3UOGA

Crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
341
structure length
341
Chain Sequence
MMSKWMQEWSTETVAPHDLKLAERPVPEAGEHDIIVRTLAVSLNYRDKLVLETGMGLDLAFPFVPASDMSGVVEAVGKSVTRFRPGDRVISTFAPGWLDGLRPGTGRTPAYETLGGAHPGVLSEYVVLPEGWFVAAPKSLDAAEASTLPCAGLTAWFALVEKGHLRAGDRVVVQGTGGVALFGLQIAKATGAEVIVTSSSREKLDRAFALGADHGINRLEEDWVERVYALTGDRGADHILEIAGGAGLGQSLKAVAPDGRISVIGVLEGFEVSGPVGPLLLKSPVVQGISVGHRRALEDLVGAVDRLGLKPVIDMRYKFTEVPEALAHLDRGPFGKVVIEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title Crystal structure of putative Alcohol dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
total genus 94
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uogA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3uogA01
1ZEMA 4YJGA 2VRCA 4INAA 3VH3A 1P1HA 2DUWA 1UZLA 4PLPA 4D3DA 2E48A 4CV3A 1XU7A 3V2GA 1Q7BA 1GTMA 4GSLA 4TWRA 5JLAA 1LQUA 2C0CA 3DHEA 2E82A 2C5AA 4OKNA 1R4NB 4YVFA 4PLZA 3KYCB 5GZ1A 1I5RA 1PZEA 2X0IA 4PLFA 1FMCA 1F17A 4J4HA 7ADHA 2H63A 3H3JA 2O7SA 3NX4A 4HKTA 1HZJA 3JYPA 1IZ0A 2O4CA 4J7UA 4R1NA 4F3YA 4RZIA 4FD3A 1Q7GA 4KZPA 5JC1A 3EMKA 1HWYA 5TIIA 1YDWA 3JYLA 4UEKA 3GZ4A 2OZPA 3OHSX 3PZRA 1GY8A 4YPOA 1YS4A 3IJRA 5AXAA 3RC9A 4BO7A 4MVJM 2PKQP 1P1FA 2I3GA 5DT9A 3WGGA 1U8XX 2EGHA 3IKTA 4WKGA 1H6BA 3O9ZA 4A26A 1B15A 2FOIA 3GY0A 3CMCO 5BSEA 4B7CA 4BO3A 3JTMA 1LDNA 1BXGA 2Y1FA 4XKJA 5ENDA 2GD1O 1ADBA 2OOSA 1B8UA 5CP8A 5DDIP 1J4AA 1N5DA 1WXDA 1CF2O 4BL5A 1KETA 3V1YA 3SJ7A 2H6EA 1B2LA 2A9FA 3CPSA 5TNXA 4BMVA 2H9IA 3E5MA 4U8GA 2PZMA 4J7XA 4KWIA 3ZNOA 2YY7A 3JQ9C 2VWGA 1GPJA 4MIOA 2FPIA 3FR7A 3H9UA 4HFJA 4ROSA 1V9LA 1U3VA 5COAA 4XRGA 4E2YA 5EQFA 1YDEA 3WOHA 4B8ZA 2ZYAA 4G81A 2RH4A 2NNLD 3G3EA 4N18A 2Q3EA 1NAIA 3KYDA 4YT4A 4MO2A 3HN2A 1IYZA 4N7RA 3ZWNA 1ADGA 1LSUA 1ZNQO 4I9UA 3M6IA 5G4KA 4BS9A 1VI2A 3QHAA 1DC4A 1DLIA 2OUIA 3JQAB 2EP7A 4IJVA 3VVCA 1P0FA 2EEZA 4TRMA 3AFMA 3HDHA 1DLJA 3LSYA 3H3FA 3T4XA 4E5PA 1HDOA 2D3TA 2OFPA 4D0RA 2DUUA 3UW3A 1M67A 5BNFA 4DUPA 1M6HA 4QECA 3JD2A 4XZ3A 2OORA 2FRDA 3ZCXA 5TQVA 4FJ1A 4BO2A 4IQ8A 1UXIA 4UVIA 4CMKA 4DMMA 1GPDG 2JFHA 3KSZO 2J5RA 1ADCA 4RF3A 2VHZA 1I30A 4E12A 2R00A 2QRLA 2X5OA 3MWDB 3PWZA 4L75A 4QFDA 5LCXA 3ZNQA 1TEHA 2YHUA 4GKBA 3JQEA 3D64A 3DFZA 5DBGA 1KY5A 4HY3A 4CM4B 1IHYA 1T4BA 5JCJA 2QZ9A 4B3HA 1RYDA 2JHFA 2TMGA 4ZVVA 3G49A 1CYDA 5L45A 5HM8A 5JPIA 4XDZA 4BV9A 4PFJA 4RQUA 1J6UA 1KVRA 3I5MA 4WLVA 1I24A 1CDOA 4OL9A 2Y1OA 1EFKA 3VPXA 5I9NA 1E3WB 1DEHA 2P68A 2IEDA 2TMDA 1DAOA 2IZ1A 4IDGA 4AL4A 2XF8A 3GEGA 2PGLA 4WK6A 2EJWA 4IIUA 4UULA 4YTEA 5JDIA 5L51A 1ZBQA 3K5PA 3IL2A 2BGLA 4GSKA 1T2EA 2NM0A 2WJPA 3GVXA 1QR6A 3DBRA 3PVZA 4A0SA 2UYYA 2AQKA 1DFHA 4PRKA 1X1EA 1T25A 1ZIDA 3OQ6A 4AICA 4O63O 5JO9A 3VZRA 1EUDA 3JD0A 5JCXA 2CF5A 4JROA 4HWKA 1U5CA 3EC7A 1GU7A 2GO1A 2I5PO 3JQBA 2DBZA 2EWMA 1L1FA 5TS3A 4NFSA 3BMQA 5DNAA 1AXGA 1YB5A 2VOJA 4ITUA 1DHTA 4E2XA 1EUZA 3AUUA 3D3WA 2YFQA 4J4TA 3V5NA 2BRUA 2QX7A 2NQ8A 1CJCA 2ZTUA 4XYGA 1SPXA 3D0OA 3WQSB 4ND4A 4Q3NA 1WMBA 3ASUA 3D4PA 3QLJA 1I3MA 3PWKA 2O23A 4BQRA 5JDCA 4BNFA 2NQTA 4CMAA 4R3NA 3GMSA 4D3FA 2GUGA 1F14A 2RIRA 4QEDA 4KUEA 1ZK1A 1NR1A 1F0YA 4KQWA 4CM3A 2J5QA 3UXYA 1QG6A 5IJZA 2RBEA 1O9BA 2BI8A 4JJFA 5G0SA 1DSSG 2DM6A 3JQFA 1AHHA 4EI2A 4OM8A 4NI5A 2EJVA 4J2HA 4UUNA 1XDWA 1ZVMA 3HN7A 3QW2A 1SEPA 4XR4A 1YBMA 2AHRA 2YDYA 1G1AA 1U5AA 4NJMB 3FNGA 2GERA 2VWPA 1GYRA 3GZNB 3H9QA 4RF5A 3AU8A 3CEAA 3O26A 4Z3DA 3SJUA 5IG2A 2J6IA 3GGOA 1EDZA 2I76A 3L77A 5C7LO 1DRUA 2DTEA 1DPGA 2G76A 3ZV6A 3ZNNA 2R00C 4G65A 2AQIA 4Q3BA 1DC5A 4E5NA 1NFFA 2ET6A 1A9ZA 1PQWA 3R3SA 2O3TA 4CR8A 4IINA 5LC1A 2P2SA 4G5HA 5F1OA 3GG9A 1EK6A 2AMFA 3TL2A 4BNXA 1O8CA 4U7WA 1JU9A 3CKYA 4IY1A 4BIIA 3UICA 2EGGA 5CDUA 2XXJA 4TMFA 4MVJE 2CVOA 4WECA 4BNHA 1EBUA 2IZ0A 3NV9A 2PNFA 2X22A 4R41A 4X54A 1LUAA 3DTYA 2J5KA 1MUUA 4XEHA 2FPGA 2W2KA 1M75A 3SC4A 3ZU5A 4WLOA 1JKJA 3OJFA 4TVBA 3BTVA 3N7UA 4Z9YA 5GZ3A 5L53A 5JDIC 4HNHA 2C07A 3TJRA 1S6YA 3K9QO 4XJTA 1Y8QA 1DC3A 5B37A 4AJ2A 4YRAA 3W4IA 3PPIA 1ZH8A 2QG4A 3JYOA 1XGKA 5DBFA 3UKOA 2ZB7A 3WYCA 1ENPA 3AM5A 5AXBA 5TRTA 4DIFA 1EMDA 3D3EA 5IZCA 3MJCA 3TF5A 1NHGA 1KEVA 3WNVA 3AY6A 1QXSA 3JQBC 3S2IA 3EZLA 2G82A 1LLUA 4CMCA 1ZJYA 2QRKA 1A27A 1ML3A 4FN4A 5JMPA 4RPGA 2W8ZA 3P2OA 4PCVA 1P31A 1PSDA 1A4UA 4DIBA 3Q11A 2C2YA 4N5MA 4RVDA 1O94A 3Q2IA 1JQBA 1O89A 2AG8A 3IKVA 1L7DA 4LISA 4CUJA 4F46A 1GZ6A 2J3KA 2BKAA 4PG6A 5JS6A 4IDFA 3C24A 1PZGA 3ZW8A 4C7KA 3E18A 1WLYA 2X9GA 5TX7A 2G17A 4BNZA 4DC0A 4WLUA 2JAPA 3RBZA 3F4BA 1ENYA 4DC1A 2HDHA 3EY4A 2Y0CA 4BKUA 1UZMA 1YJQA 4YYZA 3E8XA 3VC7A 4PIVA 1E6UA 1N9GA 1R4NA 3E1KA 3EGOA 1MB4A 3KYCA 3JQFC 3QVSA 2P91A 3I9LA 5ENVA 1LXCA 4XJSA 4HFMA 4CV1A 4RVUA 3CTMA 1P45A 5JW6A 4U5QA 1E1KA 2AA3A 3RKUA 3LYLA 3ONFA 3DB2A 3EDMA 3HFGA 3AI3A 4TRNA 5JMWA 1JVBA 3NYWA 1I0ZA 4KDFA 5F5LA 2PZLA 4P8RA 3RI3A 1J49A 1ULSA 3DBHB 5CEEA 3O03A 4E5MA 5EQDA 2FR8A 4J1TA 3H2SA 3QWIA 4AJPA 1EE2A 2FPPA 1GUZA 2WYUA 4IIVA 4PLYA 1XCBA 1E7SA 2A35A 4L73A 8ADHA 3X2EA 2OMEA 3FNFA 4W9NA 4BNUA 4DLAA 1KERA 3COSA 3BHJA 1EVJA 1HYGA 4RPLA 5DOZA 4PLTA 3TZCA 3K2BA 1EEHA 5JAIA 4XGNA 4Y6PA 5A03A 