3UP1A

Crystal structure of the unliganded human interleukin-7 receptor extracellular domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
201
Chain Sequence
DAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-7 receptor subunit alpha
publication title Structural reorganization of the interleukin-7 signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3up1A02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up1A01
3ILQC 4YUEL 3GFUA 3GO1H 3W81A 1I1AC 4NGHH 1U8KB 3DX6A 3F62A 4KMQA 4FG6C 1FFOA 3RAJH 4POZD 4CU6A 2A83B 2UZYB 1MFCH 2ED7A 2FEDD 1UT9A 4YLQT 3WXVL 2VERN 5JOFB 8FABB 1T0PB 5D7JA 3NGBB 3X13A 2ATPA 4PJAF 3MV9B 43CAA 1RULL 2HFTA 2J88L 3AVEA 3CLFL 1IC5L 5E2VH 4QRRA 5CUSH 2A1WL 3ZTNH 3ARGD 4NN6C 1DZBA 4TUKL 4TNVF 3ZSTA 4WRLA 3CFBB 1KUMA 4HBQA 1NGYB 3CFJA 4FZ8H 1J12A 1PY4A 3MLSH 2R8SH 5SWZE 3MBEA 4XBPB 5F9AC 4HEPG 4WEMB 4ZTPH 1KIUA 4KVCL 5E56A 4JB9H 1P5VA 2Y23A 1U8IB 1IKNC 3U2SB 2AP2A 4PJ8D 5DD1L 2LQRA 3FKUS 3ES6A 1HXYA 3C8KA 2VNCA 1QBLL 3SKNA 2Z8SA 1GC1L 1G9NL 1YMHB 3PABA 1ADQA 3ZL4L 3RI5K 1N59B 1OAQL 35C8H 5DI8B 3TIEA 1QG3A 3DVNB 2BMKA 2CDGA 3WSQH 3S9DB 3P9MB 2E7HA 3KWWB 4FQCL 4G42B 4OLXH 3TT1H 2ADJB 1K85A 5J89A 1XF2B 3RL1A 3MNZB 2QHRH 5SV3A 4OF3A 2Q6WB 1FL6B 3VWJA 4XI5D 2CDEB 3I6GB 3MV01 2VLKA 4UINH 1AP2A 4L3EE 5L7XL 4CVWA 5F96L 2VDQL 2CRZA 3TESA 4YC2C 4L4VD 1MIML 2VWEE 4KC3B 3KYNB 3OAYH 4LKXB 4C54A 3JTTA 5IQ7L 4OM1H 4NT6B 1MVFA 1U8LB 1SBSH 3IFPB 3HG1E 2DJUA 4PRBA 2VDPH 4AH2B 2OCFD 2AI0H 4QHMB 1O0VA 1PLGH 4GT7A 3GB7A 3KPLA 1QEWA 1FNEA 1P1ZB 3QDJE 4FQ2L 4CN6A 4FTVE 5AG9A 3UPRA 3QUXB 4F7CB 1I7ZA 1HXMA 2K1MA 2VDMH 4WFEE 4NQCA 1A7PH 1BD2B 5J06A 3MFFA 4O4YH 1HNFA 5EO0A 1UZ6E 2O5YL 3HE7C 3SKJH 2C1OB 3SCMC 3CSPA 4FFVC 3GM0A 1KIPB 1A1NB 1G7MA 2B4CL 1K8DA 2F8VA 1MLBA 3VFOB 3DTXB 2F8OA 2HJKA 2D9QB 1ND0A 3CFCH 4JG1L 1IAIM 4PY7A 2BSTB 1T2XA 4K94H 2P48B 3OKNA 4Q9QL 4HWEL 3JV0A 5CJOL 1NCAL 3PHOB 1NGZB 1GGYA 4XPGH 4X4ZA 4PV8B 4TSBL 