3UOGA

Crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
341
structure length
341
Chain Sequence
b'MMSKWMQEWSTETVAPHDLKLAERPVPEAGEHDIIVRTLAVSLNYRDKLVLETGMGLDLAFPFVPASDMSGVVEAVGKSVTRFRPGDRVISTFAPGWLDGLRPGTGRTPAYETLGGAHPGVLSEYVVLPEGWFVAAPKSLDAAEASTLPCAGLTAWFALVEKGHLRAGDRVVVQGTGGVALFGLQIAKATGAEVIVTSSSREKLDRAFALGADHGINRLEEDWVERVYALTGDRGADHILEIAGGAGLGQSLKAVAPDGRISVIGVLEGFEVSGPVGPLLLKSPVVQGISVGHRRALEDLVGAVDRLGLKPVIDMRYKFTEVPEALAHLDRGPFGKVVIEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title Crystal structure of putative Alcohol dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
total genus 94
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uogA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3uogA01
2QYTA 3P19A 3PHHA 2VTDA 2O4UX 3DZIA 3ADPA 4Z9YA 3DBLB 3F4LA 1MX3A 1E7MA 1I0ZA 4IDBA 4G2NA 1U1IA 2AEJA 3BAZA 1CQJA 1PJQA 4O5OA 5AYVA 3DO5A 3HFSA 4R54A 5KKAA 2PH3A 3ONDA 3RROA 1G6KA 4DMMA 3QWIA 1SOVA 3WGQA 3HDYA 1HKUA 3AUUA 4UUPA 4E2YA 1O0SA 4CM3A 3GK3A 2FR8A 2ZQZA 3HSKA 4DXHA 1B26A 1LDMA 4RF2A 4TRMA 3RFXA 3ZHZA 4GL4A 1ZCJA 4JQCA 2X1HA 3QIVA 1X1EA 4PLPA 4PG7A 3L4BC 5TF4A 4OMUA 2BGKA 2VUUA 1PJLA 3BMNA 2PZLA 3RUDA 3DXFA 3RBVA 1HTBA 2CDAA 3OA2A 2WWRA 1H5QA 3D5TA 4HFRA 4AJOA 4AVYA 5IJZA 1ZSNA 3DZKA 1DFGA 3PYLA 4OJNA 3FBTA 4YA6A 1TLTA 4PCVA 2P9GA 4NG5A 4MVJA 2UYYA 4TQGA 1ADFA 3NV9A 1NFFA 1VPDA 4J16A 5TSDA 2X0NA 4R41A 3HN2A 4DLAA 5G0WA 4YAJA 2D1YA 3TJRA 2C0CA 3JCZA 4XQEA 1HDRA 3QVOA 5B4VA 4YAGA 3MJEA 1YDEA 1K3TA 2NU7A 5HTOA 3JQAA 4YACA 1E7QA 1N5DA 3F3SA 3B1JA 4MIYA 5I8ZA 3RAJA 1L7DA 3OIFA 3B20A 4DGSA 4DTIA 3ZU2A 4CM7A 1QV6A 2VWQA 2OORA 3IUSA 3O9ZA 4G65A 3ZW8A 1GFSA 1ONPA 4PGFA 4WCFB 2C20A 2O2SA 3PWZA 4I8XA 4PG5A 2DQ4A 1SO8A 4HFNA 5G4LA 5BSHA 5B4UA 1PS8A 4WLVA 3ROKA 1LSJA 1N7HA 4PVDA 3Q0EA 5I9MA 1L7EA 2DBRA 1EK6A 3WBFA 1MP0A 5H83A 2Z1NA 3BMOA 1BTOA 2Y1GA 1DC3A 3MJ4A 2IRWA 4ND3A 4PZDA 1PJ3A 1JA9A 4BKOA 1BMDA 2FZWA 4PG6A 4N18A 4KTTE 4X54A 4Q39A 4B3HA 1C0IA 1SMKA 1QXSA 1HXHA 4YEDA 2HLPA 2C29D 1PJCA 4NIMA 9LDTA 3ZWYA 3DMTA 3DMTC 1X14A 2FOIA 2ZTLA 4MVJF 3GG9A 2EP7A 5CP8A 1JDJA 4R1SA 4YJHA 4XZ3A 3T7CA 3GPIA 3LSYA 3I4CA 1E92A 4Z6KA 2Q45A 2Y1FA 2WTBA 4P8RA 3UOGA 1A4UA 4YJGA 3RSHA 2ZCUA 3MOGA 3MJVA 1CQIA 3GVPA 4NU6A 2C59A 3MJSA 3VZPA 3C7CB 4BNYA 4HUJA 4Z0TA 2DBQA 3FWNA 4RV9A 2I99A 3OF2A 3PJGA 5CDGA 4JP3A 1KVSA 3UICA 4FQ8A 1ZH8A 1SNYA 3SX2A 1P1KA 5I7SA 4ZVVA 1ZK3A 4Q3EA 3V1YA 4GQAA 2DUWA 2ZYDA 5KJFA 1PL8A 3E8XA 2NWQA 1DLJA 3V1UA 4NZ9A 1UUFA 1GQQA 1EVYA 2RH4A 3L6OO 4M49A 3VPHA 1ID1A 2V6GA 2DKNA 4U0JA 1ENYA 3STHA 4I1IA 4A7PA 3GFGA 2X0IA 4MIOA 1E3IA 2JHGA 1SC6A 3PVZA 2NQTA 2A35A 4UEOA 4J1NA 2HQ1A 2QHXA 3KYCB 2CUKA 1V35A 5H81A 2PKQP 2VHXA 1YJQA 3WXBA 1H9AA 2CVQA 2F00A 4OSOA 1EFKA 5AVOA 4OL9A 3LDHA 5BSEA 4N5MA 3WIEA 4BB5A 1ZZEA 4LMPA 1B0AA 2VWHA 3AM4A 3DOCA 1XQ6A 3UKOA 4NI5A 4RPLA 4XD2A 2GN4A 4CMIA 5KTKA 1IPEA 3O03A 4B7CA 4ZRNA 2BKAA 4N54A 3AI3A 1YONA 2GYYA 4FBGA 1A72A 3FR8A 3O4RA 2X0JA 3VVBA 5FYDA 3LLSA 3ZWAA 4R69A 3PP8A 1U8FO 4YAKA 4TKMA 4GLOA 2C07A 1R4MA 3PFWO 4IQ0A 4ZQEA 3C3XA 3B1KA 3F9IA 3WB9A 5ITWA 1YWGO 2EJVA 1Y9EA 3WWZA 1BVRA 3WTBA 5ER6A 4YB8A 5JC1A 2D5CA 3O38A 3W4JA 1X0VA 4R5HA 3PHLA 4BNTA 4CM1A 4YJHB 4AJLA 4KZPA 5I7EA 3ASUA 3CSDA 3GDFA 3TOXA 4I5DA 2Q2QA 4IJWA 4WECA 4YJGB 3DONA 5A03A 4MIEA 5IXSA 4MVJP 3EW7A 2OXIA 3WQQA 4MINA 1GUYA 4BNZA 2ZKLA 4Q9NA 3PK0A 4GH5A 2Q1WA 1HSZA 1QRRA 3PHJA 2VUSA 3ENNA 4EBFA 4GSLA 4BNMA 3HN7A 3ZV3A 3RC7A 4A10A 1R0SA 1ADBA 2X0RA 5ES3A 4XQGA 2DVMA 1U5AA 2NTNA 2JD1A 2WE8A 3OEYA 3EAGA 3JYPA 2ZQYA 2IYPA 4CV3A 1RYDA 2ZCVA 4RQUA 4PLTA 1KVQA 3GG2A 3IL2A 1XHLA 1A7KA 1JAXA 3HADA 2Y67A 3RC9A 3QRWA 2X9GA 5DNAA 3SC6A 4R9SA 4UVIA 1U28A 4M1QA 3ZU5A 3TQHA 3ST7A 3D3WB 1T1SA 1DB3A 4NQZA 3S8MA 1QYWA 1VE9A 1XKQA 2XXJA 3DEYX 4AJ1A 5DOZA 2DTEA 3EVNA 1CWUA 1JVSA 1AXEA 2NUAA 4DPKA 1H2BA 1IL0A 4KUGA 4RLHA 3VKVA 4IMPA 3E1KA 4CMIB 3WYCA 4B7UA 4KQXA 4QO8A 4E13A 3QV1A 5DZSA 4DMLA 1DO8A 4ALJA 1A27A 3KTDA 5A4DA 1E3EA 1GUFA 2HO5A 4AJIA 4FFNA 3DBRA 4FFPA 2OP0A 3UCFA 5JAZA 1QLHA 3D4OA 1DJNA 1PGNA 1R4MB 4RVGA 3OIGA 3ZNOA 3TPCA 1HE5A 3PDUA 2FSSA 3DOOA 3ZWWA 4CM8A 1ZXLA 4UVDA 5EINA 3EC7A 1VI2A 2X7HA 1GEEA 1ONNA 1H0KA 1OFGA 1NTOA 1Y9AA 2FR0A 1A9YA 3FTNA 4D44A 4HNGA 3O8QA 1GEGA 3UCXA 3WWYA 8LDHA 1ZMOA 4J0FA 3RUCA 2QW8A 5HBRA 4CLOA 1U3TA 3GR6A 1UR5A 3JYNA 1JWBB 1O8CA 2YUTA 4L74A 1H2HA 5CHEA 1G0OA 4L75A 3RUHA 2YDYA 4KOAA 4I9NA 2C82A 5IG2A 1KC3A 2UV8A 1M76A 1QKIA 5BSGA 4WGGA 1GYRA 1X7DA 2OZPA 5TT1A 4BNHA 5TQVA 1PZHA 2Y0CA 3A14A 4XB1A 1DIGA 2XF8A 3D7LA 2QZZA 3FHLA 2J3IA 3OICA 4IXWA 1I24A 2Y93A 3ZNNA 1J0XO 3DZBA 3RFTA 3TZ6A 1NHGA 2E6UX 3DFZA 1O6ZA 3VZSA 2GF2A 3RU9A 5A04A 1LDNA 3ZZNA 3WYEA 4CMAA 1N8KA 4XA8A 5F3RA 4QTZA 4OAQA 3RCBA 4XYEA 2QG4A 3ZWMA 1PGQA 3M2TA 2XOXA 3LZ6A 2NLOA 3FNFA 4D41A 1P1IA 4JBHA 5C7IO 1DPGA 4WLFA 4OQZA 4BGIA 2UUOA 5G0SA 2NNLD 4RDIA 3GUCA 2W8ZA 3G0OA 3JQ6A 1IULA 2OMEA 4U6QA 2W90A 3GDOA 4J2HA 3DL2A 2OBYA 4BMVA 3I9LA 3RIHA 4JN6B 4W99A 3A9WA 4P38A 3DHNA 4RVDA 3H9QA 3COSA 4CLRA 4G5HA 3ZV4A 3ONEA 5G0VA 2YV3A 5TRTA 4BV9A 3KETA 4YT8A 1PJTA 3KUXA 