2RHRA 1Z7BA 2Q49A 3WTCA 1GCOA 3GA0A 3RSHA 2IYPA 2WMDA 3SX2A 2NU6A 3LU1A 4XD2A 3QVTA 1NP3A 1K2WA 1V3UA 3OIDA 1G6KA 3H9GA 5AXCA 2BFAA 1X13A 3OFSA 2Q1SA 3HDJA 2IYOA 4RCVA 2BGKA 1PS9A 4BO1A 5HA5A 4PZCA 1EDOA 1MLDA 4EGFA 2EKLA 3WR5A 4NBTA 3UF0A 4E33A 1UDAA 2DPHA 2GN9A 1XU9A 3BYZA 4ZRMA 1HDXA 5TSDA 5J23A 2YHIB 3PXXA 3JQAA 4EJ0A 1SB8A 3K31A 2P9EA 1CRWG 2VTEA 2WD7B 4AJJA 3LLSA 1IOLA 2C59A 2POQX 1VL6A 1PGOA 2QYSA 1ENOA 1CETA 1ISMA 4FOSA 2SCUA 5COBA 5A9RA 2X5KO 1GYPA 4BGVA 2FZEA 3TNLA 2B37A 4ILKA 1KS9A 3OEYA 1NXQA 1P33A 3UGKA 2Y66A 2DPGA 5G0TA 1VLLA 3NEPX 4XR9A 3FR8A 3NDRA 4L4RA 1LLDA 1E7QA 3SLKA 3V1UA 4BO6A 4PLVA 1NAHA 5B4VA 3WJAA 4BNLA 4UVEA 2Q2QA 4K6FA 4KTVE 3AOGA 4CM4A 1GADO 4GH5A 1YGYA 4KUHA 5HRUA 3JYNA 1UDBA 3OA2A 3H5RA 4E4YA 4DPKA 4I1IA 1PGJA 1HDZA 1YL6A 3QSGA 5U1PA 4L4XA 2EF1A 4XA8A 4A10A 3PQEA 3PLRA 4HUJA 3E03A 4YJHB 3F3SA 2YDXA 4K1LA 4AJLA 1PWZA 4I5EA 3JYQA 4TKMA 3I23A 4JK3A 4Y8VA 1J5PA 1GUYA 1VRWA 1C1DB 3CIFA 4RF4A 4GLOA 1E7MA 1PJBA 2J3IA 1YO6A 4GVXA 4R54A 1BRMA 1NR7A 2I99A 1E7WA 1QV7A 4MVJD 3S1LA 5IXSA 4IGEA 1OOEA 2WTBA 4QSMA 1YJ8A 4W9NC 4WE3A 2X7HA 4ZN6A 3TZQA 1DFGA 3AW9A 4PRLA 2O2YA 3BMNB 2DFVA 4E13A 3DZJA 2OL4A 1ZK0A 3I52A 4Q39A 4A73A 4J7CA 1IULA 4D79A 5CHEA 3A14A 3AY3A 2O2SA 1C0PA 2VNAA 2JCVA 4WNIA 1PJ4A 5ICSA 4BB5A 1E3SA 4B7XA 4WEQA 5CEJA 1UP4A 2VT2A 1HYEA 3B70A 1ISHA 3DO5A 4B4UA 2HJRA 4P4GA 5ER9A 2X6TA 4AG3A 2ZB4A 1H6AA 4YDRA 2AQ8A 4RLSA 5CAEA 2ZQZA 5EL0A 3M2PA 3UCFA 4DYVA 5U4QA 3DHNA 4S3MA 3SEFA 1QKIA 3DDNA 4QO7A 4DYDA 3W4KA 1WDKA 2VYVA 4P38A 2JHGA 4CR6A 1R66A 5L7WA 2G1UA 4FBGA 1SC6A 4R5HA 5F1PA 1R12A 4MPDA 4FFLA 3LF1A 3KETA 3G79A 4RGBA 4M86A 3D7LA 4AJOA 1U3UA 3VH2A 3JQ9A 4R9SA 4DA9A 5KIAA 5H82A 4NJMA 4YB8A 1IUKA 3GZNA 3NAQA 2HMUA 1EFLA 3DL2A 3GPDG 4RPJA 4D42A 2WYWA 3FRJA 4ZICA 1HE4A 3IMFA 4JP2A 1EQ2A 1G0NA 3OH8A 2ZJ1A 4JJIA 2ZB3A 5BSFA 5FF9A 2DAPA 3KSDO 3JQ8B 3RJ5A 3OM9A 1NFQA 4B4OA 3C85A 3ENKA 3NTRA 1YOVB 3PRJA 1VKNA 1VSUA 4KOAA 3RC7A 3KXDA 4BNYA 4OQZA 1HE5A 2ZQYA 3CXRA 4YA6A 1PZHA 1VJTA 5I9LA 3H65A 4JXKA 2Q46A 2JD2A 4EJ6A 4J2OA 4WEOA 3ADPA 4NBVA 3KEQA 1OMOA 5KTKA 3E82A 1U4SA 5L7TA 4BKPA 1ZUD1 4P22A 5CG2A 2EW2A 2D59A 1E5LA 7MDHA 3JD3A 3E9MA 1M76A 1T2FA 2JKVA 3X2FA 5BSGA 1B7GO 3MTGA 5HTOA 3ETEA 1Y81A 4R16A 5I7SA 3GVPA 3QQPA 4E21A 3OJLA 5ILOA 3FCOA 4BKQA 1I01A 1I10A 3DZIA 1R6DA 1LBEA 2I66A 4CM9D 2QQ5A 3E9NA 4XRRA 1OAAA 4YQZA 3N74A 5G0WA 3JV7A 4GMFA 3MJVA 3QA9A 2ZK7A 4EEXA 1EVYA 3I9MA 3KM0A 5IDYA 3S55A 4YEDA 4IDAA 4ND2A 1PIWA 1I3LA 3HB4X 3DQPA 4GMGA 4DMLA 3UVEA 1LSOA 1VSVA 2VUSA 2B36A 2E4AA 5ILGA 3A9WA 4YXFA 1ZXBA 3RC1A 5T64A 4CL3A 4KTTE 2Y05A 4MKRA 1CERA 2YV2A 2O7QA 2NU8A 1KEPA 4XGKA 1C1XB 3IS3A 4MP3A 5KJFA 1I33A 3G1TA 3B1KA 1PTJA 4R1UA 4RVSA 2V6GA 3NT4A 3JD4A 4P4LA 4NMHA 3AFNA 4IQGA 4FR5A 4YAJA 2BFPA 1K0UA 5L7YA 4DPLA 2PZKA 2IXAA 4YAGA 3MTJA 3SBOA 3LT0A 3UCXA 2CF6A 2UV8A 5L3ZA 3V2HA 3NJ8A 1BVRA 1DJQA 1KYQA 1YQGA 1A9YA 1E6EA 2NACA 5BT9A 1LC3A 2GCGA 3RUHA 4Z6KA 4Z0TA 1LRLA 5L95A 2QZZA 4CUKA 1U1IA 3O38A 3BTSA 3F9IA 4IXWA 4WUVA 1VL8A 4NIMA 3RUAA 3VH4A 3ZI0A 5C5IA 3OJ0A 3GNTA 1YL5A 4E2WA 4M54A 4XYBA 1HTBA 5CEFA 1E3IA 2CVZA 4IJWA 1WP4A 3RAJA 4EUHA 1QYXA 3QRWA 4ZHSA 2I9PA 3PK0A 2NV6A 2F1KA 5CFZA 1LTHR 1WW8A 2VTDA 1BXZA 2WE7A 1HRDA 3WSVA 3DEYX 3ZU4A 4J9VA 4CMIB 1KOLA 4E3ZA 3E9QA 3PQDA 3IJPA 4AJKA 3G0OA 4JX8A 3FTPA 2ZJ0A 3AJRA 2Z1NA 3RBXA 2NUAA 1T26A 4Y9DA 2X9NA 3W4JA 4KWHA 1YQDA 4FFOA 5JSFA 1YVEI 3HZZA 3K2EA 4WNCA 3IOYA 1XKQA 5CDTA 1R37A 3DMTC 4Z0HO 5JAQA 1I32A 3WG9A 4JGBA 1HYHA 4W7HA 4EW6A 4KUGA 2OBYA 1K6XA 1P1JA 2RH8A 1YXMA 1DRWA 1FDSA 1OZAA 3PHLA 2DVMA 4XQGA 3PJFA 4E5KA 3JCZA 1XSEA 1BMDA 5KJCA 3ZGYA 1MP0A 2PD3A 4S1VA 1P1IA 1LC0A 3P2YA 5T6BA 1U2GA 2H1SA 1U7TA 4OSOA 4LCEA 4I9HA 4BNVA 3DZFA 3W8DA 1PR9A 4D0SA 2YV3A 3ASVA 4AJ4A 5IF3A 1TA4A 1ONOA 1XYGA 1GZ3A 1UAYA 1NM5A 2LDBA 1GL3A 5DULA 3HE3A 4F6LA 5GMOA 1A4IA 4H7PA 2PH5A 5GZ6A 1H2HA 1T2DA 5L4LA 5FI3A 2YV1A 2HMSA 2R2GA 1Y8RB 2QRJA 1WZIA 2GZ1A 3ROQA 2DU8A 5A06A 3AM4A 5JY1A 4W6ZA 4NH4A 2BHLA 2RHCA 2YHIA 4BNKA 2EERA 1B8VA 3NT5A 3RASA 1XQ1A 4DQVA 2WD7A 4BQPA 4CM5A 2XXBA 4IJKA 5C37A 1I8TA 1W73A 4DL9A 1CQJA 4ZRNA 3IUPA 1R0LA 3VPSA 5C7IO 1P74A 2WE8A 3V8BA 1Y1PA 1U2DA 5DF1A 5TT0A 3PIDA 4GLLA 4WOJA 2GN6A 2UUPA 4DLBA 2C5EA 5IXYA 4QTZA 3LF2A 2RCYA 1KC3A 1N1EA 1EBFA 3F1KA 4MP6A 4Y6SA 1F12A 1WPQA 3PGJA 2JD0A 2XPCA 4I5GA 2YFHA 4J90A 4U6SA 5C7OO 1Z74A 2VYND 4WGGA 3BZUA 1XA0A 5IAAA 3BMCB 3GG2A 4OOEA 3S8MA 4GWKA 2FR0A 3U49A 5IZ4A 1HL3A 1RJWA 4ND1A 3VVBA 2Q99A 3NKLA 3HFSA 4EEZA 2D8AA 1AE1A 3AU9A 4R9RA 4OKIA 1Q2XA 3FF4A 3C3XA 3U4IA 2DTDA 4Q3AA 3D4NA 2HLPA 3FD8A 1GQYA 2IODA 4BHTA 4JBGA 4NQZA 3QVWA 2JCYA 4YJHA 2WWRA 3TOZA 4J6FA 2CSUA 4JIGA 4L8VA 1NYTA 2HRZA 3ONDA 4ZD6A 3KO8A 4BV8A 1C1DA 3G1UA 3ZHZA 4CLOB 1JWBB 3NT2A 1JN0A 4EUEA 4ALLA 4Z9FA 5L4NA 3RWBA 4FPXA 4IBOA 3EZYA 4BO5A 1JKFA 3DHYA 4BOYA 1DIBA 4DVJA 3AM3A 3BMNA 3FN4A 3B20A 5BSHA 2HK8A 1LU9A 1P3DA 1Z6ZA 1PL7A 2HO5A 4GPD1 1W6UA 5H83A 1PJQA 1N1GA 2Q45A 4FQ8A 2AE2A 1X1TA 2EHDA 3L4BC 5TT1A 1ZKMA 3WSWA 1DAPA 4XIJA 1Q7CA 3NUGA 2C82A 3GPIA 2HK9A 4L9RA 1LQTA 1XLTA 4RJTA 