3UP1A

Crystal structure of the unliganded human interleukin-7 receptor extracellular domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
201
Chain Sequence
DAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Interleukin-7 receptor subunit alpha
publication title Structural reorganization of the interleukin-7 signaling complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3up1A02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up1A01
1CD1B 4OZFA 4PLNC 1NFDF 4PP1C 4QXGL 4J3OC 5E7FA 5FGRA 1ZGLP 5HI4C 4D3CL 4PJ7A 3L3DB 5E8EB 4CNIA 1NFDA 2X89D 4HAGA 1DUZA 4QTIH 5HYIA 1IM3A 2VDLH 4M8VA 3VXSB 3G5YB 4RZCA 3GO1L 4N90D 1JGEA 3G6DL 2AK4B 3GBML 4DKFL 3NFNA 4BQ8A 1KLGA 3GKWL 4FXKA 1V7NH 2CQVA 5I19H 5KSAC 3QXDA 3UMTA 2D03H 4WWID 2VR5A 2WUCL 3T2OA 3QEQA 4AEIH 3SDYL 1A7OL 3OG4B 5IJVB 1GAFL 3ULVL 4YDIL 1UACH 3PWUA 1WZKA 2P1YA 3WHXA 5I6XC 4DKEH 3L7FB 4MJID 4XPTL 5FF6B 3V5HB 4R4NC 4JPKL 5I6XB 4GG6B 2O93L 4XVSH 3I84A 3DTXB 2BSTA 3O11A 3O2VL 4TNWK 5DZNA 4LL9A 3FMGL 1DSFH 3HE7A 2IQAB 5A2FA 1CBVH 4P4RA 5I30L 2AXHA 4Q0XH 3UJIL 4I2XE 4XHJD 1WBYB 5EC2A 4LAJH 2FYYB 2XA8H 4AENA 3T0EE 4FQCL 3MBEC 1MFDH 3REWA 3O3BA 4K8RL 1KNOB 2MNUA 3MBEB 3QXAA 4Z8FL 4ZD3H 2BOBB 4M7JL 3JV5A 1NMBH 4OZGB 2A6KB 5ESAB 4Q74A 5E5RB 3RVTC 2G5BB 5C6TL 1IAKB 3VH8A 4U6XB 1QBBA 2R2HA 3LIZL 4XCNA 4HJJL 1C7TA 4ODWB 3EOAA 3HZYA 4GW1A 4YHNA 4DZ8B 1T1WB 3MLWH 1F4XH 5C08B 1KEGL 4D0BB 4P3DA 4P5TC 5HHOA 1EBPA 1T0PB 2ZUVA 2E6QA 3SY0A 5I18L 5TE4H 4A6YA 5D1QD 3FTGB 3VFUA 4P5TB 4Z18A 5HYSA 1FVDA 5JO5B 1U58B 4HCRA 3LKPB 4H5SA 1AI1L 4HF5L 4GAYA 1CLYH 4HXBH 3FO0H 1DZBA 4NKMB 1YC7A 4F7TB 1YJDH 4F7EB 1LNUB 3ZHLA 1XGUA 1HH6A 4FQ2L 4JPWL 2ZUYA 5JUEH 4RRPG 3A0OA 1EHLH 5IROC 5DVOA 5FKPB 1YMHB 2CDGB 1DL7L 5J57B 3NCFB 2X1WL 4YWGL 4WJ5B 1E4XL 5DTFA 5BVPH 5ADPH 4NUGL 3BE1L 3CVHB 4U7KA 3TBTB 4BJLA 1MAMH 1HQ4B 5GGVH 2FWOB 3RWFA 1KGCE 1S9YA 3ARGD 3DRQB 2XOTA 5F89A 1WWCA 2JJVA 4NQCB 3QDGE 2OBGA 4XNYH 4UIKL 3UO1L 2DQHH 4KJWD 3GJFK 4MVBD 1VGKB 4G43B 2BFVH 3I75B 3ALWA 4QNPF 5FM5M 3VXMB 5CKAA 3L9RB 1JNHB 1NAKH 4TVPH 3AREA 1AD0B 1FIGH 2VUOA 1E0OB 5JXED 1SVZA 2XPGB 1OARH 3ARTA 3INUL 3QDJE 3BEWB 1NC4B 5TDNA 4KTDL 3D5OF 4O2EB 3DXAA 3JV4A 5ABDE 4LPVA 2VXUL 1FGNH 5DQDL 5J89A 1X3DA 5CINH 6FABH 1HINH 5CJQH 3QCTH 3TZVD 2GJ6D 2Q8BH 4CVWA 1G7QB 2VDRH 5MEND 2EO1A 3ZL4H 3CFEB 1I3RA 4M5YH 5H35B 1CI5A 3C60D 1HWGB 4J4PA 4TSBH 2DLTA 2NY3D 3LPFA 2M8XA 4LSTL 5ITBH 1UEYA 2VNCA 3MCKB 1R3IH 3TN0C 4YUEH 5MERA 5FECB 4YXHL 1NEUA 2ADGB 3R4DA 4YO0B 5TQ2H 1U3HA 3TN0B 3BO8A 2ESVA 4NN6C 1CFQB 5B8CA 1EAPA 2DIJA 1P4IH 1Q9LB 5J6GA 5INCB 1X4XA 2I9TB 1CE6A 4MNGB 1PY4A 2DWEB 3MLZL 2IAMC 4DVBA 5T33L 3ARFD 3L1OH 1KEMH 4YQXH 4MJ2A 2IAMB 3P40A 1BZ7B 3ROLB 2EIBA 5CMAB 5DQ9A 4WFHD 4LAQH 3B5GA 2X7LB 3BXNB 4JHWH 4MNQE 2R2BB 2XZQH 3GSRB 3MXVH 1A6WL 1IEHA 5D93C 5A1AA 5JPNA 3KNBB 1FGVH 1LK2A 5HI3C 3WDIA 2W65A 3G04A 2AERT 1TTFA 5D93B 3I3BA 1NAMH 4G8EA 1RJYB 2VLKE 4MMXC 3TNNA 4WU5A 2ATPB 5T1LD 1ZLVK 3TT3H 1ORSA 1L7IH 1T2XA 5DD3H 3KYKL 5CP3A 4HX1B 4QHKI 3SO3C 4LVEA 4NC2B 1JV5B 4H8WC 5IQ7L 5IP4A 4WFFD 4LIQE 3QSKB 1OGAB 1X5KA 3GB7B 4RFNC 4Y8DC 3SO3B 4Z7UB 4F33A 1QBLH 1HKLL 3FFCA 3CH8A 5I75C 2IAND 5GGQH 4RFNB 2B1HH 1RULH 1YY8B 4Z7QE 4OIIH 2GJZB 4IOFD 1ZANH 1B0WA 3K2UH 4R2GB 5I75B 1MH5A 3GDBA 4D0CB 4P57B 3BWAA 3CFBB 3RGVD 1TVHB 3G5XA 4PJGB 3MXWH 4LASH 5IMMB 2FEDC 4GQ9H 1BFTA 5JIKA 3RA7H 3BIKA 2KL6A 5HYFA 2AJYH 3K4DA 3H3BC 1C8PA 4G7YH 5EG6C 1AFVH 4JG1H 3SGEH 1WWWX 3PGFH 4Z77B 4GXVH 2FLRT 2FO1A 1NBYB 3VFNB 1EZVY 3ULUH 3KPQA 5L2JB 3G08B 1UB5B 2YPVH 3EUUA 4IMLB 4YAQA 1PX3A 3QCVH 3WXVL 4XH2B 4EUPA 3MRMB 4PJHE 5GS1C 2P8PA 1G1CA 3BJLA 1HHKA 2Y07H 4ERSH 2Z31C 1IT9H 4YDKL 2FX7L 5GS1B 3FQUA 3CC5A 3BZFA 4LFHG 5GRZA 2Z31B 5EIIB 2FHCA 4RMVA 1G7MA 3WFEH 2H26A 5EORH 5EIQA 3U6RA 4XNQB 1XH3A 1RUML 2X4OB 4UB0L 2DOCA 5D5MB 5DJXA 5FYKD 4QGTA 1CGTA 5IFAL 1A9BA 1XIWC 4J8RA 4CVXB 4N5UA 2BHYA 4QWWC 5GS0D 3H9SB 1EX0A 3U9UB 4MA1C 4PJAB 1XIWB 1ZHNA 4IHOB 3RZCC 1JWMA 2P5EA 1U42A 5GJTL 3AU1A 4WGVB 1Q9OB 4JPVL 2XRAL 1XGPA 4JFEB 5IQ9B 3B6SA 1LEKA 1MVUB 4N0RA 3T0BA 2DJUA 3O9WA 3A6BL 3T1FB 1AXSB 2E27L 2FBOJ 2W9DL 4QCIB 1MPAH 3LKQA 1BX2B 2A73A 2YD7A 4K2UL 4OTXH 4KAQL 4PY8I 1J1PL 2LVCA 2H2SD 3MRJA 1YNLH 3L3OA 2VC2H 5D8JH 3MRGA 2YPLE 2AXFB 4XMLH 4MXWL 2EDNA 4H26B 5IHUH 4FA8A 1RIHL 4QOKA 1PQZB 4F3FA 5DLML 3MRIA 4MNHA 1A2YB 1RMFH 3PDOA 2P7TB 4PJDB 1EHNA 1OAYL 3GKZA 3QPXL 1U8LA 4GMTH 1CF8H 2PNDA 1WAAE 4HUUB 5GGUB 4NRYA 5HDBF 4G9FB 4D9QD 2OL3H 1YY9D 4WHTA 5C8JA 4FQ1L 4KKLD 3VWKA 1OTUD 5T3ZE 3PIQB 1OB1B 2FNBA 2NX5D 2ZUQB 3RTQD 2R0KH 1SYSB 4OV5B 1MCHA 1OP9A 4L8BB 3NTCH 4GRLA 2I9LB 1T20B 4P48A 2V5SA 5DFTA 1CFNB 25C8H 4L8CA 3D0LB 5JOFB 2J3SA 2AW2A 5L7XL 5D7SH 1ZWIA 3BP5A 5D2LE 3BPCA 3L3GA 3FT2B 1T1YB 5CGTA 5BVJB 2H45A 3PQYB 3SDXE 3OAZH 1T0MB 4CJ1A 1W72L 1YN6B 4X9GA 3DBXA 2BVOB 2F53A 2AEWA 2R9HC 3HZKA 3ULVD 4Q58C 1SBBA 4JM2B 1LO0L 2BNUB 2XTJD 3OXRB 2MKLC 3SQOH 3H3PH 3F5WA 4PGDA 3EDJA 15C8L 3PP3H 3RNQB 1FVCA 3DURB 5JHDA 3IKCA 2CGRL 3P4OA 3FO2A 4QRUB 5DD5L 1K3ZA 2YEZB 4YEFA 5BZWB 