4OT1H 4X6CE 5DK3A 4M7KL 4ETQB 5MHSD 1EXUA 2NMSA 3TJHD 1U36A 1UCBL 3MLYL 5DMGC 3A67H 4KV5E 3HI6L 5GZOD 1YEKL 2M26A 1FNGB 4HMDA 5DHVA 1CFQA 1Q8MA 4PG9B 4PLKC 3BO8B 2D31A 4GAGH 5E2TL 1I8IB 4D3CL 4J8RA 1RZIA 5DLMH 5I1GL 2NY0C 1I8KA 3QEQE 4KVNH 3BMWA 1T1WB 2OMNA 2DQUH 3O6LH 3UTQA 1U9KA 3OXSA 4Q0XH 4O2EB 2EIEA 5IB3B 6CGTA 4O9HH 3TV3H 1JN6A 3QEUB 3MLXL 3T0ED 3RY4A 4LSUH 1YEHL 5IW1B 3VFPA 2YD5A 1AC0A 2QSVA 1NLBH 1UKTA 1H5BA 3IDUA 1IKFH 4PS4H 5SWSA 3QDGD 1FL5A 4NFBA 3EO9H 4N8PA 3E6FA 3V5KA 2ZUYA 5GISL 1DVFA 5E9DB 4NM8L 2FJFB 2BHYA 3QQ3A 1AE6L 1T1ZA 3A0OA 2W0LA 4MNHA 4NNPL 4OZ4A 4OAWA 5CMAB 4DTGL 2ICWB 4RNRB 1RUAH 4Z7UE 3V4PH 2XT1B 3P11L 1UJ3A 3GMMB 4X9IA 3DYPA 1G9MC 3ZYIA 1BECA 3BPOB 4KWUA 1RUQL 3O6KL 1WVZA 3UTSB 5EUOF 3ULSA 1BGXL 4XPAH 3H8NA 2X4RB 1MCFA 1OSZB 3VWKC 2NY6D 1FFNA 2AJYH 4PJHB 4N90E 1U8OB 5KAQG 5D96B 4NKDA 2E9IA 5FOBA 1CGUA 3H9ZA 2X7LA 3MV8D 4XBEH 3M1BB 5MERA 4XH2B 2MNUA 1C08A 5EC1A 5GSRA 2GJZB 1BWWA 3D0LA 3FZUD 1X5HA 2X5PA 3RX7A 1FZOB 1T89A 5EPMA 4NO0D 4R8WH 4DVBB 3SDAA 1FZKA 2VR9A 4W4NA 2P5WB 1PX3A 3BP6A 4PBWD 3EYQC 4XNXH 4GMTL 1I1AD 1R5IB 4H25A 3G6JF 1HCFX 1UFUA 3U7AA 2F54E 3BYTA 4FG6D 5EU3B 1CQYA 5IVXE 1OF2A 3BUTA 4O2FA 2ICEB 1F11B 3UO1L 1WF5A 1MFNA 4JGMA 4MNQA 3UC0L 1RHHA 1FZMB 4WTZG 3VCLA 5GRVL 1Q72L 1HHHB 1BJMA 3GMLA 5C0AB 4P9ML 3UTTA 1KULA 2LE9A 4OF8A 4ETYA 4X99A 1QFWI 1MF2L 1T3FB 5C0BE 4G6FB 2BVEA 2GSIA 3LOWA 3MJ7A 4FFYH 4JM2C 5I17A 4NBXB 4ZUWA 3QUKB 1EJOH 3GI8L 1P7KB 5C0CB 3IFOA 1EHXA 5GHWL 2FX9L 1IGIL 1MJ7H 3LPWA 4X6DA 3WFCH 1WUNT 3EFDL 1K5NB 1ES0A 5F1IB 1GOFA 1A7NL 1YEDB 1OPGH 1NMCB 5IMKA 4WNQA 5B39B 2HTLC 5ACZB 1NCDL 5HHOA 4TVPL 1N8ZB 5JLZB 3IJSA 5T5NF 3QT2A 4EUPA 2QR0A 1QFUH 5CHNB 4YBLC 4C56D 2D3VA 5IBTH 3BQUB 1BVLB 3QUML 2V2TA 4YFEA 1MLCA 3GHEL 1S7RB 4LLYB 1AD9B 1GZPB 5KBNC 1U93A 3MLRL 1XIWA 4LSSL 4YHPB 1DUYB 1LK3H 3FFDA 2PCPA 5IW3A 2E7LC 1A47A 3RWCA 4ZUSA 4U1HA 3P0YH 4GSDH 3RNKB 3Q5OA 2ZUXA 1PG7L 3U7WH 4ERSH 4BZ1L 