1E1MA 1FDTA 1I36A 1ONNA 1P9LA 1E1NA 1ADFA 3DFUA 4XB1A 4E5YA 2E37A 2C20A 4EJMA 3PIIA 5IDWA 5KVVA 3JQCA 2I67A 2EP5A 3NTOA 3P7MA 3L6DA 1JAXA 2BFMA 3ZHXA 1DIRA 3WICA 1NPTO 1PGNA 1YB4A 4IGFA 1H0KA 5KKCA 3I4FA 4CM1A 4CM6A 1UP7A 4G2NA 3ZWWA 1MG5A 3PYMA 1QV6A 3D5QA 1VM6A 1ZO8A 4B3IA 1BTOA 3KLPX 5FYDA 3AI1A 3U4DA 1YWGO 1NQOA 1T4DA 3VH1A 4D3SA 1LI4A 1X14A 4ID9A 1V35A 1PGPA 4HNGA 3I1JA 5CPFA 4R4JA 1KVUA 3LC1O 3L4SO 2ZTMA 1MGOA 4WLNA 3VKUA 5JO0A 3B6ZA 2D5CA 3DONA 4JJGA 3PYLA 1C0LA 1A72A 1YL7A 3ZN2A 1NVTA 4OGWA 3UFXA 1WAMA 4W4TA 4EDFA 4OJNA 3L07A 4ZA2A 4XQCA 3ZWYA 3R6DA 3W6ZA 3BA1A 5EERA 1AXEA 3ZW9A 4MVJI 2JD1A 5A5FA 2W98A 4YBZA 4CLDA 4F45A 3RFVA 4DPMA 2E6UX 2LDXA 1PGQA 1DOHA 1YOVA 3GDFA 5ADHA 2Q1WA 1UDCA 3HQ4O 3QWAA 3JSAA 3WMWA 3DZKA 4FJ0A 5T5QA 1F8FA 4CMJA 3OMLA 1PX0A 3B1JA 4GQAA 3Q3CA 3GUYA 3DOCA 4MDHA 4YT8A 5JFOA 2HSDA 3VZPA 3H5NA 2NU9A 3RUIA 4ALKA 3GC6A 3TWOA 4N5NA 1TT7A 2BMAA 2JFFA 4CM7A 2B69A 2YYYA 3ZWOA 5EMHA 4QQRA 4B4WA 3CH6A 3PHJA 4L76A 1R0KA 3WQQA 1LRKA 4NZ9A 3Q0EA 2OP1A 3RKRA 4CMEC 1GQQA 1UXHA 3MOGA 4IUYA 1K6IA 3AI2A 1Z7EA 3OBBA 2GN8A 4NBRA 2X4GA 4DQXA 4LW8A 4ZU3A 3ZV4A 1NNUA 5KJEA 2NLOA 3C7CB 1Y9AA 1VL0A 4CV2A 3TN7A 2AEFA 4EYEA 4MKZA 2IZZA 5ITWA 1DRVA 1RKXA 4IMPA 1SB9A 4W7IA 5K0ZA 1PEDA 2EW8A 3IUSA 3L9WA 3RUFA 2R6JA 2P9CA 3MZ0A 2ZYDA 3U4CA 3VTZA 4Y98A 4YAIA 4LK3A 3FTNA 2ZTLA 4DQUA 4AJ1A 3BMOB 1C1XA 3PJEA 4UVDA 2VRBA 2X0NA 2ILTA 4FCCA 2IE0A 1GV1A 3OETA 3DBLB 1ZK3A 2Y1EA 3KTDA 4P4NA 1PS8A 2HK7A 4U0KA 2IDZA 1HE2A 3IAHA 3PGXA 3IDSA 5CDSA 2Y99A 4J91A 1I2CA 2A94A 1G0OA 1JDJA 4EBFA 5KVCA 2OXIA 1BGVA 1Q0QA 3HJAA 1U3WA 1IPFA 3G17A 3VZQA 2D4AA 4I8XA 4BNMA 4EUFA 5KCZA 1TB4A 4BB6A 1HLDA 1ISGA 3PEFA 4RDHA 1AUPA 1SOVA 1V6AA 4OYRA 2FN7A 3BAZA 1WMAA 9LDBA 2EG9A 3DZBA 3OICA 4II3A 5DCWA 3RIHA 2CZCA 3O8QB 4IS2A 2B83A 3ZWMA 3ENNA 4TZTA 1GV0A 3KHUA 3PDUA 2Y0EA 1O5IA 5B4TA 1FDWA 2YJZA 1B16A 3NDIA 1ZZEA 1B26A 2O48X 3DTTA 1HDGO 4Z0PA 5A3VA 3H6KA 1OFGA 4IPTA 4ZQFA 4N54A 3DAGA 2HUNA 1FK8A 4Y67A 3INRA 1ISFA 1H6DA 4I5DA 3UAGA 1GFSA 1ISJA 3GT0A 4FC6A 4CMIA 4DWVA 4YJFB 4E2ZA 4XB2A 1KVQA 3Q9UA 4RVHA 4OHUA 3K73O 5JAZA 4WJZA 1JLLA 5AYVA 2WD8A 4TROA 3HWRA 2GN4A 2HRBA 1QYVA 1CQIA 1DIAA 2AEJA 3CZRA 4OMUA 5BQFA 4U6QA 5JYDA 1UP6A 3K8ZA 2DBVO 2HMWA 2B5VA 1TI7A 1DJNA 3F5QA 4CMGA 3OEWA 4PVCA 3GR6A 4ZQBA 3O4RA 4FS3A 4MVJH 2W2LD 4AJEA 3KZVA 1LA2A 4D7AA 4A27A 2NTVA 1JAYA 3TFQA 4ZGWA 2D5AA 5B4UA 3ZHYA 1MC4A 3F4LA 4MKXA 4NJOA 3QWFA 5I7FA 3AOEC 1GEEA 3EUWA 1NQAO 4YAEA 2J3JA 2OBNA 2VQ3A 4LVCA 2B35A 2BGMA 5EN4A 3VZSA 1YBVA 3GUCA 4TVOA 4R51A 3ZWAA 1N2SA 2Y67A 4YJDA 3WGIA 4FIZA 1W8DA 2YUTA 5JNLA 1Y8RA 2YQ4A 4JP3A 4N5LA 4OXYA 3WIEA 2O4UX 3I83A 4FDAA 3WGQA 5T67A 5TLSA 5FWNA 5L40A 1PQPA 4MVJA 4YQYA 4Q3CA 5ITVA 3MJ4A 4MOWA 2BI7A 1E3WA 4CQMD 3RD5A 4HADA 1ORRA 1ZXLA 4FFNA 1NHWA 2HQ1A 3DZHA 4I9NA 4ZQHA 4A5OA 4AFNA 4BMSA 4PVDA 4WOKA 4J16A 2CUKA 3EHEA 4ND5A 3OJEA 2V6MA 3TFOA 4BKRA 4CODB 1YBAA 1U7HA 3LC7O 3ZZNA 2VHYA 2PD4A 3ORFA 1NPDA 3PTZA 1ENZA 4OIMA 5TF4A 4O1MA 3INGA 4ALMA 4E31A 1NQ5A 2BH9A 8LDHA 1NVGA 4J1QA 4CM8B 1Z45A 4HBGA 2VOEA 3KOUA 3ZWCA 3MJEA 1NQTA 2VZ0A 5F21A 1T1SA 3H4VA 1YONA 3BMCA 4CL8A 3C1OA 3BTUA 3DAPA 2AE1A 3GNSA 1PJTA 4IJUA 2Y1CA 1LRJA 3RQSA 1N7HA 3V2UA 3TQHA 3ICPA 1ULUA 4CV0A 5ES3A 2O3QA 1SMKA 1XEAA 4OAQA 3VPGA 4LN1A 1FJHA 2V6BA 2X23A 1XIVA 5HBRA 3WYBA 2UUOA 1LDBA 2Q1TA 3FBTA 4FGWA 3RJ9A 4R3WA 5JAMA 3I9JA 3BTOA 2FSVA 4J9UE 4OQYA 1BDBA 5A04A 1KEWA 1FDUA 3WXBA 4O0LA 3RVDA 1UXJA 3LZ6A 3GGGA 2W90A 3NDJA 1UR5A 3QWBA 5THKA 1GAEO 3QP9A 5AOVA 5BNIA 3IP3A 4GX2A 2ZCUA 4CLOA 3HG7A 4IS3A 5T57A 5JE8A 1DB3A 2HCTA 2WYVA 4OXKA 1KY4A 1AGNA 3WWZA 1SEVA 1Y5RA 4MVJP 3VDQA 1A5ZA 5I8WA 4FB5A 1LDMA 4UEOA 5FFFA 1ZEJA 1D7OA 1OC4A 4BNWA 1YRLA 2WSBA 2AEMA 5EIOA 2CFCA 2NVUB 4CMBA 4B79A 2OGUA 2Y93A 4BGIA 1RPNA 4XQEA 1XELA 2GF2A 3EW7A 3GN2A 2JCXA 4Z3KA 1JWAB 4HFNA 5DOVA 4DXHA 3NRCA 5A9SB 3WMXA 1VJ0A 3SVTA 4AJHA 1Q0LA 3SXPA 2NTJA 3RUDA 1TVEA 4D43A 1LEHA 1RYEA 2Q1UA 3QVXA 2VWHA 4WLFA 2GNAA 5JXWA 5KOIA 4GI2A 3ABIA 1BG6A 1RM4A 2E49A 1BHSA 1JKIA 3CE6A 3DMTA 3ZV3A 1GCUA 2NTNA 4C7JA 5CDGA 3CSDA 4WLEA 6LDHA 3GAZA 3WB9A 4GGPA 4CM9A 4PG4A 3I6QA 3A28A 4AJNA 2ZTVA 3ONEA 1ZFNA 4XYLA 4FFMA 2PGJA 3Q9NA 1HDRA 2X5JO 4CR7A 1NVMB 1HDYA 2NADA 4LMRA 2VUTA 3H9EO 3F47A 3T7EA 2VZ9A 2P4QA 4XIYA 2HMVA 3V1TC 1TT5B 3A4VA 4QX6A 1IZ9A 1SAYA 3P5SA 4MVJG 4DIOA 2CY0A 4J0EA 4R01A 2IRWA 1C0KA 1Q1NA 3IC5A 3TZKA 4BNNA 3EAGA 5DBIA 1PL8A 2O50A 3H9JA 4KMSA 4JBHA 1X7DA 1RM3A 4NHEA 2Q4BA 3BHIA 1PL6A 4JN6B 3R3JA 3ZWXA 1BW9B 3W6UA 1X0VA 1H6CA 2JAHA 3GEDA 4FSHA 3ITDA 1M66A 2GDZA 4TZKA 1B3RA 3WBBA 1N9GB 3PHHA 4H15A 1E3LA 2EKPA 4OXNA 1L7EA 3RROA 3RUCA 3C1TA 3K30A 2PR2A 3PHGA 3QJ5A 4OO3A 4NU6A 1K3TA 1O95A 4PZEA 3AK4A 2VRCD 3ADOA 4O59O 4M8SA 2FSSA 5A4DA 3KYBA 1GD1O 4IZHA 3RFXA 4E32A 3F6YA 2I65A 4M1QA 1HKUA 1K6JA 3K6JA 1HZZA 1NFRA 3JQ7B 2VNSA 1FDVA 1VC2A 2PLAA 3H5AA 1IHXA 2ZATA 1LJ8A 2V65A 3CUKA 4XCVA 1PU2A 1ZK4A 5AVOA 2FY8A 1MG0A 4MIEA 3WGZA 3FI9A 4RLHA 2CNBA 5CDYA 4R68A 1P44A 4IXTA 4K26A 3WFJA 1KIFA 2J3HA 3R1IA 3WWYA 3UOGA 1DC6A 3PHIA 3PDJA 1LDGA 3K96A 5A5EA 3BMOA 