3UOGA

Crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
341
structure length
341
Chain Sequence
MMSKWMQEWSTETVAPHDLKLAERPVPEAGEHDIIVRTLAVSLNYRDKLVLETGMGLDLAFPFVPASDMSGVVEAVGKSVTRFRPGDRVISTFAPGWLDGLRPGTGRTPAYETLGGAHPGVLSEYVVLPEGWFVAAPKSLDAAEASTLPCAGLTAWFALVEKGHLRAGDRVVVQGTGGVALFGLQIAKATGAEVIVTSSSREKLDRAFALGADHGINRLEEDWVERVYALTGDRGADHILEIAGGAGLGQSLKAVAPDGRISVIGVLEGFEVSGPVGPLLLKSPVVQGISVGHRRALEDLVGAVDRLGLKPVIDMRYKFTEVPEALAHLDRGPFGKVVIEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title Crystal structure of putative Alcohol dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
total genus 94
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uogA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3uogA01
3QWHA 4II3A 4FC6A 1EVJA 3LC1O 2O4UX 3AU9A 2JD1A 1R37A 1I3NA 2C7VA 1LRLA 3ANNA 3NYWA 4GPD1 4RPLA 3WYBA 1PQPA 2DAPA 3E48A 3SLKA 5T64A 4WLNA 3GOHA 1WNTA 2O48X 1HDRA 4J0FA 1YVEI 3VTZA 4E33A 4XR4A 3DZKA 1MXFA 3KRTA 5KWEA 2HK8A 4L8VA 4W99A 1Q0LA 5F5LA 3ZW9A 3INTA 1OBFO 1DRUA 1R4NA 2PGDA 2GERA 1E1NA 1QYDA 2X7HA 4OIMA 2ZK7A 4RVHA 4D3DA 4E12A 4QSMA 4MIEA 2JCYA 5JCJD 5GZ6A 3UFXA 4K9DA 1A7KA 3VPHA 3GEMA 3DZHA 4KMSA 2X58A 1C0PA 1XU9A 1EQ2A 1KVSA 3I52A 4OXYA 3GC6A 3VTFA 3W6ZA 1P31A 2VHVA 1YL7A 3H6KA 3ZWPA 4TVOA 5DCUA 4YT8A 5JAZA 4LVCA 3I5MA 3ZGYA 4CR6A 4J4TA 4YWJA 5L3ZA 4FPXA 3VZPA 3LYLA 4LK3A 3ZWVA 2HDHA 1O94A 3A9WA 1UZLA 2H9IA 2DQ4A 1DHRA 8ADHA 2H6EA 2P4QA 4OO3A 3CZMA 3PHHA 2VHZA 5J23A 2OMEA 1SOWA 4W9NC 3RROA 3VDQA 4XKJA 3HNPA 4IJKA 5BT9A 4IDBA 5C7IO 5JO0A 4CM8A 4RZIA 1MX3A 4HNGA 2ZCVA 1A7AA 1JDJA 4IDGA 4GGPA 4XYMA 1GPDG 1D1SA 2J3IA 4AICA 4CLDA 1EK6A 2GO1A 3JQGA 3K2BA 4Q3EA 5DOVA 1YH3A 4PZDA 5KKAA 3B1FA 4ALIA 4I9UA 5TF4A 2NQTA 3W8DA 1R4MA 3F1LA 1WZIA 3SX2A 4BO6A 3HDYA 1I24A 5DP2A 1CDOA 2X0JA 3D64A 1V0JA 2VRCA 1PWZA 3Q9NA 5A9TA 1EUZA 4R3NA 1X7GA 4RLSA 4WEQA 1ZJZA 1U8XX 3QVXA 4AL4A 4JX8A 4C4OA 3QRWA 5I8WA 1K6IA 4R5MA 1ZBQA 3X2FA 4YEDA 2WEKA 4E0BA 1MB4A 1ULUA 4WCFC 2EW8A 4E5MA 3VH1A 1Q0QA 1XU7A 2A35A 5U4QA 1JKJA 1DFIA 1NAHA 3KVOA 3L4BC 4GSLA 3ZDFA 4DGSA 1KEWA 3L07A 3JQ7A 3VKVA 2Y1EA 4NBTA 1ULSA 1RWBA 4WLFA 1W0CA 5JSFA 4AG3A 4JBHA 5BSHA 3NV9A 2WTBA 4DPLA 4KOAA 2XF8A 4KWHA 3HQ4O 1PZGA 1XSEA 2NVWA 4BO8A 1C14A 2IEBA 4RQTA 4FOSA 2E6UX 1LDEA 1V3TA 3H5AA 4WOKA 3ZWBA 1PS0A 4BL5A 2B69A 4UVGA 5IXYA 1YBMA 4E30A 5IDWA 7MDHA 5JO9A 1IHYA 3JQ8A 2GCGA 2R00A 2VHXA 3ON5A 1AGNA 1PGJA 4R9RA 1SNYA 1HYEA 2B83A 2CDAA 4TVBA 4PLWA 4ZA2A 2PKQP 4WKGA 2ZB3A 1QG6A 3CXRA 3KEOA 3W8EA 1KC1A 1AXEA 1QV6A 1YONA 5KJFA 2QYSA 1RKXA 3QY9A 3UCFA 1KVTA 4PG7A 3U9LA 4E5YA 3OJLA 3EHEA 1JVBA 2AA3A 1HE5A 2E4AA 4H7PA 3VVBA 5COQA 3KXDA 4UEKA 5L45A 2C54A 1N9GA 3LLSA 3GF4A 1BVRA 1DRWA 4U5QA 3S8MA 2PD4A 4CMAA 4RZHA 1ZEMA 5L4SA 3WGYA 5CEFA 4JK3A 2WD7A 2AHRA 2D59A 4BO2A 3RUDA 5JC8A 2HQ1A 3QW2A 4U7WA 3WIDA 3ICPA 4AJ2A 3JTMA 1ZUD1 3PPIA 4CMJA 4ZQGA 3H9UA 3AWDA 3N7UA 3DZBA 2ZJ1A 2C20A 1DIRA 2C7GA 2YDXA 2AG8A 4WGGA 4CQMA 1DO8A 2HCTA 5COBA 4NR0A 1AHHA 1DRVA 5TT0A 3OJFA 1MGOA 3RU7A 1KVRA 4B4OA 4BKPA 4ALKA 3LT2A 4TRNA 4LRSB 1XQ1A 3GAFA 2JCXA 3OJ0A 1M76A 3ZN2A 1YO6A 4JN6B 3WR5A 5ITWA 4HV4A 4YQYA 5KJ6A 1WMAA 4NG5A 1YS4A 4LSMA 4G81A 3TJRA 4OSOA 2WMDA 2BD0A 2V6GA 2YV3A 3BA1A 3E8XA 3IUPA 2VTEA 3K2EA 3Q11A 4MINA 3WOHA 4K26A 4B3IA 4XGNA 2BI7A 3ZHBA 4E5KA 5A03A 4RPKA 5L40A 1OZAA 3PEFA 4CODB 1GU7A 5LDHA 3LC7O 2YW9A 3AY6A 4DL9A 1E1LA 4I5GA 4EGFA 4NBVA 1QRRA 2IDZA 1Z7EA 2G5CA 1AUPA 1XELA 1V6AA 4OMUA 3OETA 3U49A 5KIAA 1BXZA 4EW6A 2P91A 4M54A 4O63O 4CV1A 1LUAA 2QZ9A 4KUEA 1CQIA 1Q7CA 3PVZA 2O3JA 1ZJYA 4XB2A 1LSUA 3W1VA 2Q45A 4XWYA 1LLUA 3HADA 2GF2A 3RI3A 2ZYDA 1DFHA 3Q3CA 4U6QA 2QHXA 5FEUA 1PS8A 1B0AA 1EVIA 4Q3DA 5U1PA 3U4CA 1I32A 1TEHA 3UKOA 3JQ9A 2ZB7A 3NKLA 4IJVA 4DIBA 4D0RA 3D7LA 3O4RA 3PIDA 2HAEA 4FN4A 2AQHA 4I9HA 3E5RA 4DTIA 4PLYA 2EG9A 4GGOA 2ZKLA 4CMIB 5AXAA 1V8BA 3BMNB 3PTZA 1I0ZA 4WCFA 1HTBA 4XRGA 4IIUA 3ZU2A 4BHTA 1BTOA 3JQAA 3HB4X 3GEGA 3L4BA 1B8PA 3PFWO 5G0SA 3QE3A 4J7XA 1X7DA 5BSFA 3KO8A 4ND4A 1T2CA 5JYDA 4J6FA 3HWRA 1TB4A 3HDQA 4UVHA 3HG7A 3SJ7A 5KNLA 1IYZA 4R5HA 4LCJA 3E82A 2Y1OA 3TDKA 1QLJA 3RKUA 3JYPA 2VYVD 5JAQA 4Z0HO 3PQDA 2EGHA 2GN9A 3ADPA 5JY1A 5K1SA 3H9GA 2YJZA 4FGSA 5IN5A 2GUGA 1DBVO 5JW6A 1YL6A 3UGKA 4P4GA 1YGYA 2NVUA 5T5QA 1BDMA 3OHSX 4YJDA 1DHTA 1VL0A 4R1SA 1HDYA 2XAAA 4ZRNA 2PGLA 2G1UA 4J1TA 4CPDA 7ADHA 4CM4A 3WFJA 1KETA 5T8KC 1ENOA 1WP4A 4GLOA 5C3MA 3GMDA 4KUGA 3IKTA 4CLOB 1PJSA 3DO5A 4BNUA 5EESA 4JBGA 3U62A 4BV9A 1XDWA 2UVDA 4L0QA 4PCVA 2O2YA 3ROKA 1IZ0A 2D5CA 2QRJA 4N18A 2FZEA 3ZV6A 2BKAA 1E3IA 2NVBA 3ZHZA 4MO2A 1SEPA 1FK8A 1ZEJA 4MPDA 4N54A 2E82A 1MLDA 1N1GA 1Y9EA 2HMVA 3N74A 1PGPA 4E32A 4GX1A 4PRKA 1GYQA 2X1HA 4BB6A 1EE9A 2HSDA 4CMCA 4DBZA 4JCOA 3V2HA 2WSBA 3IP3A 5ER6A 3C1AA 4F6LA 4NH4A 1M75A 5IDXA 1MG0A 3ITDA 3OM9A 3QIVA 3OH8A 3H65A 4ND2A 2W2LD 3MOGA 2DUUA 3LC2O 4G2NA 3PJGA 4UEOA 1DFGA 3UW3A 2VT3A 1PZHA 1VSUA 5FFFA 4C7JA 3VH3A 4URFA 2J5RA 3WG9A 1VL6A 1WMBA 3INGA 3PYMA 2D0IA 3OBBA 3UH1A 1ZZEA 4BB5A 2X0NA 2VUSA 4J9UE 2VZ8A 1NM5A 4YAEA 4BGEA 1I2ZA 2ZTMA 3ORFA 4XEHA 3RUIA 4R9SA 3SEFA 3OJEA 