1ENOA 3KZVA 5CEJA 1ISJA 1KEVA 2EF1A 4ND2A 2VHZA 2PK3A 2OGUA 3P2YA 2YQ4A 1CIVA 5DBGA 3WMWA 4BO0A 1H6DA 2Y05A 4A27A 4OOFA 4W82A 3O8QB 3KSZO 4K28A 2JKVA 1IE3A 3ICCA 2H5LA 4IIVA 4CLOB 3WGGA 4U0KA 1U3UA 1MC5A 2QQ5A 4BNFA 1IUKA 1QSGA 4MDHA 3U9LA 4MKRA 1IZ9A 2ZTVA 5ILGA 1ZK2A 5DF1A 5A9TA 2B36A 1L1FA 2WD8A 5ITVA 1I32A 2EW8A 3PJDA 4IINA 1TT5A 3JQ7A 4BGEA 3B1FA 5GZ3A 5AXDA 1MXFA 4PZEA 4CMGA 1OZAA 4YWJA 2DAPA 4Y6PA 3B6ZA 3NKLA 3GOHA 3LT0A 1RM0A 1Z45A 1JKJA 4QX6A 2GR9A 1VLLA 2JJYA 1BXGB 1F17A 1O9BA 3SJ7A 1SPXA 1MG0A 4LSWA 1X13A 2UVDA 5ENVA 4FC7A 2ET6A 2FR1A 4RPHA 4XIYA 5F1OA 3JD0A 4ESOA 1U9JA 4JCOA 2CF5A 2ZTUA 3RBZA 3I4FA 3ZHBA 2O50A 1YL5A 1SB9A 4ID9A 1H94A 5AQ1A 4R5MA 3FBGA 4CUJA 5LDGA 4RF3A 4CMBA 1DHTA 1NR1A 2GD1O 3OQ1A 4K1LA 5J23A 4DIOA 2IODA 2A4KA 2FWMX 1UP7A 1GTMA 2PZJA 4YQYA 4D43A 3W6ZA 1DIBA 2NU9A 1ZKMA 3DBHA 2I5PO 2AE2A 4Z9FA 4FB5A 5U1PA 3N58A 3SC4A 3RC1A 2AA3A 3IUPA 5T67A 4QFCA 4J3FA 2VCYA 2GN6A 4CLRB 4YAEA 1E7RA 1UP6A 3EVTA 5DOVA 4DVJA 2O3UA 4HV4A 3Q9UA 4I9HA 4KTVE 1M66A 3PZRA 1ZIDA 5LC1A 1PJBA 3HZZA 4ILKA 3IS3A 1ORRA 1U7TA 4F6CA 1R4NA 1GR0A 2FRDA 2Z95A 3TWOA 3JQBA 3JQBC 1XSEA 4BO4A 4OH1A 2PGJA 4FFRA 4B3IA 3QLJA 3GVIA 4M54A 1E1MA 5F5NA 2YY7A 2WJPA 3BTVA 3I5MA 3GEGA 3JV7A 3FD8A 5ENDA 4BMNA 1XQ1A 3R0IA 4YXFA 3W8FA 3LVFO 3UAGA 1T24A 1T2EA 1H6BA 3H7AA 1ZVMA 3JQFC 4RVUA 4GMGA 2GNAA 4RCVA 3JQ7B 1TVEA 4PG4A 1ZFNA 4AL4A 3VPSA 4JXKA 4IDAA 1YB1A 5KJ6A 3ZWCA 1RKXA 1LXCA 1P44A 3ZWVA 3D0OA 3KM0A 1PZGA 3DBLA 3SVTA 4JJIA 1NAHA 1YQGA 3DBVO 3DTTA 3JQEA 1UXHA 3NTRA 2DLDA 1YQDA 4D3SA 4II3A 4XR9A 3GZNA 3WGIA 1A9ZA 1I3KA 1WAMA 2RCYA 3SJUA 1Q1NA 1HYHA 2GDZA 2HMVA 4LN1A 4NBWA 3RASA 4FOSA 4DC0A 4NBVA 2Q99A 1R37A 4NFSA 3DBHB 5IF3A 3FCOA 1EEHA 3HNPA 5IN5A 5BNTA 1T4BA 5JMWA 3ITKA 2VNAA 4PLWA 3UHAA 1BDMA 3NRCA 3U09A 4TWRA 3D64A 4YDRA 3T4XA 2JCVA 4ZU3A 3PZBA 4FSHA 4RO0A 3DHEA 1UZMA 2FY8A 5I7FA 4IJVA 1D4FA 5IFLA 3KB6A 3JYLA 3WQRA 2IXBA 1DC6A 3H5AA 3C24A 4R51A 1T26A 1ADCA 4CMHA 1ZW1A 4AJJA 4NK5A 2O48X 3H5RA 1GV1A 1CF2O 1R4NB 4DBZA 5I9LA 1LX6A 3TF5A 4Y67A 3AM5A 4MKZA 4OOEA 1NWCA 2ZYGA 2BGLA 2V65A 1ONOA 4RL6A 3MEQA 1KERA 3R3JA 1YGYA 1PEDA 3QJ5A 5K6AA 5K6AC 3E82A 4Y98A 1S7CA 2P4QA 4RDHA 9LDBA 3LQFA 4OKNA 4UUMA 5C37A 5JE8A 4OGWA 2HMSA 2DBVO 3D4PA 4E5YA 3ZWXA 4BKPA 1NQAO 1GYPA 1I36A 3I9NA 4N7RA 3OEWA 3WX0A 4BS9A 5KVCA 4D3FA 5JAMA 3PLRA 1Z7BA 5I7VA 2B4QA 1GADO 3DFUA 3NEPX 3GA0A 4MVJD 1CEQA 3FN4A 4NDNE 1MUUA 4YRBA 4PFJA 4ZQGA 2VYNA 3IQDB 1HE3A 1DC4A 4TRJA 4Z9XA 5AXCA 2NADA 2RBEA 2V6BA 3U49A 3NGLA 3GMDA 1RM4A 2Y1DA 2IEDA 1HZJA 4XJTA 3TRIA 3JQAD 3GZNB 6LDHA 2SCUA 4GLLA 1X7HA 4RVSA 2PR2A 5DP2A 1W0CA 3MTJA 1K89A 5CFZA 1P1HA 4I08A 2Y66A 1O89A 1XU7A 5FI5A 3OSUA 3ADOA 5CEFA 1U3VA 4IDDA 3L4BA 3LF2A 3ZHXA 3W4KA 1NVGA 1X0XA 5DBFA 3F46A 1Z75A 2GPTA 4DBVO 1LI4A 2RIRA 3ANNA 4CLDA 2Q50A 4OXKA 1JU9A 2G5CA 2UUPA 5JXWA 1QORA 4UEKA 2X5KO 3RC2A 1F8FA 3OHSX 1SEVA 3KEQA 3RVDA 2JHFA 1QYVA 3LC2O 3LK7A 2ZJ0A 3VOSA 3QSGA 2Y1EA 4AFNA 5T8KA 5T8KC 2BFPA 3VTFA 5LDHA 4E6PA 3K30A 4P4NA 5K0ZA 2YW9A 1EVIA 2YYYA 4PN3A 1UZNA 5FFFA 4WUVA 4O59O 5U9CA 1QYCA 5EESA 1WZEA 1HWYA 1EZ4A 1ZO8A 2OBNA 5TC4A 1C1XA 3M2PA 3WNVA 4D0RA 1U4SA 3KYCA 1BG6A 1EMDA 3EY4A 5EJ2A 1N92A 3WIDA 4ROSA 4XYBA 3F47A 2IEBA 4BO7A 2PNFA 1U5CA 2YQ5A 5IDXA 3LLVA 4F3YA 3AUAA 5FWNA 3RBXA 4GVXA 5THKA 1LRKA 1BSVA 2O7QA 3PDJA 3GQVA 5EMHA 1BWSA 3IP3A 2G76A 3U5TA 4NH4A 5F5LA 4YR9A 3IMFA 2AQHA 3PGXA 4XB2A 4ALKA 3SEFA 1NM5A 1MLDA 3EGOA 1RWBA 2CFCA 5L7WA 1PR9A 5F1PA 1PGPA 1LDEA 1GY8A 1V0JA 3G17A 1X1TA 1A7AA 2BFOA 1VSUA 2JL1A 4MP3A 5DCWA 1E6UA 2HMWA 1I8TA 1Y1PA 4L73A 4LCJA 1H93A 1Q0QA 3UF0A 2VHWA 5A3VA 1RJWA 1Z6ZA 4AJHA 4BO2A 5MDHA 2W2KA 2GASA 4MP6A 4YT4A 4E2XA 3FRJA 3RI3A 1YL7A 4CL3A 4IGFA 2VN8A 2VYVA 3KLPX 3TZCA 3INTA 3KOUA 4NFYA 4KWHA 3KYBA 1GL3A 2OL4A 2IDZA 3K2EA 3EUWA 1MG5A 1KYQA 3BHJA 2EKLA 3AY3A 2BF7A 1B2LA 1NPDA 1XGKA 2I3AA 3OETA 2VQ3A 1UAGA 2EEZA 4GKBA 1BW9A 5DULA 2HRZA 2RH8A 4JROA 5EERA 4FD3A 4P4GA 2YJZA 3ZV6A 3DZGA 3NT4A 3ON5A 3WGHA 3GNQA 4MVJI 2C7GA 3WGZA 1Y6JA 1ISIA 3EK2A 2EV9A 4GMFA 4K6FA 3F4BA 3WSVA 1X15A 1ISGA 3NT2A 4ZQBA 5COQA 3L77A 2PGLA 1E6WA 1RM3A 1HSOA 1VL6A 3KBOA 1Y5RA 1MFPA 2CZCA 3IJRA 3OA0A 3KXDA 3C7DB 2Q1SA 4NU5A 4A2CA 5IDYA 2DFVA 2DU8A 4E5MA 4J1QA 4NHEA 5KWEA 4J7UA 2FP4A 3GC6A 1C1XB 2GZ3A 1LU9A 4AJ2A 5CPBA 4WEOA 3EHEA 4CR6A 3P5SA 4E32A 5IZCA 5IZCC 4J7XA 1VKNA 3D3WA 4JLWA 4MVJM 1F06A 5IAAA 1EVJA 3GPDG 3ZU4A 1IPFA 2DTDA 5IXYA 4EI2A 5T57A 2AXQA 3MZ0A 5DCUA 4BQRA 4E2WA 4TVOA 1W8DA 1ULUA 1FXSA 3ICPA 4ALMA 5TJHA 2BELA 2VRCA 2XPCA 2R6JA 2VT3A 1KVTA 1V8BA 1C3VA 4HFMA 2J8ZA 2ZATA 4PLHA 4YRAA 3BTSA 3L9XA 3D1LA 4BO1A 1OAAA 1NQTA 4UVHA 1B14A 3VH1A 3AFMA 1H6AA 1PTJA 2CNBA 1YKFA 2JD2A 4EYEA 2W2KB 2O3SA 2GERA 3H65A 2BI8A 2Y99A 3F6YA 1T1RA 3KVOA 2NTJA 3H5NA 4J91A 4BKQA 3DAGA 8ADHA 3RUFA 1PQPA 1Z73A 3KHUA 3ITDA 1NNUA 4AJ4A 5L4SA 3WTCA 4BGUA 1R6DA 3E9NA 1U7HA 4OQYA 3CKYA 3M1LA 4RPGA 3HG7A 3ZV5A 1ISFA 2IE0A 2D59A 1JLLA 4DREA 4Y6SA 4B4OA 4YPOA 1BW9B 3TZKA 4J7CA 1Z82A 2Y0EA 1U4OA 1AUPA 4KWIA 3GN1A 2DTXA 4PRKA 4DC1A 3QVTA 4B7XA 3HDHA 3ANLA 3MTGA 1NVMB 2VNSA 3TN7A 3DZJA 