1DBVO 2EKQA 4NFHA 1LDEA 3HDYA 4FW8A 4UUPA 3DBHA 5TJHA 1YKFA 2VHVA 4XDYA 2Q2VA 3DBLA 2BD0A 1X7GA 2O3UA 3D5TA 4Q3DA 5I7VA 3C7DB 1WVGA 5K6AA 4A2CA 5T8KA 3WIDA 3H7AA 2A92A 3GVHA 2O3JA 5F3RA 2WM3A 1Y5MA 1UAGA 3S2EA 4K9DA 2GGSA 3ZWVA 3R0IA 1OBFO 2I3AA 3GVCA 4KQXA 4L4SA 1B0AA 1LSSA 2PTGA 4HX5A 1WDMA 3INTA 4WCFC 1JVSA 4ZJUA 3RFTA 1ZCJA 3S2FA 5KWEA 2GZ3A 5MDHA 3L9XA 3HDQA 3L4BA 4OSPA 1QORA 1E1LA 3VTFA 4QT0A 3O8QA 4FOOA 2Y1DA 2FR1A 4LVUA 1W4ZA 1E5QA 4L74A 3VKVA 3LT1A 4CLRB 4NK4A 4CQLB 5LDGA 2X0RA 3OQBA 3U5TA 1SO8A 1NWCA 2CMDA 3P19A 4ALIA 5A9TA 3M1LA 4CUZA 4CQMB 4C4OA 3ROKA 1BVUA 4YACA 3GNQA 4BNGA 4F6CA 3A06A 5BNTA 3M2TA 4QO8A 3FHLA 2X86A 3MJTA 4UVHA 1D4FA 4YT5A 2DBQA 3EK2A 4YJFA 3HNPA 2HAEA 3I9NA 4BO0A 2Z95A 3KUXA 3DAFA 1VPDA 3AUSA 2VHXA 2CDCA 3ULKA 4YCAA 4EZBA 3KSUA 5EPOA 5HS4A 1WDLA 3WGHA 4B7UA 1P1KA 2DLDA 1GDHA 1ONPA 3A1NA 1NX6A 1Q0HA 1NTOA 1LSJA 2VYNA 5I9MA 2RAFA 3LT2A 3QV1A 1HSZA 4Q9NA 4BGEA 4XQ9A 1MV8A 3F46A 3DOOA 2B0JA 3DWFA 4LMPA 4NU5A 4B3JA 1Z75A 3KBOA 1K5HA 1PZFA 1QYCA 4FFRA 3WNQA 1LLCA 1UJMA 1Z82A 1E7RA 1YQXA 2BF7A 2B4QA 1EE9A 1IPEA 3F5SA 3UCEA 4PN3A 2PKQO 2CVQA 4GKVA 4J4BA 3OSUA 5JCJD 2I6TA 3PYXA 4DRYA 1TXGA 1VKOA 3DC2A 1ZMOA 3GRPA 3LDHA 3PLNA 2GZ2A 3HUDA 3KLMX 3K92A 4PLGA 3MWEB 4PG5A 1RM5A 2PK3A 1OI7A 3GMDA 5TJ9A 4M89A 2CDBA 4WCDA 3JQGB 3FSRA 1E77A 1CWUA 1ISIA 4ALNA 2GSDA 5KNLA 1QP8A 1MXHA 5CG1A 1J0XO 5DN9A 5B1YA 1HEUA 1ID1A 1BDMA 3RCBA 4HXYA 1S7CA 1TLTA 3GH3A 5EJ2A 3PP8A 1D1TA 1H93A 4BO9A 5TC4A 5JY6A 1F8GA 3HSKA 5AQ1A 4GL4A 1P1RA 4BUCA 4CMEA 3NGLA 4FFPA 4PLWA 5A3JA 2D2IA 2NU7A 4NR0A 3FPLA 2ZYGA 1NPYA 3T4EA 1VE9A 5JBIA 3ROMA 4CLHA 9LDTA 3AY7A 4PLCA 3VAZA 2J8ZA 3QE3A 4PLHA 5T8KC 1XHLA 3TSCA 5K6AC 2QYTA 4B4VA 4QUKA 5KJ6A 3ZU3A 1JTVA 5F1KA 3WDSA 1XQ6A 4CM8A 3CINA 1U8FO 2PKRA 4CLXA 3HADA 3Q1LA 4EITA 1BSVA 4ZQEA 1MC5A 1EUCA 3ANNA 5DCYA 1DXYA 1IY8A 1CIVA 2DBRA 4DGSA 1V3VA 1C3VA 2QIOA 4GVLA 3ZV5A 1V3TA 3KV3O 3WJ7A 1KBZA 2IXBA 4RQTA 5IN5A 1AN9A 1SOWA 1XWFA 2X8LA 3UH1A 4BGUA 4URFA 1PJCA 4OH1A 1HT0A 1Z73A 4JNKA 4BNTA 4QFCA 4IDDA 4BMNA 2FMUA 4I5FA 5FEUA 3TL3A 5HWSA 1R4MB 2VWQA 2YW9A 3OIGA 3GN1A 4WCFB 3FBGA 1N7GA 2ZCVA 2ZKLA 4GX1A 3OP4A 3WYEA 2WDZA 2VHWA 2P4HX 5A05A 2W4QA 2P5YA 2H5LA 2AQHA 4NK5A 4K6CA 2BELA 4HV4A 1O6ZA 1ZSNA 1HE3A 4I08A 3TRIA 3H2ZA 1PJ2A 3ZNPA 1CEQA 4RV9A 2Y1GA 2NVUA 3UN1A 3WX0A 4J49A 1JW9B 5EINA 3L0DA 5I8ZA 4YT2A 2XAAA 1YB1A 1W0CA 1X7HA 1BWSA 1E3JA 1RWBA 4IZIA 5THQA 3RBVA 5K1SA 1U28A 3HHPA 4NBUA 2PWZA 3JQ8A 2ZIZA 3E48A 4JBIA 1DFIA 3NTQA 5A9SA 1H9AA 1GQ2A 4YJGB 3C8MA 1QMGA 3GFBA 3RU7A 3MEQA 3IP1A 5B12A 2UAGA 1I2ZA 3DXFA 3TZ6A 4YR9A 4GX5A 4WASA 2C54A 3TPCA 1MA0A 3Q6IA 1GYQA 1XG5A 5JYEA 2YQ5A 2CDAA 3U0BA 1ZK2A 4BO4A 2D0IA 1D8AA 2X0JA 3B1FA 3LLVA 4NNJA 4KDEA 1X0XA 5EESA 3PJDA 1IE3A 1QLJA 4RDIA 4LCJA 2EIHA 3E5RA 4YAKA 2Q4EA 4AVYA 1IL0A 1VJ1A 3EYWA 4DREA 2HJSA 3U9LA 4D45A 3SLGA 4FC7A 1H94A 5ER6A 4RVGA 4TRJA 5LDHA 2C29D 2DT5A 4RL6A 4B8WA 3QY9A 4IM7A 3RU9A 1TT5A 5G2OA 3ITKA 1QYDA 3BIOA 3EVNA 3GEMA 1LX6A 1LNQA 4YWJA 5MGBA 3OIFA 5HS6A 3AOEA 2PH3A 4RF2A 1HXHA 1O0SA 5C3MA 2PGDA 2PA3A 2O3RA 4H3VA 1ZSYA 4HFRA 4Q3EA 4IQ0A 3GDOA 5TGDA 1GZ4A 4IDBA 5IFLA 3E6AA 1P0CA 3C7AA 4CLEA 3OF2A 5JDCC 3SC6A 4J0FA 2BFOA 3VDRA 1BW9A 1V0JA 4CJXA 3LK7A 3KB6A 3NGXA 2DQ4A 3AUAA 1BXGB 1HDCA 3KRTA 2D1YA 1R15A 1BXKA 5G4LA 3GDGA 1QSGA 2Y68A 3STHA 5IDQA 4UEJA 5G0UA 3ZU2A 3F1LA 6ADHA 1DIHA 3WBFA 1KC1A 2A4KA 3FNEA 3ICCA 3M1AA 1B14A 1UXGA 2P9GA 3TZHA 1GEGA 2OO5A 3ETDA 1DDOA 1XR3A 5COQA 5K9ZA 2JL1A 1ZW1A 4PG7A 4UUOA 3I3OA 2VUUA 3MJSA 1R0SA 2WEKA 3W1VA 1NASA 1F06A 2PZJA 4ESOA 4CMHA 3LQFA 3FWZA 3N58A 3UHAA 4PG8A 3ON5A 4PGFA 3JQ7A 3KYDB 1RM0A 4JCOA 3I9OA 4UVGA 1A7AA 4II2A 4NBWA 5G4KB 4DLLA 1KVSA 3GQVA 3PJGA 4W99A 4BVAA 3IIEA 1MX3A 3ANMA 3CZMA 2G5CA 1UZNA 3I9KA 4NG5A 1EZ4A 2P5UA 4DBVO 3GHYA 4R1SA 3QIVA 4OOFA 3FWNA 1DO8A 3L6OO 4QXMA 1PJSA 2PFGA 1Y7TA 4UAGA 5A1TA 2GLXA 5H81A 5KKAA 2G0TA 4HP8A 2GRAA 1D3AA 5IDXA 1A7KA 1FXSA 1IB6A 1Y6JA 3WGYA 1PQUA 1MXFA 3ZDFA 5DP1A 4R69A 2C7GA 2Q50A 2AXQA 1MFZA 4DTIA 4K28A 5IN4A 1HF3A 1NBOA 2W2LA 3W8FA 3ZWPA 5L9AA 4TKLA 1M2WA 1U4OA 3WFIA 2VCYA 1FF9A 1UXKA 4XGIA 2GYYA 4IDCA 5CPBA 4BO8A 4RPHA 1YH3A 2YZ7A 4J1SA 2GPTA 3WGTA 3I6IA 3WS7A 4IDEA 2GR9A 2ZB8A 1T1RA 3OQ1A 5IZCC 4DBZA 4ALJA 1T2AA 2QW8A 4LRTB 5L4SA 1SNYA 4ONEA 1ZMTA 3LT4A 4O6VA 1YE3A 3PFFA 1ZJZA 3QVOA 4UUMA 3VHRA 3GVIA 3AUTA 1R16A 4CLRA 2VZ8A 1WZEA 2DC1A 3D4OA 4CQLA 4MIYA 3W8EA 2PD6A 2CD9A 1EQUA 4A7PA 2B5WA 1U9JA 2FZWA 5ICMA 3MOIA 5GY7A 3PI7A 4CQMA 3LVFO 2Z5LA 3WQRA 1SCUA 3UUWA 4JLWA 4MP8A 3TDKA 5DCUA 3OECA 3H8VA 3D1LA 3PZBA 4JQCA 3DBRB 5I7EA 2XOXA 4A03A 2B4TO 3QWHA 2PY6A 4TQGA 3MCVA 4AJIA 4W82A 3JQAD 3ROPA 1E7YA 3I4CA 3Q2KA 2C2XA 2EXXA 4RVFA 5F5NA 2HKIA 4GX0A 4R5MA 1X15A 3PFWO 1I3KA 3C1AA 3BMQB 3GLQA 4BNIA 4NPCA 1EVZA 1GR0A 3VPHA 3ZHBA 3KEOA 4CPDA 1PR3A 1D1SA 3FPCA 1ARZA 3AWDA 3GHHA 5FI5A 3D3WB 3T7CA 4GBJA 4XWYA 3HB5X 2X9VA 3BHMA 2BLLA 2F00A 1PJLA 1JA9A 3ZWBA 4YRBA 4MVJF 3PQFA 1H5QA 2NWQA 2Y0DA 5BR7A 1LDYA 1E3EA 4XYMA 1P77A 5JC8A 2JJYA 4E30A 1WNTA 4LRSB 2UVDA 1NWHA 3RUEA 2Q2WA 4RORA 3S2GA 1C14A 1E92A 