2Y05A 3D0OA 4W7IA 2A92A 2WD7B 4XGKA 4ND3A 2ZATA 4E4YA 1HDXA 4HFNA 4YB8A 4NIMA 3RUHA 3ZU3A 2HMTA 1T25A 1LRJA 4UULA 1KOLA 4ZD6A 1S6YA 2AQIA 2C5EA 3CZRA 3RQSA 4M1QA 1E7SA 1T2FA 3BMCA 4TZKA 3PQEA 4JNKA 4DBVO 1NP3A 1RJWA 1L1FA 3EDMA 9LDTA 3EK2A 2OP1A 4Q3AA 5KJEA 2HMWA 3FBGA 3GN2A 2Z1NA 5GMOA 4YJHB 1LRKA 1U28A 2POQX 4CJXA 1HEUA 3JYOA 4MVJG 5I7FA 3DHYA 4HY3A 3K96A 3S55A 3ZNNA 1YJ8A 5C5IA 1Z74A 1TT5A 3VH2A 4BNVA 2V6BA 4IUYA 2CF5A 1ENPA 3F47A 3WGQA 3CMCO 1HDOA 3K6JA 4B4UA 5BQFA 2E37A 3MOIA 2EHDA 4WNIA 1IL0A 1IZ9A 1LDYA 1VKNA 2X5OA 3E6AA 3PHGA 5IZCC 1P1KA 3TRIA 3DBHB 4GVLA 5F5NA 4AVYA 4KP7A 4E6PA 2FN7A 4CLEA 1F06A 5GZ3A 5JFOA 4M49A 3R6DA 4N5LA 2GD1O 2Q2VA 4M87A 4E13A 3ADOA 1R6DA 3COSA 3DXFA 3NAQA 3TNLA 5JY6A 1UR5A 4CR7A 3ZU4A 4BOYA 3IOYA 3FSRA 4P4NA 4IQ0A 3AUUA 1M67A 2WYVA 4EEXA 5I7EA 3BMQA 2J5KA 1IULA 3GVIA 4IM7A 1F14A 1FDUA 1CQJA 4LMPA 4OXNA 4K28A 5JPIA 1K5HA 5A02A 4EJ0A 3FR7A 3NT5A 3LF1A 2PZLA 3ZV3A 1J49A 2JKVA 4ZRMA 4XIJA 1NFRA 4RCVA 1MFZA 3QV1A 3RKRA 3C3XA 1KC3A 4Z0PA 2D8AA 2YHIA 3QHAA 1C1DB 3O38A 2A4KA 3ZWAA 2CF6A 1LDBA 1Y5MA 2UAGA 3VDRA 5TGDA 3E9NA 3GNQA 5G4KB 5I9NA 2QRLA 4D43A 3PHIA 3G17A 1F12A 2O3SA 3WNQA 4XYLA 1SZJG 4BO4A 3CKYA 4HADA 1PJ3A 1DC4A 2RCYA 2ZYGA 3GMSA 1E3WB 5EERA 1G6KA 5JYEA 1NPTO 4P22A 4H16A 4D42A 1E77A 3VH4A 3IUSA 1FDVA 1IE3A 1YB4A 3MWEB 3F5SA 2VYND 5C7OO 4UVEA 1DIGA 2F1KA 4F3YA 1RM0A 4OKNA 4ALMA 3EUWA 3TF5A 3I6QA 2JFGA 3ONDA 2X8LA 2FPGA 2PFGA 1XG5A 3PIIA 3D3EA 5F21A 3T4XA 1U3VA 3UOGA 2WM3A 3ICCA 5KTKA 1PZFA 4ITUA 5ADHA 1T1RA 4XRRA 3KSZO 3L6OO 1GPJA 3LF2A 4PG5A 3OIDA 3RUAA 3WFIA 5JDIA 2DT5A 4IDAA 4R51A 2PK3A 2DVMA 4YJFB 3O9ZA 2D4AA 1LC0A 2C2YA 4NU5A 4A27A 1EMDA 2JFHA 5BSGA 1EBUA 3CMMA 1UP6A 1G1AA 1DIBA 4EITA 1B16A 1VPDA 1ML3A 1YQGA 1CJCA 3QWBA 4AJPA 1MV8A 3I9LA 3KB6A 5FYDA 3UCXA 4CLRB 4XQEA 4JLWA 3RFVA 5GZ1A 1O9BA 2RHRA 2NV6A 4PN3A 4MP8A 3D4NA 4L4RA 3MJEA 2DKNA 4JIGA 4RDHA 4E2WA 5FWNA 4J7CA 4ZQBA 2B35A 2G17A 3U4DA 1D7OA 1ADGA 2EF1A 2GZ2A 2PGJA 1P1JA 4R54A 3WGTA 1CIVA 2JAHA 4WECA 3STHA 3UCEA 4CL3A 5CHEA 4Y8VA 1ZSYA 4N5MA 4NK4A 2OZPA 2RH8A 2PLAA 4IMPA 2ZIZA 4PGFA 1A9YA 4I08A 2C0CA 1KIFA 4TQGA 4DIOA 3A1NA 3INRA 4WJZA 4XQGA 1X13A 4E21A 1WAMA 4GKBA 3DL2A 5L7TA 3BHIA 2HLPA 3NDIA 4FW8A 1YKFA 3AI3A 1N1EA 1VJTA 5DOZA 4ZQFA 1U8FO 3W8FA 3GG2A 1Z6ZA 4LCEA 4EYEA 1GADO 2ZB8A 4TRRA 5JAIA 5A9SB 3SBOA 8LDHA 3OA2A 1DJQA 4J49A 2O7SA 2FZWA 2W2LA 3FNFA 4F45A 4J1NA 2O23A 2PKQO 5I7SA 4D3SA 2TMGA 2GN4A 2VZ0A 4TROA 4BGVA 3I23A 1W73A 4UUPA 5IZCA 1K6XA 1Q2XA 5ILGA 1E3LA 1NPDA 4RGBA 1E0DA 1ONOA 1P74A 1DC5A 2BFPA 1DLJA 1DDOA 5KOIA 4FJ1A 4CMHA 2P5UA 2AQ8A 4GX0A 1DEHA 2JJYA 1UAGA 1FJHA 4GLLA 1B7GO 2HK9A 5A5FA 3L6EA 3IC5A 4ESOA 1UXHA 1Z82A 2YQ5A 1ISIA 2Z1MA 3VPXA 2UYYA 1XYGA 3BMCB 3CIFA 2Y66A 1HT0A 1E1MA 2I65A 3EYWA 2HO5A 2OXIA 1GUZA 4NBWA 1EFKA 4Q9NA 5HA5A 2UDPA 3IS3A 3RAJA 3VHRA 3WS7A 1Y8QA 1KEUA 1M66A 1XHLA 2B5VA 3QJ5A 1Q7GA 3GNSA 4MOWA 4N5NA 5FF9A 1XWFA 3HE3A 3IJPA 4JJGA 4W6ZA 5JNLA 1WPQA 1LDMA 2ET6A 4IDCA 2LDXA 3NJ4A 1ADFA 3QQPA 3PYLA 1JKFA 1U4SA 3ETEA 4OHUA 1P1RA 1RPNA 4IDDA 4BO0A 4MP3A 4OJNA 2EEZA 4F6CA 2YUTA 3GVXA 3KV3O 4QQRA 2X4GA 1U1IA 2VRBA 4Z0TA 1G0OA 1O89A 1AHIA 3C24A 2YDYA 3S1LA 2P9GA 3DOOA 4RF5A 1NR7A 3JQEA 1PJ2A 2A94A 2O3TA 4BNZA 1PJLA 1LDGA 4IJWA 2W2KA 3K92A 2I6TA 4CLXA 4DPKA 5HRUA 1WWKA 2OORA 2Y0DA 4WCDA 1E7MA 1ENYA 3H8VA 4FB5A 4PLTA 4RO0A 1IY8A 3GAZA 4EEZA 1Y7TA 5L4NA 4OH1A 3VOSA 3PLNA 3ZWWA 3D1LA 5THKA 4DUPA 1QP8A 1I30A 1E7RA 4TKLA 4MVJM 4K1LA 5KVVA 3QA9A 4TZTA 2DBQA 1E7QA 1NQAO 2EGGA 3H9EO 4BIIA 2FSSA 3GT0A 5CEEA 1V3VA 3JQ9C 3Q1LA 4BNJA 4XQ9A 3GPDG 3JQBC 1KYQA 1TT7A 3BMOB 2X0IA 5G0WA 1YE3A 1K89A 1EVYA 1GZ3A 3DAGA 4I5DA 2EP5A 4XDYA 3WBFA 5TS3A 4GAEA 4OXKA 1ZNQO 1JU9A 3GUYA 4IMRA 4DMLA 1BW9A 1Z73A 2VT2A 3B70A 4BKUA 4YT2A 3DDNA 1I5RA 2ZYAA 3IMFA 1R0KA 2ZB4A 3D4OA 1Q0HA 4CMGA 3GUCA 1Y1PA 2GASA 2OHXA 2X0RA 3BZUA 3OECA 1GTMA 4D3FA 3K9QO 3PFFA 1VJ1A 3DTYA 2CVZA 2GR9A 1NVGA 1O5IA 3G49A 1U9JA 3L0DA 3F3SA 4Y9DA 4UEJA 1UXJA 1HDZA 2DPHA 1UDAA 1U4OA 4E31A 1SAYA 4Y6RA 1SEVA 4YBZA 3KLMX 2EV9A 4HWKA 3OQ1A 4LISA 1I8TA 1BRMA 4UVIA 2P9CA 2WE8A 3MJVA 2FMUA 4IZHA 4J3FA 4CM3A 1N7HA 3GZNA 1B3RA 1DSSG 3OIGA 4DPMA 1O8CA 3FTNA 3H2ZA 1EZ4A 1GR0A 1U3TA 2JD2A 3TOXA 3UVEA 1IPEA 2GLXA 4DC0A 1NWCA 4CUKA 4B4WA 1GEEA 1NVMB 4XYEA 1XLTA 1HLPA 4BO7A 1BXGB 4HKTA 3JD4A 4PLGA 4YCAA 1ADCA 4MKZA 3I83A 4BUCA 3PGXA 3JV7A 3WNVA 4Y6PA 4PG8A 3RC7A 9LDBA 1AE1A 3VPSA 1EVZA 3C7CB 3GVPA 1JN0A 4MVJH 3Q2KA 1I36A 3RBZA 3IP1A 4D46A 3M2PA 4O5OA 4FDAA 4HFJA 3CINA 3V8BA 1HE2A 1FMCA 5L53A 1KY4A 4MVJA 1LI4A 2FRDA 3KYCB 3MWDB 1BDBA 3PK0A 3ZI0A 1HDGO 5IN4A 1XCBA 4MIOA 4XR9A 3WMWA 1EQUA 2RBEA 4IXWA 2HK7A 4LGVA 4QEDA 4GX2A 5CDSA 3F5QA 4DIFA 1R16A 3CSDA 5AOVA 2JL1A 1SMKA 4FFMA 4RQUA 2CFCA 3KYDB 1MC4A 3F46A 4IJUA 3WMXA 1QYVA 3D3WA 2HMSA 3MTGA 5KKCA 3OEWA 3G79A 3DBRA 3P2OA 3M2TA 1MC5A 4KQXA 4IINA 2VNAA 1PJ4A 4E5NA 2VWPA 5KJ1A 2AQKA 3G0OA 4I5EA 4INAA 2C29D 4FFOA 6LDHA 4AJNA 4XA8A 3WSVA 6ADHA 5IAAA 5G2OA 1D4FA 1W6UA 2J6IA 2NWQA 3EGOA 2G76A 4LMRA 4J9VA 2Q2WA 5K6AA 4L74A 1P1IA 4MVJF 2VUUA 2HU2A 4Z9FA 2X6TA 2BI8A 