3UCEA 4B79A 3V1TC 1MV8A 4M8SA 5ADHA 3MCVA 4YJFB 5ILOA 1K6IA 4WNIA 2J6IA 5DT9A 4JIGA 4CODB 3AK4A 3DMYA 1EFLA 4ZN6A 4PLFA 4E33A 5IDQA 3NTOA 3PLNA 1ML3A 3G49A 4BUCA 3VZQA 3FF4A 4ITUA 5JCJA 2P68A 3JQDA 1HLPA 4Y8VA 1I2ZA 4EGFA 1LLUA 5K9ZA 3Q9NA 4D3DA 4CJXA 4CMCA 4RORA 1D8AA 1H6CA 2D4AA 2J5RA 2WMDA 2H9IA 1DHRA 3BYZA 3GEMA 4OHUA 3H9UA 3WJAA 1LTHR 1NVTA 2ZB7A 4GGOA 4TZKA 3OMLA 3SLGA 5JLAA 4Z3KA 2JCXA 1HL3A 3BHIA 3LU1A 3K2BA 3GZ4A 3DB2A 2FPGA 2Q2VA 1PU2A 1WW8A 1LQUA 3SBOA 3D4NA 5HRUA 1TEHA 4M87A 4E30A 1A5ZA 2ZB4A 1ZSVA 3MJTA 2QX7A 2D5AA 5KVSA 3L6EA 1DIRA 1BHSA 1WDMA 2LDXA 4FGSA 4MVJH 1I10A 1ZJYA 1NPYA 1FDTA 2WYWA 1DDOA 2ZB3A 3GNSA 4J4TA 1QYDA 5CDTA 4CMJA 3OJFA 2YV2A 1DXYA 1GZ6A 2DPHA 1SAYA 1PL6A 2FZEA 4RGBA 3WS7A 1JKFA 1EVZA 4R1NA 2V6MA 2I3GA 4KUHA 2P5YA 4XQCA 4UUNA 1LLQA 4J0EA 5T6BA 3I9OA 4IMRA 3F5SA 5L95A 4U7WA 2HJSA 3GY0A 1ZK4A 3AUSA 4IUYA 1T2DA 2O3RA 4AJPA 5JSFA 3FPLA 2X86A 4BO6A 2O2YA 4AICA 4BVAA 2GSDA 1GD1O 2QYSA 4CLHA 1XEAA 1KEUA 2BMAA 3L6DA 1CJCA 5DDIP 3W8EA 4XQ9A 1D1SA 2WE7A 4C7KA 5EL0A 1BXGA 1YB5A 2DBZA 2X22A 4DLBA 1YBMA 3JQ8A 4XIJA 2EP5A 4MPDA 3BMQB 4Y9DA 1UXIA 4XX0A 1M6WA 3K73O 1PQUA 5AXAA 4XCVA 4CM6A 1YO6A 1HE4A 3PXXA 2NV6A 2B4TO 1HETA 1Q7BA 2A92A 4RZIA 4IDCA 3JQCA 7MDHA 2NU6A 2UDPA 5I8WA 3I52A 1M6HA 4K9DA 1JAYA 3A06A 3I1JA 1SB8A 1P0FA 1IHXA 4MP8A 1LEHA 2H1SA 1BRMA 3ZI0A 4TROA 2X23A 4K6CA 4W9NA 4W9NC 3FSRA 3KEOA 3NYWA 3HUDA 3ETGA 4D46A 1DEHA 3JYOA 3HWRA 7ADHA 4P22A 1TT7A 4WASA 5G4KA 4FCCA 5JCXA 2J3JA 2WD7A 3V2HA 3RUIA 2CF6A 5DN9A 1F14A 1D1TA 3GVHA 2V7PA 4JNKA 5EN4A 1EBFA 4CQLB 2D0IA 3PWKA 3C1AA 1YS4A 3H9EO 4BQPA 5TGDA 3GRPA 4O0LA 1P1FA 5CPFA 4BO9A 3D5QA 4MOWA 3I23A 2GN9A 2FMUA 3CXRA 4GWGA 3ZU3A 4BNWA 5JY6A 5KOIA 5GMOA 1NASA 3LC7O 3H3FA 3HQ4O 4KMSA 4YRDA 1OMOA 1WNTA 5I9NA 1C0KA 2DC1A 4NR0A 1AE1A 3G79A 4FS3A 4Q3CA 1PQWA 3E03A 3UH1A 1YH3A 4DPLA 5DP1A 2AE1A 4JJFA 4NK4A 3RUEA 1ISMA 2DFDA 4R3WA 1P9LA 1I3NA 2EHDA 3JD1A 3N7UA 3F1LA 4A5OA 3QE3A 1AGNA 2W2LD 1NAIA 1ZMTA 4N5NA 4CV2A 3KSUA 3W6UA 2JD0A 5JAIA 1B8VA 4FJ0A 3BXXA 2AEMA 2GLXA 4EJ0A 1R0LA 1W4ZA 3GVXA 5JYEA 5A02A 3QA9A 1IZ0A 1ZJZA 2ZTMA 4CR8A 2FPIA 4XEHA 2J5KA 4BNJA 4ZJUA 2OHXA 4FOOA 1JW9B 4J1TA 1UDBA 1KEWA 3AI1A 3VVCA 2P5UA 3N74A 3RU7A 1DBVO 3BMCA 3JQ8B 4Z0HO 3S2IA 2B5VA 4BB6A 5BQFA 1P77A 3G3EA 4FN4A 4H16A 4L4SA 2GZ2A 3RFVA 4CMEC 2NTVA 2VWGA 4QXMA 3H9GA 3LF1A 4L4XA 3AY7A 3FPCA 3K8ZA 1NQOA 1VL0A 3BTOA 2VHVA 4XR4A 2GZ1A 1MFZA 2RHCA 1VM6A 1PX0A 3VDQA 2WYVA 4E3ZA 3HDJA 4FIZA 3DDNA 4WCDA 3PYXA 3TFOA 2X5OA 3L9WA 4PZCA 1N2SA 2IZ0A 1E5QA 4E4YA 4RVHA 4A73A 4E31A 4EJ6A 2D2IA 2BHLA 3U4HA 3ETEA 3K6JA 4FFOA 3NJ8A 3T7EA 3WGTA 3NDRA 1QLJA 2R00A 2R00C 4BKUA 5KCZA 1NBOA 1ZNQO 4S1VA 2AG8A 5G4KB 4GX0A 3PGJA 1J5PA 1KETA 3F1KA 5B1YA 2E4AA 2WD7B 1BVUA 4J1SA 2PKQO 4ND1A 2E49A 4WEQA 3NUGA 1LLCA 1HRDA 2POQX 2X5JO 1B3BA 1YL6A 5KNLA 4I9UA 1HDGO 5JPIA 3CZRA 4IBOA 2ZYAA 1HZZA 4H3VA 4NNJA 2EW2A 2CVOA 4UVEA 3H8VA 2Q1TA 4BO8A 4WK6A 3AOGA 2CDCA 4AJNA 3NAQA 4WNCA 4W4TA 4ALNA 4MJLA 3R6DA 2BFMA 2BRUA 2Y1CA 5C5IA 2GCGA 1P74A 2OFPA 2HU2A 1TA4A 3IKVA 3ROMA 4TRNA 1CDOA 4B3JA 4O63O 3OFSA 3NT5A 3A4VA 1Y8QA 4L76A 1EQUA 1R0KA 3HFGA 3JSAA 1YQXA 3H9JA 1KC1A 4TRRA 4F45A 3UW3A 2J5QA 3D3EA 3ZW9A 2PV7A 3JQFA 1R66A 3I83A 5A1TA 2FN7A 3MJCA 1MGOA 2HUNA 2WSBA 2I9PA 4J43A 4OM8A 4JP2A 4ONEA 5GY7A 4F46A 3FWZA 2AEFA 3BMCB 5B12A 4J9UE 4UAGA 4CQMA 1U3WA 4NPCA 1T2FA 3GAFA 3WFJA 3VKUA 3C8MA 1HDZA 3OECA 1HDOA 4RF4A 3VHRA 2EERA 3WJ7A 4E5NA 1VL8A 5L7YA 2IYOA 3PQEA 1PZEA 2VZ9A 3V2GA 2EGHA 4IQGA 3ZN2A 4BOYA 3CH6A 1G1AA 4RVFA 3QHAA 3TDKA 1WVGA 2C2YA 4RF5A 4PG8A 3C1OA 2C7VA 1N9GB 2O3QA 1UH5A 4LCEA 1CYDA 1GV0A 3PTZA 2HKIA 5JO9A 4D42A 1XLTA 1C0LA 4MO2A 1LDBA 1T4DA 2VYND 4RLSA 1DRVA 1DRWA 4BL5A 5COBA 3V2UA 1JKIA 2QRLA 3ZWPA 5G0UA 4B8WA 4BNVA 5C7OO 1GQ2A 2I65A 5TX7A 1C1DB 3OQBA 3VTZA 4NBTA 4LISA 3TFQA 5EIOA 3ZWBA 4DWVA 1YOVA 2AG5A 2AHRA 2HMUA 1Q7GA 4HXYA 3AW9A 1OC4A 4E2ZA 1YDWA 4TSKA 1LQTA 2DPGA 3K92A 4XKJA 3ZH2A 3UFXA 2WYUA 4BNXA 4ZICA 4QEDA 3L07A 5FF9A 2PLAA 3E9MA 1UAYA 4L9RA 2VWPA 4CM9A 1NX6A 1VRWA 3Q3CA 4XYMA 4JBGA 4ZA2A 4CV1A 1HLDA 2HSDA 1AN9A 3W4IA 3M1AA 3GNTA 5H82A 1Y8QB 3IP1A 4XRRA 1WDLA 4HX5A 4Q3DA 3GGGA 3ZNQA 5F1KA 2HK8A 3KV3O 4FJ1A 3NDJA 4OO3A 1PJ4A 1E6EA 3HB5X 4E12A 1Q0HA 3JD3A 2AW5A 3JD2A 3DAPA 4GX5A 3GGPA 1UDAA 1P3DA 5IZ4A 4HY3A 3TOZA 4OIMA 1ZUD1 4OXYA 4M89A 3K9QO 4CQMB 4E21A 1XYGA 5THQA 4YVFA 1MC4A 2X6TA 4M86A 1YE3A 3EMKA 2PH5A 2JAHA 4E5KA 5JMPA 3DAFA 2RAFA 3I9MA 4U5QA 4JGBA 3GN2A 1M75A 3QWBA 4EUHA 2ZK7A 4QECA 5JFOA 1HE2A 1PZFA 2P9EA 1E7SA 4IQ8A 1ULSA 2VTEA 1BXKA 4KQWA 1MB4A 2BFAA 3G1TA 3KO8A 4XDZA 5A9RA 2Q4BA 1YJ8A 4H15A 4I5GA 5JS6A 1PS9A 4BO3A 3TNLA 4JK3A 3INRA 4B4VA 5B4TA 3SLKA 1E3WA 1AHHA 3UUWA 2PFGA 1P1RA 3CINA 1LUAA 4JBIA 4GPD1 3SXPA 2GGSA 2D8AA 2HDHA 3A28A 2JFGA 4R4JA 4WE3A 4BHTA 5KJCA 1YOVB 5JDIA 5JDIC 3K31A 3C7AA 2VYVD 4KUEA 4A0SA 4CM4B 3ZWOA 3GGOA 4WLOA 4DIBA 4J9VA 3L4SO 3OJLA 1PWXA 4IS2A 4HKTA 3KYDA 3WGYA 4YTEA 4LVUA 4RPKA 2DT5A 2O7SA 1S6YA 3LYLA 3GH3A 1NHWA 1Y7TA 3WBBA 1TB4A 3OJEA 4IGEA 2ZJ1A 3NX4A 5JNLA 3ZNPA 3HDQA 1K5HA 3LT2A 2X9VA 4QQRA 