3OA0A 4NDNE 3RC2A 4L0QA 4XYEA 3EVTA 1SZJG 3JQGA 4M55A 1V8BA 2Z1MA 1A71A 4TSKA 2C7VA 1T24A 3GF4A 4UREA 3DBVO 4RZHA 1N8KA 2X58A 3GGPA 3WGOA 1DHRA 2GASA 4PZDA 1DIGA 2OP0A 4IMRA 3TOXA 5KJ1A 1WWKA 1K89A 1KVTA 3GOHA 2V7PA 3DMYA 3GAFA 1E6WA 3DR3A 4ND3A 1H2BA 2V6FA 2VT3A 3U09A 2IEBA 3VPFA 2JFGA 3GK3A 1E0DA 4LSWA 4BKOA 1LLQA 3ETGA 3PWSA 4E6PA 2FHSA 1PWXA 3GRKA 4M49A 2NSDA 4Z9XA 4LGVA 4J43A 4MJLA 3CMMA 4H16A 4XX0A 3ANLA 4D46A 2B4RO 2FP4A 2DTXA 1EVIA 3VOSA 3DZGA 1AHIA 3GFGA 4ZQGA 2W2KB 4O5OA 2NVBA 3NJ4A 4RPKA 4YRDA 1EK5A 4MINA 1N92A 3JQDA 1T2CA 4M87A 3JD1A 1UUFA 1QYWA 2UDPA 4TRRA 4D44A 1MFPA 2DFDA 2PV7A 2AW5A 3OJOA 1HETA 4LSMA 2X1HA 5AXDA 1C0IA 1Y8QB 2HMTA 4Y6RA 2VYVD 4KP7A 5G0VA 1M6WA 4BNJA 2EV9A 2NVWA 2FWMX 5KVSA 5DP2A 4J1NA 1QRRA 4FGSA 4GAEA 1R4MA 3WTBA 2O3SA 1Y9EA 1QLHA 3KVOA 2AG5A 3L6EA 4WCFA 3ZH2A 1HLPA 1HSOA 4R1TA 4U0JA 3DOJA 2HU2A 1PJ3A 1U3TA 3FNHA 4WPGA 3IQDB 2DKNA 4GWGA 3U62A 1H9BA 1SBYA 4GGOA 1PS0A 1B3BA 4NFYA 5U9CA 1I3NA 1UH5A 1ZSVA 3U3XA 1I2BA 5KVQA 2QHXA 2OHXA 2VN8A 3ST7A 1B8PA 1KEUA 4J3FA 4E0BA 5DZSA 1GUFA 3WLEA 4RO0A 3U4HA 5A02A 4D41A 3JQ6A 3BXXA 4FJ2A 3WLFA 3LC2O 1OC2A
chains in the Genus database with same CATH superfamily
1ZEMA 4KO4S 1AMOA 1P1HA 2YJ5A 2COKA 2DUWA 2FLVA 4PLPA 4ZOLF 3TLMA 4D3DA 5EWMB 1HV8A 5LQAA 2IVZA 1QIEA 3IPAA 5DWQA 4GSLA 1V7PC 2GWHA 1LGYA 1UPCA 2AOUB 2C0CA 4JLNA 4TWRA 2C5AA 2R8PA 2FSGA 5BORA 1SJ9A 2JKZA 3KYCB 1PZEA 1CZOA 1GPBA 2VG8A 4KNVA 4MR8B 1F17A 3MXTA 4J4HA 6GPBA 4CKZA 7ADHA 1GFIA 2YZNA 3LG2A 3AHIA 1HZJA 3MHTA 4J7UA 1TYAE 1IM5A 2JLSA 1Q77A 3BIWA 2GKSA 3ZZ0A 3NOOA 3EMKA 3CR7A 2GXAA 1OWOA 1DBQA 3NNNA 2BGNA 5H9WA 1IN7A 3G02A 3KZXA 3QF4A 5BR4A 5CITA 1GTZA 3UMYA 1VYTA 5LA6B 5DHQA 1G38A 3MMPA 2I0FA 1MPTA 3WAGA 2C9MA 2G9RA 4RABA 2GTPA 1R5JA 5CCBA 4BNDB 2Q7OE 4NECA 3N87A 3T52A 3VZDA 4QUEA 3WGVA 1V2HE 3PF9A 1VG1A 1PK8A 1S2LA 4IIJF 3U4GA 5MHTA 4LJ9A 1U8XX 3SQWA 2XECA 3O3NB 1H6BA 2BAGA 3O9ZA 4A26A 1CT9A 1FTWA 1OH7A 4TWIA 3L8EA 3U16A 2QL6A 4EY4A 3HXKA 3M3PA 4MZXA 1W36B 1W29A 3IBGA 4B7CA 4BO3A 4Z4IA 4Q9IA 3QLTA 5DGTA 5BUQA 3KDSE 5AW9A 1MW8X 3DTNA 5ENDA 1WXHA 2I4NA 2Q27A 5CX4A 3TUIC 5F98A 4ZEMA 1J4AA 4D3XA 1Z29A 3VR6A 3TLZA 2YHSA 3ZHTA 4EKYA 5KSYA 3A9TA 1G8PA 4OQDA 5IK2D 2Q5IA 1KETA 3K15A 3EH1A 1XQXA 3V1YA 3AZPA 4BL5A 4EVRA 3CPSA 5DLDA 1XRQA 5IU6A 2JNWA 2V7WA 3K8YA 4CF5A 2NU6B 5AI4A 3BCHA 3E5MA 1W4CA 2BGGA 1X3LA 4G0PA 3FPFA 3VMMA 1KSJA 2X6RA 3JQ9C 3U3ZA 2UYCA 1R5NA 2VWGA 5AOBA 1II8A 2IH5A 3T7SA 4X20B 3V8EA 4B43A 5K7SA 4O4LA 5FR1A 4ZT4A 4ROSA 1C30A 5BW4A 3OTHA 5KSZA 3KQSA 2JARA 4HAVA 1XRRA 1XL0A 1U6KA 3SS8A 4ID3A 4P35A 4X7BA 3C3BA 3OD1A 4X8HA 4M88A 5FP0A 3GH1A 4LYGA 4Q21A 1AA9A 1AK9A 1IYZA 1FFXB 1GQSA 1N5IA 2A33A 1SZCA 3FGOA 3WK7A 5EIBD 4I9UA 3M6IA 5LJLA 5LYJF 4LZJA 1JG6A 3ER9A 3A6KA 1U11A 3QHAA 3KELA 2P9YA 3E3LA 1GGJA 2PKCA 1UDWA 3GLVA 1QGAA 3AFMA 3AESA 1WSDA 1G5IA 4OJKA 4PNPA 4OFBA 3FHCB 4ECAA 5FKJA 1FSGA 3BQ9A 4DCTA 4EFMA 2WW8A 2HRCA 4E5PA 1HDOA 1M2OB 2V1XA 3AR2A 2G63A 3L1VA 3GLIB 4YHHB 3UW3A 3GT7A 1M67A 2OD7A 1WXGA 3FWHA 4UBLA 1SUWA 5BNFA 3OZSA 1YZTA 1N2OA 4XZ3A 3SPXA 2FRDA 3TW6A 4C01A 3ZDZB 5HX7A 2D1SA 1ZOIA 4DMMA 1UXIA 3E4DA 5IF9A 2IYRA 2MDTA 1AZTA 1JDBC 3IMCA 3QVVA 4FQ7A 5KYUA 4LHEA 1A98A 1E6CA 4S35A 3VKFA 1K7XB 4RF3A 4ZPJA 2BEJA 3HM9A 2R00A 3ECSA 1OWMA 1MRNA 4DFDA 1TEHA 3KTFA 2A5FA 3D64A 3HBAA 1YR1A 4X1YB 5CUQA 5LQJA 1XTBA 1JMKC 5E2AA 4ATNA 1QGDA 2I29A 1EM6A 1JT9A 3KHKA 3H2GA 4W8HA 4DCVA 1HNZB 1JDUA 1IHYA 1T4BA 5JCJA 4B3HA 4PZ0A 1OPRA 2BP7A 3LQ2A 2YY6A 3D6AA 4QDOA 3ROEA 5KKNB 3TIGA 3MIZA 2IHYA 3HRKA 3LUJA 2DX7A 5HM8A 5L45A 3H1GA 4MDEA 2CHEA 2IKSA 2Z1DA 1VKZA 2ZIFA 3D3JA 4RQUA 3D4LA 3E0QA 3IAXA 3VYTB 4GXNA 5AW4A 3VKGA 4LJ5A 4U3JB 4A3SA 2ECOA 3HVKA 1E94E 2F3RA 1TCBA 4FEYA 1S2NA 3AGPA 2SHKA 1DAOA 2IZ1A 3I2KA 4RTNA 3FKQA 1LBSA 2XF8A 4B1FA 1YGPA 2PGLA 1HNNA 1W34A 2ZJ4A 5JDIA 3AVWA 1VJDA 3R0JA 3FFTA 4RLQA 4DY6A 5DM2A 6YASA 3KCNA 1T2EA 2NM0A 4JJ4A 4ES6A 3GVXA 1QR6A 1TJ5A 3PVZA 4BE4A 1G9TA 3KD3A 1RLMA 2KSQA 2AZMA 4KPUA 1XZGA 1X1EA 5EKDA 1T25A 3OQ6A 5AVTA 4R2JA 4ZYLA 3F6RA 3WOVA 2QYOA 2YVKA 3EVZA 3VZRA 1I4WA 1JQEA 1RQRA 3ME5A 4TTTS 2CF5A 4B44A 1H2WA 3FDJA 5IT5A 4MV0A 3ZQKA 2GO1A 2Z58A 4D1YA 2EWMA 4BLOA 3BMQA 4ARUA 2H0RA 3IOBA 3MERA 4KDCA 4KSCA 5DNAA 4NCNA 5E6UB 2IS4A 1KP2A 4HT3B 2CXHA 1Q44A 4ITUA 2XTAA 1NATA 3A1VA 1R10A 3ESZA 4P2GA 4PX2A 4RZ2A 4DCUA 4D9IA 3HXOA 1RRCA 1BEEA 5IH3A 1HA3A 5KNDD 4BYMA 3I01M 3LUFA 3MXOA 1XZKA 4L07A 3HO6A 4ND4A 4Q3NA 5EIBC 3IUBA 3ASUA 3INYA 5F4ZA 4WFKA 1Z5UA 1YAJA 3FPKA 5ITSA 5CAEB 3CX8A 1JX6A 3RSGA 4UAVA 4XSHA 4CIWA 3O31A 1A0OA 3DKVA 3I62A 4R3NA 5D01A 3AVQA 4D3FA 2GUGA 1U9ZA 4WY8A 2RIRA 1N77A 4LC1A 4ZMBA 3C5HA 1KJJA 1XEFA 5FDFA 3OCUA 1XTZA 4JR1A 5LD2C 2Z8YA 3UXYA 3EARA 1JIKA 2RBEA 2AUNA 2GO7A 3KJIA 1DNPA 3OE7D 1PJRA 4L28A 4QHSA 5G0SA 3SYRA 2ZRHA 2A9OA 4TTSA 1Z7WA 2E4ZA 4NI5A 1V3QE 1KO8A 1TYDE 2EJVA 4LVOA 4UUNA 2P6MA 4OGKA 3OE4A 1FRQA 1SEPA 3FRHA 3LSTA 4S05A 1ITZA 4HDOB 1LY1A 3OQVA 3UAWA 5M7EA 1YBMA 5CLGA 3UUGA 1G1AA 1KFKB 5DEIA 1F6BA 3FVWA 5IG2A 5JWOA 1I4TD 4Z3DA 1LFAA 2J6IA 3S8EA 4G0YA 2BH2A 4A6XA 3RT1A 