2E48A 3I9KA 3NJ8A 3PHJA 1R4NB 3Q2IA 2FOIA 3W4KA 1WDLA 1C1XA 5CP8A 4U6SA 5F1KA 4AJ1A 1X14A 4QFDA 3BTUA 1LSOA 4PZEA 2VHYA 3TZKA 4IGEA 2BFAA 2VWHA 3DC2A 5CDUA 4FGWA 1P3DA 2EJWA 4QTZA 2Q4BA 2WE7A 2WYUA 5JCJA 1X0VA 3IDSA 1SPXA 5TRTA 3NUGA 4R1TA 4EI2A 4RVUA 2NU8A 1W8DA 2BELA 2I3AA 3JQBA 4BMNA 3IAHA 5TLSA 3NT2A 4OOFA 1LXCA 4EUHA 5EINA 1IHXA 1KY5A 1NX6A 3C8MA 4YJGA 1KEVA 5BNIA 1PGQA 4BNYA 3GH3A 4ZJUA 2HJSA 2QQ5A 2BGLA 1C0IA 1DC6A 1YRLA 3F6YA 4CM8B 1TVEA 2JHGA 3ZV5A 1LSSA 3U09A 4PLFA 3VC7A 4PIVA 5H82A 1QSGA 1CETA 3PZRA 5HWSA 4I8XA 5ICSA 1R66A 4B7XA 3JQGB 3FWNA 5DULA 3UAGA 4EDFA 1D8AA 3ZWCA 4CQLA 4JROA 3WICA 3MJTA 4FJ2A 3T4EA 1E1KA 2W4QA 3OQBA 1PJBA 1R4MB 1OI7A 2WWRA 4B8ZA 1I3LA 4YAJA 2V6MA 2UUOA 1XIVA 1ONPA 4RLHA 5DNAA 3ZWMA 4Z6KA 3K5PA 1H9AA 3RC2A 4BNFA 3K8ZA 1RM5A 1E5LA 1AN9A 5FI5A 3QVOA 3GGPA 5JMPA 1X1EA 1ISMA 5JBIA 4HXYA 2AEMA 2EJVA 5G0TA 1QYWA 3AU8A 1ID1A 4CM9D 3O8QA 4RV9A 4J90A 2Y1DA 3F9IA 2PD6A 1Y8RA 2DTXA 4AJJA 2Q46A 1ORRA 3AY3A 2DBVO 1PEDA 4UUOA 1ZSNA 2H5LA 3JD3A 1ENZA 3RVDA 5DP1A 1ZK1A 5A3JA 3DOCA 5TJHA 1U2GA 4O6VA 5C7LO 3WLFA 4BNGA 2AEJA 4CMKA 1OOEA 1P0FA 3I9JA 3JQ7B 3FPLA 3ZW8A 3MJSA 4QUKA 1IB6A 1LA2A 5TIIA 3TFOA 1N92A 3RBVA 1ZW1A 1B2LA 1HYHA 2Y0CA 2V65A 2YV1A 4B7UA 1NASA 3WGGA 4M55A 3G3EA 2I66A 3E9MA 1NHGA 4JJFA 3F1KA 4PLZA 3ZU5A 1I10A 4LVUA 3W6UA 3PZBA 1GAEO 1N7GA 3B1JA 3JQ8B 3PLRA 5JDIC 4NDNE 4Z9YA 2GNAA 2WDZA 3HUDA 4PRLA 1UJMA 4S3MA 5CPBA 4WEOA 1FDWA 1WDKA 3LSYA 4YRAA 4KDFA 4HUJA 4ZVVA 3ENNA 4NNJA 2OL4A 4XJTA 4ALLA 2EKQA 4J43A 4L75A 1IOLA 3K73O 4XX0A 4IBOA 1YOVA 5A9RA 3Q6IA 1GD1O 1PX0A 1A72A 3HFSA 3JYQA 1ZXLA 5JC1A 1PL8A 2BFMA 3BHJA 2Y1FA 1N9GB 4FC7A 4TMFA 5A4DA 1XGKA 4AJOA 2HRZA 3DAPA 1YDWA 2A9FA 1EDZA 2GZ3A 2EWMA 3S2EA 1H6BA 3MZ0A 5IXSA 2J3JA 2VCYA 4YQZA 2VTDA 1X1TA 3JCZA 2QX7A 3OSUA 4I5FA 2QG4A 1JWBB 4GMGA 2D1YA 2X86A 4MIYA 3BTVA 3KSDO 4CUZA 3E5MA 4BGIA 2HMUA 1T2DA 1GCOA 4D45A 1JW9B 3JQ6A 3WIEA 1E7YA 2AW5A 4CQMB 2GDZA 4JP2A 1GDHA 2JHFA 4A2CA 2PH3A 3SLGA 3FWZA 3JYNA 1T26A 3LLVA 1ZIDA 1NWHA 2FWMX 1HZJA 2PV7A 4ILKA 1SOVA 4WLVA 1PJCA 3RFTA 4CL8A 5ENDA 1PS9A 5L7WA 1LBEA 2DTDA 2PZJA 2D3TA 3S2GA 1Z45A 1J6UA 2VHWA 3JD1A 3LDHA 3H4VA 4XIYA 3RUCA 2YY7A 4HBGA 2XOXA 3JSAA 1V35A 4RPGA 2I9PA 4AJLA 3AUTA 2GGSA 3PDJA 2X5JO 2Z95A 1DIHA 4BKRA 3LZ6A 2Z5LA 4EUFA 4YDRA 4YT5A 3OICA 4KZPA 1YB1A 1NQOA 4U0KA 1BGVA 1UZMA 4J91A 4GQAA 4R01A 4YRBA 1BHSA 3S2FA 3CTMA 1HF3A 2X9VA 2Y1CA 4I9NA 1O95A 1GYRA 4DRYA 3RJ5A 3ZNPA 1GUFA 3L9XA 1MA0A 4BMSA 2ZCUA 3FI9A 1QR6A 1AXGA 2DFVA 1VSVA 3OQ6A 4R41A 3DTTA 4PZCA 1VLLA 2SCUA 3MJ4A 4RPJA 3ITKA 3ONEA 4UVDA 3ZWOA 2IEDA 2P68A 4DLLA 5ITVA 3OMLA 4J16A 2WJPA 3WJAA 4GX5A 2VN8A 3X2EA 1M2WA 1PL6A 4FFNA 2NQ8A 1WXDA 3Q9UA 1SBYA 1EE2A 1ZFNA 1RM4A 2P5YA 5TJ9A 1GYPA 2BRUA 5G4LA 3ROMA 2EP7A 3U4HA 1NHWA 4BGUA 5H83A 1HZZA 2O2SA 1K0UA 2OOSA 4IXTA 2NNLD 2PR2A 5CDGA 2WYWA 3ETGA 4Y98A 3VPFA 5EMHA 4E2ZA 1H9BA 5L51A 1JLLA 5CDTA 4N7RA 2VRCD 4NJOA 4C7KA 4WCFB 4WLEA 4IGFA 2J5QA 4RF4A 5THQA 1CWUA 1HRDA 3JQAB 3KYBA 2W98A 2BHLA 3ZNQA 5BR7A 2GYYA 3G1TA 1UAYA 4CMEC 3V1YA 2ZQYA 4P4LA 3VKUA 5A04A 3DEYX 2JAPA 2P9EA 4F46A 5ILOA 4GH5A 4Z3DA 3WGZA 3C85A 3PGJA 5TSDA 1WLYA 3L6DA 3CE6A 3FF4A 4Q39A 4ALJA 5EIOA 4R68A 1NPYA 1UXKA 4YR9A 4NPCA 3FHLA 3MEQA 2GRAA 3FTPA 3NX4A 3PDUA 5ER9A 3ZWYA 1ADBA 4DQUA 1O0SA 3RUEA 1BVUA 2NVUB 3CEAA 2VYVA 3V2GA 2BH9A 1VL8A 5JMWA 1MG5A 3HHPA 4LW8A 4BMVA 3H2SA 3RJ9A 4Z3KA 5LDGA 3CPSA 2BGMA 4CM4B 4HP8A 4ND1A 4XB1A 1ZCJA 1C0KA 3NDJA 1WDMA 2C2XA 1OC2A 4Y6SA 5I9MA 3T7CA 3E03A 3DZGA 1N2SA 3DB2A 4WUVA 1P1FA 1HYGA 3WTCA 5COAA 1LJ8A 2J3HA 5T6BA 3W4JA 1B26A 1LX6A 3AI2A 3TZQA 4BO3A 4M89A 4OL9A 2YQ4A 4CV2A 2PZMA 3AFNA 4GWGA 3PWSA 1F8GA 3BTSA 1NQTA 1ZK2A 4A10A 3NEPX 5AQ1A 1L7DA 3OIFA 2NTNA 2EERA 1ISHA 4XJSA 4YVFA 1JVSA 1B8UA 3I1JA 4JJIA 3A4VA 3GGGA 1OAAA 3NTQA 1QXSA 4YTEA 1K2WA 3PHLA 5IF3A 1SB8A 2NU9A 2PTGA 4IDFA 2FR1A 4EJMA 3I9MA 1H94A 3PJFA 2EKLA 2QIOA 4K6FA 4DLAA 4BNLA 1SB9A 1XEAA 4YA6A 2DLDA 4BO1A 1F8FA 3GLQA 1LLQA 3D5QA 1DPGA 4NK5A 3RSHA 3ETDA 1MXHA 2XXBA 1UZNA 2Q4EA 3JD2A 5MDHA 4J1QA 1LLCA 1NBOA 1UDBA 4FSHA 4M8SA 1ISJA 3G1UA 3QWIA 5A5EA 3GA0A 3FNGA 5TX7A 3AOEA 2B4RO 3KHUA 4ONEA 1GV0A 3RFXA 4R1NA 3PP8A 4FS3A 3WXBA 1H5QA 1GZ4A 2AG5A 4TRJA 3ZHXA 3KOUA 1ARZA 1T4BA 3OF2A 2P2SA 2ZJ0A 4ZQHA 4O1MA 3MTJA 4KUHA 3UICA 1PQUA 3TWOA 3WQSB 2QW8A 2VWGA 1ZVMA 1JTVA 3I4CA 5GY7A 2DBRA 3ULKA 4RVGA 1FF9A 2H63A 2CD9A 2PZKA 3DMTC 4OOEA 3P2YA 2GZ1A 1H93A 4IPTA 1TT5B 2AXQA 2NU6A 4NZ9A 3GDFA 1PQWA 5B37A 5DDIP 4BQRA 2O7QA 1RYDA 2NTJA 1TXGA 2FSVA 1JAYA 3KTDA 3GRPA 1QYXA 3IQDB 4D41A 2NLOA 1V9LA 3GZ4A 5EQDA 5KVSA 5JE8A 5AVOA 4E2XA 1HLDA 5C37A 5I9LA 1U7TA 1T2EA 4MJLA 4CM5A 3ZWNA 4XD2A 4YAGA 3E18A 2VNSA 5CFZA 3EVTA 1HE3A 3DOJA 4DQXA 1RYEA 3NT4A 4WLUA 3T7EA 5KVCA 3H5NA 4CMEA 5K6AC 1U5AA 3TQHA 3H3JA 4MKRA 4IZIA 3BMQB 1BMDA 4BV8A 3M1AA 3RASA 3CUKA 3ZCXA 5CG2A 4R16A 5EJ2A 2BMAA 3ZWXA 2ZTVA 3A14A 4YXFA 1LEHA 1DAOA 3JQAD 4DYDA 3ZNOA 3WGOA 1JQBA 2I76A 3HDJA 4W7HA 4CMIA 3BMNA 1I33A 3VVCA 4JQCA 1FXSA 4PLCA 3O26A 4RVSA 2PA3A 2YHIB 5TC4A 1U5CA 4OQYA 4UUNA 5B4TA 3I9OA 4TWRA 4FJ0A 2B36A 1T1SA 