4BMSA 4TKLA 1SEPA 4ZQHA 2C54A 2CMDA 1ZK0A 1OI7A 3E48A 1B15A 3Q1LA 4Y6RA 5JAQA 1DJQA 5JC8A 1I3LA 4ZQFA 4QO7A 5BR7A 4MKXA 5TS3A 4B4WA 3PIDA 2NACA 4XGNA 5F21A 3I3OA 1NPTO 4QFDA 4YBZA 4NMHA 3U4DA 3QWFA 3FNGA 4YJDA 5TNXA 3ETDA 1HYEA 4J4HA 1T2AA 2QRKA 4XWYA 2RHRA 1LC0A 3INGA 2ILTA 1EUDA 2X4GA 5L7TA 5G2OA 3WSWA 4BKRA 3GT0A 2PA3A 4GI2A 3X2EA 1F0YA 4YT2A 4PVCA 5JBIA 1IOLA 3DOJA 1PGOA 3VAZA 4BNUA 5JDCC 3RWBA 5JDCA 3V5NA 4CV0A 2VRCD 1F8GA 3AI2A 2VT2A 4WLNA 5LCXA 2F1KA 4RPJA 1E3WB 1H9BA 3OJOA 4L4RA 5FEUA 2D3TA 4PLZA 4UUOA 3GLQA 3GRKA 1GU7A 3R1IA 3ASVA 4INAA 5KVVA 2BGMA 3QP9A 4HBGA 3ZWNA 4GVLA 3QQPA 3Q2IA 1WDKA 2XXBA 2FSVA 2H63A 3IOYA 4M55A 4BNLA 4L8VA 2EG9A 2A9FA 4WPGA 3W8DA 2I6TA 4L0QA 3BZUA 4YJFA 1KOLA 5CDSA 3BIOA 1EUCA 1E1KA 1MXHA 3AOEA 1T2CA 2CSUA 3AOEC 1ARZA 3I6IA 1R12A 3BMNB 1I2CA 1GZ4A 1TI7A 5BNFA 1P0CA 1YVEI 3KYDB 1NQ5A 1UXJA 2HMTA 4XDYA 2GN8A 1IYZA 2P9CA 5CDYA 1IB6A 1DC5A 2VOJA 1O95A 3JQ9A 3JQ9C 1GPDG 1JQBA 1DFHA 2JCYA 4IZIA 1ZEJA 3WQSB 3NGXA 4R9RA 1WMAA 1QV7A 4NBUA 1EDZA 5C7LO 3OH8A 4ZRMA 1PR3A 5DCYA 3ZHYA 4TVBA 3WLFA 1E3LA 4AG3A 1B8PA 4RQTA 2EKPA 1VJ0A 4IJKA 3WYBA 1HDYA 3UN1A 3DWFA 1JN0A 3GAZA 3AFNA 5KIAA 1HDCA 5MGBA 3H3JA 3JQAB 1E0DA 3OM9A 1YBVA 1M67A 4HP8A 1E1NA 2VUTA 5JCJD 4EEXA 1EDOA 2V6FA 3KRTA 3VC7A 1GDHA 1NXQA 4QT0A 3RD5A 4ND5A 3HJAA 3EDMA 5BNIA 4PLYA 1LDGA 3OBBA 2B83A 4LK3A 4EW6A 5TJ9A 2OP1A 4YT5A 2ZIZA 1RM5A 3DTYA 4UVGA 3RJ5A 1R15A 1ADGA 1FDUA 1WLYA 4OSPA 4OKIA 4GWKA 4OXNA 4AJEA 2PGDA 2E48A 1XA0A 3BMOB 5CAEA 2IZ1A 1J6UA 4BV8A 5BT9A 5A5FA 1I01A 2NVWA 1YRLA 1DAPA 3PEFA 4FPXA 2H6EA 3LT1A 3PIIA 3H4VA 2Y1OA 4ND4A 5L53A 1YBAA 2I76A 1GAEO 4J6FA 1E3JA 3QY9A 4FFMA 2Y68A 1NP3A 1GCUA 1GPJA 2WM3A 3I6QA 3NDIA 3BMQA 1KS9A 1PL7A 1CETA 3PHIA 1EUZA 4WOKA 4EJMA 4U6SA 4Q3NA 1PJSA 2B35A 4EDFA 1V6AA 1N7GA 1LC3A 2NSDA 3DR3A 4BNNA 2XAAA 5IN4A 3EZLA 4DRYA 4TZTA 4WKGA 3ENKA 4XRGA 1QG6A 3FNEA 3HHPA 1VKOA 3WGOA 5CDUA 4W7IA 4DLLA 3RKUA 3CZMA 4LRTB 3E9QA 4I5FA 1KIFA 2E82A 1FJHA 2O4CA 4GSKA 3BHMA 1B16A 5CG1A 4CLXA 1XELA 4LVCA 1UJMA 1Q7CA 5KJEA 3WNQA 1SCUA 4LGVA 4FGWA 4GKVA 4URFA 1U2GA 4W7HA 4J4BA 4DL9A 3GFBA 1WPQA 2WEKA 3PJEA 4BGVA 2OOSA 5A9SA 1B8UA 4GX1A 3IKTA 1ENZA 1SBYA 2EXXA 1ZXBA 3RQSA 1W73A 3FNHA 1RPNA 4RZHA 4EZBA 4WLEA 1DIHA 1XCBA 4IPTA 4IDGA 4CQLA 2NVUA 1YXMA 3Q6IA 1Y81A 5BSFA 1WWKA 2BD0A 5HM8A 5JW6A 1NR7A 4XYLA 2CY0A 4IIUA 2HJRA 4HADA 1U2DA 1E1LA 1BGVA 1PSDA 3KLMX 3P2OA 2C5EA 2O3TA 2VOEA 5TT0A 4OYRA 1QP8A 1NYTA 1PGJA 3GHYA 3O26A 1DLIA 1XWFA 4JX8A 1B7GO 3GF4A 4XJSA 3U3XA 1BDBA 4IXTA 4PLVA 3PRJA 3QWAA 3W1VA 1DOHA 3PPIA 2AMFA 1DSSG 1VC2A 2HRBA 3PWSA 3GMSA 1OC2A 1DFIA 2VZ0A 3VZRA 1KEPA 3QW2A 3KSDO 1LNQA 2Z5LA 3WG9A 1GUZA 3S1LA 4PIVA 5T5QA 5AXBA 1LDYA 1TXGA 1W6UA 2I66A 4G81A 1QR6A 1XU9A 3MOIA 3C1TA 3AUTA 3CIFA 1LLDA 3MWDB 4R68A 3P7MA 5CG2A 5CEEA 4FC6A 2EGGA 2PTGA 3ZDFA 2PKRA 5HWSA 3WOHA 3VDRA 4DYDA 2O3JA 4CL8A 4UULA 2Q4EA 1E3SA 1HF3A 1UXKA 4R16A 4DQVA 3PQDA 4YCAA 4K26A 1F12A 3ROQA 2YFQA 3ANMA 2Z1MA 1BXZA 2BLLA 3ROPA 5FI3A 3AJRA 2Q2WA 3TSCA 2YHUA 4A03A 1EQ2A 5G0TA 2P4HX 4C7JA 2G1UA 3U0BA 4R01A 2C5AA 2AQ8A 3F5QA 3GEDA 5GZ1A 1Y8RA 2A94A 2J3KA 3IDSA 5KJ1A 2UAGA 3JTMA 4MVJG 5AOVA 3IJPA 4Z3DA 5EQFA 5A3JA 3H2SA 4ALIA 2B5WA 4LSMA 1LSUA 1P45A 2YHIA 3AWDA 4O6VA 5T64A 1I33A 3E18A 5A9SB 4P4LA 1V3TA 3IC5A 4FDAA 4IJUA 4PRLA 1D3AA 4RJTA 1KBZA 2DUUA 4LMRA 4UREA 3FR7A 5EPOA 4CUKA 5L4LA 2EKQA 2NVUB 1R16A 1GQYA 2QIOA 1QMGA 2NM0A 4IDFA 5L45A 3ONFA 4EEZA 4KDEA 4NFHA 2YDXA 3FTPA 4IM7A 1NFQA 3VPXA 3GHHA 4Z0PA 4BNGA 4J2OA 3Q2KA 2GO1A 1ZBQA 5IDWA 2J3HA 1FMCA 4Q3BA 3AU9A 1A71A 5A05A 3DBRB 3H2ZA 2TMGA 3PHGA 1EE9A 3DZHA 4WOJA 4QUKA 3S2GA 5A5EA 1HYGA 3E6AA 4YQZA 1HEUA 2AQKA 4DA9A 3CEAA 2EIHA 4CM8B 3ZGYA 1X7GA 4BO5A 5JO0A 1E77A 4I5EA 2FPPA 3HE3A 5COAA 4ZD6A 5TLSA 3VPFA 1Q2XA 1LA2A 2HCTA 4PLCA 4WJZA 4TMFA 3GUYA 2HK7A 5L9AA 3CPSA 3EZYA 4E0BA 4R1UA 4GX2A 4O1MA 4YAIA 1JVBA 2X9NA 4IY1A 3QWHA 3AM3A 6ADHA 4FR5A 4MVJE 5GZ6A 1WMBA 3S2FA 3A1NA 2O23A 3G1UA 4CMEA 2NU8A 5K1SA 2QRJA 4F6LA 1GCOA 1SZJG 2YFHA 3TZQA 3I9KA 1B3RA 2FHSA 1FK8A 3AY6A 2BI7A 5TIIA 1U8XX 3VH4A 3TL2A 4KP7A 2X58A 4DIFA 1PS0A 1PWZA 1K6JA 1Y8RB 2TMDA 3CE6A 4XGIA 2PY6A 3WICA 2CD9A 1N9GA 1LRJA 3QVSA 1OOEA 1P33A 2P91A 2PD3A 3RJ9A 2NQ8A 2YHIB 3GDGA 3Q11A 4QSMA 2HK9A 1VJTA 1YB4A 4CQMD 5HS4A 1AXGA 2CDBA 4DYVA 3QVWA 4DQXA 2JAPA 2P2SA 4N5LA 2HAEA 1C1DA 1V9LA 2B0JA 5HA5A 4W6ZA 1P31A 1FDSA 3DHYA 1XG5A 2G0TA 1JTVA 2X8LA 5ICMA 3TL3A 4ZHSA 3OIDA 4HNHA 1V3UA 1O94A 1ZSYA 1I5RA 4D45A 3CTMA 3PJFA 4PLGA 1XR3A 3I9JA 1CRWG 3H6KA 1AHIA 3E5MA 1E7WA 5EQDA 1KY5A 1SOWA 2YZ7A 2WDZA 3IAHA 2PWZA 4D0SA 2W2LA 1Z7EA 5C3MA 4XGKA 3OJ0A 3BA1A 5KVQA 3M6IA 2R2GA 1C0PA 2NVBA 1GYQA 4U8GA 4J90A 4NJOA 4IZHA 2Q49A 1UZLA 3NTQA 1D7OA 3WMXA 2OO5A 1EBUA 2I67A 3VPGA 3UXYA 4A26A 1I2BA 4EITA 5L51A 2QZ9A 2PD6A 3LT4A 4DQUA 3ABIA 4JJGA 2G82A 4FJ2A 3ZCXA 4CMKA 2IZZA 3WFIA 4DPMA 1OBFO 3E5RA 3CUKA 1XIVA 2B37A 3R3SA 4NJMA 1Q0LA 3L0DA 2YV1A 2PZMA 2Q1UA 4CM9D 2LDBA 4CLEA 1I30A 4NBRA 3VH3A 1KVUA 5ER9A 4II2A 2DM6A 1FDVA 1KY4A 1GZ3A 1EE2A 2Q46A 1UDCA 1TT5B 1M2WA 4CPDA 3AU8A 3S2EA 3JQGA 1EK5A 1K6XA 