3M8KA 2I76A 2WTUA 4QGHA 2X4LA 2Q1YA 2OHVA 1B0UA 1WQ1R 2C9YA 4FYMA 3TG2A 1U2GC 4TSRA 2WF9A 3AHGA 3E9YA 1BIFA 4BN0A 4D8YA 2PUDA 4ETWA 4RX1A 1UK6A 3ZNNA 3CRZA 4TMYA 1H0HA 4GBED 4URXR 2AQIA 4M22A 1JECA 1G7TA 1DC5A 1XCGB 1ZH2A 2XRYA 1U7XA 1Z6GA 2ERCA 3H18A 5DPMA 5C8VA 5KPJA 3VHXB 1ZUHA 3LCJA 1CNFA 5A3RA 4G5HA 3EZ7A 4IQFA 3GG9A 2B8JA 2ES4A 1EK6A 1DWUA 2G9QA 3TL2A 3M6FA 1O8CA 1C41A 2C2BA 3V33A 3CKYA 4IY1A 1GTG1 1T3SA 1ZZGA 5CNMA 1YVPA 3FETA 5E9AA 4M7OA 4C3VA 1VQ1A 5HJ5A 4N03A 2BCJQ 2O20A 1J8FA 3JQRA 2QOEA 3MPOA 1EBUA 3IOEA 1M2FA 4KQ1A 4UAJA 3NV9A 5JMTA 2X22A 3DTYA 2J5KA 3ZU5A 1M75A 1USGA 5DSZA 4WLOA 1ZUIA 3EE6A 3OUZA 1QOQB 4FLEA 3BTVA 3I6MA 5GZ3A 1IUPA 1SVUA 2EJCA 1FCJA 2WWIA 2XUGA 4G0QA 1GP2A 3K53A 5LDDC 3TIFA 3AR6A 3N5CA 3K3PA 4P3XA 4XJTA 1BU5A 2JHCA 1U2DC 2Z6VA 2ATIA 2C4VA 2VJDA 3LVBA 3PPIA 5C1IA 3TUZC 2IBTA 1SUFA 2XKKA 5DBFA 2QV0A 5JJLA 2FEAA 2ZB7A 1IJEA 3AM5A 3FKSD 1FMTA 3AJEA 3DP9A 2IQIA 3HM2A 3IAS1 3D3EA 3UMSA 2KS6A 4LHSA 2Z09A 2J3MA 3MJCA 4TV9F 3TCNA 1JG3A 1NHGA 3CRRA 2LVBA 2ZAGA 3H2YA 2WUEA 3HA3A 3WNVA 1CR1A 2JI4A 4TSFD 3ZHRA 1VYHA 3S2IA 1TEVA 2AX3A 1D2HA 2PBRA 5A3QA 2WHXA 3NBMA 2H7VA 5DCLA 4CMCA 2NU8B 4AP6A 1JR2A 4C0BA 2QRKA 1ML3A 5JJBA 5JMPA 1TU0A 2W8ZA 4RPGA 3P20A 1WOYA 4HLUC 4JB3A 8ATCA 4DIBA 3L5KA 4EY3A 3EEFA 1O94A 1TJPB 2IZ6A 5JSHA 5FPPA 3LC0A 1NUQA 1BX3A 1U8CB 1EP9A 2C3YA 1M7HA 1QUEA 3REQB 2QPAA 5KOHA 4C7KA 3E18A 2K5UA 1BA3A 1ABBA 5GIOE 1OKKD 1S1CA 1WD5A 4LBVA 4UJ5A 5DFAA 2ZJFA 4J6EA 4E5UA 3GWGA 4WLUA 1WF3A 5BSMA 5AP9A 1YCDA 5FUVA 2ONJA 5AW2A 2HRQA 3IAUA 1CJKC 1GXSB 1E4EB 1YJQA 2GI4A 3F6PA 4HGQA 4DNXA 3E8XA 2XYRA 5A7HA 4PSCA 1UXOA 1E6UA 2H51A 2A58A 3AZQA 1R4NA 3VOTA 3V4FA 1VG8A 3K70B 5JH7B 3JQFC 3QVSA 2W6JA 5HPYB 1LXCA 1Z5WA 5EJEA 5LMCA 4JT2A 3BXPA 4HFMA 3SDSA 3LQ4A 1GZVA 2Q2NA 2QV7A 3N2GA 5F3DA 5A6SB 1EXVA 3WKBA 1AKYA 1E1KA 3C6YA 3HP7A 4WTOA 1X77A 5CH8A 3QXGA 1U3GA 4JOBA 2ZJ7A 3EMDA 3LYLA 4JOQA 4YRLA 4ER6A 3E9DA 1FLVA 5JMWA 5DK6A 3NYWA 1EB8A 4MDFA 5A7GA 3R7NA 1LW6E 4KFTA 3TMYA 2PZLA 2ZRIA 3OT4A 3ZC3A 4L3VA 1TA9A 2VJQA 3M49A 1JIXA 1J49A 1ULSA 4HMOA 4Q1AA 3DHWC 1EFDN 5KYNA 2W6OA 1WCV1 1YS1X 3GFOA 3HZHA 3LXRA 1XVIA 4IFEA 4BNJA 1T8SA 1ZWLA 3M6XA 4MUMA 3LO8A 4NP6A 4XWAA 2EATA 1XMOB 1UEIA 2XV1A 1BMFA 3GJZA 1RAEA 4R3UC 4S0ZA 1PL0A 1SA0B 5DTRA 3EB9A 3P45A 8ADHA 1E7SA 1IQ0A 3X2EA 4W63A 5D5PA 4RSGA 4IRUB 1T1JA 1KERA 1GCAA 3A2MA 3BHJA 4G36A 4TQAA 5HFJA 2G5PA 2QSYA 1EVJA 2EJUA 2PYIA 4LPKA 5EUMA 4Z2YA 4QASA 1F9EA 4JR0A 2M98A 4KIJA 4Q01A 4M2LA 4PLTA 5H7XA 4R2WA 5K20A 2LP4Y 1U1GA 2VAVA 4N48A 3UJ9A 4XGNA 5A03A 7GPBA 2RHRA 2ZANA 4HRXA 2B98A 3M1IA 1WABA 1GCOA 4IG4A 1SU6A 3RSHA 1QHEA 4MQFB 1H8HA 2RIPA 1WD7A 3R9WA 4AY4A 1U8ZA 1Y4UA 1Z2CA 2MINB 3NHSA 3QVTA 2XH8A 3HZOA 5AUNB 5BN4A 5IKMA 3LW8A 4RULA 1V3UA 1QR2A 3ONNA 4C0JA 1V8PA 1G6KA 4IUDS 4MQ5A 4Y2RA 2ZRNA 3RHZA 3U56A 4CIVA 4ZDIA 3FPJA 2BFAA 1X13A 3EGDB 5IVHA 1E8DA 1K86A 4S1PA 4I1PA 4MQBA 2IYOA 3HB1A 4CF6A 2GXUA 1RKUA 2LE0A 2FF5A 3B1YA 4GKAA 3TTYA 1REQB 2CVHA 2IY8A 3TDNA 2NZ8A 4BMDA 1GQRA 1UC4B 2HNAA 2F43B 3R7WA 1VXOA 1PFUA 2P75A 3UNXA 2HDOA 5CLQA 2IS2A 1E0AA 1RC8A 5FAXA 1YUBA 3T4UA 1ZG3A 4E5VA 2ZI7A 1M72A 2FUEA 1QO9A 4LDQA 5E4YA 1L8OA 4RCZA 1HDXA 1BGXT 3QG5A 5J23A 4C0XA 3AXTA 1JFVA 2QUBA 3HDTA 2EF0A 3JQAA 3K31A 1J2EA 4X0EA 2E21A 1E8MA 2WD7B 2B8WA 3DE0X 3D0QA 3TLGB 2POQX 1VL6A 4MWGA 1PGOA 1ENOA 2FN8A 4R2IA 5DHTA 1YJXA 1GYPA 5T7BA 1W1UA 1G8HA 1TUBB 4ILKA 1KS9A 3HGQA 4RM2A 5A0VA 3GT3A 1HQKA 2WG0A 3IPLA 1NBAA 1VKJA 1VSTA 4GFDA 1N33B 2YOGA 1V8DA 4QD3A 2I91A 2XAUA 1ECLA 3QPAA 1J2TA 1X7YA 3P8ZA 4YP6A 4L4RA 4PSAA 3KAJA 1LLDA 3WRXC 4BO6A 3HBJA 1W75A 5BOSB 4PLVA 1JR3E 1NAHA 3MWDA 1NF3A 3OQIB 1L7MA 1U8YA 1R50A 4JT4A 2IU0A 3AVVA 1GRNA 3IALA 4QBTA 4ZK6A 1T3GA 4X3CA 1PD1A 3ZUGA 4U2EA 2P3QA 3AOGA 1C7EA 1AGRA 2ZRPA 4ZVRA 1RHKA 2GHRA 3JYNA 3G2MA 4DPKA 1RAIA 1DKQA 3Q87B 1QH1A 2P9JA 1Y9JA 1YL6A 3QSGA 4ISCA 1UQUA 5EZYF 4G8JA 1E9DA 3PFNA 3ZE6A 2CBGA 5E4FA 5JS8A 3KZMA 4XVQA 2H18A 1E4YA 3BK2A 2ZUUA 1ACJA 3PLRA 4GMHA 4Y1RB 4OFXA 4DEXA 2CJWA 4QLOA 1F8XA 3HKEB 2JIPA 1PWZA 4I5EA 4UDOA 4JUFA 2B1GA 4JK3A 1XDBA 1W5EA 3IAAA 2C3OA 4I0WB 1J5PA 3FNRA 1GUYA 5IKXA 4IV5A 1FJGB 2C5LA 2VR1A 4KI7A 1A1SA 2JGIA 1PBNA 4JSRA 4C2BA 5JECA 1YO6A 4R54A 2BKEA 4G5FA 4MWSA 2OCAA 3WKCA 1ZM4A 2Q5CA 3A05A 5K51A 1TIPA 4E4RA 1FSFA 1SVMA 4RK4A 4GZ5A 3QBEA 3FJOA 1YS7A 4RM3A 5AMXA 3TZQA 1XHFA 4Y2TA 3RVRA 1B1CA 1UMCA 2O2YA 4PRLA 4HR7A 4LWZA 5IMSA 5KQSA 1UJ6A 2B25A 3JPYA 1SU7A 1UADA 2OL4A 2CE2X 4RKRA 2G36A 3CB2A 4DA0A 3HLKA 3NIBA 4GP6A 2ATXA 4XIGS 4IL5A 3WDKA 3AY3A 2DT8A 2O2SA 5FOSA 2VNAA 2OK8A 1G8FA 4LWQA 1P60A 4D4KA 4JOCA 5FPQA 2I4MA 2C31A 3MK31 4WNIA 3JASA 5KX5B 1PJ4A 4HRVA 3KV1A 2GPNA 5CCEA 1IY0A 2UUBB 3WYFA 4PSVA 3GB9A 1QS0A 1M9NA 1ISHA 3O2QB 4ARBA 3DO5A 4IHQA 5CDHA 1UOEA 3SS7X 5ER9A 4P4GA 3T7RA 2X6TA 4ESVA 1W9MA 2ZQZA 5J63A 1AUQA 1G42A 4DYVA 4K0RA 4DR6B 1MO5A 4AZ0A 4LRUA 4RTKA 3DHNA 1VSBA 2AGVA 4K1XA 1ZVQA 4UCXA 4P2BA 5JT1A 2QPTA 1WDKA 3T1QA 4X97A 3Q5EA 1G5HA 2LKCA 1SC6A 5LP6B 3AHEA 1UOPA 4MPDA 3PUZA 4ND7A 4X41A 4BPBA 2XHEA 2L82A 3K0SA 1HEIA 3LF1A 1ZIOA 2FSUA 