3NRCA 4GKVA 3U0BA 4DVJA 1K6JA 1HKUA 2B37A 3U3XA 4CLHA 1MP0A 5B4UA 4BO5A 1J0XO 4BNMA 2NSDA 1E5QA 1DJNA 1EEHA 1VE9A 5U9CA 3AFMA 3BTOA 5T67A 1CYDA 2Q50A 4JP3A 2CDBA 2O3QA 5JDCC 4Q3NA 1LQTA 3KBOA 4EZBA 3R3SA 1PGNA 1YBAA 4BKOA 1HETA 4XYGA 3I4FA 1VRWA 4E3ZA 5HBRA 2YYYA 3A28A 3U4IA 5HM8A 1NQ5A 4YAKA 2VOJA 2AE1A 5DF1A 3I9NA 2BLLA 3GFBA 1ZXBA 1GUYA 3AY7A 4YACA 4S1VA 5A3VA 3HB5X 3JD0A 2V6FA 3QVWA 4GWKA 3ROPA 2CZCA 4A0SA 2VYNA 3CH6A 3TZCA 1UH5A 3E1KA 1GQQA 3GEDA 2I67A 2X22A 3TSCA 3KUXA 4FIZA 3I6IA 3IKVA 1LC3A 3KZVA 2VOEA 4CUJA 2FHSA 3PXXA 1E6UA 4IY1A 3HDHA 3KSUA 1YDEA 3HN7A 3FRJA 1E7WA 3GFGA 4RL6A 3UXYA 2EIHA 5I8ZA 1D3AA 2ZQZA 1TLTA 3BIOA 4AJEA 4CLOA 4P38A 4CR8A 3FCOA 4FFLA 3IL2A 2O3UA 2VUTA 3DBVO 5IDYA 2J3KA 2Q1WA 3F4BA 3GK3A 1HSZA 4B7CA 2X23A 1NR1A 3LT4A 4RORA 2Y67A 4QECA 4CV3A 5JCXA 2DUWA 2Y0EA 2VZ9A 1HL3A 3VPGA 1VM6A 1ZSVA 4YT4A 4EBFA 1HWYA 1EFLA 1SO8A 4L73A 3ZZNA 4OQZA 1NYTA 2Q2QA 4QO8A 4BKQA 3FD8A 2IYOA 3K30A 1NTOA 3DZJA 1P0CA 1VKOA 3ABIA 5AXCA 4GBJA 1O6ZA 4L9RA 3H7AA 4FCCA 4TSKA 1NNUA 3VZRA 1T24A 4KWIA 4CM1A 3WYCA 4BS9A 1GZ6A 1NXQA 2DU8A 2QRKA 3RD5A 1JA9A 2QYTA 3ANLA 5F1OA 3EMKA 1M6WA 4IQGA 4PG4A 3WLEA 2PWZA 1PR3A 1GEGA 4MKXA 1VC2A 4KQWA 5H81A 4UUMA 4K6CA 4YPOA 5JS6A 4HFMA 2C59A 1PZEA 3A06A 2UV8A 3BAZA 2D2IA 3DMTA 4FFRA 5DBIA 1PU2A 2EKPA 4MVJI 4B4VA 3R0IA 4IIVA 3TFQA 3AM4A 1BSVA 2Q49A 3UHAA 1F0YA 3LK7A 3GHYA 2AEFA 1BXKA 3H3FA 2P4HX 3L9WA 1XQ6A 2D5AA 4LSWA 4DYVA 4QFCA 2OFPA 1IPFA 1C3VA 5HS6A 2PKRA 4EJ6A 1LNQA 1ZK4A 3BHMA 2NM0A 4GI2A 5TQVA 3HFGA 3ZH2A 4AJ4A 1EK5A 2CVOA 3D4PA 3RUFA 1A5ZA 1K3TA 1LSJA 3MJCA 4I1IA 4IDEA 3GDGA 4B3JA 3Q0EA 4YJHA 3VZQA 1P33A 4L4XA 3WQQA 4A26A 4D7AA 1KS9A 2G82A 3DHNA 5MGBA 1HSOA 2DM6A 2GSDA 3BXXA 5BNFA 1H0KA 5KJCA 4J4HA 4D44A 4CM7A 1XKQA 1ISFA 3U5TA 3UUWA 2Q1SA 1WZEA 1GY8A 1Y8QB 5IFLA 5DBFA 5ICMA 4OGWA 2VWQA 4A03A 5BNTA 3RC1A 1N5DA 5T57A 2IRWA 3GGOA 3IIEA 2C07A 2Y1GA 4H3VA 3DBHA 4MVJP 4XZ3A 3SC6A 4FD3A 3B6ZA 3JQFC 3KETA 3TN7A 1C0LA 4W9NA 1YJQA 1A9ZA 3QP9A 2YV2A 1U2DA 1A27A 3ASVA 2G0TA 4JBIA 4BO9A 3DZIA 3SXPA 4QX6A 1X0XA 3GNTA 3PWKA 4LRTB 5HTOA 4RF2A 3NGLA 4R1UA 1NAIA 4XQCA 3H9QA 2QZZA 1E92A 1Q7BA 3DAFA 1WVGA 5LCXA 5KCZA 2IXBA 1A4UA 3PQFA 1U3UA 3R3JA 5JDCA 1OC4A 4L4SA 2DBZA 2LDBA 2BF7A 3OA0A 4J7UA 4D0SA 2W2KB 4W4TA 3DBLA 2YFHA 2IYPA 3WDSA 1U7HA 4PLHA 1MUUA 3ANMA 2O4CA 1A4IA 1C1DA 2VQ3A 2PH5A 1CEQA 3GVCA 1YXMA 5G4KA 2OGUA 4Y67A 1KEPA 4GVXA 2UUPA 2PY6A 3ENKA 4MDHA 1P9LA 4ND5A 2O50A 3QLJA 3GQVA 2Q1UA 1E3WA 4R3WA 3ONFA 1VJ0A 1Y5RA 4GMFA 5A05A 3RU9A 1B15A 1PR9A 3MCVA 4P8RA 4QO7A 2BFOA 3EW7A 2B5WA 4D79A 4XCVA 3SC4A 4OKIA 2Y93A 3P5SA 3FPCA 5IZ4A 3WJ7A 2Y99A 2HRBA 5K0ZA 1DOHA 1R15A 4BNKA 4PLPA 2NTVA 1NFQA 3EC7A 4ZGWA 3FR8A 1F17A 2JCVA 3PRJA 3C7DB 1BW9B 1HE4A 1I3KA 3KM0A 3S2IA 3NTRA 5BSEA 2GPTA 3NDRA 1ZK0A 3PWZA 4BNXA 2Q1TA 2RH4A 4RDIA 2J8ZA 3KEQA 3FNHA 3L4SO 2PNFA 1I2BA 2JD0A 3B20A 4AJHA 3AM5A 2HKIA 1TA4A 1SC6A 4IS3A 3D5TA 3WWZA 5JLAA 3RIHA 4DLBA 4YJFA 2IODA 1GFSA 4JGBA 1ZMTA 2CVQA 2GN6A 4NJMA 4NHEA 1E3EA 3V5NA 4HNHA 1EBFA 3VAZA 1LTHR 4W82A 4CLRA 3RWBA 3C1OA 4BNTA 3P7MA 3L77A 3ASUA 1PWXA 3GZNB 3DONA 1OMOA 4LN1A 4ZU3A 3OEYA 2FY8A 5ES3A 2V7PA 4CMBA 4BQPA 1H6AA 1P44A 1QORA 2X5KO 2YFQA 1JKIA 3WYEA 4ZICA 2FP4A 3DQPA 5EN4A 5KVQA 1VI2A 4UREA 1P45A 1QYCA 4A7PA 1J5PA 2TMDA 1UP4A 5F3RA 1Y9AA 1PJTA 4KTVE 3NTOA 1LDNA 1UDCA 3FN4A 3QVTA 3ZHYA 1CRWG 1ZKMA 1ZK3A 4B8WA 2CSUA 1IUKA 2HUNA 3H5RA 3N58A 2OBYA 1YBVA 1KBZA 4DXHA 1PSDA 4J4BA 1R12A 4OAQA 1UXIA 3WTBA 5CPFA 1BWSA 1H2HA 2B4QA 5CDYA 1TI7A 3DZFA 4M86A 1YL5A 5EQFA 1G0NA 1NFFA 3V2UA 5A9SA 4WOJA 4YYZA 2YZ7A 3GVHA 4KTTE 1UXGA 3FNEA 2CUKA 3QWAA 4ZQEA 2CY0A 1E3SA 4NBUA 1YB5A 4RPHA 5F1PA 3OJOA 4WNCA 1LLDA 1ISGA 2CDCA 1D1TA 4WASA 3C1TA 5B1YA 4WE3A 1T2AA 3PYXA 3WQRA 3AUSA 3AW9A 2IZZA 5CG1A 1HXHA 4TRMA 3JQFA 4NFSA 4BNHA 1I3MA 4R69A 1ZMOA 4GSKA 3HSKA 2X9GA 4AJKA 2B0JA 2H1SA 3D3WB 1YWGO 1GV1A 2Q3EA 1Z7BA 3V1TC 5FI3A 4Z9XA 1DIAA 4FFPA 4DA9A 5JXWA 3WGIA 2Q99A 3AOGA 3DBRB 3TZHA 3IJRA 4HX5A 1P1HA 3DHEA 4J0EA 3EZLA 3KLPX 4RJTA 3ROQA 4NBRA 4ZN6A 1Q1NA 1B3BA 3EZYA 3P19A 4J2HA 5IJZA 2NUAA 2ILTA 3F4LA 2XPCA 3DFZA 3LT0A 4DC1A 4DQVA 4BNIA 1HDCA 3AOEC 3WB9A 3TOZA 3GRKA 4GL4A 5HS4A 5DBGA 2E49A 5DT9A 5IG2A 2R6JA 1NVTA 2OO5A 1I01A 3EAGA 3AUAA 3EVNA 1C1XB 3VZSA 5CAEA 2GN8A 4B3HA 3FBTA 3LQFA 3OP4A 3WGHA 3ST7A 3LVFO 4H15A 3UN1A 1W4ZA 1DB3A 1U3WA 1E6WA 1UUFA 3C7AA 2HJRA 2I3GA 4G65A 2ZTUA 3W4IA 4PVCA 5ENVA 5TT1A 4L76A 4UAGA 2NU7A 2ZTLA 5A06A 3TPCA 2JFFA 4IQ8A 3M1LA 4RVDA 1PL7A 3JYLA 2FR0A 1H6DA 2AMFA 1BG6A 1EUCA 1T4DA 3QVSA 4U8GA 5DN9A 1SCUA 5K9ZA 2I5PO 3RBXA 1FDTA 2CNBA 2C82A 2CMDA 3SVTA 4YJGB 1X15A 4PLVA 3M6IA 3HJAA 3DBLB 3DWFA 5L7YA 1QLHA 2X9NA 1ONNA 3WBBA 3NGXA 2C5AA 4Q3BA 1JAXA 2NACA 4QXMA 3GPIA 4CQLB 2RIRA 1Z75A 1DXYA 1FDSA 1OFGA 2FR8A 3BMOA 5EL0A 5DCWA 3V1UA 3GR6A 3UF0A 1GCUA 1PTJA 5G0UA 2BGKA 4RF3A 5LC1A 3PJEA 1QV7A 1S7CA 2OUIA 4A73A 5JAMA 1RM3A 1MFPA 4IS2A 1PJQA 3EY4A 3JQCA 5T8KA 2RAFA 4BVAA 1E6EA 5DZSA 1I2CA 4XGIA 2R2GA 1DLIA 3WWYA 2OBNA 3DR3A 2W90A 4QT0A 4CV0A 1KERA 4O59O 4RVFA 2FPIA 1P77A 4J1SA 1XR3A 3O8QB 4DMMA 1JWAB 