5B3NA 5EU7E 4U1MA 4KI5F 2X89A 1Z3GL 5EBWB 2R29H 2O5YL 4LLQA 2Q76A 4P2RA 3TJEL 2A74B 3C2AH 3EO0A 5D7KE 4QT5B 3EDFA 4M6OL 3QNYA 5ALBL 4NCDA 1UM5H 3QDAA 4FXLA 4LF3A 1DP0A 1QVOA 4WNQB 1NBVL 4POZD 5A16B 1MQKL 4HK3N 1M05A 4M62L 3DVGA 1MCNA 4K8RD 1RHHB 3MNVA 5BRZE 3ARQA 2KUTA 3DX7A 1KC5H 4C83B 5EOTB 4ODBD 4ZXBC 2VL5B 1HOCB 3WE6A 4OUOA 5D7IA 4KKAD 4LSQL 1AH1A 1A6AA 4ZXBB 3W2DL 1CWVA 4MJIA 2VDQH 3VMNA 1EEYB 3BQUC 5KS9B 5DD1H 2YZ1A 4K9EC 5IHZA 5FYJU 1NFIB 1CGXA 5EU6D 5J12C 3V6FB 2A83A 1JPGB 3CSBA 1AR1C 3BQUB 2VSDA 1NGYA 4CMMA 1ZHLA 5EUOF 5J12B 5E9DE 4QRRB 3DVNA 1GC1C 1YNTA 3U7AA 2X9XA 3FQRA 2OMNA 1BQHG 3SDCC 4Z0BL 2R0LH 1KG0A 2GITB 3NCBB 4UIMB 3WNNA 3CVHL 4ZS6C 5C0BD 3SDCB 4WI2A 2YMXL 3RUGF 3FJTA 5CSGA 2JELH 1Z9MA 4KZDH 2HJFB 1MCPL 4C58B 3AB0C 4X6BB 1XGYH 3UJTH 4QHNB 2W9LA 5I1KH 1QBMH 1UCTA 3QNZA 3AB0B 1OTTD 1ZGLA 2MSPA 1HHJB 4PRBB 2VL4A 1PW3A 5T1DH 3QJHB 2APBA 4LHUG 3BKCH 2V9QA 4PTUA 3CXHJ 4OJFH 2HLAA 2IADA 4GSDH 5FV1L 3VGAC 2EIEA 5D1QA 4UQ3A 1FLRL 3M45A 4LHUB 3GSNH 3VGAB 3KPTA 3VFMA 1H15B 1YMMB 2F5AH 3MROA 4RMSA 4KHTH 1YPZE 3CFJB 3O3EA 1KXTB 3LEVL 3OJ2C 2IPTH 3B5TA 1H0DA 3MR9B 3BP6A 2PXYC 4LBEB 1U8IA 2JCCF 5DI8B 4H20L 2CIIB 4G6MH 4ODVH 3OZ9L 4X6CF 5JQHC 2PXYB 1MF2H 5JW4R 3W82A 2KH2B 3T4YB 4KZEL 2JCCA 4PR5B 4JZNA 1NCTA 2HT2C 1WZMA 4OLXH 2ADIA 5MEPA 3STZB 3WCYA 5GSRA 4OCXH 1KXVC 2GFBB 3QA3A 1QKZH 3ARGA 3CFCL 4JFYB 3BPNC 1I3VA 5SX4H 4HQQH 4F9LC 5FB8A 4OKVA 3WD5L 4JRXE 5JOPD 3LEXB 2MQ0A 1JGLL 3BPNB 5SWZE 2GSGB 3D25A 3HZVB 4XMKH 3NCEB 5DK0B 2EYRB 3S3SA 3K8LA 3CGTA 1C12B 3CIQA 3WDJA 4Z7VB 4Z0XA 4HJ0C 5HDLA 3SCMC 4F58L 1MFBL 2Z92A 4LRNL 5JXEA 3SCMB 1YEHL 1MHHA 2YBRB 4HIJA 2BSSA 2GTWB 3CK0L 4CN4A 1R3LA 2KDGA 4LEXH 1E6JL 5T3XL 1E4WL 3MV7B 3EOTH 4QLRA 3LMJL 3OR6B 3PWJA 2Y36L 3TZVA 2GJ6A 1YEKL 5FOBB 1KSRA 5MENA 3QUXD 2GAZB 5CZVH 1LILA 2VDPH 3OTTA 3C60A 3H42L 3LN4B 5ESVA 4FQXC 1YNKH 2C3XA 3L3KB 2A0LC 3VXPA 4H8WL 3F58L 4TTDC 3PWPD 4FQXB 1S7QB 2X5PA 4MAUL 1KJ3H 3U4EA 5F7DA 2DMCA 2VDNL 1M4KA 1NFDE 5KSUB 5D7JC 3RGHA 1J0IA 2VLJD 3NCCB 5AYUL 4PJXB 4NC1E 4KDTC 3E6HA 4FQJH 3B2UC 5D7JB 4HHAA 1ZOXA 3ILQC 3B2VH 8FABA 4YHMH 4TNVK 3O2WL 3MUGA 3ARFA 4G8FB 1X6LA 1PKQA 2JE8A 4JFOB 2PW2B 2NY6C 3VXTA 4NUJB 1B4JH 3BRFA 1IAIH 3BUTA 3MGTB 2VO5A 5CEYA 2VXTH 4EI6B 1KCRL 2RFXA 1MSPA 3QEQE 3OJMB 2NY6B 5DVKA 4R7DB 1QR1B 2E6JA 4LPCA 4WW2B 9CGTA 2I07B 4QRPB 4HPOH 4ELMA 4IIQC 2FH8A 4PV8B 1DTUA 4ODXB 2V7NA 5AZ2L 4E42A 2FRGP 5I1IH 3KS0J 2Y5TB 4IIQB 3DYOA 4S10A 4XNZC 3BGFC 5T1LA 4H25B 1UWXK 5LJYH 3VFWB 3VW3L 4JPIA 3MJ6A 4XNZB 3BGFB 5KVDL 5KVFL 1IZKA 1S7UB 4QYOB 3CNKA 2EKJA 3MGAA 1GIGH 5E2TL 1T1XB 1DQDL 5KANI 2XACC 2IANA 4PJBA 3D3VB 3F7YA 3BMVA 4PGCB 4NBXB 4O2CA 2APWA 1HQRA 3LS5H 4M61A 1NEZB 4YFLF 3RGVA 2AJVL 5H8DA 1ZT7A 3RWIA 2ZJSH 3UTTB 4PFEA 3L7EB 3ELAT 3OGCB 2YD5A 3NPSC 2XA3A 4U1HA 1I1RA 2IC2A 4X5XA 3TO4C 4XPFL 4RMQA 2CXKA 3NPSB 4KK6D 1FFPB 3TO4B 4YHPB 3HPLB 3X3GH 5EO0A 2R15A 2DQUL 4MZ2A 4FFYL 1F4HA 3LQAH 2P8MA 1D6VH 4U0RC 3OB0K 5HHOE 2A77H 4OCLC 1GXEA 3BWUC 3GMNB 3D0VB 4U0RB 5KANG 3GMPB 3MUY1 3TNMA 4P3CL 2NW2B 4R26H 5FGCE 4X6FA 1JUFB 4UOW0 3WKML 3MX0A 5IT2L 2Y06L 4Q97A 3MLTB 2MCPL 1M71B 1H3PL 2NY2C 2Z93B 4WUKL 4JFXB 3HC3L 4GRWE 4TQEH 4PP1D 3FZUD 4ALAL 4LCWD 4GBXD 2FD6H 2AABL 2J6EL 3QBTB 3MTRA 2EE9A 1UXSA 3BH8B 3OAUL 4H1LA 1VPOH 3C5JA 1QLFA 1P2CB 4JFZH 4OCMC 2AK4D 2W0FB 1C1EL 4NT6B 3QJFA 1QEWB 1T22A 3VRJA 5C3LD 4G3YL 1ZLWK 3T0EB 3IFLL 4PJEF 2X44D 1JTOA 4FABH 5E0QA 1HIMH 5KSAD 4PJEA 3TH3T 2I5YH 2EZ0D 1ADQH 3HNTH 2O61B 2XY1A 1BVZA 4JO4H 2ZCLH 2VISB 4DN4L 4RWYL 4F7CA 3IU3A 1MRFH 2E7BA 3IF1A 3WS6A 4JFFD 1KFAL 2YSSB 1N8ZB 4NPYA 3WBDA 1GYAA 3KJ4C 3UPRA 2J5LC 1IL1B 4QNPE 5MEQB 3P9LB 1ES0B 4R4ND 3KJ4B 2J5LB 3QRGH 3MRCB 3DXAE 3HRZA 5DJ2A 1OGTA 3BD3A 1HDMA 5C92A 1T2QH 2AV1B 4XP4L 1BWMA 4YX2L 4UBDC 3NZ8B 4EDXB 4YK4C 1NSNL 2D0HA 5HJ3B 1QUNA 4KPHL 4K3EH 1NKRA 1RIUH 3HUJF 4YK4B 4YHZL 2NX5A 4MGXA 4AH2B 1T03L 1MCWW 2P5WD 3WIIH 3R06A 3K1KC 1B6DA 3QHFL 3VD7A 5E95B 5KN5B 5DHVH 1FG2A 2R23B 4KDWA 5IVZB 1A7QL 2OMBA 5I1CH 3AXLA 1EUTA 3WJJA 3MLXL 3JWDH 4WHYG 3RVTD 3NZHL 2ESVE 3F65A 1DJSA 2E7LC 4Z5RB 4XVTH 3FRUB 5EU5A 4G8IA 3TH2T 3JVGC 3WYRA 2VR9A 3TWCH 1XMWA 2R1WA 4K9EL 3QDGB 3KYOA 3V5KB 5E00A 5HHQB 3BP4B 5F1NA 2FJHB 2NTSP 5DJDB 2PO6D 3MMEA 1MLCB 3FT4B 1AY1H 3RDTD 3O45B 1GC1L 5DJ6B 4UTAH 2DJ4A 2NLJB 4P9HH 4XCEB 3D18B 1OP5K 4NJAH 2RGSA 4MA3A 2GY5A 1AJ7H 2IFFL 3P4MA 3DSFL 1A14H 1EMTL 3WNLA 5TGBA 3F7QA 4MA8L 3BP7B 3X14B 4ZDHB 5ADOH 4W4NA 1JHKH 4XCCH 3TO2A 3S34L 4MLSA 3ESUF 3FFCE 4LQFH 1X5YA 5EWIH 5FYLH 4HWBL 3EYVA 1HN1A 1CFSB 4X7EC 1OF2A 4WIQA 1C16B 2V2TA 3LKSB 5L9DH 1J1XL 1KCSL 3IFOA 5B4MC 5C09D 1BREA 2QQNH 4BKLB 4ZO8A 4MYWB 4KUCD 5IB3A 3DWTA 4U1SA 3OJVC 3MJ7B 4MSWA 1JPFB 1NCUA 5DSCB 1NC4D 4ENEC 1RUAL 5HY9B 2R8SL 1ETZB 2RQ8A 3QPQC 4ONGH 1CXIA 3PDGA 5L0QC 4FQIH 2C7UA 3GSQB 2XWJB 4PJ9C 4QRTA 1JZ7A 4PJIA 1BBJA 1A6TA 4YE4L 1F4YL 5L0QB 2HJKA 1ZHBB 1BGXL 5J13C 4DWHA 5KTEH 5C0BA 3ROOA 4PJ9B 2Y9RT 4LLVB 4I77L 1ZLSL 5J13B 1J05B 1UT9A 1C5CL 4MNQB 3FQTA 3HS0B 2EE6A 1VDGA 2Y7QA 2BOCB 4P46C 