3O82A 2XCUA 4OLAA 4M86A 4Z4QA 3D7LA 3PGVA 3QOXA 4NDZA 4UTZA 3O0TA 2ZREA 3VH2A 3YASA 3ZY2A 4NNPA 4UBJA 3OUTA 4YB8A 3L6UA 1IUKA 3NAQA 4ZHQB 1EFLA 3GPDG 3T9BA 4D4HA 2G28A 2VPQA 5EKSA 4AP5A 4X6UA 1G0NA 1QTIA 1SCNE 1EESA 4C7OA 5I5GA 5E4JA 2DJ5A 4JJIA 2MT9A 5BSFA 5FF9A 3EFOA 3MRTA 3JQ8B 4KLRA 3RJ5A 3ZVKA 1KHTA 2I78A 5EHZA 1UBKS 3C85A 3JATB 2UXBB 1U7ZA 1XZAA 1Y1TA 4KDRA 4M9QA 5EA2A 1VSUA 2HXYA 4BNYA 3PEUA 1E1QA 2HUPA 3E7DA 4OQZA 2ZQYA 5E3JA 3CXRA 3H65A 3ZD6A 3CUTA 2J85A 3TPZA 1G1MA 1M1XB 4LNHA 2Q29A 4C4SA 1S3FA 4DILA 4O4JA 4WEOA 3ADPA 4G9GA 4L8YA 5FWXB 1OMOA 3F4KA 3E82A 3BGOS 2DSTA 3PNOA 3VV3A 5L7TA 3NPMA 4M9SA 2OXFA 4FYKA 2D59A 3GBSA 4YGYA 1TZ2A 2OYRA 2N0SA 3JD3A 4RKQA 7MDHA 1ZIXA 1M76A 2WYIA 1E9FA 4PX9A 5BSGA 2V7TA 1TIKA 3PICA 5FLXA 3KVVA 1WUIS 4OUDB 1Y81A 3OU7A 3GVPA 3ZZTA 3QFFA 1CJMA 4UXHA 1ZAKA 2MIIA 4BKQA 3DZIA 2O8NA 1LBEA 1P4AA 1BCRA 1CQPA 3A1TA 4COOA 4Q4LA 2NO9A 4K46A 2J7PD 3IOCA 2ZK7A 4CFYA 2CMGA 5F52A 3I9MA 3KM0A 4YEDA 3D3QA 3H0CA 2ZIXB 3R7AA 2ACEA 1KAEA 1XF1A 3UVEA 4UZSA 3PKIA 1SBNE 2YKGA 1RHMA 5LIPA 5ILGA 1HFKA 3A9WA 3NCTA 5DNCA 3H05A 4XWTA 5KJFA 1TKCA 2E4WA 1G60A 4U2KA 1PDOA 4Z4FA 2QL7A 2Y05A 1CJSA 1ORDA 3HLYA 1KEPA 2BMVA 2DQYA 2UZIR 3LE8A 2IP1A 2XMRA 3P52A 4XGKA 5EMNA 1G21A 2DUNA 5BQPA 2R1VB 3WK5A 3W78A 2EQAA 2B78A 3R7LA 4R1UA 1T43A 2H1IA 2WJHA 1M7BA 4M4SA 2A5GA 3CCCA 1QHYA 1JLRA 4A8HA 1CE8A 3JD4A 821PA 2PSJA 4IQGA 3LNTA 4FR5A 4CEJA 2OG1A 3MA0A 1K0UA 4Q5IA 2W9XA 1A2BA 5AVUA 3ILYA 2H06A 3MTJA 2AMVA 3A3YA 3GFTA 3O1IC 2VSQA 1KI9A 3RADC 1DARA 2WWHA 1WV0A 4ZIRA 2N3ZA 1RWOA 1BVRA 4A2PA 1RRPA 4Y9RA 3GJ7A 2F3SA 2IYFA 1EGHA 1H8EA 2JA1A 5C5DA 1LV8A 4ZC1A 3X1DA 1A9YA 3GL9A 3EQ8A 1LC3A 3HK2A 1GGKA 5L95A 1LRLA 1SXGA 3E9CA 4DR4B 5IDVA 1U1IA 3BTSA 3BE5A 3E22B 1O95D 3OAAA 1DQYA 4IXWA 4WUVA 3VH4A 2WIJA 2RHGB 3GNTA 3URMA 1PDWA 3DV0B 4XYBA 1Y5LA 1M8PA 5FYQA 1DTWA 2I3BA 3QMWA 1CEYA 5ECDA 3I6ZA 3C3AA 4KSBA 1G6Q1 1WP4A 1WSBA 3UHJA 1SUIA 3QRWA 3WISA 1ZIYA 1JEYA 3A4YA 1PHPA 1R0WA 3PK0A 4H1TA 3ESYA 1TCCA 2F1KA 2RAPA 2ZR0A 1MJNA 2IK8A 1FQOA 2HSZA 2QN1A 4OJYA 2WJGA 2HRDA 1KYVA 2QG9A 3EQ2A 1PG5A 2BY4A 2NSYA 1YQ9A 2KB0A 1E5VA 5TGZA 3IEXA 5KPDA 1HRDA 1RRFA 3EZXA 3ZU4A 4G1CA 4O8CA 1TLFA 5BYKA 5CB4A 4G8BA 2YV5A 4RJJA 2JLBA 2OZKA 3NS7A 3COVA 4MVWA 4JX8A 1YE8A 1B6SA 1YBHA 4N9QA 2HIHA 4OQEA 5FJJA 4Z51A 4Y9DA 2NPIA 2XUPA 1QUFA 2GCIA 4U2BA 1Z4NA 4WINA 3SHFA 3W9BA 1J5EB 4KWHA 4TL8A 2PANA 4DLKA 1NLMA 5KOJA 3K2EA 2CWDA 3BIJA 3HY4A 1CQIB 1TK3A 1COWA 2KI5A 2XOEA 4C7VA 3F98A 5BR1A 1FU8A 2JRLA 3DMTC 3K0FB 1ZMRA 5JAQA 1I32A 2QVXX 3TDMA 2BCEA 4JGBA 4W7HA 4EW6A 3VM6A 3RFUA 3L1KA 1E2FA 2W2OA 3CURA 3AB7A 3L2OB 3PNBA 4JMLA 4KXVA 3TL6A 3ZIUA 2DVMA 1TTTA 1Y3AA 2DB3A 5K0NA 5JCOC 2WUFA 3NHRA 5KJCA 1HM5A 1VLMA 1MP0A 3OT1A 3ZGYA 3DEHA 1K27A 1N2CA 1ZONA 3D6NB 5LZ5A 3ZE8A 3RVPA 4CN8A 1YDGA 3RRFA 4LCEA 2NPOA 4MUBA 5DYYA 1NMSA 4AZ3A 3X1YA 4J0QA 4LJYA 1GZ3A 5TR9A 1UAYA 1NM5A 5HHTA 1GL3A 2Q6TA 1E0SA 3E2PA 3HE3A 5DIZA 5GMOA 1I94B 2QIPA 3E7FA 1JTFA 1KMMA 1Q3KA 2PO5A 1PEAA 4PBTA 2HBZA 2H54A 1H2HA 4E88A 3K9WA 4DUZB 3O4FA 4M38A 4Q48A 4XUGB 3VI4B 2HMSA 2R2GA 1Y8RB 3QXCA 2IHZA 2GCOB 4FWIB 5IJ9A 4YALA 4M3NA 4FOTA 5FBLB 3AM4A 1NL3A 2Q0SA 1EA5A 2E4YA 1Z47A 1M3SA 2ZXFA 3GRAA 3EQ6A 3HA7A 3NCHA 4TLDA 3DAYA 3ZHUA 2YR0A 2JC3A 3KWLA 3QLUC 5EIAA 3RDPA 3RVMA 1JSXA 1Z0FA 2OXEA 3NALA 4MRMA 4MWBA 1B8VA 2BUAA 5D87A 1XQ1A 4ZJZA 1F7UA 1GU0A 1MJGA 2CFRA 5EXPA 3TW4A 2ZUFA 1IUOA 1Y80A 4UHFA 1SXHA 5ELLA 1W73A 4AG6A 3VPSA 4ZRNA 5A4JA 1QWSA 1YNSA 1TZJA 2VPXA 1CIJA 4Y3UA 2ZR9A 1TLLA 1UPFA 1I9CA 1IG3A 5K2MA 1E1RA 3KSMA 1N1EA 1EBFA 2WUVA 3I61A 4D9NA 4JEIA 4Y6SA 4X7RA 4HO1X 1N0HA 2D1QA 2PQMA 3HPRA 5JBQA 5HKBA 3VUFA 1I9GA 1Z74A 4HAYA 4WGGA 5C8XA 5FLEX 1T0HB 5LB2A 1Z13A 5HJ2A 3DEFA 1G5TA 5IAAA 1NZFA 3EEIA 3TNDA 3GG2A 3OKCA 2WJJA 4CXMA 1UMDA 2Q9AA 2FR0A 5H80A 3OLYA 3C48A 5IZ4A 3OOYA 3PEVA 2RI6A 3L04A 2NXEA 2UYOA 4HNQA 4HEA1 3DCYA 2UVQA 3A1SA 2PX4A 3HFSA 1NSFA 2OILA 4UM5A 1D2RA 1Y3HA 1XJ5A 4WKOA 5I7HA 1Q2XA 5IABA 3DEJA 1C7JA 3C3XA 3OEHD 4IYRA 3HMKA 1EAYA 3D4NA 2VJBA 4J0GA 4CEIA 4ENUA 1YR8A 3ACDA 5KWJA 3FD8A 3JRNA 4BQNA 4NQZA 4KXMA 3W5IA 3QBJA 4HXGA 4J6FA 2YBDA 2C7QA 5BWLA 2ZVPX 1NBME 4JIGA 2J33A 3U3OA 2YMPA 4BV8A 2F8SA 2FMIA 2APJA 2EBHX 4MWOA 4DIUA 4KFCA 2QBYA 4G4IA 5M5BA 3ZLJA 3GJ0A 5B57C 1JN0A 1BAPA 1O96B 4ALLA 4Z9FA 4EUEA 2IOHA 1I4OA 3RWBA 4LYHA 4TMZA 1T8RA 2HJWA 3EZYA 1TFUA 2P2GA 4W1QA 2XUIA 4MGIR 3IJEB 3UB3A 1E2HA 1E4VA 3WA6A 4ETIA 4DNFA 9ATCA 2JBWA 4WOCA 3TM5A 1BE8A 3AM3A 3BMNA 3FN4A 4P34A 4DVJA 5AHOA 3U6KA 1Z0DA 1WHSB 3ASZA 1Z6ZA 4KKVA 1EDBA 1PL7A 4I1RA 2AI3A 2AI2A 5FWAA 2P67A 5H83A 3UAOA 1N1GA 3PEYA 4DWOA 2AE2A 2SECE 4WT7A 3X0DA 1L5HB 2IYSA 3OPMA 4G1MB 2HH9A 5LMZA 3HCWA 3FSGD 1DAPA 2QTLA 4HYYA 4P3PA 3MRSA 1A9RA 3V46A 4D9CA 1E1MA 2R6GA 4RACA 1USKA 2C1XA 4C5BA 5HIKA 5L3VA 3I5XA 1N36B 2ODPA 3KQKA 3JVUA 4E5YA 2E37A 4UM9D 2X3YA 3RTCA 5FHRA 1E9AA 4EQZA 2C7OA 6REQA 1H05A 2I67A 4O2LA 1ORHA 4ZOQI 1C9NA 3AIMA 1NPTO 1PGNA 3K6KA 3Q8XB 4Z54A 1NJ1A 1EVLA 1H0KA 3GLHB 3GO4A 3OVMA 4F2PA 1ZLYA 2PN1A 4RTSA 1JG2A 1UOQA 5E7JA 1VMEA 3LP5A 1P4JA 1UP7A 