2Y68A 4Q3CA 1Y8RB 4EUEA 1X7HA 5AXBA 4JXKA 4YRDA 1LU9A 5I7VA 1PIWA 4ZHSA 1XA0A 2OP0A 3OFSA 1KVQA 4CM9A 5B4VA 4XDZA 1LQUA 1QKIA 4ID9A 3JQDA 2IE0A 1R0LA 5AXDA 3PJDA 1YQDA 4PFJA 3RCBA 4NI5A 3AI1A 4OSPA 4PG6A 2AE2A 5L9AA 3H9JA 4B79A 1A71A 4WLOA 4NU6A 4MP6A 1CERA 1PGOA 2NADA 4FBGA 4NJMB 1ZO8A 5AYVA 4AFNA 4BNNA 1H2BA 3TL3A 3QSGA 3RC9A 3HN2A 3AM3A 1J4AA 4NQZA 3AK4A 5L4LA 4II2A 4TKMA 5CEJA 1GQ2A 4WPGA 4ROSA 4NMHA 3GN1A 1V3UA 1M6HA 2YHUA 5L95A 3GG9A 1DAPA 5EPOA 1BXGA 1YQXA 4PVDA 4NFYA 4FQ8A 4XYBA 4CM6A 2B4TO 4DREA 5B12A 1L7EA 1CF2O 2IZ1A 3WX0A 3TZ6A 2WD8A 3TL2A 1N8KA 1Y6JA 4BNWA 4OYRA 2DFDA 4J2OA 1EDOA 3O03A 4E2YA 2DPGA 3GDOA 4YAIA 4MVJE 4MVJD 1GQYA 1B8VA 2F00A 3DFUA 3E9QA 4AJIA 1YOVB 4CQMD 3GHHA 4NFHA 2O3RA 2EW2A 4ALNA 2DTEA 3DMYA 4A5OA 1H6CA 2PD3A 3K31A 4FR5A 3KYCA 4HFRA 1E3JA 4U0JA 2IZ0A 3B1KA 2R00C 3GY0A 2W8ZA 5TNXA 3BYZA 2XXJA 5IDQA 5A1TA 1EUDA 1WW8A 2EXXA 2FPPA 4OM8A 3AJRA 4DWVA 2I99A 3QWFA 3LT1A 4R4JA 5DCYA 3HZZA 1R0SA 2IXAA 3R1IA 1B14A 1UP7A 4KDEA 1Y81A 4FOOA 2DC1A 3LU1A 4WK6A 1QMGA 1ZH8A 5G0VA 2RHCA 3I3OA 3PI7A 4E5PA 3WSWA 3KYDA 3ZV4A 4G5HA 1GL3A 1KVUA 4O0LA 1DC3A 4X54A 3SJUA
chains in the Genus database with same CATH superfamily
1NY5A 1FXUA 3LC1O 1H8ED 4P7FA 2V55B 3RRMA 5BRAA 4GPAA 3NAZA 1FTGA 1MNQA 2D5LA 3KC2A 1JDVA 3QYPA 2JD1A 1CS0B 2PQ0A 1R37A 3R20A 2QM3A 4ZEVA 1DEKA 4JV5B 3BXEA 3NYWA 3WYBA 4GPD1 4B3BA 2C4KA 5DX1A 1PQPA 2DAPA 3TZEA 1CT9A 3HXOA 4D4LA 4WLNA 3TFWA 2H4JA 3DMRA 521PA 1U80A 1LLFA 2ZRQA 4ARBA 1G63A 5ALSA 1HDRA 3SX4A 1VLHA 5ECDA 4GKJB 3EOBI 4E33A 4KHPB 1QO7A 4BJ5A 1J9EA 2EU8A 1ZM3A 1KYIA 3M5DA 5EJGA 4YRPA 3M3DA 2IY9A 1EUYA 5F5LA 1N34B 5IBQA 4Q3KA 4L22A 1DRUA 3NATA 2UYOA 5AHKA 3NBMA 3ZS8A 3O90A 1OLUA 4DUGD 2PIAA 3T9AA 1M1YB 4Q03A 4QVIA 2I33A 4JD5A 4OB7A 3SQDA 1F3OA 3UFXA 3GJ7A 4K9DA 3S99A 3QG1A 1W4LA 3DZHA 1XZDA 5BXQC 1EQ2A 3I52A 2JZNA 4ZTUB 1T2VA 2PFSA 3SZLA 5G41A 5KWJA 2O7VA 2PKXA 4TVOA 5DCUA 5JAZA 1DEOA 5DV9A 5TGZA 4CEIA 4B3GA 3WLMA 1K75A 1PHRA 3B89A 4YWJA 2J3EA 3B8HA 3FNBA 1PVOA 1P7ZA 1LVGA 4FPXA 3FM9A 3RSSA 2NPFA 2XSZD 4QDTA 1Y89A 3GJTA 3HLTA 3PGKA 2BEKA 5JAIA 1XMJA 2HNBA 3EZ9A 1T3TA 3F96A 3QFRA 2XE7A 4Q1AA 3RV3A 1T0PA 5GTDA 1E8NA 1PHPA 4HDMB 1L5HA 2O1WA 1LFDB 3ABQB 2FX3A 2RC5A 3STVA 5J23A 3GEBA 2OMEA 1N5JA 4KGXA 1ZJWA 2QJRA 4M1EA 4NRDA 3WGLA 4IDBA 1TQ8A 4WH0A 2WBLC 4DJ5X 3PUKA 3RIXA 2EZTA 3A6FA 1A7AA 4IXDA 3QE9Y 4TLMB 3NG1A 4RU1A 3BD6A 4XYMA 1D1SA 1Z6GA 3VU9A 3T95A 1WW2A 3MWJA 3IXQA 2FP3A 3K2BA 4D99A 4G1CA 2NN3C 4Q3EA 4Z0NA 3U0VA 4BCBA 3KVVA 4PZDA 4S1OA 2JVIA 3W6PA 3LM8A 4Q02A 1H4SA 3HUTA 2X9LA 4HATA 3A1TA 4I9UA 4O4LF 5JV5A 4AX4A 3SX2A 2WZDA 4CKEA 5J47A 4GKKB 3K1JA 3W5CA 1X77A 3VMFA 4HBZA 1R6VA 1I24A 1AK1A 1S2NA 4ZOAA 3LUHA 1MIOA 1HGXA 1ZD2P 4R3NA 4RLSA 4WEQA 1UM9B 4F84A 2XCTB 3A1FA 1RAFA 2ZT8A 1ULHA 3QVXA 4J3NA 4JX8A 1XMIA 2YCBA 2O2JA 4PQRA 4EMUA 1T5SA 5I8WA 5LUAA 3GWGA 4GYYA 4HQKA 1LGYA 3X2FA 4NJEB 1A5TA 3VOBA 2FFJA 2VHJA 3AFIA 1UM8A 1ULUA 3X1KA 3KZMA 4M0FA 2PM8A 3VH1A 1A9TA 3Q9SA 3SU8A 5U4QA 3V7WA 3IURA 2IIPA 4ZOLB 5D84A 1T9DA 3UKJA 5EJ5A 5JJ5A 3IELA 3U1BA 2QRMA 3G2IA 3ZZTA 4DGSA 5IJ9B 1TVKA 1BA3A 3L07A 2GETA 2WTAA 3H3XA 3JQ7A 1ULSA 5HCIA 1Q19A 3PNVA 1Z13A 4WLFA 4JLMA 3UUEA 3IAAA 4RHXA 4DNQA 1XA4A 4KOAA 1FFYA 1ZS9A 1TM3E 3M34A 4GE3A 4RJJA 2NVWA 4QGHA 5ANRB 5LXTB 2VBIA 2JBAB 1FTNA 5AOBA 3SM9A 1D4ZA 1VQ1A 1KE2A 5AM3A 3H5AA 5B2ZA 2W9XA 3N2EA 4WOKA 4EHJA 3D3KA 3LQ2A 4E30A 5IDWA 3FOZA 7MDHA 5JO9A 2QBYB 1JGTA 1AGNA 1PGJA 2Z3ZA 5A4KA 5WRFA 4WI1A 1SNYA 1G66A 3HYCA 5CR9A 4TVBA 4PLWA 1XF9A 2IDJA 2QQ0A 4LBZA 5JIBA 1KJZA 4WKGA 2HF2A 3RVQA 2X1MA 2D1FA 3SZUA 1JEDA 3CXRA 3C5HA 4MYRA 3H1EA 4LYFA 3DLPX 1KC1A 1AXEA 1QV6A 1ULZA 3E81A 3OZTA 4GZ3A 3FOEC 4ZREA 2QMZA 3J80A 2H2AA 4JQSA 2A1TS 1UBSB 1CEYA 3QY9A 2BVNA 1JVBA 4XUGB 2EBWA 4TUYB 4OI1A 2GCEA 4H7PA 2JCSA 1M5TA 1YJXA 2A1UB 3CQ9A 2XKBA 3B51X 3KXDA 5LP6C 1CIPA 1WTAA 3CLSC 3LY8A 2E4UA 2WAAA 2C54A 1N9GA 4IVPA 2JIPA 3ZY3A 3ETCA 1LI5A 1R0CA 2D6FA 3VYRB 4I50F 2PD4A 4CMAA 4RZHA 1EJ6A 1L5MA 2YXNA 1E61A 5L4SA 2V8OA 1NDUA 5CDFA 2ZRLA 1R8QA 1QPGA 2AHRA 2D59A 1OLSA 3E9RA 4V1CB 3I8XA 2J41A 4KQCA 3QW2A 3TLAA 2PYZA 5CBKA 3EVAA 2H48A 2D2XA 3KKKA 3TEMA 2ZTSA 4WT7A 4IJ6A 3QUBA 5K2MA 2PS3A 4CMJA 3H9UA 3AWDA 1Z08A 3N7UA 2JAQA 3DZBA 4LX8A 1BMQA 1DIRA 2C7GA 2YDXA 3DJFA 4CQMA 4DLTA 1I1QB 2YXPX 4J0KA 1OBHA 4H0CA 3FNQA 2VP9A 1QGYA 4C21A 4GICA 4RDXA 1QHHB 3B9PA 4B4OA 4FFVA 4BKPA 2PSHA 3LT2A 4BLPA 4CWAA 2KS6A 1T8RA 3TOCA 1VCMA 4LJ4A 4G0PA 5BR8B 1M76A 3ZN2A 2MSDB 5HFAA 2SBTA 4JN6B 1I4DD 2QRVB 1ZM2A 2VF2A 2Z8YM 4JBWA 4G3XA 4NZYA 4UHFA 1RKBA 1CS4C 4HV4A 4DS3A 5IK2D 3CO5A 3NHBA 1PFQA 5KJ6A 4NBSA 1YD7A 4ETWA 1YF3A 4NG5A 5D3KA 1YS4A 1XKLA 2PXCA 2YBEA 3AEKB 3G89A 3QUSA 1MMFB 5AK3A 2O5RA 1JEQB 1E5XA 4OMDA 4AYXA 4B43A 4ECEA 5TMPA 5L40A 4XOUA 4RWEA 1OZAA 1OHHD 2XNJA 3PEFA 2OLKA 1GU7A 1NUAA 1I9GA 1U3CA 1GG5A 3HA3A 3AFGA 3W78A 4X8LA 5JJBA 1X3LA 3ZYZA 4NBVA 1KR2A 2PUJA 1JIUA 1Z7EA 1P0IA 1ZINA 1SCAA 2CBZA 4GR9A 4P80A 1V6AA 1NQXA 1ZIPA 3M5CA 3DOIA 4PICA 4OHMA 1BXZA 5H16A 1N0WA 3L8GA 3ZLVA 1Y3CE 1R8SA 1LD3A 1EIZA 3K6KA 3PGA1 3HBMA 3QOFA 