3MODL 1E4KC 2HKFH 1JJUA 2ADJB 5EZJB 3FAWA 4P46B 1JRHL 5I1GL 2VLKB 3C08H 1RVFL 1N2RA 1VSCA 1EGJA 3KXFD 2XV6B 1WQVT 4BZ2H 3L6FA 4OLYH 1CGSH 4YFDB 2HFFA 4POYA 5ISZD 5KZCD 5GZNC 2OJZL 4RIRA 4ZSOA 3LSOB 2P5EE 3SOBL 4PTTA 1CDBA 4O5LH 1D6EB 3MCLH 1Y6MR 4GMSL 2IAMD 4JCLA 1MFEH 1ND0B 3FO9A 4O58H 3VFTB 4CAGA 5J4MA 5EFIA 1CXLA 3STBA 2NNAB 2EEDA 4LGSB 3GSWB 3LZFH 1NJ9A 2PYFA 4JAMB 2WQRA 4PB0H 5J11C 2PR4L 1I3GL 5CEZH 1A7NH 1CL7H 3ORJA 5T3XD 4NQSB 2AJZA 5J11B 4CL7A 5T5NG 3DPBA 4ZMAT 5DK3A 5CLWA 4IRSC 1PLGH 2J7LA 4DW2H 4ODSH 2V9RA 4J6RH 4XXDA 1YEIH 1DLFH 2JIXD 3VFRA 4YHOL 4QOKE 1NL0L 3F7VB 1OSPH 3ZE1F 4PJHB 5I1LA 2Z0BA 1NC2D 5I8CB 3MQIA 4EBQH 1QPXA 43CAB 1N5YL 1FQ9C 3RAJL 3MV8D 4F80A 1CGUA 3NFPA 1IKNA 4KY1L 4JRWA 4D94A 4XCYB 5ICYB 1BP3B 4BSVB 5LQBH 3DROA 2IALB 1ZLUH 4LP4A 4ZQKA 2A6IA 3C8HA 4CADA 1H3VA 1CD9B 3SKMB 2CLVA 4L8SC 3B9DA 3H0TB 3G6JF 4MJ6A 3LDBC 5E1HB 3RWJB 3SE9L 4NHCL 4W4OC 2G75B 1NBZA 4L8SB 12E8L 4UINL 3LDBB 1KJ2L 4FQLL 2VE6A 5ACZA 4PGEB 4RGMC 1G7LB 1QSFD 1BD2D 1U2CA 4MQ7B 2F53E 3BUYB 3UROR 4RGMB 3QUXA 2GEEA 1FPTH 5GGRY 4XPAL 1WBZA 2MCG1 5FAAA 1IQWL 4NQUA 1TVBA 3TM6A 1QFOA 2YUXA 3S36H 1IGYB 5JHDE 3PWPA 1ZS8A 4LFHD 1F6FB 2AQ1A 1RJZA 3U82B 4AK1A 3AS1A 4D9RD 5EO1A 3STLB 4QKXB 3MLVH 3CVIL 3MLRL 4R4BB 5GSVB 1MCJA 4P2RE 3TVMD 1KACB 1T83A 5LWYL 2DWDB 2OTWA 2QKIB 4LSUH 2B1AH 4LPTA 3H9SD 3T09A 4RMWA 3AMLA 5C9JB 3IVKA 4CBPA 4N90E 2VXVH 4TNVF 4B7IA 4QWWD 2D31B 4ODTL 4GKZA 4PJCF 4JFED 3M8OH 4N8CH 2RIKA 3VU2A 3RZCD 5GISH 4O51A 3FHAA 5F9JB 2VR4A 4MQSB 1U36A 2FX8H 4HKXB 2ZSWB 1P4LB 1K6QH 4V2CB 5C0DB 4HGKC 4DZBB 4PJCA 1AC6A 1RFDL 1SEBB 2ORBL 3O4OC 5D7IE 3V0WH 1HK6A 4XPBH 1EFQA 4R0LA 4U3XA 1DQJB 3SGJC 1IGJB 3O4OB 4Z76B 4K7PX 5F3HA 1EO7A 4MJIE 2OJEA 2CLZB 1YJDC 5D2LB 4LCCC 2AJ3A 3N85L 2FL5A 2WBJD 5I1HL 1G9NH 4QXTA 3KPLB 4LCCB 3W39A 3LKOA 1JF5A 1XF3A 1TLKA 3V6OA 2VZOA 1JGDA 4J3SA 1ACZA 1RZ7H 3GMOB 4LSDA 4YHLL 4N9GA 1Q0XL 5C1MB 4J7RA 5GQBA 3UAJC 3O3DA 3AS0A 4IMKC 5DYOA 4XBPB 2IH3B 4HUWB 3U46B 3ARXA 5EU7C 1W0YT 3CSYA 5JQ6H 1SJVA 4YXKL 1FNGB 4KJPC 3RUGE 2DMBA 4X6DA 1BAFH 1T21A 1M1SA 4B50A 2WMPA 3HAEG 4TUOB 2OTUA 2QSCH 5E2VH 1T66C 3WO4C 1AD9B 1EH9A 3N06B 4LU5H 1K4DB 2P48B 1UB6A 1WC7A 3HAEB 5K93A 1DFBL 3WO4B 1J86A 2BRRH 4UT6L 5B38G 4Y1AD 1CR9L 1ED3A 1I7RA 1V7MH 1X5FA 4OD3H 2C26A 5B38B 2J8UA 2VDKL 2IFGA 2X4PA 1G7HA 3MRRA 3KPPB 3GUTB 2VLMD 3RU8H 1YQVH 1CD1A 1P53A 1ROWA 3Q6GH 3H8NA 1V3JA 4HWUA 5IK3A 1DBMH 3FRPG 5E8EA 4DFHA 3MACL 4LCWA 4C4KO 1AQDA 4GBXA 1B2WL 5E9DB 1NCWH 3OAYK 4GW4A 3UYRH 4GG8A 4K7PL 2JCCE 3QIUD 3NBNA 2ZG1A 2ATKB 3JV6B 3O6LL 4GT7A 4NHUA 2AK4A 4KTYA 2G9HB 3MNWB 5ACMA 2ZKHH 4YBHA 1TZGH 2Q6WB 1FNAA 3G5ZA 3ZTJH 2FDBP 4P49A 3BPLC 2EIZB 1I9JH 4ONHB 4YC2C 1D5MB 2DYPD 5KSAA 5CLTA 1U91B 3O6FC 4XNXH 4YC2B 4ZXBD 3NN8B 3F8UB 1I9RL 4GG6F 3GNML 3IU4L 3IS0X 3ALPA 3HG1B 5DHYA 5FHBH 3WNPA 3O6FB 1S7SB 3QFJD 1OP3H 4I1NB 4JFFA 4HZLB 5C0GB 4UI2A 4GG6A 1W72A 1I4FA 3CZFB 3MA9L 4PJFB 1ZA6A 3QG7H 2E7HA 1Z9SA 4IM8A 4YR6B 3GRWL 2AP2A 2DQCH 4NO3B 4NGHL 3ULSA 2R69H 4KMQA 1YPZB 4LRIC 5J1AB 1FFRA 3QXUA 4LKCB 1WBYA 1N0LA 3SKNA 2IBZY 5CBEA 5J56B 4OT1H 2FYYA 2GJ6E 3SDCD 3AS3A 1S8DA 1IEBB 2AK1L 1CK0H 1R5VB 4Y88A 4OZGF 4ZS6D 1G7IB 2P5WA 1FL5A 3WMSA 4LKXB 4GAGL 1FRGH 1CIDA 1T7YA 1UFUA 4WGWB 1DE4B 3MRNA 4OZGA 2A6KA 5E56A 2F19H 4MX7A 4EKXA 2G5BA 4K3DL 4U6XA 1FO0B 4HK3J 1R3KB 4EI5C 4XI5C 4ODWA 1GGYA 2IPUK 1I1AC 4DZ8A 5DJZB 5C86A 5H94A 4D0BA 3RKDC 4EI5B 1UM6H 2BVUA 4UOW1 1C5DB 1S7RB 4OLEA 1I1AB 2BJMH 3SE8L 4LHUD 4X7SH 5SWZB 1RZGA 1IQDA 1UXWA 1LVEA 3LKPA 4P2CG 1N64L 2LE9A 2J4WH 2PO6A 5H2BB 2MOVA 2AEPH 3RDTA 1PKQE 3E2HC 1S7TA 5T5FL 4F7TA 1FNFA 4G5ZH 4WFHE 3E2HB 3BT2L 4LSSL 5L8LB 3C9NB 2N4IA 3ZE0E 1RUPL 5K9JH 5A2KH 1JHLL 2R0WL 4M8QB 4OCWH 4ELME 2CMRL 2ERJC 2Z8VC 1D5IL 1L7TH 5C0IA 2PXYD 3E0GA 1D5ZB 2XZAH 2ERJB 4RRPA 4XVJL 3W11D 3I6GB 4X4XB 3HRPA 2FATH 1PSKH 2FJFB 4XWOC 4U6HB 1ACYL 2X41A 2F74B 2H9GB 5F21B 2SEBB 5TDOA 5GHWL 2V2WB 4NNYB 4WFFE 1CDHA 4PBWD 3CCHA 5I15L 2OK0L 5C0CB 2BRQA 2IANE 4PJBE 5GIRB 5GGTL 4M3JA 4OZFB 3EJYD 3X17A 3OG6B 4ZTPL 1WJ3A 2DBLH 5C09A 4AQ1B 2CPCA 4Y0GA 4I3RH 1HI6A 4O2FA 4PJ7B 2R56L 3L9RA 3HNVH 5ILTL 4CNIB 1QFWL 1OSZA 2P49B 4Q9QH 1NLDH 1DUZB 4HJ0D 1FNHA 1IBGH 1IM3B 4JKPL 2CLRA 4OLWL 1NC4A 1CFBA 5F9AC 1LEIB 2HYMA 2G5RA 1JGEB 3RI5K 3D69A 1FNEB 3NFNB 4FXKB 4G9DB 4Y5VC 1AHWA 1FLTX 1DQQA 4M7LL 2IG2L 4LLYA 1GGIH 4K3JL 4Y5VB 1OD9A 1F58H 3QEQB 4UTBH 3DARA 4RQQB 5H35A 4H0GA 5J6HB 1UWGH 5DMIL 3T77A 3W0WD 4N5ED 3WHXB 2Q8AH 1IC1A 1XR9B 2BVEA 1INEH 2A0LD 5DDHA 2VDLL 5E8DH 2ADGA 4TTDD 2UWEA 4UAOC 3QR2A 5IF0A 3KXFA 1TZIA 2BSTB 2OL3B 3HE7C 2Q87A 5FYKE 4U1JB 5LCVH 4UAOB 1V7NL 3HE7B 2ICES 3EDEA 5INCA 5I19L 2D03L 4MNGA 5HYQB 4AEIL 5EC2B 4M02A 2BMKA 1UACL 3ILQD 4AENB 3D2UD 2IAMA 4IS6A 4HLZH 3REWB 5DK2A 5CMAA 4YBLC 3QXAB 5MEOA 5D6DA 3VGHA 4PJEE 1QNZH 2X7LA 3BXNA 4MD5B 5CSZA 1OWWA 2R2BA 2BC4A 2HN7A 4YBLB 1EO8H 3OF6D 3VRLE 3VH8B 1W0WA 3WO3B 2VAAA 4XCNB 5E6ID 1LDPH 1CTOA 3EOAB 3HZYB 4YHNB 1CBVL 3ETBF 3U83A 3B8SA 4U3CA 4P3DB 2JIXA 2DIBA 2V5TA 5HHOB 4Q0XL 3SY0B 1Y0LA 4A6YB 