3T4EA 5L3ZA 4DUPA 1LSSA 1N1EA 1K2WA 3WR5A 3OP4A 4GGPA 3PQFA 3WDSA 4D7AA 1C14A 1UP4A 3S55A 3B70A 1LSOA 2B69A 2IXAA 2GUGA 1LBEA 1XDWA 1J4AA 1DAOA 3PI7A 2G17A 1E5LA 1QYXA 3IIEA 1PIWA 3ORFA 3DQPA 1FF9A 4FW8A 2JFHA 3EYWA 1I3MA 3NJ4A 4LW8A 5B37A 1IY8A 1G0NA 2PD4A 1WP4A 5JY1A 3DC2A 3OQ6A 2B4RO 4S3MA 4XYGA 5KKCA 1ISHA 5L4NA 2E37A 3UVEA 3MWEB 5DBIA 4CUZA 4H7PA 2GRAA 4HWKA 2C2XA 4B8ZA 4EUFA 1CERA 4BIIA 1KVRA 4FFLA 4CM4A 3U62A 4LRSB 2EWMA 2CVZA 1J49A 4AJKA 3U4IA 4GBJA 4B4UA 3HB4X 4HFJA 2AQIA 1N1GA 3K96A 3DZFA 3TZHA 2W4QA 4UEJA 5JYDA 2BH9A 4YYZA 4J49A 2VZ8A 1V3VA 4C4OA 2PZKA 1UXGA 1IHYA 1LJ8A 3UGKA 4CM5A 4D79A 4GAEA 4CR7A 1FDWA 3FI9A 3LC1O 2VRBA 1K0UA 3VH2A 1A4IA 3CMCO 5U4QA 2Y0DA 1NFRA 4BNIA 1O5IA 1P1JA 3QVXA 4IS3A 4BNKA 4ALLA 1Z74A 1NWHA 5HS6A 1WXDA 1T25A 1MA0A 3CMMA 4R1TA 4R3NA 4KDFA 4Q3AA 1JWAB 3PFFA 3RUAA 4EUEA 5ICSA 3C85A 2EJWA 1WZIA 3ULKA 1DRUA 3RKRA 1E7YA 1ZK1A 1HDXA 1PJ2A 1ZEMA 4IDEA 5L40A 1Y5MA 2VHYA 3GVCA 3PYMA 4NJMB 5A06A 1RYEA 1DIAA 3BTUA 3WLEA 3JD4A 2Q3EA 1VJ1A 1HT0A 1VSVA 2W98A 4ZGWA 3V8BA 3U4CA 4WLUA 3X2FA 2OUIA 3JYQA 1LRLA 4WCFA 2JFFA 3JQGB 3K5PA 4WCFC 4E5PA 1ENPA 2ZB8A
chains in the Genus database with same CATH superfamily
1XTJA 3EGDB 3SU8A 1U0BB 2P0AA 1MJGA 4TLMB 5C80A 3SI7A 4P7KA 4JLVA 4Z9YA 2CFIA 2W6OA 4OV6B 5AW0A 5EHZA 1IQRA 4IDBA 4G2NA 1CJTC 3LFHA 2AEJA 4EA9A 3BAZA 4TN5A 3EOAI 1PJQA 1E2MA 2QSUA 5KKAA 2HRCA 3BWBA 2C8LA 2PH3A 1NVWQ 1VGVA 3PB3A 4UNNA 4X1KB 3QWIA 3RROA 4DMMA 1SOVA 4EPWA 3FUTA 1HL7A 4MV3A 2AUMA 2QLNA 4EA7A 1YNSA 5AJUA 1D6JA 1F1JA 3WLNA 3HCEA 4CM3A 3RVKA 5JYBA 2ZQZA 3QITA 4FMDF 1X19A 4O4HF 4B4DA 4DXHA 4EY3A 3L40A 4OP2A 4PGGA 1LDMA 4M98A 5BRAA 3WLKX 2NSJA 4FKBA 3ZHZA 2WWTA 1PFKA 1ZCJA 1TFUA 3QIVA 2RHTA 3WHPA 4PLPA 5HIAA 1E8MA 3MUOA 3LUFA 5JMOA 2RAPA 2PKXA 2JLVA 4JJ7A 4D9NA 1Z5ZA 1ZIPA 4OHXA 4TMYA 4UNRA 2PZLA 3RUDA 3IVCA 1Q16A 2D5IA 4AO6A 5DHUA 5E9QA 1E1QD 2BM1A 4XAQA 4DSZA 1H5QA 3D5TA 3I45A 4KYUA 4B47A 1Q21A 3OPXA 1H22A 5CBPA 1DFGA 3H84A 3QXGA 2P9GA 3D7NA 1XD2A 2UYYA 1FFWA 3C6YA 2LZ0A 1IQPA 1NFFA 1SHKA 4M22A 1P7YA 2X0NA 3HYRA 3U81A 2FA9A 4DDTA 4ON9A 1X87A 4Z4GA 3F8SA 1GWNA 1SPBS 2EGUA 2ZSUA 3IR6A 2OHGA 4H3KB 4MA4A 5KC9A 5DLPA 2D1YA 1T9KA 4RTNA 1WR8A 4U2CA 1A96A 1TJPB 3MJEA 1R6XA 3SZGA 4Q19A 2NU7A 4YP0A 5AVZA 1K9SA 4Q6WA 3PC6A 3E2PA 3RHSA 4ZDKA 4LDNA 1H2XA 2XWBF 4K6GA 4KQEA 1W46A 1L7DA 3B20A 5DIFA 4A92A 4B0OA 4CM7A 2Y1KA 2CGEA 2FNAA 1N6NA 1NJGA 3E15A 5B7PA 4DILA 5K3FA 4X91A 1PZMA 1GFSA 1YB2A 2HPVA 4OHVA 4PGFA 4PANA 4LE1A 1HFEL 4TYQA 3VM6A 3I9V6 4PG5A 1M2HA 3SYRA 3TTWA 3E84A 4BXOA 4A8PA 3QBTA 1Q91A 5J2TF 5AM5A 5F52A 3W2TA 3SNKA 2EKZA 5H4GA 3PEWA 4PHTA 3UNXA 1Y3BE 1LSJA 3R8XA 2DY0A 3I2HA 5I9MA 3FOCA 1PNRA 1KFKB 4FGUA 1WM1A 4G6ZA 3T3EA 3N8NA 2O8DB 2Y1GA 4PZDA 3MJ4A 2RK4A 3EPRA 1D4ZA 1PJ3A 2QTFA 1BMDA 1WVIA 2EBUA 4KTTE 4PG6A 4X54A 1C0IA 2ESRA 1N5LA 1QXSA 3MMPA 4OBWA 1AQUA 1CUAA 1PJCA 1XLWA 3GYGA 4C06A 1SHJA 3DMTA 3DMTC 4TZ6A 1SKUA 3DE7X 3WQHA 4C2BA 2V7UA 5F51A 3FPEA 3VR0A 4DA7A 4YJHA 3J81k 2WAXA 1P39A 3GPIA 2GYUA 3TLXA 3ZU6A 5EQJB 2WTBA 4TMKA 3UOGA 1MX5A 1A4UA 2D1TA 3VKHA 1BD4A 3MOGA 1LVHA 5CT9A 2CDRA 3GVPA 2FW9A 2YN0A 5ALPA 3UYKA 1T5TA 4EG7A 3TOCA 1O96A 3P5BA 1G63A 2UZ4A 2I99A 5CYPA 3VYTB 1MABB 2YWHA 3AR4A 2BM9A 3PJGA 1KVSA 1OKKD 5CCDA 3RC8A 4MR7A 3PS9A 2G9RA 3EEIA 1SNYA 1WW3A 4HWTA 4LK2A 2IYRA 1P1KA 2YX1A 4JT2A 2Q7OE 2GJ9A 4XWWA 2KJQA 1DU4A 1L5KA 2O8NA 3V1YA 1WZ2A 4I36A 1ZMXA 1NI4A 4ZYWA 2DUWA 1R9MA 2H0AA 3JWPA 3K4PA 3DPSA 4JC0A 1XPRA 3UMJA 3V1UA 4LOIA 3H8WA 2V7VA 1M8FA 3KUDA 4MRSA 4PZYA 4YRFA 1U3CA 1RE1A 4G5FA 1U7PA 4B9EA 3ANSA 5C35A 1ND5A 3P0EA 2JH3A 3GDWA 3KAPA 1YFLA 3K6SA 4TTPA 2OV4A 1UQUA 1VZ2A 3B38A 3GFGA 4RVOA 1KQOA 3STXA 5J2UA 2A35A 2Q5OA 1HTWA 4LI0A 4UEOA 1GDDA 2QHXA 3HA2A 5EAIA 2HBZA 1P2UA 5H81A 1UXOA 2X76A 3EEFA 2VHXA 2HU5A 2Q21A 2F00A 3COPA 2C4UA 5E6UB 1EFKA 2A9RA 3DWGA 5BSEA 1NW3A 2P2ZA 4BB5A 2YCLA 1NX9A 2QTHA 2CLMB 3AM4A 1NMZA 4QXQA 3W8NA 1CDZA 5EZ6B 4KE9A 3I4LA 1XZQA 4FINA 5EE0A 2PL5A 4QD3A 3FOEC 4B7CA 4ZRNA 2H5JA 1L7NA 3CZ4A 2BP7A 3ZE8A 2OHJA 2GYYA 3HM9A 4QGBA 3FR8A 3R76A 3RVJA 4LKRA 3AC0A 3R7SA 1TKCA 3DQQA 3AHJA 1IVYA 1DQNA 4GM1A 4PM4A 3RB8A 4U7TB 4ZPXA 4EG0A 3LBFA 1R0ZA 2CLHB 1D1PA 1M2VA 1U8FO 3O3MB 3V3TA 4Q7JB 4YAKA 3C48A 3NBYC 1IM8A 5M34A 2YRFA 3PFWO 4IQ0A 1PV2A 4LYGA 4JC4A 3KP1A 1TVKA 4MVYA 3LLUA 4ZQEA 4HYYA 3W6NA 3WB9A 4ER3A 3DFKA 3BJIC 1YWGO 1Z6GA 1Z07A 3AVQA 3U4GA 3A6PC 3NBKA 4E07A 1P91A 3Q3HA 3QLTA 3WWZA 3CX8A 5IVKA 4BLUA 2NSHA 2VDWB 3WAKA 1BDIA 5JOQA 2R6FA 4J3NA 3FCAA 1XK7A 1T10A 4G09A 4YO8A 3W4JA 1VCIA 4BNTA 4F8JA 3FSGD 1P1CA 1X8XA 4MAFA 1DPFA 1DKRA 1MO3A 3CSDA 6REQB 4K05A 3WRWA 2SBTA 3HYLA 4RDCA 2MSKA 3EGIA 2P3OA 3TOXA 4HGQA 4IJWA 3VR6H 4WECA 4JCCA 5LQAA 1NC3A 3IAUA 5A03A 2NZJA 2F9MA 3WQQA 3T7JA 3BL8A 3T5MA 3FROA 4ETWA 2Q3BA 5EUCA 3IESA 1J97A 4GH5A 4KYIB 4B6JA 3ED1A 4XDHA 5HDBB 1QO0A 2QV7A 3PHJA 4CZ2A 1DO0A 5HCIA 1EP9A 3SFTA 2FW6A 5L6MB 3KTAA 3HN7A 3HUUA 1N0IA 5CDFA 5HUHA 4WCVA 1ADBA 2P8SA 2I80A 3VU8A 1NLFA 5ES3A 4EVSA 3AVVA 4YBRA 2G9NA 1J8FA 3EVFA 4BRZA 4YHBA 2X42A 3KE8A 4R8RA 3WQBA 2ZE8A 5CLQA 4RQUA 