4Q3OA 3K32A 4M53A 5FRDA 2OUKA 2WJZB 1Q7CA 1E4OA 4M0UA 3IBGA 4MARA 1VIVA 2MT9A 2O3JA 4GOLD 1GN9A 3FF1A 3C7KA 3KWFA 4EGCB 3TVTA 3NHAA 1R10A 4O4LB 5BUCA 3HADA 1VYVA 3FCAA 3B48A 4HDSA 3RI3A 3ROTA 2ZFUA 1VP3A 3BJMA 3Q3CA 1IK4A 1JDBC 3H8JA 1OWMA 5FEUA 4JLOA 1B0AA 5EXDA 3TR6A 2J46A 1I32A 5EUBA 4OUDA 3UKOA 3JQ9A 2ZB7A 4IJVA 3IV6A 4DIBA 2W6IA 2PMWB 2CFIA 1NKVA 2JGKA 3DT8A 1SQ6A 3DDOA 5ABPA 1AV6A 3WLQA 3RVKA 4H27A 4I1PA 2C8VA 3JATB 4W5OA 2XBUA 4J03A 2WILA 1UC4B 3FPSA 1EFHA 3WB0A 5HDBB 3LX6A 3URKA 1UWCA 3KR9A 3I42A 5JCOC 1P5ZB 4CMIB 1GL9B 5AXAA 3A9SA 3PTZA 1I0ZA 4WCFA 3ISVA 1KZHA 2ZRCA 1H2FA 3KCQA 3S8EA 3GJXC 4BHTA 1WXXA 4Z49A 1DU4A 2XNDA 4B3TB 1VJGA 2XYHA 1Z4KA 3P4UA 1WOMA 4LPSA 3IPAA 3PDHA 2R9VA 4JVSB 1VXOA 1JIVA 2Y6VA 3BCSA 3JARA 3K9GA 2EC5A 3QE3A 1DP4A 3LLUA 4J6FA 4LDNA 3H11B 4M0CA 1UPAA 4LRYA 3Q9LA 1J8MF 2VXYA 1HFEL 2XWSA 3AKCA 3SN6A 1TB4A 4YGYA 4UVHA 3HG7A 4KAXA 5BOSB 1E2DA 1J8FA 1E3TA 2VJMB 5B2EA 2EFDB 2XE4A 2FE1A 1G7TA 1SJ9A 2G9RA 4LCJA 1AZWA 3TDKA 1NKSA 3JYPA 4FE7A 4LHSA 4EI8A 5JFGA 1RZVA 3OZSA 4Z0HO 4HSGA 4HYYA 5ALLA 1WSBA 2O0HA 5K1SA 2YJZA 2I7TA 1EFVA 2GUGA 4JOCA 4U7PB 4BQIA 2HNKA 3AYZB 3C5WP 4QVGA 2CXHA 1C81A 2VTBB 2XKJE 1XP5A 3WGKA 4G5OA 2BGGA 4D81A 3V8MA 3BRSA 3DFIA 1ESZA 1DJLA 4R1SA 3TTVA 1HDYA 4ZRNA 2PGLA 2XYRA 1YRWA 3NBUA 3WNDA 4CPDA 1Z0SA 4CIBA 4IFIA 2Y27A 3UHJA 5CLHA 1DOZA 7ADHA 4PXAA 1XX6A 4GRIA 5F9MA 4CM4A 1KO5A 4MUGA 2ZBQA 1XK7A 4GLOA 1WP4A 1KOGA 2JLRA 3FJ1A 4ZTZB 2VBCA 4GYWA 3G9UA 3O9MA 4PSCA 3FRHA 3SDSA 4JI3B 4LI3X 4DM4A 3LXXA 4Z7NB 3BUSA 4UBJA 2IUSA 2P3OA 3FA2A 4I50B 1SVWA 1SR8A 2XMCA 3F6CA 4JBGA 4ZVNA 1XDWA 3OE5A 1YHNA 1XVAA 2PLWA 4MRMB 2O2YA 2F62A 1TLLA 1NOJA 4MVCA 1IZ0A 2G5PA 2I2AA 1Y1TA 5JQGA 4XAQA 4N18A 4PX9A 1RI1A 2BKAA 2PS9A 1IBRA 3B52X 4MO2A 4MUAA 3QY0A 1ZEJA 4N54A 2DHQA 2F9FA 1N1GA 2Z9CA 2V54A 4R98A 3GZTB 2Q0XA 4LX0A 4PRKA 4CW7A 3SG0A 2HSDA 4CMCA 3FRIA 2BZSA 2O5VA 1X87A 4GLJA 3V2HA 2Z6AA 2WSBA 4F6LA 4HC4A 4YXWD 1M75A 3ITDA 5C18A 5HRCA 4P3KA 3WLOA 3H65A 4AG5A 4Q9DA 2NV0A 2W2LD 4Z9AA 3NNDA 4QRIA 2QNIA 3LC2O 4G2NA 1QG2A 1DFGA 2D0PB 4DV4B 3D1VA 4ZAVA 4PINA 1CUZA 1WD7A 1YDFA 2J0EA 2VT3A 5FFFA 4AYTA 1S02A 3W6OA 4C7JA 5ADVA 2IXTA 5E6SB 3U3OA 2JGAA 3VAYA 1JRLA 1VPWA 2O0JA 3U3ZA 3OBBA 2FW8A 3UH1A 3BORA 2DUMA 2QF7A 3O2SB 4MQLA 5FR1A 5LP6F 2VZ8A 3I1YA 3TLZA 3G2HA 4OFZA 4YAEA 2D54A 1WHSA 5LQRA 3OZDA 4RKEA 1L1RA 3ORFA 1JA0A 3IT0A 4XEHA 3SEFA 3HL4A 2XEDA 3QTLA 2A92A 2L2QA 3AZQA 4XGKA 5K8TA 1UKAA 1ZD1A 1HDXA 2UU9B 3RUHA 4NIMA 2D4HA 3LZDA 3ZU3A 4UAUA 3DZ8A 1V7PC 2HMTA 1ACJA 3E7WA 2ZBEA 3EISA 4GBGA 1TM4E 4MV5A 4KEAA 2A3RA 3VPAA 3R9WA 3SJZA 1KZYC 2XHEA 1Q0TA 3RAFC 1K4KA 3RQSA 4IMIB 4RGYA 1E7SA 3R0VA 1P0PA 5CD1A 3M5WA 1QO0A 4YMTA 1R6BX 1ESMA 2AFIB 4LNUB 3UW1A 2OQRA 9LDTA 3FFAA 4GZ6A 1H0RA 4FX2A 4EHHA 4TTJA 2AVNA 5EKTA 1KJIA 2WVJA 1P1BA 2POQX 4UJ3A 1HEUA 3QNWA 4MVJG 3R9KA 3DHYA 4HY3A 2XMZA 5JZBA 2Q27A 4EG1A 3N8KA 4IUYA 1ENPA 3DMPA 1PUXA 1I7LA 3I9V6 3QPWA 3AL0C 3Q3JB 4BP1A 4OPMA 2PL9A 5EJ6A 3DT9A 5E4YA 2UUAB 5AKIA 5FEMA 3K5WA 3EIQA 3MOIA 3ZY2A 1IZ9A 2WWVD 1NR5A 2VF8A 2CVHA 1OIVA 1VDMA 3DBHB 2ZBVA 4Z4HA 2F3PA 4KP7A 4E6PA 2FN7A 1F06A 2I80A 2VC2B 4M49A 4N6GA 2WKRA 1RR6A 4FWBA 4CT5A 3BSFA 1P0QA 2H57A 4HJXA 1ADJA 4JQYA 3EFOB 4KQKA 4RHTA 2WNHA 4EY7A 3HBJA 5EHZA 3OX1A 3DXFA 1GNVA 1M34E 1G8FA 3ZDEA 4TSRA 5PGMA 5DLEA 3UT0A 1FRVA 2E2WA 1AF7A 3VR4A 4CR7A 5CLJA 4Q1EA 5F35A 4P4NA 4EVSA 3AINA 3KDSE 4IQ0A 3AUUA 5AJYA 1K7CA 1ID8A 2ST1A 1Y63A 4IM7A 2FN9A 3PQCA 3QW4B 4O1IA 1F14A 1KO7A 2G0NA 3UB2A 4OXNA 1T13A 1PFYA 2A1TR 2GBLC 5JPIA 1FEZA 4PYRA 3JQPA 2F8SA 3NT5A 2WTXA 2OT3B 4HLNA 2ONZA 4ZMSA 1KDPA 2JKVA 4R40A 3AR9A 1NFRA 2JLZA 4BVGA 4RCVA 1HKHA 3QV1A 1JQJC 3WLIA 5AESA 1KSHA 1S89A 3AVTA 3A4YA 3BJRA 3C3XA 1P19A 2R6GA 4PIPA 4Z4CA 2EHJA 4OXIA 4C30A 4HUTA 1XMQB 4BU0A 2WD9A 1YTLA 5DN6A 3OCWA 2Q4OA 1Y5MA 3R3YA 4DCJA 4WXHA 1VG1A 2WYIA 1MENA 2QRLA 2FSFA 1F20A 1R5OA 2QN7A 3AG5A 1NULA 3PHIA 4EB3A 2YRXA 1OFVA 1V2GA 3G17A 4MR7B 3TDNA 1OXTA 1IDOA 2OGSA 4KQ6A 2QX4A 1Z4PX 4HADA 3TIGA 5DJ5A 1QIFA 4HGRA 2ZYGA 2FMTA 1SGWA 2O8EB 1E3WB 3PKZA 3ZU6A 3N76A 1G6KA 1HE1C 4JC5A 4NOKA 1E9RA 5M2QA 1FFHA 3F5DA 3G9TA 4D42A 3MAJA 4Q19A 1E77A 3LUBA 1B43A 1N2CB 4Q4DA 3DDZX 3BFVA 3I30X 2SNIE 3NYIA 2P5SA 2XQIA 2XUDA 1UJ5A 3VV2A 2FPLA 2JFVA 3KR2A 2VYND 3LJKA 2IUUA 2CYAA 4F91B 2ALJA 4HVCA 4KXYA 3PEVA 4RUKA 3TW6A 5GIPE 1A2KC 1FYFA 2OHHA 4OKNA 5AICA 1AGRA 1CEXA 5HKKD 1EIWA 3SBEA 2A1IA 1XRJA 3KLOA 2JW5A 2O52A 3EQ2A 3NUQA 3DPSA 1E4YA 2BUCA 3WKAA 1J70A 3D3EA 5F21A 1U3VA 3KTFA 3WAKA 2WM3A 4DAOA 3H1AA 3OEEA 5CIQA 5CXQA 4DHWA 1WG8A 3B2EA 3ZHUA 2I8AA 3D0QA 1U8YA 1T1RA 1WCWA 2YC4C 3BWMA 4JR0A 4XRRA 5AK4A 5ADHA 1GPJA 3ESZA 3B9RA 4J8PA 3QXXA 5JDIA 2DT5A 1PT6A 3REGA 3CT6A 4F86A 3ZDRA 1W49A 1JPUA 4I1VA 3S1AB 1IQUA 2D74A 2QE7D 4TLAA 3O9ZA 4LGMA 2VS1A 2D4AA 4BPRA 2ZJBA 5C4IA 4KXLA 1I7QB 2RGEA 1D2HA 2C2YA 3AFOA 2RH9B 4A27A 4BEBA 1EMDA 5BSGA 4PHTA 4D8XA 1U9ZA 3BE6A 3CMMA 3FSEA 3V4RA 1I3CA 3AESB 4LY3A 1DIBA 1US8B 2I4OA 5FNVA 2GH1A 5BRJA 4AJPA 4E1VA 1MV8A 5DWDA 5FDFA 3I9LA 3CKMA 4Q9KA 4IDPA 5FYDA 3P9CA 2GRUA 1FDIA 5DSXA 