4Z7UF 4HUXA 4HX1A 4TUKL 3ILPB 1FVDB 5HYSB 1NC2A 4H5SB 5IMKA 1TQBC 1WWBX 2ZCHH 3AY4A 3D3VD 5EUKA 3MV8A 4D9QE 1TQBB 4WENB 2GJZA 4PJGF 1XGUB 3V79C 3VGGA 4CDGC 2WINA 1MWAA 3KJ6H 4U6VH 2NX5E 3CFBA 4GRWB 5F9WC 3CSGA 1YN7B 2EKSB 3UTTD 1U8QA 5IMMA 1NPUA 5F9WB 1KCVH 1X5AA 3MLWL 4NZUL 1F4XL 2MHAA 3ZDZE 5TE4L 4PB9H 5DTFB 2Y72A 2YA1A 4OFVA 4P4KC 3IXAA 2Y6SC 4KQ3H 1DN2A 1X6NA 3RWFB 3VMOA 4KQ4H 1X5LA 4AL8H 5L2JA 1S9YB 2DS4A 3G08A 1UB5A 4OGYL 5CIPH 1QSFA 1BD2A 3FO0L 4IMLA 5FGBA 3TJHC 5FUOH 4K7PY 5F89B 1YJDL 1MCRA 3ULVE 2B4CC 1UM4L 1F42A 1U8OA 3DUUA 4F8TA 3IFNH 5GS1A 2XTJE 2ZG2A 5JUEL 3VFSA 2YC1A 3RIFF 4HW6A 4Y2OA 1EHLL 3O8XC 4OB5L 4W6WB 2CDEA 5KVEH 4OLUH 5D5MF 4PRDA 1PG7H 4EIZC 3LKNA 1ZE3C 4XMPH 4UNVA 3UTZA 2VAJA 4PJ5D 3O8XB 5DRZA 3PNWA 5JHDD 2AGJH 5BVPL 2NY2D 2WWKO 2WIIA 2D4DA 4PJAF 5AZEH 5TDNB 4X7TB 1MAML 4PGZA 3DXAB 5GGVL 3TVMA 1S9KC 4FN0A 3H9SA 2LU4A 5GRVL 4HK0B 3U9UA 4YGAB 5I1DA 4QXWA 3NAAL 3SDAC 1Q9OA 4XNYL 2AQ2A 4JFEA 4XP5L 4JJ5A 2DQHL 1A6ZA 4J4PC 3RZCA 2W9EH 5JPMA 3SDAB 1EHAA 2WW8A 1JZ5A 1YEJL 2BFVL 4DUWA 1A7PH 1CQKA 1BX2A 1NAKL 4WEMB 4HAFA 1U9KA 1OARL 1U3HC 1GHFH 3V95A 5MERB 2DQJH 4OQTL 4TSCH 1VERA 1U3HB 3BO8B 5B8CB 3KLHD 1HHIA 1RIVH 2WBJA 1EAPB 4NZDA 4UDUA 1FGNL 4POUB 4PJDF 4XZUB 3LVEA 4TRPL 4Y16C 1CFVH 3UEZA 6FABL 1F02I 1HINL 5CJQL 3X13A 4YGVB 3QCTL 5FIEA 1VFBA 1A2YA 1ZT4A 4JHZA 1CE6B 4FZEH 2Q8BL 2EDJA 2VDRL 4Y16B 4DVBB 2VWEC 3ZL4L 2HKHH 3TBSA 4M5YL 4HUUA 4GH7B 3RKPA 3RIAK 4TSBL 4FFWC 1G6RH 1RZ8A 4PJIE 4LCUA 1IKFL 5SX5H 2NR6D 5DQ9B 4UBDD 5C0BE 2QHRL 2JKXA 1R3IL 2ZNXA 3PWVA 4X7CC 1H9VA 7CGTA 1SYSA 5JR1H 4OV5A 3MLSL 5TQ2L 2J6EA 5JPNB 1NUGA 5E08H 3G04B 2YN3A 2QQLH 1P4IL 2QBWA 4G8EB 4KVCH 4KK9C 4WU5B 5AEAA 5GGRA 1ORSB 1JZ2A 5J0BA 5INDB 1NKOA 1T1YA 3WIHH 5DD6A 1T0MA 5AWNL 1HHHB 1KEML 2DQGL 4JM2F 4YQXL 1MCFA 1YN6A 4F33B 1P5UA 4Y1AA 2I60L 4ZSOE 4YPJA 4S1DD 4Y4FD 5TH2A 2H41A 4HFWA 4HIEA 1MH5B 3OXRA 2XZQL 3MXVL 2CXGA 3BWAB 1TVDA 35C8H 3DURA 1FGVL 3G5XB 1JFQH 4YBQC 1LK3H 1PZ5A 1CLCA 1R3HA 5DJ0A 3ZLQC 1A0QH 2VZ1A 5CD3A 3TT3L 1L7IL 3HB3C 2NXZD 1KB9K 2D9CA 3L5HA 2IH1A 5I17A 3T0AA 5BMFH 3OX8A 3QIUA 1MNUL 4NJ9L 1Z6JT 1QBLL 4OF5A 5DD0H 2Z8WC 5F7UA 5TQ0H 1WV7T 5BQ7A 3NABH 4EUPB 3FQXA 1HH9A 2P8PB 4AMKH 5C0FA 3BI9X 3K2UL 5HHNB 1LO3H 3CC5B 4O9HH 3BZFB 3ZE1E 1X5XA 5JOPE 5AG8A 1MJ8H 1KIPB 3MXWL 4C83A 1WCBB 4LASL 5EOTA 2DYPA 4GQ9L 4WI4A 3RA7L 3S37H 5KS9F 2H26B 3U6RB 4S1SH 5MHSD 3UZVB 2AJYL 4ZXBA 3F7PC 3T1WA 3A6CH 1XH3B 4Z95H 1AFVL 1NMCC 3VE0A 3QFJA 4MD4A 3UCRA 4XP1H 5DJXB 1MAJA 4JFDD 1NFIA 1FFNA 2BVYA 1A9BB 1NMCB 3ARZA 3ULUL 1QFHA 4C55A 3SKJL 2JB5H 4L8DA 2YPVL 3S96A 2ITDB 1ZHNB 1JWMB 5JW3H 3AU1B 2Y07L 4ERSL 3O9WC 1JYXA 3QH3A 4P23D 4ENED 3B6SB 4BQCA 1LEKB 3ARRA 3O9WB 4BA8A 2GITA 4UIMA 4K3HA 2YK1H 4Y8AA 3SDCA 3HKFA 4GO6B 1KLUB 1KT2A 5EORL 1L6XA 1BQHA 2NY4C 2A73B 2K9UA 5M95B 1F3DJ 5I0ZA 2NY4B 3BSZH 1UVQA 2J8HA 1A64A 3P4NB 3L3OB 5IMOA 3MRGB 3PWPE 4P46D 1HHJA 4NWTH 4PRBA 3IDXH 2W91A 1QOKA 4QOKB 3QJHA 4F3FB 4I18C 2C1PA 4KRPD 5D70H 5DJCA 3MRIB 3PDOB 4JKKA 2XG4A 1D5XB 4I18B 4JFHD 4C4KT 1FJ1A 2NPLX 3DHMA 2VH5L 3NFSL 4HWBA 4JFQB 2C5DC 4LHUA 4NRYB 5H37H 2MMXA 2ICWI 5GZND 2VXSL 4WHTB 1L9NA 3CFJA 3VWKB 3QEUA 3QCUH 4GRLC 4RNRB 3EYSH 5FK9B 3LHPH 2VC2L 2DLGA 4PJCE 4U33A 5D8JL 7FABL 5IEKB 4JO3L 4GRLB 1TJGL 1SJXA 4XMLL 5IHUL 1G1YA 5DI8A 1P5VA 1DN0A 4QXUH 2A1WH 4PLKC 4KK5D 2PXYA 3MOBL 2CRMA 3I2CH 5LXGH 3BP5B 3T4YA 3BPCB 3L3GB 4PR5A 3UJJL 5I71C 1P7KA 4GMTL 2X05A 3STZA 4IRSD 3S88L 1KN4H 5I71B 2BDNH 2OL3L 3V6OE 2ZOKA 5BOZG 4XPGH 2GY7B 4YXLH 4U1NA 2X4SB 3JWOH 2P44B 3IDYB 3LEXA 3L3HA 2GSGA 1CTNA 3NTCL 4F9LA 5GRJH 3RL2B 2ICWB 4Y4HD 1LEGA 4HKZA 3HZVA 4Z7VF 4LDOB 2IEPA 5JHDB 4FZ8H 4FTVD 4PRPE 3H6JA 3ESVF 2IF7A 5DK0A 3SGKC 2Q1EA 4PGBB 1J18A 1MCWM 1QA9B 1RZJH 4Z7VA 5E4EB 5D7SL 4XC1H 3ZYOA 4LLQB 1BOGA 3MV9B 3EO0B 4X6DE 4ZO6A 2YBRA 2GTWA 3NACL 1OTSC 4JDZA 3RI5F 1ZT1B 1UA6H 3U30B 4KGLA 3ZKQD 1K8DA 5GGVY 4HMDA 3EOYG 1M05B 3RHWK 2ZPKH 3DVGB 3H3PL 3OR6A 1IGMH 4HIXL 3V5DB 3MNVB 3DV4B 4A6YL 4KXZH 2CKBH 3DX7B 2DKSA 3IETB 1IC4L 3MUJA 4HCRL 5D7IB 3W0WA 3OB8A 2J8UE 3SEPA 5F7FA 5AAWA 3JV0A 3L3KA 5KOVC 4MJIB 4PG2C 1S7QA 5IHZB 4BYHA 3NOIA 2DMKA 4OFIA 1WK0A 2A83B 2AKRA 4PJXF 3L3IA 1NGYB 1PKOA 1UM5L 4CMMB 4LCWE 1FIEA 3BX7C 3DVNB 4LLUA 5F7EH 1KB5H 5KSBB 4XHJC 1SBSH 3FQRB 5D7JA 1SM3H 2AXGB 2AK4E 5I1EH 2F9BT 1I8LA 1KC5L 5F93C 4HPYL 4HEPG 1BWWA 1FCGA 1N59A 3D2UA 1WIUA 4JDTL 3MA7A 2PW2A 4IBLT 4WW2F 1P9MC 3OKMB 3DSNA 4LARL 4EI6A 5HGBA 2VDQL 4OZHA 5DD1L 4V1DB 2HRPH 1CE1L 3MRQA 4LK4A 4R7DA 4RDQG 4IJ3C 3HI6H 4IOIA 1IGIL 1NMAH 3OF6A 3ZDXE 3QNZB 2I07A 3PWNB 1ZGLB 2B4CL 4IJ3B 4OLZL 3V9FA 2COQA 4PV8A 5E6IA 1KULA 1KJ2A 2VIRA 2X09A 4JFFE 5DUBA 4IIQA 1FYHB 4GG6E 1TNNA 4H25A 4QRSB 4P9HC 3MYJA 2IADB 2V6HA 3I9GL 3VFWA 1UCBH 3ZMRA 3T0XA 1L0YA 4UQ3B 1X44A 2J8OA 4QYOA 4DKAA 1J0YA 3VFMB 4Z9KB 3MROB 2X1XR 4O02L 1T1XA 4RBPK 3CX2A 2I25N 2NY5H 1UZ8A 3O3EB 5F1KC 3LOWA 5ICXB 3MV11 1HXMA 3D3VA 3TPUA 4OSUH 5TF1H 1MLBA 3HR5A 5I1KL 1QBML 2EIDA 3BP6B 4DAGH 1NGZA 3PDDA 2IQ9H 3UTTA 1U8IB 5T1DL 5GRVK 2P5WE 5F72S 