3RPEA 1U8UA 3I0NA 1KVQA 3W3ZB 3IL2A 2XT0A 5JHGB 2C78A 3RC9A 4XX1A 3E35A 3ILXA 2PX0A 2WM2A 2HWXA 4RCZA 3VR2D 3DLBA 1NJ5A 4FI3F 4Q9KA 1U28A 1U28C 1XDGA 3KK0A 4JEIA 5AHKA 5EUMA 5IJWA 1L5YA 1YRHA 4QOSA 5JADA 4BDSA 3ST7A 3K1TA 3BILA 4CN8A 5BVHB 1SCKA 3HTXA 1XA4A 3GT3A 1C7IA 4G5GA 4PQRA 3THRA 1QYWA 1UBEA 1YS9A 1IEXA 4TLAA 4AJ1A 5K3EA 5DOZA 2DTEA 4QXPA 4BEWA 4IJQA 4E03A 3HBLA 3I6MA 2EFYA 3FNQA 1OFUX 1V25A 1GGHA 4KUGA 4RLHA 2XCUA 5IUJC 3GPBA 4XPIB 2X0FA 1MN6A 3QV1A 4H4DA 3MWJA 4JFRA 1ADYA 2JLBA 4X6XA 1BWRA 1EFVB 4L7VA 4DR7B 1MX9A 3P32A 3IERA 1GZSA 2OP0A 4QUJA 5IHPA 1TIBA 4KQHA 3I5AA 3D4OA 1JG6A 1YCHA 3OIGA 4YCDA 1Q7RA 1WPXA 4AY2A 1VGRA 1WXIA 4LQCA 3W9YA 2B92A 1OT5A 4KN8A 1ZXLA 4MHSA 5EINA 1H2AS 2WKWA 2DQKA 4WGFA 1PNQA 4D81A 4HDKA 1ONNA 1IY1A 1H0KA 1WSDA 2O2HA 1Y9AA 4OM7A 4D44A 4RQAA 3NIDB 3O8QA 3UCXA 1QPBA 4I2VA 3WWYA 4CN9A 3KL4A 2QW8A 4Q1FA 4CMBA 4YLYA 1H2HA 2Z8YA 4Z53A 2Z1DA 2Y2UA 4LZNA 4KOAA 4TS9A 3AUYA 1AQJA 3E9DA 1KC3A 1PBNA 4A23A 3NHSA 3RS3A 1GYRA 3IDAA 1JZSA 2JA1A 3M9XA 4L0DA 1DKOA 4RMJA 5KTPA 2QPOA 2YVKA 3DV0A 2FDXA 3BSSA 3P27A 4H1UA 4JEHA 4L08A 4QULA 4B6EA 1M0EA 3O8LA 1YI1A 4QU8A 2VPZA 4BFCA 2IP2A 2AKYA 4ZYZA 5T7BA 1DIGA 3D7LA 5SYAA 1N5MA 4KXWA 3ZNNA 4NMMA 5E9AA 5AKLA 1K6EA 4RV4A 4ZT4A 721PA 1J0XO 3THXB 1V5GA 2ZJ8A 1L1EA 1QB8A 2DFKB 1NHGA 2AFRA 1TZBA 2V9PA 3S2UA 4XB6B 5DM0A 1O6ZA 1C4XA 1U0RA 1UJ4A 2GF2A 2FFAA 3RU9A 1LDNA 1KWKA 4R2LA 1N8KA 2JA2A 2BHSA 4P3NA 3RCBA 1C7ZA 3EJ6A 1IZYA 4XYEA 2ATXA 3RHFA 1PGQA 3HKCA 3M2TA 2Q3HA 1U2QA 3ZTTA 2XOXA 3LZ6A 2V96A 5EZYA 3FNFA 4Z4FA 4BYMA 2MSWA 3WY9A 2X8JA 5C4IA 1QFZA 4IL5A 2HD4A 2NNLD 4URYR 3A9TA 3QMWA 2R5FA 3GUCA 2W8ZA 1G2PA 1P8AA 1U9ZA 1R0XA 1U0OC 2QP4A 1SXQA 1IULA 3K6RA 2OMEA 1TW2A 2X2OA 3PLAE 3OPQA 3B8EA 4J2HA 4JI6B 2PGOA 4FT4A 5D6OA 2P79A 3NM6B 3LHIA 3RIHA 4JGIA 4KVAA 2PZAA 3A9WA 4LXTA 4W99A 3B6KA 2WMOB 5EHQA 1TF5A 2QAGA 2QAGC 2VQFB 4JT9A 1QO7A 2VSYA 1KP2A 1E20A 4HI0E 3OWHA 2R5WA 2FW8A 1FX0A 1WB9A 1RRKA 3OHPA 4ZCTA 4BV9A 4TXJA 4HAYA 2C8KA 2ECOA 4XVUA 3KETA 2O2CA 3R8CA 2DSNA 1OQAA 4D3ZA 4GEGA 5B7NA 2BFBA 2XUOA 3KQKA 2IUFA 1XRRA 9ABPA 3B1VA 4P7FA 2IHVA 5ALUA 1FFCA 1FPQA 4GLFA 4ND2A 2II6A 2MSLA 2OGUA 2PEYA 4BO0A 4D8TA 2CJYA 2B3TA 2Y05A 4A27A 1B73A 5K6TA 2AJTA 4KN5A 4W82A 1RI1A 4WK4B 2A86A 3NOQA 3ZE1B 1O94D 2JZCA 2YCBA 2XDWA 5E38A 3C87A 5GONB 1HR0B 4NICA 2B2NA 1Q83A 2QQ5A 1HQKA 2VDOB 3M6LA 4HDRA 3BK7A 3K4QA 1E0JA 1HK7A 1RPJA 4RLQA 4TT8A 5DF1A 2CMKA 5AHXA 5FRDA 3UZUA 1QKJA 3OCXA 3BKXA 5DU2A 4ES6A 4A8TA 5BMVB 5ITVA 1Y6GA 4Q1VA 3OCVA 4IINA 4PFSA 3B1FA 1CB7A 5FBWB 3SEAA 5HQ3B 1UCFA 1K7CA 2ZT5A 4GDMA 3NAMA 1GSAA 3EIFA 1AHNA 4ZCQA 3ZHRA 1RM0A 1Z45A 1L2TA 3EEBA 4ZCPA 4ZZ1A 6NULA 5I9TA 2WHQA 1R5OA 1SPXA 3DEFA 3BB1A 3ILHA 1JEDA 2HC9A 3G2MA 2GK7A 3ZE7A 1EDDA 1X13A 3DW3X 4RPHA 4HAOA 5F1OA 3O82A 4EFKA 3MJDA 3JD0A 4QA9A 5GQSA 1XTQA 2A5DA 2CF5A 2GBCA 3HS3A 3INNA 4L78A 4MI9A 3T5TA 5DYYA 4CUJA 5G02A 4GP9A 2ZI5A 3HRKA 4RF3A 1DHTA 2IW3A 2EKDA 2RG7A 2X3FA 2IODA 4U7GA 4DIOA 1UP7A 1W0JD 1GPNA 2QX9A 2QU8A 2ZRJA 2AMYA 3VNVA 1XLUA 5B3KA 1CUCA 1QBGA 2OCIA 1DMSA 2I5PO 3DBHA 3R3ZA 4L2IB 3TM4A 2BBWA 3DJYA 2ZS8A 3W77A 2CV2A 3DEKA 5BW5A 1KI6B 3N58A 3SC4A 2CCKA 5JH7F 1SCJA 1RLUA 5T67A 4BFXA 1TQHA 4MI1A 2IOFK 2VCYA 4CLRB 1J7JA 1E7RA 3EVTA 4UBOA 5DOVA 5KTRA 4PO9A 1NXPA 2SECE 2XE7A 1KJQA 3Q9UA 4JX9A 5JI3E 2I4NA 1M66A 1MV5A 4V0RA 4L4ZA 1PJBA 2B7LA 2CNOA 3LPMA 1H23A 4K7JA 4ILKA 1KPIA 3R2JA 3DLHA 4PQEA 3D7MA 1YB6A 2HLNA 1R8QA 4LRWA 1GR0A 5HKBA 5LU8A 3TWOA 1VP3A 5HZKA 3JQBA 3JQBC 1JWLA 1O97C 1GFIA 5I01A 4EMBA 5HQTA 1LS1A 3DGEC 2GBFA 3B7WA 3QKWA 1H1TA 1JLMA 4OH1A 2YOFA 4M54A 4CCSA 3UHOA 3TZBA 3TQTA 1KKMA 3M3DA 5HP4A 4EA6A 3I5MA 3VJRA 2JGKA 1VLZA 3L7JA 4BRSA 3GEGA 3JV7A 5CURA 4EB6A 1HORA 4EDHA 4GG1A 5FOVA 3VR1A 5LP1A 2ORED 1N7IA 1XQ1A 3I30X 4OBBA 4R2XA 5JEDA 1EINA 3UAGA 1G8AA 1X9IA 2QNBA 2WLTA 2YRXA 1AKNA 3LY7A 3TTYA 3S8YA 4X5OA 3VDNB 1O1YA 2OG2A 1KRWA 3FWKA 2H7XA 2AS0A 2FN9A 5HUQA 1YA4A 4RCVA 3CZQA 3O6VA 2AK2A 4PXYA 1QVRA 1WCWA 2ERYA 5FADA 4V0LA 1E5VA 1NIPA 4FE7A 5CR9A 1OBHA 1YB1A 2VRNA 4M0LA 5L3QB 1Z39A 2J0QA 3D0OA 3KM0A 5GIOE 1Q77A 2NP6A 1EFTA 1JXOA 2AC7A 3BB4A 1JHAA 1TJ4A 1SVOA 3BREA 3EQZA 3IBGA 4UXIA 3VUEA 4EW3A 2C99A 3SVTA 2BY4A 3T41A 1VHWA 1CVLA 4FDLA 3UPDA 4CEHA 1V26A 5BUQA 2W2TA 1OUMA 2C98A 5ESXA 3TKLA 5JYCA 3KOXA 3EIHA 3OE1A 4EY4A 4YMGA 1XYYA 2C31A 1RLOA 1U1GA 1YGPA 2ZBGA 5KTSA 4NBWA 3MAAC 3ZDAA 3U9TA 2FEKA 4DC0A 5FQNA 1NZFA 1QNFA 1R37A 3I6YA 1EEHA 1EX1A 2F3SA 1IONA 1TKAA 1BXRA 1E9FA 3HNPA 4WZBE 5AW5A 1D1QA 1T4BA 5BNTA 4GM4A 4MQ4A 4A3SA 1QMPA 2VNAA 3FJYA 1XJCA 1BDMA 1KMCA 3NRCA 3RVBA 3UHAA 4TWRA 1ZA1A 1O58A 4YDRA 3DP9A 5CX1A 3VQTA 2D5LA 5HVNA 1SIBE 1D2EA 2ZDGA 3BXFA 3OD5A 3SPXA 4Z4EA 2WINI 1ODLA 1WCIB 1D4FA 4Y9UA 5IFLA 3L0ZA 5DX8A 2IEIA 1FP7A 2RI0A 2R1ZA 5ICGA 3H5AA 3C24A 4R51A 2G83A 1JEQB 3LXUX 5K3SA 1T26A 1ADCA 5C5CA 4FGLA 5TDHA 1IXSB 1GV1A 5DWVA 1CF2O 3OX4A 5I9LA 4EYGA 4RVCA 4B43A 1J21A 5D85A 2QGZA 2PL1A 1M6VA 4DLUA 5EXPA 3SOPA 3S2YA 4AMZA 3AM5A 2MINA 5AOBA 5FBHA 1W0KA 2ZBUA 5KS2A 3P0JA 3L18A 3MEQA 4HUQA 2CNDA 2QZJA 4Q5IA 1IEWA 3R3JA 