3NNSA 5GZ1A 1ZWKA 3I8OA 2RG1A 1RXWA 5FYQA 3IAXA 5IJWA 1XCMA 3D4NA 4BJ1A 3MJEA 4KBFA 4EUSA 2Y1LA 5FWNA 1AUOA 1FYXA 3KJHA 3U4DA 2BONA 3K1TA 2EF1A 1BYUA 3A1DA 3SZMA 2C58A 2FP4B 2PGJA 1P2DA 1G9TA 1C3XA 3FWYA 3MBKA 1G98A 1QJCA 2EP8A 2JAHA 4LCBA 4PPQA 3UCEA 5KQLA 5EG5A 1J23A 2NG1A 4EFLA 3IDZA 4EYSA 1AB6A 1N5IA 2QUJA 4B2PA 4NZMA 1OI2A 3DKKA 4Y3UA 3F6EX 2HXSA 3A1NA 4NU0A 4YWHA 1YB2A 2ZSHA 3GP3A 2C3YA 4KNYA 4UAJA 1P7VA 3NDIA 4QDKA 3ZWQA 3RGWS 3JWHA 4OHZA 4MW1A 1ORDA 4AUEA 3W8FA 3GG2A 1Z6ZA 3V46A 1OW3B 1RC0A 2DWOA 4IRXA 4TRRA 3T15A 1Q1ZA 4OBBA 2XBMA 3PICA 5GV8A 3HR4A 1XQVA 2VJOA 3A1SA 3OA2A 8LDHA 1Z0DA 1XLUA 1ZH0A 3FNFA 1L4LA 3IPCA 1XZBA 3WE7A 5BNZA 2QR2A 3C43A 2O23A 3R3XA 4L4UA 4C4YA 5AKKA 4EPWA 2GA9A 4F3CA 3MAAC 1JALA 2OV2A 3PC2A 4ZCRA 3PUYA 4R2IA 3U1VA 5LL6P 1DWUA 5B3KA 4TROA 1IDN1 4US0R 2AYYA 3E3AA 2CUNA 1IU9A 3HJGA 1E3LA 3H87A 4DBLE 1KQGA 2NX2A 1O97D 3HXQA 1ONOA 1P74A 1SA0B 1DC5A 1DLJA 3QHPA 5EP2A 3VYUB 3W0LB 4KRXA 4L51A 4MUFA 2CNLA 1N3IA 1X92A 2AQ8A 3LCJA 1MORA 1J2TA 2XOEA 1SXJD 4RV5A 1UAGA 2QMQA 4TYNA 1I4LD 2NXEA 1PKXA 5CYGA 5H70A 3EGXA 3P4XA 1OBOA 2UYYA 4X9XA 1UMCA 3CIFA 4C01A 1E1MA 5LNK1 3EYWA 1U81A 2QN8A 4PC6A 1O1YA 4UTXA 2F8LA 2OXIA 4BVFA 5KQPA 4CEJA 4Q9NA 2YZMA 3COVA 1R1DA 1KIMA 2UDPA 3RAJA 3LGAA 3VHRA 2JPDA 3L1UA 3VR5D 1GTL1 1NU8A 4O2AA 4KIWA 2B5VA 3QX9A 3HKEA 3FYUB 5DBOA 3LRTA 5KYVA 5JBQA 3HE3A 4JJGA 1JDBB 3ZCTA 5MN5A 2ET6A 2OCDA 1JEYA 3VNSA 3NJ4A 3D2BA 3H5VA 3QQPA 5GGXA 1DT5A 3GNLA 1JKFA 4FFWA 5HPYB 4IOJA 4XSVA 1A1VA 5GOTA 3EMVA 5CB8A 1ZKDA 2EEZA 1HY3A 2GFHA 3GVXA 2H4YA 5CNIA 3KV3O 4DXAA 5ESDA 4HVTA 1E3DA 4K05A 1U1IA 2BFEB 2BLNA 1H8HA 2ZAIA 3O3MB 4XEUA 2VRBA 4MCAA 3UGTA 4CQJA 1G0OA 2A5FA 2YFKA 4P7GA 1A96A 2JI8A 3U7EB 1SM4A 1EWYA 5IRCD 1XHFA 2WMNB 2ZE8A 3LUAA 3TX6A 1PJZA 5FI1B 1G5HA 4IVNA 3WZ2A 3RFFA 5KUTA 1PJ2A 3VKHA 1QHXA 1DZIA 1H1LB 4AN0A 5JH7F 2O3TA 4ZYUA 4BNZA 1JHDA 3OT1A 1G8JA 4JIMA 2ISSD 2QW1A 1N5RA 3RWMB 2GCOA 4HTFA 1MABB 2JATA 4NQRA 1AKMA 2XCQA 2Y0DA 2EWVA 3N8NA 1KAMA 1UCFA 3A4MA 4PGAA 4WXMA 3E5NA 3DQQA 5CYFA 4F3TA 2EJCA 2PU7A 1ENYA 1J1ZA 3UC5A 3EB9A 4GI7A 1AC5A 4MGYR 4US2R 3GAZA 1FZQA 1ZQ1A 3HUUA 3HCWA 3KOXA 3UK6A 3VOSA 5L4NA 5HE8A 3SVLA 3IIKA 3O2QB 4MCIA 3ZWWA 5I7RA 1MU0A 4I1SA 3BM5A 4C1NA 4DUPA 1QP8A 1I30A 4HB0A 4Z9BA 1JIIA 4P83A 3GUZA 4TZTA 5EE0A 4EX7A 3IE1A 1GSAA 2AOUA 4QGGA 2L18A 3GX1A 3L01A 3O47A 1Z5GA 3A0RB 4MCJA 3REOA 5I01A 2MINA 4AIIA 3OLQA 4NTZA 2HEIA 5DSZA 3UO8B 1D8TA 1RRGA 1DUSA 1BCSA 1NT4A 1QGAA 3IOCA 4TTPA 3JQBC 4L6IA 5CX1B 3VHXB 1VLVA 5IWCA 2QPAA 5D5PA 1QHIA 3RLIA 1K89A 1EVYA 3BC1A 5UKDA 3DAGA 4XDYA 3Q3EA 1Q3KA 2CHEA 2ZBRA 5HDQA 4TV8F 1XZHA 1TX4B 2GFQA 2RBKA 3KJEA 4GAEA 3NWEA 1UBTS 2HA3A 4DLXA 2FUCA 2HCJB 3B70A 4IR7A 1T6YA 1Y80A 1I5RA 4KAJA 1KFEB 4LE1A 4UZSA 5FJIA 3HDVA 3UWPA 2ZB4A 1D6MA 3DC7A 1QU2A 1I2AA 3G2QA 1KIAA 3CNHA 3LHKA 3K70C 4W1SA 2VKQA 1Y1PA 1PD1A 3FKQA 3OECA 3EBPA 3IOEA 3MUEA 2BZ0A 3P9PA 3TEJA 1G19A 1O5IA 3G49A 1U9JA 2FPIB 2Y1XA 3L0DA 4HWRA 4ZAFA 4ZEMA 3IBSA 3U4MA 5KYNA 3ZHTA 1OB5A 1HDZA 3OOJA 8MHTA 4E31A 3E84A 4FINA 4N49A 1N5OX 5FPKA 1CUCA 1FYVA 4EVRA 5JJCA 2V45A 3GGJA 3B3AA 1MEOA 4JQOA 5BO5A 2Z9BA 4A15A 4NP6A 1OREA 2FTKE 4LISA 5K3OA 3NHKA 1AQYA 1BRMA 3QKTA 2P9CA 2WE8A 4MR8A 3WLJA 1SUFA 3FPGA 2BGNA 3RYIA 1RWWA 4CT4B 5H80A 1IXYA 4KE9A 1AQNA 3QEAZ 4GNRA 1PI3A 4DHEA 2Q0SA 3C87A 3V33A 1ZL2A 3ES9A 3H2KA 4D9NA 2QQGA 3A4LA 3LHSA 3SEZA 2QU7A 4TLDA 3U1TA 1F6WA 1EKXA 4BMPB 4ZFNA 1QDLB 2ZS8A 1CJUC 3BVPA 1L5KA 2AEEA 3GROA 2RHOA 4C3VA 2VTVA 4A0RA 2JD2A 4KJXA 1T29A 3UAZA 4DC0A 3U61B 3C6KA 4MTLA 4B4WA 1GEEA 3DBOB 4WW0A 2Q3HA 3WK9A 3H4MA 4D9GA 3GP8A 4KO8A 4BO7A 1BXGB 1RWQA 3HGMA 4YCAA 4TGLA 4C4RA 3CA8A 3SP1A 2R5NA 4CF4A 2ATEA 2PVPA 3JRWA 1XT6A 2I1LA 3JV7A 3QUAA 3WNVA 2VQSA 4PNZA 1AE1A 2GD0A 3VPSA 4GPIB 3JXEA 3KJXA 2XQFA 2NZ8A 3PRKE 3FHOA 2Z1DA 3Q2KA 5C8DA 5DGHA 3INNA 1YS1X 2B3DA 4D46A 2XWPA 4V0LA 5K8LA 3G8AA 1LPBB 4IFBA 3UM9A 3WV5A 3RVPA 2VLIA 4Q7EA 3T5AA 3GIDA 5DM70 4TMTA 2DG2A 2O8DA 1LI4A 2FRDA 2JJQA 3I6ZA 4YCJA 5HIMA 3MWDB 2JLBA 2CVFA 4IVRA 5EIWA 1KY3A 2HR1A 5IN4A 1XCBA 2I6UA 4PHFA 4XR9A 4AF6A 4LGVA 5B2FA 4GP7A 1Q5PA 3OMWA 2XMBA 1KMIY 1QO9A 3WQBA 3RRNA 4UPEA 1YUNA 1X7WB 5KTOA 2XCOA 2G7ZA 6ABPA 1CUBA 1FRFS 2FEKA 4BC1A 4NCAA 1SMKA 4FFMA 4KQ1A 4RQUA 1YI8A 4RQBA 1EM8A 4ZTBA 4CIDA 1SQFA 2P9YA 4Q05A 2E1RA 1XAIA 3U4GA 2HFJA 2EW1A 4F4IA 4DANA 4RK7A 3AB7A 2HMSA 3P2EA 4QPNA 5EQJB 5ICEA 3ESBA 3T12A 3QFHA 1GZ5A 2OHJA 3DUFA 1CB7A 1KYTA 4P36A 2QTVB 1M1YE 3P2OA 1NM5C 1MC5A 3M2TA 3IKLA 1NG9A 2RGYA 2VNAA 4E5NA 1JEEA 4OMFG 4S1NA 1TKRA 2AQKA 3KKOA 4X84A 1CR2A 5A5GA 5JYCA 4XA8A 1SRQA 2LIPA 3WSVA 4DR6B 1SH7A 3IR6A 2IE8A 2A9VA 5G2OA 3DH0A 1JBQA 1JQDA 1VRCA 2DHCA 2O07A 2G76A 3RSFA 4J9VA 4NZZA 3TX2A 3WK8A 2JFBA 4L74A 3QEMA 4MVJF 4TN5A 4Z9FA 2BDEA 5JNSA 4HLUC 3OQHA 4R8KA 5KMGA 4U63A 3LUKA 4IUBS 1BXRA 1TM1E 2BI8A 1BGXT 3M6FA 3QM1A 1A8UA 1II0A 1JHPA 1T9GS 2Z2KA 4NS4A 4RTMA 4CEHA 2ISCA 4MQ6A 4BNDB 1R4NB 2JIOA 3RF7A 3W4KA 3JRXA 2C7RA 1C1XA 4FEEA 4RMGA 2CLMB 4LDZA 4AJ1A 1X14A 3NQ41 1FP2A 3BTUA 3A31A 4JC4A 4LOKA 3TD9A 5BWCA 1ZD3A 5C5DA 2R25B 5AK0A 