQ3A 3LKNB 2ICEA 1MHPH 1SJHB 3MRDA 1ORSB 1FFPA 3D85D 4IIQC 2VXQH 1G9NL 4YPGA 1K4DB 4OLZL 4NM8L 4JG0L 3IDXL 4LSVH 4MGXA 3VWJC 4KGLA 1N2RA 3TCLB 1FFPB 2QBWA 4M61B 5IBUG 1OY3B 1VFAA 2PXYD 4G7YL 3NH7H 2A83A 1LD9A 3DXAD 4OCRH 1U95A 2KZ1B 2FGWL 4K3HA 3GKWL 4XPHL 1DVFB 4FABH 4I9WD 4WTZG 3QJHB 4OZHE 5JMOC 3QXDB 4CMHB 3P0VL 4XVUC 4PJ5E 3VGBA 2ZCKH 2CKNA 3MJ6A 5BV7H 5C0RH 3HI5L 4P4KC 1KSRA 4KJYA 2DLTA 5HYJA 1OLZA 1A1NB 1INQA 3O2VL 1ETZA 2A6DA 3OB0H 5HJ3B 3WIHA 4BQ6A 3D85B 4MNQD 4KJYB 4U31A 4OKDA 4M9OA 4OQTL 2EDOA 3DIFA 1NLDL 3QFDB 1KEMH 4Y4FA 1J7VR 1DE4A 4M48H 4KQ3L 1XF2A 4GXVL 3U79A 3ZT7A 1M4KA 3MLZH 4HGMA 4I2XB 3HC3H 3THML 4HIEA 3FHQA 1ITBB 1C12A 4Y4FB 3AS3A 5FYLE 1WSST 5DFVC 1X5JA 4KRNA 3GBNL 4EZMA 4EJ1C 3W39B 4G6AD 3WFHA 2RFXB 4FMKA 1YEEH 3CSYB 1CLOL 4WFEE 4DAGH 1GXEA 1C12B 4JEGB 5L8JB 3WN5C 2MWCA 1DVFC 3FO9B 4HMDA 3ZYOA 4YEFA 2YUWA 2R56H 5E8NA 5C08A 3FFDB 1EV2E 5TDOA 1RJLB 1AQKL 3RHWK 3E0GA 4DN4L 1J0JA 1S5HA 3DX8B 5MI0B 3U4EA 3G5XA 4XNZB 5GJSH 1JUFA 1QSED 4OZGB 2WQ8A 3EOAA 1CGUA 2OXHA 4YPJA 1OTTC 3L6FA 5D2LA 2MCG1 4HBCL 4HEPG 2DJ4A 4GAJH 4KAQH 4XHJD 4C83B 2QQKL 4X4ZA 2LVCA 3C9NB 4J3XA 4PJ5B 4KRPC 1AJ7L 4Q97A 3UEZA 1BBDL 4X4ME 3UBXA 1I7ZA 2BNQE 1UQSA 2EH7L 2AI0H 4RGNC 4WFED 3UJTH 1JNLH 3TPUA 3QIBB 3N85H 3Q1SL 3FAXA 3TV3L 3ETBF 2FCBA 5D2NE 3RAJL 5DZOA 4M6OL 3SDAB 3V5HB 4F37K 3BQUB 4G43A 3B9DA 5EU4B 2VLRB 3D2UD 1J1OH 3FB6A 3EOTH 1UB5A 2H2PC 2X4TB 3JV6B 1I8MA 3ULUH 4OM1L 3ZKSD 4KJWC 2BSED 5FYJD 3G6JE 4NBXB 5CZVL 4N8VG 2C4XA 4FQLL 2CLRB 3MNWA 3IFPA 1IAIH 3ZE1F 1AD0A 2OP4H 4L4TB 2AGJH 3A6OA 2EECA 2VC2L 4JM2A 4G9FB 4HPYL 2P8LA 1MJJA 5CBEA 1A7RL 1NSNL 5E5RB 3TWCL 2FWOA 2GEEA 2J4WH 4FTVB 4K3EH 5J6GA 1CIUA 2VZOA 2JIXD 1NCDL 5EZOL 3V0WL 3B8SA 2HMID 1W0YT 5IGXH 3QAZB 4HCRH 3VFGH 4DW2H 1J8HA 3TNMB 2DYPA 4M1DL 3DUHA 3HAEG 4KUZH 2Y7QB 5DZNA 4WTZA 1JPTL 4ZDHB 5A1AA 5GSRB 3RWCB 1CD1A 1YEJL 5GGTH 5D71L 4RNRB 1YEHH 2C3VB 1OQXA 1RJCA 4J12A 5IVXE 1AO7A 1XT5A 4U1KB 2F58L 2RCSL 4Z7WA 2GTWA 4PJXE 