1PFQA 1V26A 1ZUNA 2AUMA 4G2NA 4MV7A 3UWPA 2ID8A 4MUNA 2OCPA 3V6LA 4BX8A 3PDIB 5KQMA 1XDUA 1BTOA 4LX0A 5DYGA 5JRZA 2FMTA 3AI1A 3VH1A 2QZJA 1IEVA 1YUNA 4OX9Y 2V55B 3ET5A 1SQ5A 4OX9B 4CIDA 4HNGA 5D3MA 4R4JA 1KVUA 3ORYA 3BWMA 3TE7A 2CHVA 4TTJA 3QKSA 3L4SO 2ZTMA 3LQRA 4MV9A 4Z86A 3RVJA 4AG5A 2VJAA 1SURA 2HFJA 3ORQA 4EGCB 2F59A 1KU6A 1SVKA 3I4LA 3TEFA 3ZKWB 4YMVA 5J47A 2VSNA 5BSTA 1DELA 5DI3B 1R0BA 3ZN2A 2HREA 4YMIA 2RJOA 3ZK7A 5CM9C 5KNCA 4PC2A 4LC0A 3QPBA 4FE4A 4XQCA 3GROA 3QYAA 4Q7KA 5IVDA 2WNHA 4I6EA 1SVLA 2PVSA 3BA1A 4KW7A 5KTOA 4C1NA 4RFLA 4LJRA 1J1ZA 1IXSB 3ZW9A 4WJLA 2R2AA 2JD1A 4YRZA 4F45A 2BTOA 4DPMA 3TB4A 4YCLA 4E7PA 2E6UX 2LDXA 1YOVA 2B6HA 1Y89A 5EJ4A 2OTCA 2WVHA 5F35A 3LX8A 1MIOA 1SCKA 2Q1WA 3VMFA 5T5QA 5HCUA 1YB6A 2H65A 4FKBA 4I5IA 4CMJA 2D06A 2QE7A 4OHKA 4POAA 3VU9A 5AVWA 3F9CA 3Q3CA 3Q98A 1M1YA 4QTUB 2CYAA 1GILA 4MDHA 4YT8A 1EINA 1W25A 2OV1A 3T5MA 5AESA 3RUIA 5KNBA 3B9PA 3T0IA 1GG9A 1TT7A 2BTQB 5AM2A 4GI1A 2YYYA 2C8JA 2JDID 2AEEA 2CHFA 3CQ9A 4N5DA 4CBVA 1D4ZA 4QQRA 1M2GA 1T5HX 1XO1A 1YQEA 2CKDA 1VBKA 3LBHA 5G3ZA 1R0KA 1TF2A 5BW6B 3VGPA 4YRGA 4NATA 2GT1A 2YTZA 1GVNB 4I3FA 1IZZA 3Q0EA 4CKEA 4GYWA 4CMEC 4GLFA 1F3OA 3LX4A 3MOGA 3STUA 5ERYA 1K6IA 4KR0A 3WLHA 3ENWA 4Q1BA 4EMTA 2GN8A 4NBRA 5JSUA 4DV1B 4DQXA 4JJAA 3ZV4A 2JJ8A 4KV7A 2AOUA 1G20B 2WF7A 5KJEA 1XTUA 3EVCA 4REQB 1Y9AA 2GTIA 3TN7A 5BYAA 4WK4B 4YRJA 2WIDA 3R3YA 3U7QB 2VATA 5C2JB 2QN8A 3WE7A 5ITWA 4YIHA 2XMQA 1XXLA 3WRWA 4W7IA 1Z0AA 2WU8A 1PEDA 2Z08A 1CUYA 3GEHA 3RUFA 5FH9A 4NFLA 4CCAA 2R6JA 3PUKA 5REQA 4OP2A 2PXXA 1QQ5A 3GQBB 3VX4A 2X6QA 2ZYDA 4F1WA 3U4CA 5JNUA 4IJ5A 5BRJA 2VUHB 1EXDA 4LK3A 2O1SA 4G0MA 4DQUA 2P3SA 3C6XA 4AXBA 2TMKA 2ECKA 2HF2A 1C1XA 4AJ1A 1W2HA 2BDUA 3CRQA 3DFKA 3LKDA 2FEPA 4V0SA 4AMBA 3QPDA 1Z6TA 4FCCA 4IQ4A 1GV1A 1MAWA 1E2UA 4ROTA 3T38A 2Y27A 1DVRA 3H5WA 3DBLB 4ZI7B 1ZK3A 4HAUA 4HQNA 3QKUA 1GIAA 2Q5QA 2IDZA 2A5DA 5A4IS 2N42A 3BD7A 3IDSA 1OFVA 4MWDA 4YAFA 1R8QA 1DBIA 2Y99A 1I6KA 1SCAA 1AGXA 3U48A 1YJCA 5D6NA 2IIBA 2KM1A 2WM2A 2QM7A 3W7AA 5TMEA 3WXMA 2HDWA 4F5EA 5KVCA 1BGVA 1ULBA 4NPAA 3F5MA 1U3WA 1NSTA 4ZAGA 3G17A 4FGUA 1W5BA 1K5DA 4TTRA 1TAUA 2J0UA 2Q3JA 3STVA 1YNOA 4JB0A 5AW3A 1VIVA 4BB6A 4EZEA 3BX1A 1ISGA 4ARVA 3JZMA 3PXAA 3U80A 1SOVA 2Q3LA 3BAZA 1RPAA 2CLKB 1K8ZB 2SKCA 1WMAA 2A2ZA 1U1CA 3L4KA 2EG9A 4GD3Q 2OV4A 3I39X 3RIHA 2CZCA 1Z4MA 1S8OA 2INGX 4TZTA 1GV0A 5B4TA 4GOMD 1B16A 4TS4A 5HNKA 1B26A 1M1NA 1PG2A 2CXXA 2O48X 1D5CA 2AD5A 2P2DA 1WX1A 1NVFA 5FOXA 2ZUSA 4N6OA 1CV2A 1FK8A 4JI6B 4E03A 3W1WA 1HNWB 5B3AA 1H6DA 1SOAA 2FPRA 3ESCA 3K6RA 4HGOA 4I5DA 1U28C 5K0GA 2YASA 4CMIA 3IUYA 3DC7A 2IHTA 4E2ZA 3DJFA 3QKRA 3NWJA 3NXKA 1Y7HA 1KVQA 3QV2A 4FGLA 4PSDA 5F7OA 5JROA 1RJ9A 4RVHA 4OHUA 2XNCA 2VJPA 5JAZA 1IQRA 2ARKA 5FBKA 1U2PA 5AYVA 2VK8A 2WD8A 3AUJB 4UHDA 2BFCB 2NYUA 2HRBA 4C87A 1QYVA 1JJAA 1U0NA 3L7KA 3NFRA 1UFOA 1UMBB 1UP6A 3OQHA 4U6QA 4EUSA 5JYDA 2JVIA 5DTMA 4XARA 4LKOA 1YMUA 1KRHA 2ZW9A 4LXGA 1DJNA 2XVZA 1WNFA 4PVCA 1Q1EA 1QH8B 1U5BA 4E70A 3O4RA 1UM9B 4FS3A 5TVGA 3P2JA 2K7ZA 5AICA 1QC5A 1LA2A 1TD9A 2AHOA 3R6TA 1H4TA 4M9ZA 1M6VA 4A27A 1L5KA 2GARA 1S3SA 1MC4A 1P7ZA 1YS6A 1UFQA 4MKXA 5LR6A 3QWFA 1GEEA 1LVHA 1K4YA 3I3SR 4JVSB 5JWHA 1U6JA 1QF9A 4W5HA 1Z06A 2A14A 2J3JA 4RIFA 1KDPA 4CNQA 2MJLA 3L8MA 4IV8A 2BGMA 2PGOA 4ZYZA 3RFCA 4BMOB 5CB0A 3VZSA 2EQ5A 3GUCA 1FP1D 1GTL1 4L16A 4OATA 2JFXA 1Z6AA 3RARA 1U6IA 3STYA 3NLLA 4CCWA 1CY2A 1E1YA 1YRBA 4KMRA 4JP3A 4OXYA 5H0IA 3WIEA 4FDAA 1E2BA 3IV9A 5L40A 1A9PA 2ONCA 4YQYA 4Q3CA 4D9KA 3PE4A 4XPIA 2WTXA 3MSCA 5CVTA 4I4NA 2PX8A 3O84A 4MOWA 4AWXA 5AFSA 3WLPA 3UQYS 4HZUA 4HADA 2H3EA 1TVKB 1ZXLA 2DQSA 5E6RB 3DZHA 4MQEB 2XD9A 3JQPA 4EBBA 1L7AA 1RHUA 4LDNA 1P17A 3RVKA 4WOKA 1LPBB 4TS9A 3QK7A 1Z6YA 1B6TA 5K8VA 1SBZA 2Q6OA 2CUKA 1SUPA 3EHEA 3R0XA 4M0UA 4ND5A 1EX7A 3EH2A 1Z8FA 2ADFA 2QROA 4CODB 2J0SA 1IJBA 3LC7O 4RKEA 1ILEA 2CKMA 4R2HA 4ALMA 3HCNA 4E31A 4H6WA 4O1MA 5K03A 5IWAB 1NQ5A 3BEOA 1RTTA 4D26A 4J1QA 4UNIA 2A5YB 3KAPA 1T91A 4CM8B 4HBGA 5IJWA 5K01A 3KOUA 1IVSA 5F21A 2VZ0A 5K3OA 3ZI4A 1T1SA 3H4VA 1MQ8B 2ZVQX 2QJWA 3BMCA 4FBMA 4O5AA 2HIMA 2GKGA 2AE1A 4IJUA 5DM4A 2X41A 3G59A 3VNQA 4DRXA 2Y1CA 2P6OA 4ESHA 4L57A 1KKMA 3ICPA 1I13A 1ULUA 4QFMA 3TR5A 4H3SA 1ETUA 1XTIA 2O3QA 1SMKA 4GM4A 2GZSA 4CZ2A 4RA9A 4LNUB 1FJHA 2X23A 4YRMA 1Z4LA 2JATA 4QATA 1XIVA 1V96A 3B7PA 5JNWA 2PPLA 2ZUBA 3H2KA 4HDRA 3MWGA 4XTRA 4R3WA 1FLDA 1KTVA 1XZMA 4JH0A 3I9JA 3IVGA 3SXUA 1YBFA 4J9UE 1OLUA 5A04A 1KEWA 3DYIA 2SKDA 1JT2A 4O0LA 3LWBA 2WZBA 3GFRA 4WZBB 1UXJA 1CG6A 3BORA 1FDIA 3I2YX 4Q4CA 3IEMA 3FTQA 3NDJA 4KH1A 1J25A 5EJMA 3ZQJA 3DDUA 2I1LA 1YZVA 3LUHA 2C2ZA 2HF9A 4ZJYA 2ZRAA 3TMKA 5BNIA 4UFOA 4CLOA 1V5FA 1NIPA 2ZCUA 3BJZA 4GPEA 2YJTD 1JEOA 2EP8A 3HG7A 4D98A 3WWOA 1D0IA 4JKOA 4E14A 3GPLA 1GUDA 2NV2B 4HVCA 4OXKA 5K3EA 1OASA 1KY4A 3HL0A 2E0IA 1E0JA 1Y5RA 3QE2A 2OXTA 1KKLA 1A5ZA 4MB0A 5ECYA 3S99A 1LDMA 3VDQA 1VLZA 5I8WA 1PRYA 5F2OA 2KYRA 3IUQA 2E5WA 4XUEA 1XA4A 2I7TA 5F12A 4QBIA 2GFHA 2G08A 2HPAA 1DBRA 3CLUC 3HVRA 2I6FA 3WO1A 5HR5A 3IIKA 1I7SB 3W2TA 4BC0A 3GJRA 1MB2A 3T7JA 3D1JA