5IW6B 3OGCA 5MI0C 4U05A 4K7FA 5EPMA 2EH7L 3BKCL 4OZGE 5DA0B 2XKSA 4KJPD 4NKIL 4GSDL 5MI0B 4JZNB 1J8HD 1KXQE 5C07D 2V9TA 1IFHH 3HPLA 3WUWG 4ZG1A 5MEPB 2XFXB 2F5AL 3Q1SL 3QA3B 2VABA 4KHTL 4M48H 4WHCA 1T66D 1I7ZB 1HZHL 3MRHB 5FB8B 2AJUH 3D0VA 3GJFH 2IPTL 4TVPD 1P7HL 3D25B 4ONOA 2NW2A 4G6KH 2VDMH 1MHCB 2XQYG 3DV6B 5DUMH 1JUFA 1K4CB 2DQTH 2HFGH 4D9LL 4L9LA 2IWGA 4ODVL 4XB8A 3SKUD 5JXEC 4Z0XB 4LLMB 2Z93A 3OJDA 4PJ5A 5EB9A 4OCYH 3MSPA 4HIJB 4OLXL 2BSSB 4FQHA 1R3LB 1YZZA 5EN2B 3D85D 1INDH 4OCXL 5FCUL 3BH8A 1FORH 2W60B 4R90H 3TZVC 3QQ9D 4HQQL 4TTGA 4HH9A 4I3SH 3M07A 4NT6A 3TZVB 5D1XC 1SJEB 4F7PB 2GJ6B 1QRNB 1EA9C 5MENB 2A6DA 4XMKL 1QSVA 4HFUH 2FSEA 5A40E 5HVHC 3QAZC 5JW4N 5BJTB 1DEEB 3GK8L 3K4ZA 2DQEH 2BNQD 5HVHB 3QAZB 3VXPB 5L8JB 2APVA 5GPRA 1TDQA 2O61A 5DFVD 3WXWH 1U3YA 5C09E 2C4FT 3U4EB 4LEXL 2EO9A 5F7DB 2YSSA 1N8ZA 3VXUD 3EOTL 4MA7H 3GMLA 4EDWH 1IL1A 2QTEA 1L4IA 2UUDK 3ARFC 5ID0A 3O6MH 3I6LE 4YPGB 1V3LA 8FABB 5CZVL 4PP2B 3MUGB 3ARFB 3RIAF 1GGCH 5E4IA 2AV1A 3QISA 1U8PA 1PKQB 1X9QA 4LPXA 1KELL 3VXTB 1F45A 1YNKL 4QO1A 1Q94A 3UDWA 5CEYB 3G9AB 4GRMA 2RFXB 5DUPH 3EYQD 2AEQH 4UUJA 1KJ3L 4NRXB 3FOLB 5BW7C 4ELMB 4B7LA 1BVLA 1ZLVH 5IVZA 1E27A 1UZ6E 2V7NB 1OY3B 3GMQA 1EUUA 4FQJL 2X4TA 3JBG7 5T1LB 3DETD 4DOHE 3KXFE 5EA0H 3QHTC 4Q9RL 1WZ1L 1B0GA 3B2VL 4JPIB 4YHML 1DBBH 3FRUA 4KKCD 5DZOA 4EI5D 3O81A 4XI5D 4EXPX 2E7LA 2B0SH 4FP8L 1XF4B 2VXTL 3QB7C 4JKWA 2IANB 4MNGE 4PJBB 1TJHH 5JXAL 3BP4A 1BJ1H 3RGVC 3VD5A 3QI9D 2OR9L 1HQRB 1BMGA 4M61B 4NFCA 5F88B 3RGVB 4HPOL 4NNPL 3RY6A 2D9QB 2NLJA 3ULUD 4XCEA 3D18A 1DQLH 5CSBA 1CT8A 4X5XB 1IARB 4N0FB 1B88A 5T3XE 1G7JB 4WHDA 1KN2H 1E28A 5DT1L 4ZPVA 1OLZA 3U9PL 1XFPA 5EO0B 2DM7A 5AG9A 1GIGL 1VCAA 2HLFC 5HDOA 2P8MB 2FZ3B 2OXGA 1FDLL 2XKUA 2ZSVB 4QRQB 4M9PA 3QDHA 3TNMB 2F58L 3F6LA 4XWOD 1J7VR 4X6FB 2ZJSL 5C0CD 2P24A 3MV8E 1BFSA 1CFSA 3SDDC 3QULB 1KTKE 4JZJC 3SDDB 4J23A 1LO4L 3CLEH 4GS7C 4JFDA 5GS0C 5IR1B 4ZYKB 3E1F1 1TJIH 3O41A 3LQAL 1UXSB 1YECL 1D6VL 1EERB 2BHUA 1F8TH 2HG5A 3C5JB 4GS7B 3KYAA 1JPTL 4W6XB 1QLFB 3S98A 3TIDB 5DSCA 2WANA 5IOPB 3O6KL 5F7WC 5HY9A 1ETZA 1IC7H 1BF2A 3QJFB 4X6EB 3RRQA 3VRJB 4P23A 2IPKB 3GSQA 3VJ6B 2XWJA 3OKOB 5KJRH 2E8YA 1QSFE 1BD2E 1BLNA 2GT9A 3UTSD 1S5IH 2H2SC 3N1PC 1BZQK 2WWMC 1J05A 2GUOB 4GKOA 3VD4A 4FFVD 3HMXH 3DNKA 3T8XB 4TQEL 3WS6C 4CW1B 2BK8A 5HD8D 2FD6L 1N4XL 4F7CB 3IU3B 4QTHB 1HILB 4P46A 5E2UH 1E4KA 3VXQB 4NPYB 1QHPA 3UPRB 2HFEA 5HVGB 4GJTB 2R4RL 4D9RE 1S7WA 5C0JB 1NUDA 2XTLA 3HRZB 5DJ2B 1OGTB 3V0VB 4Z7QF 1IM9D 1HDMB 3H9SE 1CG9A 2OS7A 1YY9C 1NGQH 5FM5O 1YC8A 4KKLC 4ZTOL 5IB4A 1OTUC 3L5IA 4L3AA 4XP9L 5GGTA 1GL4B 3RTQC 4QF1B 4QY8B 4GOSA 1HIML 2I5YL 4JFEE 1ADQL 3BKML 3HNTL 1CU4H 3G6DH 2NX5B 3RTQB 2ZCLL 2NNAA 2WSKA 3R06B 1MRFL 2EDTA 3LRHA 4OKDA 1NH6A 1FG2B 3IJYB 3WJJC 5SV3A 3AXLB 4NQSA 2YUWA 3ET9F 5LGJB 1GAFH 4JN1H 3QRGL 5T5NF 1YYMH 5C7XH 2FGWH 4PJHF 4LOUC 5E99H 3O3AB 5EU5B 4G8IB 5CHNB 1T2QL 5HYEA 3ULVC 4XPTH 4IRSA 1A1NA 2R1WB 2XTJC 3WFHB 4K3EL 5FO8A 3EKCA 4DK6A 5I8CA 3MO1B 5F1NB 1BVKA 2XTJB 1TZHA 3O2VH 5A2LH 4NP4H 2MPAH 1VACA 4LNRA 4Y4HA 4N0CC 1MCOL 4FTVA 4IDJL 2RCSL 5ICYA 3ZTJG 4BSVA 3IJHB 1F90L 2IALA 2R4SH 4FQCH 4MA3B 4PPTA 5I76A 4XVTL 4B5EA 3P4MB 3BOVA 3DMMD 2H32H 4M7JH 1G9MH 5TGBB 4MLIA 3CDGA 4K8RC 5BXFA 2EDRA 4MQXC 1G7LA 4P4KD 1JP5A 4L3ED 2I24N 3RY4A 4Y1AE 2O5XH 4EVNB 4W6YB 4UTAL 3EYVB 4P9HL 1HSAA 3EGSA 4JR9H 1E4XI 2V2TB 1PBYA 1N3NA 4BM7A 2G60H 3B9VA 1EXUB 2VLME 3MLPA 1KV3A 4HF5H 4NFBA 1AJ7L 5IB3B 5EU6B 4U1SB 3RP1A 1QZ1A 1URLA 1A14L 3O8XD 1H3UA 4GXUN 4MSWB 3STLA 2YS4A 1FSKC 1WAAF 2LQRA 2KKQA 2E7CA 4BELD 4RISH 5ADOL 1EEUA 1EEZB 1U95A 4XCCL 1B3JA 2C7UB 3LRSA 1MHPH 2OQJA 4LQFL 4HV8A 4QRTB 5IVXA 4PJIB 5EWIL 1U3ZA 1BBJB 2D31A 2VQ1B 2HJKB 4MMZC 5JMRA 3HNSH 2P8LB 1O5DT 5C0BB 4YWGH 3ROOB 5I74B 3B83A 2QJDA 1P4LA 3U0PA 4G80A 5SV4A 3Q5TA 5C0DA 2NY7H 4DZBA 3FQTB 2QQNL 3FFDA 1OTTC 1OPGH 5D72H 1WEJH 5D2LF 1CGVA 3T2QA 2PYED 4N0YH 2D7MA 4BSJA 3RPKA 3QZWG 2DM2A 2VN4A 1N2RB 3ARBD 3QFJE 4Q6YA 3V2AR 5DGRA 4NOFA 5FYKU 5DS8A 2O26U 3GFUA 5T1MA 4FQIL 3QUMH 4LCCA 1JF1A 3C87A 4ZSOB 5KTEL 3OKNB 3GMOA 4PTTB 4XAWH 3INUH 2PTTA 3ES6B 1WTGT 4KTDH 4XAKD 3FB8A 4BFBD 2QR0B 4PD4J 5EFIB 3VWJD 2HKFL 2VXUH 1I8MA 4XBPA 2IH3A 3U46A 1NJ9B 2PYFB 5E2WH 3X3FH 1UJ3A 1RU9H 3JTSA 3C08L 4IMKA 5BO1H 3PHQA 1T04B 2AJZB 3I50L 1DBKH 4BZ2L 3OV6A 4OLYL 1CGSL 5E2JA 2X40A 1JK8A 2GTZA 3HFMH 1VEPA 1J8HA 4DQOH 4XTRD 4XXDB 5C07A 3VFRB 1X4ZA 4NCC2 3W81A 1AD9A 4O5LL 5BV7C 5I1LB 4YXHH 1YYLL 4C57C 3HAEA 4WY7L 4XC3H 4O58L 5BV7B 2NW3A 3LZFL 1XCTA 5IBUB 4KGJA 4P0DA 2JJWA 3O2DH 4XGZA 1WF5A 3SGDI 5B38A 5CEZL 4Y7MA 1CDUA 3GUTA 4DUXA 5I2IA 5T33H 1CDGA 3DROB 1VFOA 1CXEA 1A8JH 1X7QB 4WFGE 4ZQKB 4DW2L 2A6IB 3UYOD 2QL1A 4J6RL 1YEIL 4CADB 1MY7A 1P69B 3D85A 6CGTA 1OSPL 2ED7A 1NBZB 4X99B 3HB3D 3O4LB 3FRPA 4UV4H 3J8F7 2FO4A 4EBQL 2VE6B 3CUPA 4FMKA 3MOAL 3JV6A 4K71C 2G9HA 3MNWA 3MRLB 2Q6WA 4MS8D 4R97C 3DLQR 3QUXB 1V3KA 4K71B 3WFCH 1CS6A 3KYKH 4R97B 3DVFA 5JHLH 1J1OH 1SMAA 5HI5C 1FAIL 2BNQA 2QLVB 1D5MA 1UEMA 2BY0A 1U91A 4R4FH 4AG4H 1ZS8B 5IW3A 