1WITA 5ANMA 4DKFH 3OGOE 2XZCL 3ALWA 3QUYC 4K71C 3EDJA 2VLKD 1NBVL 5FYKD 4GAYB 1I7UA 3SKOA 4AZ8A 3OL2A 1QVOA 4BH8B 1NAML 4HBQA 4D0DA 1AXIB 2BY2A 2QSTA 1TMCB 4PJDA 4YGAB 4R2GC 2NW3A 3V4UL 2VLLA 1C5CL 1IAKA 1IJ9A 2MQ3A 1CN4A 4BQCA 4AEEA 3BO8A 1HH9B 2DQFA 6CGTA 2FR4A 5JPMB 4ONGH 1A9EB 4JPVL 4AY0A 3TIDB 4OLWH 3KHOA 3MZGB 2GK2A 4X6BB 5C2BH 5MEPA 5EO0B 2VISB 4ODSH 2EC9T 4ISVB 4PV8A 4KK5D 3S98A 4QRRE 1T6VN 5IVZA 3CFEB 1JF1A 1S7VB 3O3DA 3WIHH 5E8EA 1AQKH 2PTUA 2XTJE 3HI6H 4Y4FC 1CTNA 2XICA 2X9WA 5L7XH 2VH5L 1S7VA 3OHXA 1IGMH 4PG9A 4H26B 4OB5H 1OAKH 1TXKA 3NPSB 1S9KC 3O6FB 2B0SH 1YEEL 4DCQA 4LARH 4HKBB 1H8NA 2SEBB 1FG9C 2P5WB 4F2MB 3MRPB 4KMLB 1JGVL 1C08B 2VDLH 3HHRB 1A6TA 3FRUB 2VNCA 3KPSE 1OP3K 1RULH 3MLRH 3TM6A 1HWHB 5I8CA 1FVCB 3S34L 3S37X 1UXSB 8FABA 4FQIL 3O2WL 3V7AG 2LU3A 1QSFD 3QUXC 4C56D 5C07E 4PY7A 32C2A 3PL6C 4YE4H 5E1HB 4CNIB 1JNJA 1BFVL 4WW2A 5IF0A 5C9JA 3HG1E 4ODHH 2EIZB 3BJLA 4GW1B 3SY0B 4ZO9A 1JGUH 5BO1L 4NZDA 2IQAA 1AXTH 1ORQA 4J3UA 4OTXH 1V7NL 2XG5A 4PG2A 1CLOH 3S5LB 1A3LL 4DAGL 1JGVH 4Y5YA 2ZZUT 3DSNA 4IRZL 1DBBL 4U49A 4JPIB 3KPQB 5C0IB 4TVPE 5TE7L 1HH6A 4PV9A 1KXTB 2A6KB 1M71B 1EDQA 5A43C 2A38A 3KXFD 5C08B 4M48L 1OSZB 1I9RL 4UT7H 2F15A 2H1PL 2H2SD 4YGVB 2HH0H 5LBSL 4LLMA 1JRHH 1HILB 2YEZB 1CICD 5D5MA 1UM4H 3ARPA 4Z7UB 2OJEB 5D1QB 2NXYC 1FYTB 1D5ZB 1S7QA 5FECB 2ZOKB 1IC4H 4F37F 5M95B 2E7CA 4OCSL 5JHLL 3NIDE 3W9EA 4FXLA 2ZNWA 1DQLL 2YWYA 3ZDYF 1KV3A 3BZ4A 4LAQH 1O7VA 3RVXD 1OWRM 1VESA 3CXHK 3RQ3A 1P7QA 1A6AA 3WV0A 1NBQA 3ARGC 3MLZL 4LVEA 1ADQL 4QRUA 4I0PD 5EZIH 4ETQB 1AC6A 5K9OA 5SX5K 3AUVA 2JLLA 5L6YL 3GMNB 1NBZA 1MCWM 1XIWC 2OI9B 5LQBL 3C87A 2I60H 5SWSD 3ZDZE 3IFLL 2NY6D 3K4AA 4K3GA 4P2OB 2RCSH 4PBWD 4I8DA 2C7UA 2Q87A 2E6QA 2DLIA 3ZDZF 4R26L 3O0RH 1QRNE 2H8PA 1H3UA 2VMFA 1MH5A 1JPTH 5DQJA 3TVMC 3MGOA 4KROC 1TPXB 4PJGE 5CJQH 4MJID 1EH9A 3V6BR 5D1QC 3WLBB 3NA9L 1ACZA 5GGRY 4M62H 2YWZA 5DMJB 5DQJB 1BQHA 2EXYD 4JDTL 5EPMA 3VA6A 2X1PA 4W6YB 2BVPA 3MV8A 2ADJA 4POZD 