3H42B 4K6OA 5K6AA 5K6AC 1F5SA 3O7WA 2QRZA 3FLBA 5ALZA 1SRRA 2DPMA 4OKNA 1XZAA 2H1RA 2H59A 4UUMA 3U7QA 2O5EA 1Y3AA 1U0JA 4A6PA 3R9XA 5KTMA 5BYJA 3T1OA 1VE3A 4XTCS 1Z4KA 2DBVO 2FB9A 2YN4A 4MITA 4X6UA 1NBMD 1GYPA 1I36A 3ZWXA 4E5YA 5C1OA 1WABA 4BATA 1E2PA 1JEOA 4HDMB 3WX0A 5KVCA 2OMKA 2VDNB 1VJ5A 3PPXA 3Q3JB 1GTZA 1R9JA 5JAMA 3QLEA 5TF0A 1G42A 1A2BA 1GADO 4DZRA 1Y4AE 2ICAA 1OILA 2AK3A 1AF7A 3STUA 2YWGA 1H4VB 3F6PA 3NORA 5JTTA 4PFJA 4Q03A 2ECKA 1E2LA 3EZ9A 3VR6A 4XWKA 2VYNA 3IQDB 1U65A 4HZGA 2VPYA 2YW2A 4BMPB 1BC5A 1W25A 3RANA 2NADA 1NDQA 1XP8A 2OOKA 2RBEA 2WSSA 2XAUA 3B82A 4Q12A 3IILA 3U49A 3GMDA 3K20A 3RSOA 2WU1A 3WDKA 5B55A 2BEJA 3JQAD 3GZNB 3ND5A 2ABWA 2OY0A 1QQ6A 2SCUA 5BR8B 1X7HA 1QS0B 2YNMD 2C4MA 3DCYA 2YYAA 3TQOA 5DP2A 1ZGGA 1RRMA 1RBYA 4I08A 4A8HA 2XXAA 3Q7IA 4EARA 1W1WA 1E18A 1U3VA 3L4BA 4NEHB 3LF2A 3ZHXA 1BH2A 3W4KA 5L3VA 4YALA 3O8CA 5LZ8A 3TVYA 1KFBB 2XA9A 3M34A 1LI4A 4JYPA 4CU2A 3V7YA 2H0RA 3TG2A 3IOEA 5EFOA 4B74A 1BE1A 3TLAA 4M6WB 2W2NA 3QFRA 4D5GA 2PMDA 4W6QA 2UUPA 3QVMA 4B3SB 3DYBA 3KZXA 5K01A 4UEKA 1RABA 3O1JC 4IKOA 3EZ6A 1TPYA 4BEVA 3KEQA 4MS4B 4ZOAA 2H1FA 3RVDA 1QHIA 1ZUWA 1QYVA 1VL2A 3P2JA 2F9FA 4DT1B 3I5YA 3LC2O 1QU2A 2R11A 4EBBA 3ERCA 4CQJA 3MRXA 3NS7A 2D8MA 2Y1EA 3C3BA 4KAJA 5T8KA 2Y71A 5T8KC 2R48A 3VMFA 4AFNA 3RG8A 3DMPA 1RQRA 4P4NA 1XRNA 1EVIA 5ADVA 2DJIA 1KH2A 2YYYA 1C9KA 2HQOA 2GBPA 2XKAA 1EH5A 1HM5A 2OO3A 1VJCA 4O59O 5FFFA 1DTEA 1DTWB 3E22A 4S1TA 4AC9A 2VXYA 2OBNA 3N8HA 2J3DA 1XDZA 5JJ5A 1PWYE 5J1SB 3CO5A 1NSFA 2PSHA 1D9ZA 1U4SA 1TRKA 3UQYS 1EMDA 3EY4A 2G71A 3T94A 1IN6A 3AZPA 3UXMA 3WIDA 3WLMA 3B2NA 1E1CA 1OZGA 3NBUA 3DDWA 2PNFA 4QVGA 1U5CA 2YQ5A 4U2KA 4TUYB 3W5SA 4O4IF 1BYIA 4R1MA 2QNRA 3M6UA 1EZZA 1T3TA 3A36A 3P9XA 4GVXA 5I45A 1QGED 3NO4A 2CXOA 4J2TA 1M7BA 1OROA 2RBKA 3AVOA 3UT5B 3LDUA 3WKDA 3GQVA 3O2JA 1TUBA 3S40A 3UWPA 1BWSA 3IP3A 1AZSC 3IO5A 3CRRA 3L1JA 5CRIA 5F5LA 2ADFA 4YR9A 3CKMA 3SEFA 2PFKA 4N8SA 4RHXA 2PUCA 1PR9A 1XZNA 1XMSA 2JIMA 3OLZA 1KAGA 1U0LA 2JGDA 4NULA 5F1PA 4G0WA 1NRXA 3G17A 3HJRA 3OCUA 3R23A 4ZDIA 3IEVA 5DK4A 2O19A 1SUWA 5LNK6 5TPZA 4YUXA 2Z9DA 2PUAA 1BVYF 5CW1A 1JQ3A 3R74A 5HJ7A 1E6UA 2HMWA 4LTDA 1LPNA 1V7CA 5L3SB 4O4JB 2AC2A 2VHWA 3JZAA 3G02A 1ZCAA 2LXNA 1E69A 3M6MD 2W2KA 3MJRA 4MWGA 2EZTA 2GASA 4IGIA 4UBIA 4MW5A 3KWJA 3P71T 4YT4A 4GI7A 1EFPB 5CXUA 1Y7PA 2Y2VA 4GPBA 2XBLA 3AHEA 2OHHA 1YL7A 3N0XA 2XBUA 1NQXA 4LDRA 4BN4A 2WYHA 4Q9LA 2VS1A 2C9BA 3K2EA 5DM70 3L8FA 3P9NA 3EUWA 1L8AA 3UJ9A 1GZHB 3R3UA 2Z4SA 5AVJA 1AK2A 2VK2A 3NPMA 1M3SA 1JZTA 3PQ5A 2BF7A 4CIXA 1THMA 2VAXA 2BCGY 4XDGA 1NC1A 2UZ1B 1V11A 3KXKA 4IIFA 1F51E 1VG9B 5TQ0A 3SP1A 4P6VF 3EQ9A 1WQ1R 3OETA 2V8BA 2EEZA 4QTUB 3FFWA 2J45A 2RH8A 4JROA 5HCNA 4FD3A 1DTSA 5J5VA 3N0RA 3BXOA 4X44A 1PR5A 3DOFA 1JALA 1U8TA 3AEKA 2WWGA 3GNQA 2IU3A 1T34A 2HCFA 3F4BA 4C43A 4KHPB 3WSVA 2DG2A 4JYCA 1XAHA 4N48A 1Y89A 3NT2A 5COQA 1DDIA 3RSCA 2WWIA 3G6WA 4IKEA 5DLQC 2ZWPA 3DL7A 1E6WA 3MRTA 2EDCA 3UB2A 4X00A 3KBOA 5HFJA 5LA6B 2CZCA 1FYWA 5K3CA 2IYSA 3KXDA 4NU5A 2DFVA 1PWEA 2YY5A 4RUKA 4J1QA 5IC6A 3I8XA 4YC7A 3VVLA 3IAS1 3ESDA 4J7UA 4Y6OA 1PT9A 3U4QA 1F2DA 4WHMA 4FZVA 1V7QA 2E6KA 3G89A 5D51S 5K3AA 2ODEA 3VKFA 4F71A 3P5SA 1EVEA 2DT8A 5KC8A 1LLFA 4YQFA 4JLWA 4I6JA 4MVJM 2AFIB 4FHZA 3OFVA 3DT8A 3BJZA 1CW2B 4P0PB 2AXQA 4HZUA 1JR4A 2M1XA 3A31A 4R8MA 4JIMA 3TVTA 1VFNA 5DHAA 4Z0NA 1W8DA 3ICPA 1GN8A 4JASB 1RP7A 5KO2A 4M9XA 2XPCA 3HL4A 2JIZD 2R8ZA 4JOSA 5JSYA 4X24A 1QK3A 2REBA 4S2EA 3VU0A 5EJ9A 1EI9A 1N2OA 4NDZA 1V8BA 3HRHA 1FP4A 1N6PA 1P8JA 2J08A 2PPLA 4UC0A 2IITA 4XM2A 4YRAA 3A25A 1LCIA 2BPOA 3BTSA 5A4MS 2BV3A 2BZ0A 1OHHA 3CPHA 4JBLA 5SZHB 3TBKA 3UHFA 4BO1A 5LD2C 1OLSA 1RAFA 2W5UA 3JS5A 1B14A 5EWJB 5KOJA 1K88A 2IYLD 3AFMA 1H6AA 3UXHA 2CNBA 4DB2A 4EYEA 3QX8A 4MVXA 3FMPB 4DQ0A 1ORVA 1ZG3A 1VG8A 2BI8A 1C30B 2FRXA 2K7ZA 2QMQA 2Y99A 3F6YA 3H5NA 4IR7A 4OQQA 1QF7A 3DUWA 2JGLA 4I6GA 4BKQA 3DE3X 3AM1A 1P80A 1M0TA 2W93A 1KQNA 3RUFA 1PQPA 4DV3B 1K66A 3QI7A 3SS9X 4GLBA 2CN1A 4FHCA 3V4ZA 4ANFA 3KCNA 1KEKA 5GJBA 5K2OA 3CA8A 3ESZA 1RXEA 5DYIA 1TCUA 3CKYA 2QLJA 3GRRA 4RPGA 3VO9A 3ROXA 3DOUA 3HG7A 3ZV5A 4DAEA 4NESA 1LW7A 4IVRA 4G01B 1JLLA 2C9OA 3JTEA 4G63A 4MW1A 3EVGA 3URMA 5KCMA 1T0BA 1AURA 1UMCB 1Z82A 1GPAA 1WB4A 4J7CA 1QAQA 1N6LA 2P9JA 3IIIA 3PNSA 4PRKA 1EBBA 3IH5A 1KDRA 4B0PA 1XZPA 3ESBA 4YK7A 5FP0A 5JECA 3M1YA 4RCYA 2J41A 1G7SA 3QVTA 4MEAA 3T5GA 2FP3A 2NX2A 2ZGVA 3ANLA 1NVMB 1YIAA 2VNSA 2CHFA 3MTGA 1FDIA 4O02B 3F7NA 1R4ZA 1JEEA 4B79A 3V1TC 1CBUA 1MV8A 5ADHA 3ZD7A 3MCVA 1ISSA 1EUCB 1A77A 1XD9A 3FIUA 3I6ZA 5DT9A 2YS6A 4IH4A 2E5LB 1SIOA 3QVVA 4CODB 5IF9A 4U3JB 4U7DA 4ZN6A 4PLFA 5DYWA 3NTOA 5TB5A 1EWKA 3PLNA 1J8YF 4DCSA 4DRXA 2IQ5A 1LWNA 2HIHA 4BUCA 2PSDA 4EGFA 2QK4A 3JQDA 1HLPA 1I2ZA 2F8LA 1JS1X 5EIBD 2QPTA 5AH0A 4OX9B 1N0HA 1TZKA 2J5RA 1N4AA 2OV3A 2D62A 1DHRA 3BYZA 4Z99A 3GEMA 1HH4A 3ZPXA 4EPXA 2OXEA 2CCJA 1BX0A 3SQXA 5BORA 3OMLA 4G0OA 4F5YA 4D25A 4Y30A 4YRLA 1XAIA 2PVPA 1NVEA 3BL5A 3K8QA 2FPGA 3QVGB 1PU2A 4KNWA 4DXDA 1WRBA 1WW8A 1LQUA 4P31A 1K3UB 2H5EA 3A4MA 3CSUA 4IWXA 1XTPA 1F6WA 5E3JA 1ZVVA 