1DQMH 3NCJL 5C2BH 1AXIB 2R2CA 3HG1A 3NIGE 4PJFF 2LABA 3GIVB 3O6FA 4Z7VE 1T83C 3VXUA 4HDIB 1KJMB 1U0QA 2VLJB 4KK8D 4L1HA 1PJ9A 4M7KL 1YPZF 5JNYA 3IVKB 5D4QA 1MVFA 3CH1B 3MV7E 1RPQA 5BS0B 5IGXL 5HHMB 4GFTB 3B3IA 4L29A 4JANA 3S36L 1NAMA 4LRIA 5ECJE 5EULV 4R8WL 4PRID 5F9DC 4HUKB 4LVHC 3QRFM 1EZVX 3W0WE 2NY4D 3FQWB 4LVHB 1EV2E 1ZTXL 4HS3A 5F3HB 4YDKH 1NUFA 3OQ3B 1UWXH 3VFVB 4P5MA 4LSUL 2FL5B 1AGEA 4NKOB 2EDEA 3V6OC 3RWGB 5ELIA 3W39B 2VXVL 3LKOB 1IGCH 1XF3B 5DJZA 1MELA 1KTLB 3C5SA 4EI5A 3M8OL 4N8CL 1C5DA 1S7RA 5GISL 2EDQA 4HGWA 2FX8L 1G7PA 5GS0L 2Z91B 5IFAH 1XF5A 3PV6A 4HKJB 3O3DB 1XCQA 2M1KA 3QI9A 2NY0D 1D3CA 5JTWA 4I4WB 5DYOB 5DZLA 3V0WL 4I0PD 3C09C 4XPBL 3CSYB 3MRBB 1ZEAH 2W1NA 1JGUL 1RURL 2XI9A 3C09B 1NCBH 4OZHE 3GSVA 2ZZUT 1E4JA 3L5WA 4FRWA 2VZSA 4KK6C 4OGZA 1G9NL 4X6DB 1T21B 4X80L 5DRNB 4EQ2A 2X70B 4OI9A 1KB9J 4QRPE 3KYMA 3OB0H 4K2UH 2OTUB 3ISWA 2HMIC 4M3KB 1RZ7L 4PLKD 2A2QT 2EECA 4X4XA 1UB6B 1WC7B 1FG9C 3IKKA 2F74A 2H9GA 4HGMA 4WU7A 1ED3B 2ZUXA 2V2WA 3QEGH 2GCYA 1RSFA 5CAYB 5JQ6L 2J8UB 5C0CA 4BK4A 1G7HB 3D3VE 3MJ9H 3MRRB 4M7LT 4OAWB 4PJ7F 4BFIB 3FZUC 4J3XA 4GBXC 5CJOH 1BOYA 3NVQA 3LS4H 5IK3B 4M03A 3UTTE 3TF7C 4LCWB 1AQDB 4GBXB 4OIBA 5E2VL 5L8KB 2L7JA 4GW4B 3MV9D 1WIOA 2CH8A 2GK0B 4GG8B 5TJWK 3ZT7A 2BRRL 1LEIA 1ZLWH 4NHUB 1DBAH 5I9QC 1D5BB 1V7ML 4OD3L 1FNEA 3OKLA 5D7LD 1OTSD 1MFCH 4G9DA 4X5WA 5I9QB 3G5ZB 1JIBA 5L7XH 2EZ0C 1A4KB 1VENA 4Y5VA 3T08A 3UTSA 4HT1H 3MCG1 4RQQA 1P6AB 5KSAB 5E94A 1RZIB 5J6HA 4NWUL 2AV7B 1DBML 2XKNB 3NA9H 3HZMA 1XR9A 1HYRC 3CLFH 3RX5A 3X11A 1H3TA 1ZSDA 5DHYB 4S11A 1EVTC 1PEWA 4JFFB 3UYRL 3BESR 3H9YA 4KTEL 1W72B 1I4FB 4U7SA 1M7IA 4PJ5E 4BFGA 1ZA6B 2OL3A 5SWQB 4KU1A 2CGRH 1FN4A 4U1JA 1TZGL 4S1QH 3PF2A 4Z78A 3ULSB 1IM9A 3U4BH 4OF0A 3ME0A 2MTPA 2PN5A 1Z3GH 2O5YH 5HYQA 4O4YL 3SKNB 1FFQA 5CBEB 4M6AA 3QUZC 3N9GL 1S8DB 5ALBH 3F12B 3IDJA 4XNXL 4MDIA 3P0GB 3V7AG 3QUZB 4U1KB 1AO7D 2P5WB 1FL5B 1UKQA 5FHBL 5FM4A 4YHYC 3PHOA 3GHEH 1MQKH 1NCNA 2QHLA 4V1DD 4MD5A 3MRNB 4YHYB 3SE3C 4MX7B 3EFFA 3QG7L 3GEWB 1A6VH 1NCCH 3GMRB 1I1YA 3FN9A 2H1PL 4OZ4A 2R69L 2B2XH 5H94B 2EDFA 1A1MA 4ISVB 3MRDA 3V6ZA 5TDPA 1CZ8H 2PO6C 4OT1L 3VI3E 4IRJD 1GOHA 3ILPA 2HH0H 3RDTC 1RZGB 1IQDB 1UXWB 3E6FB 3ZSSA 1OLLA 2PO6B 1WIPA 3RDTB 5E03A 4NQXA 1S7TB 1OP5H 4GRWF 3EZJB 2YRZA 1SJHA 4WI7A 4X7DC 1YEDA 1UG9A 4ORGB 2F19L 1NANI 3TLRA 4LSRH 4ZUVA 4KH2A 1YN7A 2EKSA 2V17H 3CVHH 5C0ND 1JBJA 4U1IB 5C0IB 4MCZA 2EXWD 4RSVA 4GUPA 3DMMA 4LSVL 4ELKA 2X6MA 4KRMB 4LEOA 4XWGH 2NYYC 5FYLD 1EGJL 3FONB 5F7HA 4PJ8D 2EDDA 5TDOB 3LV3A 2J4WL 4P4KA 3F6IA 4DN3H 3CCHB 4L3EA 2E9JA 1CD0A 3SE4A 1U6AL 4G5ZL 1ZKAA 3C8DA 1S7VA 2ITCA 4F37K 3I02B 1I7TA 3Q6FA 1U41A 5K9JL 4K94C 5C09B 3KDMA 4OCWL 1X5HA 1HI6B 4O2FB 5KVGH 5DJAA 3KWWA 3BVNA 4PRAA 2QQQA 3GI8H 1QQDA 1OSZB 3O8XA 2FHFA 4U49A 2CLRB 1RUQH 4X7TA 4TSAL 1AHWC 1OCWL 3D69B 3DRTA 4HK0A 3OZ9H 1AHWB 5DMKA 3JWNC 1DQQB 5M94B 3MLUL 4LLYB 5CZXC 1QRND 1A5FH 1T1ZA 5EU4A 3SDAA 5D1XD 2DBLL 3T77B 1YEEL 4I3RL 5BV7L 1R24A 4HLJA 5H37G 2HJLA 3QIWC 4RAVA 4Q9QL 1NLDL 5HHXL 2PYEA 4YDJB 5MHSE 1IBGL 4EOWL 5DDHB 3QIWB 4XPHH 3GSNA 2UWEB 3ARBA 1DBJL 3BISA 5IF0B 1OW0C 4DOHB 3KXFB 1TZIB 2A9MH 1ZV5A 4JFDE 2WM0A 1CICD 3T0DA 4XZUA 5ISZB 2EDKA 3BN3B 4ZO7A 5KZCB 4G6AD 4NN6B 1QBAA 4NZRH 4YGVA 1GGIL 1XGTA 2VTFA 4LRNH 4Y16A 4UTBL 5CEZD 2EE3A 4QGYA 3C5ZC 2BMKB 1JF6A 3CK0H 2HRLA 1UWGL 5IBTL 1E6JH 4IS6B 5D6DC 5AYQA 3VWJA 2F54D 3BKYL 5DK2B 3EZ8A 1CQYA 5MEOB 5F8QC 1INEL 2YXFA 2QQKL 1CVRA 5CSZB 5E8DL 2BC4B 3CDCA 2HN7B 1YEKH 4XBGB 3JWOC 1MREL 1W0WB 1CLZL 1NDGB 2VAAB 5LCVL 1AE6L 1R0AL 3H42H 4TN9A 1VESA 4AEEA 4PY7A 1TMCB 5F7NC 1B6UA 2JIXB 5INDA 1Y0LB 1X5JA 3MLYH 1MHEA 1RZJC 4HUXB 4OFPA 1AIFA 2FR4A 4MAUH 5CP7B 4X4ZA 1HHHA 1NC2B 3AY4C 1C08B 1MJ7H 4JFHE 1CIUA 2VDNH 5IMKB 5FYJH 2R39A 2Z4QB 4HH8A 4RAHA 5EUKB 3MV8B 1QLEH 4G42A 1QNZL 3EO9H 4NQED 3GM0A 1SVCP 2WINB 1MWAB 1TIUA 4ZOAA 3FN0H 1U8QB 1LDPL 3AFLA 4ZUSB 4AM0A 4S0SD 3NA4A 2MHAB 3MFGB 5EO9A 1KCRH 4M6MH 2XQBL 4M4RA 1MCCA 3K80A 2CKBB 3O0RL 3H2WA 5FGBC 3IXAB 2EDOA 4AIXA 2ZCHL 1RZKC 1QSFB 1BD2B 5AZ2H 4JDVA 2HLFD 4LVNC 1GGUA 1U8OB 3DUUB 5HHNA 4U6VL 4LDLB 4LVNB 5K33A 5CUSL 4K23H 5KVFH 1KIPA 3BGMB 1WCBA 3VFSB 2YC1B 4XT1C 4HULB 4LMQE 1KCVL 2CDEB 3BFOA 4FTVE 4PRDB 1DQDH 4TULH 5K9KA 5B22A 3LKNB 3ZSTA 3UTZB 5IWLC 3SDDD 5C0RH 2YZ8A 3PNWB 5DRZB 4PB9L 3TVMC 1SY6H 1JMZA 2WIIB 2YXMA 1JYVA 3U7YL 4CUCA 4KQ3L 3TVMB 4E41D 2VXQL 4QHMA 2ITDA 4J3WA 4NN7C 5FUOL 5I1DB 2BY2A 1EHXA 3TP4A 1E6OL 4NN7B 4MA1B 3IFNL 2FIKA 2WAHA 4JJ5B 1A6ZB 5GRWA 3RZCB 5JPMB 5DEGB 1GGTA 4ZPTA 2HVKA 1EJ6A 1KLUA 5KVEL 2XY2A 4OLUL 4PRIA 3DUSB 4GKSB 1TQCC 2E3VA 2P47B 2AGJL 5EOCH 2WWMD 1XF1A 3P4NA 2WBJC 1HHIB 2Q7YA 5IB1A 2WBJB 3B9KC 4UDUB 1G0YR 4OLVL 1H3PH 1OQOA 3REVB 3B9KB 3X13B 1VFBB 1ZT4B 2W59A 5JORA 1D5XA 2ICCA 2YA2A 2W9EL 4I18A 5FDYA 2C3WA 4BUHA 3FAXA 3TBSB 3UTPE 3DX6A 5CS7A 5L2KD 3P2TA 5KAQG 4JFQA 2GIYA 5EBLA 5IVXE 1RZ8B 4LCUB 1WSST 4S0TD 5K59F 5FA3B 4I0PA 5CCKH 3T3PF 1GGBH 3PWVB 4RNRA 5I8EB 1GHFL 5FK9A 4I0CC 4HIIA 5IESH 2DQJL 1BM3H 1T7XA 4TSCL 5IEKA 4G3YH 