2GQHA 5GJTH 4WI7A 1B2WH 2AI0L 3KPMA 1S9XB 1DSFH 4PR5A 3PWPB 5F3HB 3RDTA 2BMKA 3QH3B 1M7IA 1FG2A 4QRSB 3OKMA 3M1BB 3TA3A 4IOIA 4PJHB 5BRZD 3DRTB 2VXSL 4FNLL 5M94B 3QH3A 4V1DB 4W70A 4YHZL 2DQGL 3IXAB 1N5AA 2FSEA 4QRSA 1O5DT 1QLEH 1IM9A 3JWDL 3Q6FB 4P2RA 4I5BB 5F7MC 3H7BA 2EEDA 4QT5B 3WCYA 3CFDA 3OKKB 4P57A 3PDOB 1EAJA 3T04D 2DI7A 2G60H 1FYTD 1JP5A 4PUBH 2EE9A 4LU5H 1CFVH 3GI9H 4U1KA 1CI5A 4ZODA 4PJFA 1U8MB 4C54A 3DUUA 3T65A 2VZ1A 4RIRB 1JGEA 1FBIL 5F88A 1H15A 5B39B 3BHBB 2ICWA 1G1YA 3OKLB 5IMOA 1ERNA 2PW1B 4K8RD 2JJUA 2WWMD 5E4EC 5I9QC 4EEEA 2FYYB 3RX8A 4JY6B 2MHAA 4OZGE 4JFHD 4NOFA 5GRVK 3JV4B 5KOMC 3X13A 3FCTB 2ZKHL 1UM6L 5T1DH 5DHVB 4DEPB 4NNYA 4RFEB 4N8CL 1M7DB 3BPCA 3WLWC 1YNKL 1CXLA 2VDNH 2VDNL 1R6VA 2CJUH 4LKXA 4JPKL 5EIIA 4LPUA 4MXVE 1C5BH 1SJHA 3MRDB 4EI5A 3OKNB 1HOCB 1MRFL 4HLJA 4MA3B 3MRGB 3QXDA 1EXUB 4TNVK 5JNYA 5LGHL 1KPRB 3VWJD 1A7NH 3ZO0A 2FGWH 5SWQB 1O0VA 5DJ2B 4W6XB 3CLEL 4HH8A 1JZ5A 1A6VH 4JHAL 2IALA 5JDSB 5JNYB 3O3AB 4X4XA 1LP9B 1FBIH 3SE9L 2Y07L 1X5YA 4APQA 1G7IB 4J1UA 5KSAC 4L8BB 1NFDE 4OQTA 3N06B 3V6FA 5CHNB 3FRPA 4XNUL 5T5FL 4YHKH 1WBYA 3TO2B 3HZKB 2ZJSH 5DJCB 4U33A 4L4TE 1IGJB 2WV3A 4YBQD 5C0GB 3IDJB 2KQNA 3BP5A 4S1RH 2IH3B 2A1WL 2YUXA 4P23C 1G84A 1T20A 4UTBL 3T8XB 2EIDA 2IF7A 1HYRC 4O58H 4DVRH 5HHXH 3O9WC 5C0GA 1R24A 2MOVA 1IGML 3BP4B 5FCUH 1YQVL 5TDOB 2XPGB 4PBXA 2A6IA 4MLSA 1NFIA 2BSSB 3DX6B 5DJZA 2E9BA 1JUFB 4KROB 5C07D 2DL2A 3GO1H 3VGAB 2NY7L 4EN3B 1QSFE 3FFCD 4QKXB 3RUGA 3BEWB 2R23B 4LNRA 1OGTA 4NUGL 5C0AD 2R2EB 5FUCE 5IMKB 4I0PC 1FNAA 3CFBA 3OPZH 3UBXB 4ALAL 3I9GH 5CP3H 5MP6H 5HYJE 4Y4KC 4M93C 3BKCL 4DGIL 4E42B 4KVCL 4JZOA 1WT5C 4JDZA 3C5SB 3B8YA 5IG7B 3Q3GA 2CKBL 5IR1A 4XNMB 3RZCC 2H2PD 4JZOB 1UB5B 5KVGL 3T3ME 4AJ0A 3EYVA 4O4YH 2WUBH 1I8MB 3MUZ1 3QBTB 1HHJA 1T7YA 2IPTL 3LQAL 5CEYB 1YC8A 3RWHB 3HLAA 2P7TA 4JFPA 4MAYC 4ONHA 1VEOA 3QQ4B 1LO4L 3EYVB 3T4AB 4CJ1A 3IFOB 2V9QA 5GRUL 3IDNA 1QFWI 4NKMA 3E8UL 4AMKL 4GKSB 2P7TB 4PGDB 1M7XA 1HXMA 4HFUH 