4Z9AA 1TEHA 4OLBA 3I62A 1AV6A 4NAUA 2ZB4A 1ZSVA 4EFDA 4RIEA 1ML4A 4C08A 5KVSA 2D5AA 2A1UA 3RC3A 3HGTA 4B3GA 5EJEA 5MHTA 3SF8B 4JELA 1XU4A 4G8CA 1XWWA 4QGSA 3ZYZA 2Q0QA 1E99A 2I2AA 1DDOA 1ECCA 1EM8A 1VHTA 3GNSA 3I53A 3E1GA 3T1VA 1QYDA 4P33A 2OXCA 5ARDA 521PA 4C7BA 3OJFA 1MOQA 1YUMA 1K5DA 4M9CA 2QXUA 5HUJA 1DXYA 1IQ0A 3NHBA 4R98A 1PAUA 4EEKA 2XCTB 3ACBA 1ZH0A 2DPHA 2PNJA 5I6DA 4RGBA 1PL6A 2FZEA 3FMGA 3R6TA 3E0QA 4YJ3A 5BSUA 3S70A 3BM5A 2I3GA 2GPBA 4QEKA 4CIYA 4RTJA 16PKA 3H86A 1BQ3A 3I72A 3PC4A 1MDBA 4UUNA 3SHVA 5EP2A 1H1LB 1LLQA 3I9FA 1S8OA 2GF0A 5G53C 3H1TA 4A2WA 5HPYB 4FEAA 5DGCA 1WQ3A 1OGIA 4HQNA 3AUSA 4IUYA 2Q5EA 3PEVA 2AWOA 4ZT3A 5EHIA 1Z7YA 3L82B 5GADl 5REQA 2A5GA 3E70C 4AICA 4QKQA 3UJPA 4IFBA 1GD1O 1QNLA 1M0WA 2HRQA 3FGOA 2WY2D 1Q50A 2PEZA 2WE7A 4XQ9A 4BTVA 5KB3A 2XYGA 2X22A 1RQPA 2NAPA 3OD1A 4FWTA 3VJLA 2YJNA 2YXEA 4Y9DA 1TOAA 3G9XA 4MR8A 1JAHA 1RT9A 3EFEA 4L4YA 5K0TA 3K73O 1AZTA 2PRZA 4JHLA 2C00A 4N82A 2YV5A 2C04A 2E4VA 3HN6A 4L5JA 3ZH9B 2NV6A 4WFQA 1Q7BA 4U2DA 7MDHA 3MCTA 4AQDA 1I4OA 3V2IA 3FMIA 5JU6A 1WUTA 1R88A 3I52A 4OLHA 4UNSA 1U90A 3AONB 2BZSA 3NBZC 3SQLA 3UGQA 1BX3A 3ZVLA 1PFVA 1KPHA 1LEHA 2PX8A 2WV9A 4G56A 4D92A 3NNSA 4N6NA 1BRMA 4TROA 4V24A 2G70A 1V47A 1V8FA 1FZQA 4K6CA 4LZAA 1XDDA 2CUZA 3ONWA 1W1IA 1CKEA 4EY6A 1NF9A 5GONF 4M9UA 3ASZA 4YUYA 1WB5A 4W7SA 1QTRA 4FE4A 1GUAA 2YWDA 2DRIA 2HYIC 2BISA 3UV3A 2UVPB 2OZLB 4B3XA 5C7YA 4DSNA 3HJBA 2QRMA 3G5TA 3V2HA 2IYXA 3RYFB 5HNKA 1F14A 4PXAA 4H4CA 4QQFA 1D1TA 3GVHA 3FHOA 4K88A 3NCHA 4PNZA 2GPJA 2Q5CA 1M2KA 4PSKA 2CZGA 3L7YA 5CNKA 4YONB 1K7XB 1U1EA 3DW1X 2D6FA 1MMFB 3H18A 2BAGA 4BO9A 4Q7EA 5JS8A 3D5QA 1H69A 2DULA 2ZRCA 3CXRA 4NCHA 4Q1AA 5IK2A 3ZU3A 1P9OA 5KOIA 3ZDBA 4F3NA 5CA0F 3HJTA 3PXUA 2O8CB 1CZHA 1DEOA 3C3EA 4N0PA 2BMWA 4KMSA 3ZWKA 2VDVE 3I2GA 5I9NA 4M2LA 3M6FA 3UUFA 4BLVA 1PSWA 2XMCA 4ZYTA 2H00A 1KYWA 4LFAB 2IP4A 1M6YA 4LUCA 1QE3A 1RXWA 2AE1A 3HEBA 5EGSA 3TRHA 4R3WA 1P9LA 1XN1A 1JI0A 1MOZA 1WOMA 1SUFA 2QR3A 2Y9PB 3OKCA 1NAIA 1ZMTA 1VIYA 4JU9A 2FUG6 1RHJA 3W6UA 5AJWA 3H0EA 3K0AB 3S5UA 2I2FA 2OBFA 2AEMA 2GLXA 4HRYA 3REGA 2X14A 1SD2A 1JLRA 1A8QA 1BE0A 1UM9B 4REMA 1PYDA 2G80A 2OLEA 3N7AA 3NH9A 3FYUB 3E27A 3N7TA 1GLGA 3B1WA 4FYJA 4CR8A 2CE7A 4B3MB 4FOOA 1JW9B 4J1TC 3CX3A 4J1TA 1KEWA 3MFQA 4GPAA 4R1LA 3VVCA 4XSVA 3JQ8B 1GTJ1 2B5VA 5BQFA 3PQ4A 5H3LA 5I47A 1PVOA 3I0ZA 1W2HA 1WMFA 3CEMA 4I8IA 4JP1A 2GZ2A 3OESA 3A6HA 3FYDA 5KNBA 3N6RA 2VWGA 2JJ2D 5I5EA 3GP8A 1IPHA 1F0NA 1E6CA 3K0HA 2O6HA 5K1ZA 1R64A 1XTZA 2LGJA 1LPBB 3A6FA 3J81A 4LS3A 3I61A 2W00A 1I80A 1ZRHA 1O7JA 2VHVA 3AZQA 1G3RA 3ZZTA 3CVOA 4XR4A 1MFZA 1SVNA 3FYCA 3N3AC 4LJAA 1PX0A 3BGVA 4B73A 1M2GA 3BF8A 2WYVA 4HTFA 4JLNA 2GTIA 2X13A 4FIZA 5ERYA 3T34A 3VDQA 3OZWA 5DTMA 3DDNA 3B13B 4WCDA 1SVKA 3HB1A 3OLWA 4IDPA 5FD8A 4ARVA 2VAWA 1QGDA 2IZ0A 1E5QA 2G8NA 3P97A 1FUEA 5EPUA 3WL3A 4HH1A 4E4YA 2G9ZA 2AKEA 2P6PA 1S02A 3HO8A 4Q05A 4LOJA 3GLIA 4FFOA 4IZOA 2HZ7A 4ZOBA 2PLRA 2G72A 1X7YB 5CK4A 1YFZA 1VPLA 1WHTA 1Z4JA 1IAQA 1ZNQO 3A1WA 5G4KB 5KCZA 2O8BB 3PGJA 3F1KA 2R6DA 1I13A 1KIMA 3C5WP 2NYRA 4Y2RA 5JIBA 1ZLXA 4ZO7A 5A7HA 3OMWA 1Y5IA 1LLCA 2FVYA 2VP3A 3MINA 3NUGA 4TSFD 2ZT6A 5P21A 1B3BA 1YL6A 3E4CA 1RWWA 4G2TA 5JPIA 4IBOA 3U56A 2XIQA 1FFGA 3DP7A 4H3VA 3COVA 2EW2A 1V96A 4CFSA 3USZA 4L5CA 3GGJA 1RD4A 4WK6A 2VTVA 1I9CA 2JI6A 4Y2TA 4AJNA 3NAQA 4ZKEA 4WNCA 4BAZA 1PT6A 3AEZA 1MNAA 2OFPA 3ROMA 2ZSFA 1NN3A 5AK5A 1N0UA 2O8FB 2B2XA 3N2GB 1KI4A 5B1DA 5LQDA 1DAKA 1NUPA 2IX3A 5LU9A 1RQ2A 2J3MA 4RACA 1MAHA 3A4VA 3L8ZA 2F67A 3H9JA 4U7HA 3HDGA 4TRRA 1CJVC 2J5QA 1DWPA 5AW8A 3LX6A 1M8GA 1GGKA 1FYXA 1YRYE 4PX5A 3W3AA 1XXHB 1YT5A 5DNCA 1QCZA 1N9ZA 1T5IA 1NF8A 3N07A 1LBSA 5ERXA 2WSBA 2IXGA 2WF7A 4WN9B 5GJWC 4ONEA 3LBYA 1WUIS 4F46A 3MYRA 3K72B 4MHOA 4DMGA 4ESEA 1PEAA 1B23P 4BVBA 2FEXA 3BMCB 1XMXA 3ZDRA 3ONVA 3L46A 3IQFA 3OE7D 1VL1A 4CL0A 1UT6A 3KVNA 4RH3A 3GAFA 1U11A 4PNHA 3TH5A 3VKUA 4CXMA 4DUZB 3C8MA 4IV8A 1FP2A 4A15A 2IIVA 2QJRA 1HDOA 4Y1RB 1J0BA 1NUHA 2EERA 3D4IA 1EP3B 4UKDA 5K8VA 5CCXA 1MH9A 3LRPA 4L9SA 4PYMA 1ODIA 3LA6A 4IQGA 4R3UC 3V2GA 4BOYA 4EIWA 1G1AA 4CKYA 3V4LA 2FG6C 4RULA 1WVGA 2C2YA 3NNDA 1E4EA 1PWHA 4NTZA 1N9GB 1Y7LA 4HBZA 1GV0A 2V54A 4YNBA 5FV7A 1EVQA 3K94A 1U9YA 3PTZA 1EESA 4ND8B 4FXPA 3CKLA 1D09A 4DA8A 4MO2A 4RMIA 3SHWA 4TVKA 3UJCA 4RKQA 3SM9A 3M1IA 1RWPA 2X3YA 1SG0A 1AQLA 5G0UA 3ZWPA 4E88A 3GJSA 4AZ3B 5GTDA 3BA6A 2BFCA 3TMYA 3NUQA 5TX7A 4QYWA 4GVPA 4NBTA 1EJ0A 2OD2A 4WXRA 3ZWBA 4TMTA 2XY4A 4BV3A 1YOVA 2AHRA 2UYCA 5TQ2B 3KKMA 1YDWA 3PQ3A 4G0XA 4FWIB 2XCQA 2F43B 4W5WA 2CK3A 3R44A 4HNUA 1XRSB 3UFXA 2JATA 3PQ6A 5FF9A 3E9MA 1UAYA 1ZD3A 3MTIA 3N2IA 5A4AA 1PLKA 2LW7A 2W6CX 3JRXA 4A6DA 4ER5A 3MUEA 2YINC 2XMRA 4PZAA 2A0YA 3OHMA 1NX6A 1VRWA 2R2AA 4IJ5A 5KMGA 4KPEC 1EK2A 4CV1A 3ENZA 1HLDA 3TNFA 1AN9A 1E62A 1HMPA 4N03A 3AHDA 4FNMA 3T61A 3PXEA 4JUAA 4PZLA 2G08A 1QRSA 2FMHA 1E3MA 3OP1A 1J2TA 4C88A 4HX5A 4X61A 3GGGA 1S3IA 2HK8A 5TVGA 1GGMA 4Y0AA 3JAWA 1E3DA 2BZGA 3I58A 3NDJA 2WTNA 1DARA 4JUCA 2VH5R 4MS3A 2OLJA 2REQB 3HB5X 2BEVA 2GCPA 2AG1A 2L82A 4AIIA 5KNCA 1H05A 1PFGA