2AQ3A 4HIHB 3MRKA 1RIVL 3IFLH 4XHQA 1N6QH 3FB6B 1OOAA 1UYWH 1CFVL 2DQIL 5GGRB 3EBAA 3CXDH 3PABA 1LGVA 4FZEL 5A2JH 1JN6B 3CFIC 5DD6B 4OF6A 2DF3A 4RWYH 3S37X 2W07A 1D9KC 4LOUD 4Y1AB 1KFAH 1HE7A 1T4KA 3VXOA 4X9IA 3DO7A 2X4SA 1D9KB 5E5MB 5TH2B 4HFWB 3GI9L 4HIEB 4HEME 3M17B 5GS2H 1ZHKA 1J0ZA 3RL2A 1AGFB 2ICWA 4DGIH 1S5HB 1UQSB 5E08L 1Z9OA 2QQLL 4M6NH 1TXKA 1PZ5B 1R3HB 2D7QA 4AEHH 5DJ0B 4PGBA 4KVCL 4N0CD 5CJBA 1QA9A 3IRZA 1BFOA 3OAYH 3T2NL 1XF2A 5CD3B 2D7PA 3SGKA 1BPVA 3QIUC 2BXYA 3MV9A 2IH1B 5I17B 1S9XA 3OX8B 3QIUB 4DCQA 3QHFH 4KRNA 5C07E 1ZT1A 3BYYA 1ADQA 5BQ7B 2L7UA 5D7LA 3U79A 3FQXB 3VA2C 2X4RA 1HH9B 5C0FB 4UOJA 5IFHL 3MLXH 2YPKA 3V5DA 4Y2DC 5D7IF 35C8L 3DV4A 5F3BA 4MQXD 4TVPE 1JFQL 2VLRD 3IETA 5B39G 2DYPB 4Y2DB 1LK3L 5DHXB 3N1MC 2Y25A 2X2YA 5AD0A 3TCXA 4MDJA 3VE0B 3QFJB 4MD4B 1DEDA 1ERNA 1FFNB 5DVLA 1ORQA 1GC1H 5KSBF 1GCFA 4YIQA 4PG2A 4XX1G 1N6UA 1KENH 4L8DB 3S96B 2I26N 4TOYL 4U31A 3NABL 4N9OB 5KSBA 3IAQA 4NO2A 4AMKL 1IGFH 3QH3B 4HS8L 1LO3L 2R1XB 1JNLL 4O9HL 1U2HA 2AXGA 3EFDL 5DHVA 3I6KB 2IFFH 2IGFL 3S37L 1KT2B 2D0FA 1BQHB 4ZAKC 5CBAA 1FYTD 4MA8H 2HAZA 3A6CL 3OKMA 4Z95L 1AO7A 3OKEA 2DLFH 1UVQB 3HHRB 4ZAKB 1G0DA 3SKOA 5AUMA 4V1DA 4DJMA 5IMOB 1P9MA 4RA0C 1Y6KR 3PWNA 4X9BA 3UPCA 4GKNA 1PYWA 4HWBH 3HG1E 1WFOA 5C71A 2GJJA 3PV7A 4U6TA 2C1PB 2HWZL 5JW3L 5DJCB 1J1XH 4JY4A 3VXUE 3HMWH 4AIZA 4K94L 1A7RL 2H8PA 4QRSA 5ICZA 4PJFE 4PYHA 5EZIH 4FG6C 2B20A 1FJ1B 5HGAA 1FHGA 2YK1L 4IRJA 3BIBX 4P59L 1JRHI 5KVMC 2PUQT 3QEUB 5ETUB 5ICXA 4HBCH 1RUAH 3BSZL 4PREB 1Q1JH 2EDHA 2EICA 1UH3A 1ZK9A 1TCRA 3DO3A 3MGOA 3KPNA 4MQTB 4NWTL 4YE4H 1BGXH 1ITBB 5C0EA 1GZQB 1DN0B 1EEQA 1KPVA 5IW6A 5DF0A 1DDHA 5D70L 3W11C 4OFDA 3WHE0 3T0WA 3VXNA 2HTLC 4UZGA 1P7KB 1OAXH 3MODH 3N1GC 4JM4L 3P11H 4JE4B 4NQDB 3AAZA 1QSEB 5I1GH 2XFXA 2ZOKB 4WCYL 4NBZB 4U1NB 1MUJA 1I7ZA 3QO0A 3WUWA 4F9PC 1RI8A 2WBWB 3L5XL 3MRHA 3EYSL 2D7NA 1KTDA 3EJYC 3L3HB 4F37F 3WNKA 4UT9L 3W9EA 1LEGB 4HKZB 1MHCA 1T5WB 2N7BA 3OKDA 3DV6A 1K4CA 4X98A 1A02N 8CGTA 4QXUL 3SOBH 2A1WL 4ZUWB 3ALXA 4LLMA 3I2CL 5LXGL 3ULUE 2EC8A 4KJYA 1BOGB 3OPZH 5F70A 3PGDB 3RWEB 1KN4L 3QYCA 5EN2A 4N8VG 4JEGB 4JDZB 4Q2ZB 3QHZH 43C9A 2PR4H 4XPGL 3O4LD 4YXLL 3GSXB 2W60A 4KHXH 1RY7B 4G7VL 1A4JB 1K8DB 3JWOL 4N8VB 4IRZH 5ITFB 2BCKA 1J12A 2WZPD 1SJEA 4F7PA 1QRNA 3QUYC 4FZ8L 3WIFB 4N5EC 5D1XA 3J7HA 5BJTA 5I8OL 1NL0H 3W0WB 1DEEA 3QUYB 4OGAD 3ZDYE 1RZJL 5GRYA 1LP9A 5C0CE 5DVMA 4XC1L 1M6OB 1A47A 4PRHD 1N5YH 1MRCL 3THMH 5HI5D 4BZ1L 1F00I 3RAJH 4JQXC 2AKRB 3L3IB 1MWAL 3MNZB 4PJ7E 1TITA 4YDVA 4RCAA 4KMTH 1CICA 1ZA3A 3V4VH 1P4BH 4LLUB 1T7WA 3QQ3A 5LGKA 3WSQL 1I8LC 4YPGA 3EDKA 3SHSA 2CKBL 3RVWD 4PP2A 3QWQB 3TBVA 1FZKA 1U8HA 1JNNH 1LDSA 3R1GL 1N0XL 5BS0D 1T5XA 3BEVB 1N59B 2V2XA 3D2UB 3LQZB 5HHMD 3MA7B 1U8NA 4RWHA 2C4FU 1C5BH 2F54A 4CU7A 2HTKD 2D7TL 3ZE0F 2OZ4H 2JK5A 5HGBB 3UTSE 3JSSA 2JJTA 4OZHB 4FQLH 5ANMA 4ELMF 4KUZL 1RZKL 3H7BA 3MRQB 3HC4H 3HR6A 4NRXA 4D8PB 1LWRA 3KPSB 4IOIB 5E6IC 5GJSH 3FOLA 3VFGL 2FBJL 3T65A 3KLAA 3F62A 3VD9A 5E6IB 1KJ2B 2BY3A 2VIRB 1KB5L 1Z5LB 5BW7A 2M2DA 5DUBB 1JI1A 1IQWH 1SBSL 1RK0A 3B4NA 5IHBA 1SHMA 4RFEA 1SM3L 5FV2A 2E9BA 3MYJB 3S35X 5EOQH 1J87A 1ZVHA 5I1EL 3L5JA 4PJBF 1J9CT 1WISA 2AEIT 1NQBA 1XF4A 1UZ8B 1HXMB 2YRPA 3TYGL 3TPUB 2BSRA 2Z35A 1MLBB 2HRPL 1G9MC 3HR5B 4NQEA 5IW1B 3HI6L 1NMAL 5C0AB 4C56D 2H32B 5F88A 1T0NB 1NGZB 4R96A 4ODTH 3EJJX 5LGHH 1Y6NR 4J3UA 1MCIA 3KPRB 4K7FB 5EPMB 2ZOLB 4PIRF 4N0FA 3SQBA 1G7JA 2IBBA 2XWBA 1UCBL 2VABB 2FZ3A 2HMID 2X9YA 4X9HA 2CKNA 4OZIB 2ZSVA 4OSUL 4QRQA 4ZUTA 4PBXA 2RR3A 3N85H 4NKDA 3DYMA 1J0HA 3CFDA 1JTTA 1OAZL 1NGPH 4OBSA 4L9LC 4DAGL 2IQ9L 4PV9A 1WZLA 3CMOH 1F4WH 2OR8A 4L9LB 5J1TC 3JZ7A 3QULA 4JQIH 5I16B 1QG3A 2DRUA 1ZMYA 3WUZA 3OJDB 4PJ5B 3SDDA 2E6PA 1CDJA 2Q86A 2NY2B 1IFHL 5I8KH 2QEJA 4FQHB 5IR1A 4JZJA 4ZYKA 1U93B 1GPOL 4E41A 2ENSA 4ZNEA 3ZYIA 1B9ZA 3TIDA 4YXKH 2VLLA 3C6LD 5IOPA 3ZKNC 4HH9B 2AJUL 1ONQA 3GHBL 4X6EA 5CILH 4G6KL 2VDML 5IMLB 2IPKA 3S35L 3VJ6A 1A21A 1XR8B 2A6DB 2ENYA 3OKOA 5DUML 4CRPA 2EYTA 1R3JA 1UH2A 2FSEB 2HFGL 4L3EE 3NPZB 1T80A 3VRLF 3S8WA 4ONFL 2GUOA 3T8XA 1CR9H 4OCYL 3KLHC 1INQA 1Q72H 4CW1A 3NIFE 1GZPA 1INDL 5I1JL 4QTHA 1HILA 3BYTA 2VDKH 3VXQA 5F7MC 1FORL 4OFKA 1FZOB 3GMLB 5C3TA 5C0JA 1UENA 4D2NA 4Q9CA 5ID0B 3RX7A 2K7PA 1VB9A 3V0VA 4GLRI 5L2KA 3MACH 3UDWC 2NR6C 1U8PB 4M43H 3TCLA 5KW9H 1BZ9B 2DQEL 4QF1A 4QY8A 1Q94B 4K7PH 4GRMB 4L3CA 1K8IB 3RTQA 4UUJB 4Z7WB 2BZDA 3RWHB 2YD3A 1XAUA 3QUZD 3ZDZF 3D9AH 4EQ3A 4HG4J 3UC0H 3TFKD 1BVLB 3IJYA 1E27B 4MA7L 3GMQB 4JY6A 4EDWL 2PYEE 4N8PA 5JDJA 3AGVA 2AI0H 1MI5B 2X4TB 1Q8MA 5LGJA 3O6ML 5IV2B 4U1GC 4GAJL 4WUUB 4WVRA 3EHBC 3ARVA 1B0GB 3ULVF 1BFVL 3O3AA 1WLHA 3V8OA 5CHNA 4MHHI 4S1DC 4Y4FC 3WFHA 1A3QA 1U92B 1A3LH 5DUPL 3CU1A 3MO1A 4Y4FB 2ICWJ 3G5VA 4XCFH 3RY6C 1KCUH 2QV2A 5KSVA 3GRWH 4XAKE 2XXMB 2P46B 2VWEE 4KFZC 4NGHH 1ZGLM 3N1FC 3ARDD 1OL0A 4WO4D 5ID1A 1MIEH 1LO2H 1NDMA 3BDYH 1BBDL 2F8VA 2NXZC 1CT8B 3IJHA 1IMHC 1AKJD 4OUUB 3WS3A 5EA0L 3TBWB 2NXZB 1E28B 2FJGB 3LH2L 5EZOL 3TIEA 2IBZX 5GRUL 1JPSH 1DBBL 4WV1A 4ZPVB 