2R69L 4N0RA 4XAWL 3G6DH 4YDLB 4OKVB 2FX9H 3P9LA 1MCNA 4UOW0 2YD3A 2IG2L 4IJ3C 4QXWA 4DFIA 5CBAA 3VXPA 2VQ1A 3G5YB 4UNTA 1VKXB 1VFBB 3CCHB 5HYFA 5ALCH 3H7LA 1D5XA 2FWOB 3HE7A 2VLRD 2BNRD 5DK3A 3MNWB 3P77B 1QRKA 5DRWB 3UZEA 2A74B 1OAUH 3BDXA 1YEIL 1AD0B 4TN9A 5SWSB 3Q6GH 2EEBA 3ZDYE 2QSQA 1JGDA 4KMQA 1XCTA 4OUUB 2YN3A 3RWIB 5E2UH 1BBJB 2QSCL 3RGHA 3TJHC 2AQ1A 4GKZA 1F6AB 1SMOA 5FKAB 3HA0A 3IXAA 2X4SA 3QCUL 5GGRA 4YX2L 3Q6FA 3ULVH 2A77L 5DWUH 3V9FA 2AQ3A 1CG9A 5DT1L 1JWUB 2KZWA 1EUUA 4NYLB 4OBRA 5DRXB 5DC4B 4WHDA 4NC0B 4JY5L 5HVFB 3SOBH 1FGNL 4JN1H 3C5ZD 3RVTD 3KYMB 5D5ME 5J4MA 4LASH 1ZA3A 3AB0C 4J3OC 1G7MB 3TBWA 1BEYH 1OLLA 2HN7B 3ELAT 4E0RA 3AC0A 3O3BA 4BUGA 3QIWB 3LZFH 3C08H 5M7QA 4HJGA 1JTPA 3KXFB 5C08D 4L9LC 1EEZB 1MHCB 2J88L 3BRFA 2UYLB 4JAMA 1U8QB 3LQZA 4U1LB 4XI5D 1OW0C 2DN7A 1LO2H 1I7UB 2NY4B 3WO3B 1FVEB 3AS1A 4OB5L 1XF5A 3VXRD 1ZT4B 3MRHB 1Z9SA 1YUHB 2GSGB 3HI1A 3MUY1 5JPMA 2DQCL 2HTLD 1ZLSL 3MRNB 2D2OA 3EYFA 3WFCL 1I4FB 1EFXD 1WWBX 1T04B 3O6KL 3MA9H 1QRND 5E4IA 4K3DH 3QDMA 2R56L 4H26A 1RJZA 3VRLF 1LEKB 4ZSOE 4LHUB 3D18A 4NQSA 2BJMH 5CWSB 2E8ZA 4OCXH 1CD0A 5DJ8B 4EI5B 2DAVA 3GZKA 2WANA 4QLRA 3BKYH 3D3VD 3Q2CA 1ZHKB 5DVNA 5CFHA 1U58B 4GKNA 4PP1D 4UV7H 4TULL 1QRNB 5FUCC 3CPLA 4WHTB 4TNVF 2CQVA 5ITFA 2FH8A 2BCKA 1WWWX 3ZKMC 4A6YH 1YY8B 1NBVH 1X4XA 3LV3B 3WNMA 1L0QA 4KVCH 3BVNA 5IVOA 3DBXA 3RNKA 4RA0C 5C9JB 5FEBA 1OWWA 1YPZE 4U1GB 5DLMH 3U46A 3SN6N 3P73B 3A6CL 3SGKC 1A6ZA 1NMBH 3P4LA 3HZKA 1UXSA 3NAAL 4MAUL 1MLCB 3MQIA 4JRYE 1JYVA 2AK4D 3MJGX 4LK4A 3P73A 4J4PD 4OCWH 2ZOLA 2I27N 3KXFE 2P8PA 2WINA 5IEHB 4IRSD 3AM8A 4UUJA 3MNVB 1ZHBB 5HHNA 4F7PB 3MRRB 1BF2A 1OSZA 5DDHB 2V5RA 3UDWC 4V1DE 2CKBH 3MNVA 4CUCA 3FQTA 3S5LA 4K2UL 4MA1C 4A2MA 1BQHG 5HVHB 1IZJA 3VFNB 4KVNH 3ZYZA 1Q72L 5DYOB 4ZXBC 4CW1A 4ETYA 4L29A 5BRZA 1F13A 3EDFA 3TIEB 3PIQA 5JQHC 4QHUB 1BOGB 5F3BA 3SQOH 4O02L 4HUVB 4M7JH 4RMWA 4Y4KD 1OOAA 4JFOA 4OCSH 2DLEA 3QCVH 3NTCL 2EIEA 3OBAA 1BOGA 5F3BB 5F93C 3MRFB 3MO1A