1SQ0A 4Q9IA 4FGUA 5AJUA 2VWHA 4NMMA 3D59A 2B7BA 1QHSA 1P3DA 1IRIA 4FGWA 4KE8A 4QUEA 1U31A 1RJ9B 1U0RA 2HHCA 1VE5A 2V0NA 2WE7A 2ZYWX 2ZE6A 3LWNA 3HU5A 3QBTA 1CX9B 2WYUA 3ABRB 1X0VA 5JCJA 3ZDYB 1W36D 1CLEA 1SPXA 1UWKA 1MH9A 4Y1GA 3EVBA 5TLSA 2REBA 3MG9A 2H17A 4WV3A 1PT5A 4EUHA 5EINA 1IHXA 2B3TA 1BNCA 1KY5A 1D6JA 5I3ZA 4WOPA 4B4KA 3CSSA 4IILA 4GMKA 4G4GA 1ZJ4A 2ZT5A 4ZJUA 3NVMB 4Q4JB 1Y6FA 1M6EX 1QGZA 1GPBA 1C0IA 1DC6A 3QLVA 4Y6GB 1HA3A 4DNXA 3TEFA 3IP6A 3D02A 1GZDA 1LSSA 5FD8A 3U09A 3VC7A 3T52A 2QX9A 4HT3B 1SUPA 5H82A 4QYMA 1GSOA 4JVMA 5CU7A 3KEGA 1R66A 3OQPA 5DULA 4B7XA 4R2WA 3ZQ4A 3JAWA 2LKCA 1Z07A 3M89A 1T0IA 2ES4A 3NLLA 5KOYA 1GNRA 1SUEA 3T4EA 1H2WA 2XXAB 1GPAA 1R4MB 1SUAA 2WWRA 2J4CA 3O0TA 1ZW6A 1IVSA 2V6MA 3QPBA 3TQIA 3QLUC 2IOFK 5KWIA 3LBAA 1ZNZA 2GCNA 2QD2A 1H9AA 1VTKA 3Q1KA 3BT7A 4BFLA 5AH0A 3K8ZA 2VAXA 5I7UA 1COWD 4B9EA 4L2IB 1V7QA 1TD1A 4RIGA 1JHYA 3GGPA 3N0VA 2C9CA 3K6RA 4JLPA 3RHZA 4AIRA 3AHJA 1ISMA 3SPXA 1SQSA 3BRWA 4YAFA 4ICIA 4XVUA 3R41A 1QYWA 3C98A 4Z2YA 1KRHA 4RV9A 1CF9A 4H59A 4J90A 2CJWA 2WT8A 2Y1DA 3I6YA 1Y8RA 4U9UA 4AJJA 4B5KA 4GT1A 2A59A 4K0KB 1YZ3A 3BDAA 2VR1A 3PGVA 3HL0A 3RVDA 1WVMA 4HCJA 5L3RA 4ARZB 1KEKA 4ER5A 3O4GA 2W0MA 1W5SA 5TJHA 1U2GA 4D5EA 4G0OA 3X1DA 3FUXA 4FHDA 4K8OA 2BE7A 1WU8A 3I9JA 1CJVC 2J32A 3FPLA 4G1MB 4LXQA 1ZN2A 3RRJA 1RXVA 4NECA 5G02A 3A11A 3LVQE 3QMVA 1LA2A 1M5RA 1Z68A 3GT4A 5JCPA 4WKBA 1D6SA 1N92A 1QF7A 4EB8A 1VHDA 1B2LA 3DD1A 1RNLA 3IBTA 2CV0A 1P9WA 4B7UA 1N3LA 1Y1RA 4IDQA 4D4JA 3LP8A 1D2CA 3WGUA 1CDEA 2IUFA 3L1KA 4JJFA 1V16B 3JWGA 4PLZA 4V0OA 3FIJA 1G16A 3KJIA 4LVUA 3W6UA 2XTNA 3B1JA 4OU5A 3GELA 4NAUA 1M5UA 3OPMA 4G0VA 4FR2A 2ERCA 2RG7A 1WUTA 2WDZA 1XQXA 4V24A 2D7JA 4S3MA 4Q7KA 1W0KA 5ICFA 4ROTA 5TS2A 3STYA 3Q40A 2EZ9A 4OXXA 5FWYB 4YRAA 2X1LA 4EZEA 1KRXA 2R4QA 3CXUA 3CZAA 3OCCA 4ZCIA 4HNAB 4FEYA 1JPNA 5FOVA 4OHYA 4RD1A 1PFVA 1FX0A 3QK7A 2OL4A 4OJTA 4Q0MA 3PDCA 4NCHA 4D3YA 2ZUVA 1YVRA 4OHCA 5TF0A 4D57A 5B5SA 3K0CA 4L75A 1IOLA 2Q1XA 2ZDHA 3E9ZA 3K73O 1CUAA 4WY5A 4M22A 1CUXA 3Q6IA 2W5UA 3EGIA 4OBXA 1GD1O 1WKBA 2FWNA 3RG8A 1RQNA 2JVKA 3JYQA 2A5LA 1NDHA 3LG2A 3QH4A 4GLBA 4GM4A 2WHYA 4C1BA 2FK7A 3NRBA 4OFWA 4ZRDA 5EIHA 1SXIA 3GLIB 5FUXA 1BU8A 1CK4A 5C4MA 1XGKA 2HRZA 2JBWA 1YDWA 1BJTA 2A9FA 3LUFA 3R3UA 4MO9A 4UZEA 4L3VA 1CVRA 1D04A 1G5IA 4LIPD 3AKZA 1TZBA 2PSJA 2AF4C 4YQZA 5IH7A 3TLKA 2OHIA 1EXVA 3ZQUA 1VPEA 3LX8A 4PYKA 2QG4A 1JQ3A 1PFKA 3BZBA 4A1FA 5CB4F 3EVEA 2E7ZA 3NC0C 4HGPA 3HKCA 3B1VA 4CVNA 3BTVA 1PFGA 1OXKB 2BM1A 3E5MA 3KSDO 4NBLA 4N3AA 4ZPJA 3T0GA 3D8RA 3SXUB 3JQ6A 4V2UA 4MVWA 3P45A 1RXCA 5BV1A 1T8PA 2IX3A 1ICIA 2Q8QA 3CEPB 3WIUA 4LGCA 2MWMA 2VUIB 5EYPB 1K6EA 1MO2A 3BN3A 1BHO1 4TKVA 5H4HA 4F4JA 4O2BF 4RK5A 3MJRA 1L8AA 4NNPA 5FA6A 1BS2A 4EBBA 4WNYA 3B6MA 3SZGA 1K7XB 4ZOCA 1FFSA 1UQRA 4CL8A 3A27A 5ENDA 5I3CA 5LNK6 1KYZA 3WIBA 3DKIA 2PZJA 4M1WA 1ESCA 2JAUA 4HPXB 5TPWB 3UA4A 1DQZA 2BFDA 4XFJA 1E69A 2EOAA 1Z7WA 2HTFA 2XOXA 2WA2A 3JSAA 2EIXA 4ZVTA 3OEHA 4KAFA 4N3GA 1D2AA 4HZGA 3ZC3A 1IEWA 2C03A 4FHZA 3KUCA 4OQPA 1DIHA 1RHQA 1SHJA 4U02A 5K51A 5I48A 3DPUA 2Z3WA 4U6NA 2Z5LA 3WK6A 4YDQA 4K6OA 1G5TA 2HF9A 5F76A 1X7ZA 3W90A 1YB1A 1L8OA 3LUGA 2B4YA 4HUQB 4JC0A 1TTHA 3DWEX 1X3SA 4U0KA 3NM6B 1BHSA 2OZLA 2D1TA 1FFAA 3OJCA 1FUKA 2BZ1A 1T34A 1GYRA 3ND5A 4RLQA 4ZVMA 4YCSA 721PA 1MA0A 2WZBA 4MWBA 1BX3A 3MNFA 1UBJS 2CNKA 4BDSA 3N5KA 4LXTA 3W2HA 3AETA 2FQXA 3EGCA 4R41A 3DTTA 5KX5F 1BEUB 1XTVA 2XUQA 3T9FA 3BEOA 2SCUA 4MGEA 2AYXA 2ZE7A 1JB1A 1ZMXA 2ZU0C 3ITKA 3ONEA 4L3WA 3SDBA 3QKUA 4LF6B 1JDPA 2O7RA 1E9VA 1OZGA 4CI9A 1YQTA 3QPCA 3OMLA 1AUVA 2FPSA 4J16A 4GX5A 1M2WA 1PL6A 4DXDA 4FFNA 5B1SA 1PR5A 1MJ5A 2R1UA 5EKXA 4IHJF 4JBXA 1EE2A 3QVGA 3H0KA 3RVNA 1KP2A 1PR2A 5F78A 3ROMA 4W5JA 1KKMA 2V5AA 3COPA 5KQSA 2OOSA 3OZCA 1K0UA 3EEIA 4CEHB 2ATXA 1TJ5A 2WYWA 3CVYA 1ZN7A 5EMHA 5CA0B 3GLHB 1H9BA 4P4SA 4JY7A 4FKMA 2ZUWA 4CDGA 5I7OA 1JLLA 4EJMA 5CDTA 2CKDA 4N7RA 1BFDA 2AL7A 4PQYA 1V7CA 3ZU4A 1R5NA 5H02A 2H08A 4WLEA 4C7KA 4Y0NA 2J5QA 3GJ4A 4PYQA 1X1SA 2JGMA 3EQ9A 3GFSA 4OQEA 5ELLA 5THQA 3Q7IA 3F3KA 3IEMA 5IKMA 3K70B 4HRAA 4KIGA 2VJCA 1OAOA 3LPAA 3LUJA 4I9GA 2SKEA 3RRXA 4LVOA 5EWMA 5DASA 3ZKWA 1NKTA 3ZI4A 3HEAA 2OWEA 2OZKA 2P9EA 4GH5A 5INTA 2FEWB 3QA3E 3BBLA 1BOFA 4HYQA 5ALOA 4G5GA 2NMVA 3CNBA 3R6TA 1L7MA 3L6DA 5HZHA 2J9RA 2V7QD 5FBZA 3THXB 3VR1A 1PTKA 4L6CA 4RA9A 2VDWA 1MBZA 2XLBA 4W6QA 3BWYA 1UXKA 1P2BA 2F90A 3VZDA 4DSNA 1E4EA 4YR9A 3F67A 5F4ZA 2I71A 2Y0BA 3FTPA 4DR5B 1MAVA 3ICOA 1ZGCA 4DQUA 1WD5A 1MZPA 4UOZA 5C46F 4MW7A 1X7XA 1T6ZA 3QFFA 1F4VA 3QU4A 4NU8X 2G04A 3V2GA 5CVTA 5AR1A 3QUCA 3HA5A 2Q9AA 1VL8A 1XVIA 2VQ6A 1WDWB 2ZUTA 3IDAA 4ZIRB 1MG5A 5EJ9A 1B1CA 4FLEA 4M37A 1OV6A 2J9XB 2XVAA 3ZR4B 3E53A 4O33A 3RJ9A 4M0LA 3U44B 1IBLB 1XROA 4OF4A 1Y1KE 1KQPA 2XCSB 1T9GR 4HP8A 3ADCA 2IUTA 4ND1A 5C8ZA 2YJGA 3CV3A 4BWVA 3OQNA 1DAHA 1WDMA 1RWVA 2C2XA 4QHYA 4ETIA 4X62B 1FFBA 2BEUB 2BY4A 3DB2A 3NRJA 3UWDA 1O77A 2QN2A 1JFLA 5COAA 3M9XA 3W4JA 1B26A 4F97A 4BO3A 4HAVA 1PQ4A 4WTOA 1JL3A 3EDCA 4OL9A 3K9CA 1Z6XA 4YP6A 5ILQA 3FCXA 5LYJF 3PJRA 3PWSA 5J2UA 4TPKA