4X83A 1H3GA 4MD0A 1EIBA 4MHHG 4LPUA 1TJHL 5JMOC 3Q0HA 3ZT5A 1TPXC 2NYYD 5F44A 3Q2CA 1TPXB 2H6PA 4JO1L 1IC5H 3WLBB 4EVNA 5HPOA 1SMOA 2VLRA 5DVNA 2P24B 1CDCA 1DQLL 1EXUA 3IYLW 4TUJA 1ZVSB 1KN2L 4YZFF 3A67H 3TBYB 1N64H 2GSIA 3BJ91 4JFDB 4PLJD 1MCBA 4HBQA 5EU6A 3WFBH 3O41B 3WFDL 1FBIL 2HG5B 4RFOH 5ENWA 3PJSB 4ETYA 2EEAA 2OR7A 3BIAX 3NMEA 4P23C 3FCTA 5KG9B 1MRDL 4DVRL 3BT2H 4PJIF 4W68A 1EEZA 2YD4A 3U2SB 4F2MA 5HYJD 1RUPH 4P23B 4KJQC 1TETL 4OCRH 4UQ2A 3P30H 5TFSH 4MB5A 5TE6L 4DGYL 2VQ1A 3BAEH 1QFWI 3BKJH 1BLNB 2GT9B 2P8LA 3QUKA 4XVJH 5CEXA 2VJXA 1SYVA 2C4XA 1FYTA 4CMHC 4EN3C 5CZXD 4X8XA 5T1KB 4CMHB 2DQFA 4EN3B 4Z6AT 4CN6A 3ARUA 3U0WL 4Y5YA 4HMCA 5I15H 2OK0H 4LIQH 1N5AA 1BIHA 4KRPC 3QIWD 2HFEB 2YHGA 3U7WH 1S7WB 4LQ1A 4KRPB 1IC7L 1A6PA 3TA3D 3T0VA 1HNFA 3QZWA 3PL6D 4OI7A 4DGVL 3MOQA 5KJRL 2LFGA 1CG9B 1NCAH 4QHLA 3S9DB 1MCQA 3RVUC 5IB4B 1S5IL 3OKNA 2DIAA 4LMQI 5DWUH 3ES6A 4OLWH 5DA4A 2AJXH 3H9HA 3IDMB 2QR0A 1JZ4A 3OHXB 3C5ZD 2NTFA 4PRIE 5E2UL 2B7DT 4KK5C 4L4VB 1UGNA 1XEDA 3MFFA 3QWOB 2J1KA 4K3JH 5D71H 4LSPH 1T04A 3TEUA 4LPYA 4MJ5B 2FECL 1UC6A 5A3IC 5DMIH 3OKKA 2PW1A 1RUKH 2CRYA 2OTPA 3NH7H 1NGQL 1UWEH 4G6JH 2Z9TA 4IRSB 4MZ3A 4P2RD 1A1NB 5F9OH 5FO9A 1DLHA 5FO8B 4RAUB 1KTRL 1OAUL 3JUYA 1CU4L 4KI5D 5EBMA 1BVKB 4Y4HC 1TZHB 3WN5C 4EJ1C 4JGUA 1VACB 4LNRB 4Y4HB 3WN5B 1TENA 1G9EA 2UZIH 4FTVB 4F8QA 2D3VA 1KBGH 3H7LA 1OAKL 5F1OB 4JN1L 5DURB 2DTML 5K59E 1YYML 4LNVA 3T3PE 1X7QA 3S5LG 5C7XL 2FGWL 5I76B 5E99L 3C8KA 1D7FA 2JJUA 2ED8A 3BH9A 4NM4L 4NM8L 4JB9H 1H3XA 5I1AA 3S5LB 3DUHA 4X99A 1YDPA 2ZUUA 5HGHA 5KBNC 1FZMB 1HEZB 1M7XA 3CDGB 3O4LA 5BXFB 4NP4L 3RY5A 2MPAL 3O3UN 3MRLA 1MIML 4HC1H 1QD0A 5CJ5A 2MWCA 5L6YL 3OXSA 1HSAB 3EGSB 1CXHA 1N3NB 4TUKH 1O0VA 4L4TB 2R4SL 2YA0A 4PRHA 3RIFK 3HI5H 3MRFB 4KV5F 3QIBD 3GIVA 4U2ZA 1MFAH 3VDCA 1G9ML 5IEHA 3R0NA 3WKNA 4HDIA 1KJMA 5FA4A 5FOJA 5EH1A 2VLJA 5T3ZH 3MV9E 3QXWA 4JLRA 4P99A 1U95B 5CJXA 4M5ZH 3LRSB 2O5XL 2OQJB 4HV8B 4NZUH 5IVXB 3CH1A 2EC9T 2KQMA 5D7LE 5BS0A 5FUZH 4KRLB 4JR9L 2WV3A 1NUNB 2G60L 1ITCA 3U0PB 4G80B 4E0RB 3DIFB 3KHOA 3WHE1 2WUBL 1MCLA 2MJWA 3N1QC 3FFDB 2V7HA 4G6FB 3QG6A 4OGYH 5SWSD 5B3JE 2VYRE 1UM4H 3JXAA 3FQWA 4LPWA 1S3KH 5EIVA 4PRNA 1CDYA 1T89A 3VFVA 4RISL 4Q9BA 2FCBA 4NKOA 5E8OA 3RWGA 3CSPA 2MKWA 5DS8B 5T1MB 2CJUL 1MHPL 1JF1B 4OB5H 2YKLL 4RBPH 3B9KD 4YH6A 4M1GL 1KTLA 3HNSL 3QDMD 3S3PA 5KSBE 2X4QA 4NO5B 2PTTB 3Q3GA 1PY9A 1KF9B 2NY7L 2Z91A 4ODHL 1X5IA 1VKXA 3FB8B 2DDQL 3EOBA 4HKJA 3QFDA 2CR6A 1UJ3C 5LBSH 3W5MA 1OPGL 5D72L 1I8MB 4I4WA 4XVUD 1WEJL 5DEZA 1I1FB 4N0YL 1UJ3B 4OD2A 4C56A 3JTSB 3MRBA 3NAAH 4G8GD 3FKUS 4X6DF 3P9MA 3PHQB 4XP5H 1AO7E 2J88H 2UVFA 5HSFA 4AIOA 2Y4SA 4ODUB 4V1DE 5CIPA 3HAEH 1YEJH 5IKCB 1JK8B 1P7QD 3RPIA 3QUML 3DGGA 5DRNA 2GTZB 2X70A 4MWFA 3SBWA 3RL1B 1J8HB 5C07B 3BD4A 4Q7DA 1BJ8A 2OSLA 4XAWL 1PAMA 2DKMA 2E5EA 4OQTH 4FOMA 4RA3A 3K1DA 3VG9C 1TTUA 2J8UF 2NW3B 1XCTB 3UPAA 2N56A 4TRPH 1D9KD 4XGZB 5E2WL 3TGXA 3X3FL 3VG9B 1RU9L 2GYSA 5LAXA 4WFED 5BO1L 4OAWA 4XP6L 5I2IB 4BFIA 1DBKL 1F97A 1QP1A 4UDTA 5FCSH 3HFML 4DQOL 4ZNCD 1IKFH 2QHRH 2CUMA 3RBSA 1H5BC 4DTGH 3D85B 3QQ9C 2W0LA 2GK0A 1H5BB 3C6LA 3MLSH 4XC3L 2FO4B 3CUPB 4L5FH 5FYLE 3MBXH 1D5BA 4K55A 4HS6B 2F15A 3WLWD 2YD2A 3O2DL 5HHVH 2VITA 4RGOL 1QPPA 3V4PL 3FHQA 1A4KA 4Y4KC 3ZDXF 5DFVC 5AWNH 2BNQB 2DQGH 4Y2DD 4F7MB 1RZIA 3TC9A 4Y4KB 2FIRT 2AV7A 3BPLB 4NO0B 4ZFGH 2XKNA 4DEPC 2I60H 1XGQB 4P9MH 1QO3A 2NZ9D 4U7MA 3LY6A 4DEPB 2UUDH 1T3FA 3VXUB 3T04D 4UV4L 1CN4A 2WP3T 1G6RA 2KQNA 2R1YA 5SWQA 1I9IL 1CFTA 5JNYB 3RFZC 3CD4A 1LD9A 2BXZA 2A6JB 1HSBA 4I3GA 3WFCL 5HDQH 4BFEA 2DD8H 5JHLL 4PBVC 1J1OL 3EYQC 5ERWA 3SGEI 1BQLH 1P1ZA 4OF7A 3B3IB 2C1OB 4L29B 3L95A 4YEEA 1LE5A 4JANB 1QRNE 1MNUH 1NAMB 4NJ9H 5ESQB 5MENE 4R4FL 2FEEL 4AG4L 3F12A 1DQML 1FO0H 4R2GC 5C2BL 4JHAH 3QUZA 4U1KA 4XNMB 4ZAKD 1CGWA 1LP9E 3WIHA 4HS3B 3DETC 2BY1A 2YOCA 4P5MB 2ADFL 3ECBB 1AGEB 3IAGC 4P2OC 3GMRA 4KKCC 3SE3A 3ZYJA 4MXQD 2EDBA 4XB7A 5FUCC 4P2OB 3Q5OA 3C5SB 5FKAA 4ISVA 4LHJB 5BOPA 1OHQA 2XZCH 4HGWB 3TYFB 4DK3A 2J2ZA 1UH4A 1G7PB 3QI9C 2XT1B 1XF5B 3PV6B 4FG6D 3UP1A 3SKJH 4JZOB 2EEBA 3E6FA 1XCQB 1EFXB 5CEZE 3QI9B 5FXCH 5D9SB 2RB8A 5F96L 3EYOA 3ULUC 1S9WA 1A22B 5MP6L 3ARDA 2F54E 4WO4A 1A3RH 4HZAA 4ORGA 2VSCA 5JW4Q 5ANME 3GSVB 5HTSA 4R7NA 3L5WB 3RJQB 1AKJA 1IGCL 5HHPA 2VQTA 4U1IA 3KYMB 3K46A 1MCDA 2XNAA 4NQDD 3DVIA 1H8NA 2HTLD 3FONA 1QSED 4XBEL 2DAVA 5TE7L 2GKIA 4WU7B 5DMGC 1BQSA 4OZFH 4APQD 2GCYB 2RBLA 4NZJA 2E7MA 4MXVE 3B8YA 1ZEAL 1NCBL 3BW9A 3I02A 4NQEE 2QSQA 4KUCF 3PHSA 2VH5H 3FB7A 3NFSH 2VXSH 3BPOC 3AVEA 4J1UA 5IBLC 3CPLA 4I5BA 3A6OA 3ABZA 3CMGA 3MREA 3BPOB 1J5OH 1Q9WA 7FABH 4JO3H 1TJGH 4M1DH 3ZTNL 3VFOA 1OAQH 4Y19B 2ILLA 3OKLB 5HYJA 4AZ8A 3QEGL 4X5WB 3MOBH 1S78C 1IGTB 4ACPA 1JGVL 3MJ9L 3OR7A 5HGDA 1RZFL 3UJJH 4FFVC 3UTSB 2L4OA 5DRWB 5E94B 4JVWA 3S88H 1LO5B 4X4YB 1UZ6F 5HD8C 1VGEH 5CJOL 3QUYD 2ZUQC 3LS4L 3HZMB 3GGWB 3C6SB 1BIIA 2UWEF 3X11B 1QYGH 1ZSDB 1PVHA 1AGDA 2YD9A 2QSVA 4YDJA 4QTIL 1G84A 3AC0A 3HPJB 3S3JA 3OGOE 3QIWA 1M7IB 1NGWA 5JIHA 1KCLA 1DBAL 1FN4B 3GBNH