3OJ2C 1IGJB 4ZOEA 3D2UB 1NSNH 1CDYA 3C87A 5FGBC 3WS6C 1FG9C 3I6KB 2R39A 4AIZB 5D7LB 2FZ3A 2UUDK 2EEBA 3MNVA 4OZIA 1E4KA 2NW3B 5E5RB 3M17B 1FVEB 1CFSB 5J4MA 5IIEA 5ANMA 4ALAL 4HULB 4LL9A 2BVQB 5IK3B 4D0DB 4G3YH 2R0LH 4S2SB 4AMKH 2XQYK 4LBEB 3R8BB 1UA6L 4JO1H 4UOW0 1M05B 4PGBA 3LPGA 3D69B 2R0KL 4JFEE 3EFFB 4JPIA 4QXTB 1XR8B 4QTHB 5DJAA 5EUOA 2X6MA 3HE7D 3GSRA 2V2XA 1C5DB 3SCMD 4D8PA 3BEWB 1LEKB 5TH2A 3VDBA 3SQBA 2MHAB 5C92A 2QQNH 4LCIH 3MRIA 3VFNB 2FR4A 3BIKB 4XP9H 1F4WH 4KTDH 1KB5A 3QB7C 4HS3B 4PD4K 4Y2OA 3RWHB 3ARGB 5HHNB 1RV6X 5F1NA 2IFFH 5D6CA 3MZTA 4KPHH 1VGEL 1JE6A 3GJEA 5CLTA 1AGEA 3K4ZA 4BH8B 4K8RL 2ZCLL 5T3XL 5J11C 1MQKL 2EYTB 2R29L 4ZYKB 1UKSA 3SBWA 3ZKMD 3MJGX 1TZIB 5T1MA 3BN3B 4X8XA 4UDTB 4JFFA 2CO6B 4XVSH 5I6XB 1A9BA 2P7TB 3L3IA 5L2KA 4IS6A 5CP7A 3ARXA 2R56L 4LRNL 3D9AH 4PP1D 4YDKL 4G8EA 2VE6A 3ARFA 1N5YL 2IALA 1I1FA 4RX4D 1WISA 4OCYL 5JPMA 2B0SH 1P4IH 4BUGA 1FE8H 3GSQB 4CN4A 3D87B 4NZDA 4YBHA 4KZEH 4MSWB 1RD6A 3MRHA 4CVXA 1T22A 5DJ6B 5FA3A 1WZ1H 4OLUH 4HH9A 1A1MA 1DN0A 4Z8FH 5I8OH 1ZGLM 2OR9H 3OPZH 3B6SA 3GJFA 3ALWA 4WDIA 4HFWA 3LMJH 5C8JA 2MKWA 2E5EA 1LE5B 3QXDA 1CU4H 2ICWJ 2DKSA 3RUGF 2EDFA 2YZ8A 4ESKA 1KSRA 3UCRA 3P77B 5A40E 4BQ8A 2YR3A 3T2NH 5C9JA 5BOZG 3O8XA 4KHXH 4TSAH 3FQNB 4PJGA 3DX7B 1H3XA 2WBJC 4KK8C 2AK4B 4LCWD 1QSFB 5D2NC 5D1QC 3RGVB 3OB8A 4JFZL 1U8QA 4NIKB 3QFJE 5TE7L 3QBTB 3K1KC 4L3CB 4F9PC 2UUDH 1NH6A 5ID0A 3X14A 2JCCB 4IRSD 4PG2C 5IM7A 3CPLB 3DIFA 4D9QE 1CXFA 3GIZH 1NFDB 4BQ6A 4JFPB 4HGMA 1X7QB 4X6FA 1EEYB 3IDYC 5IMLB 2C7UB 3LKRB 4OZHF 4GW5B 2C3VB 4UI2A 3DYMA 5KVDH 5ITFA 2X4PA 3VWKD 5EULV 1OD9A 3ARBB 3GSNB 2JK5A 4OQTL 2DTML 3CMGA 3QHTC 2CK2A 3PF2A 3P4MB 1D5XB 4MJIA 4XCCH 4DGIH 2NY1D 1R5VB 3TYFB 1NDGB 3ZKNC 1KCSH 1CE1H 3RWFB 4V1DE 3U0PB 3O4LE 3FB8B 2ZUUA 4XPFL 4WV1C 4HSQA 1K8IA 4U2ZA 1CCZA 1M7IB 1RZGA 4ZUUA 1I7TA 1FYTE 4P4KA 3EYQD 5JUEH 4U1LA 1AY1H 1ETZB 1NAML 5FDWB 3V0AC 3LRHA 2D7TL 5J13C 1DQDH 3TO2A 1R0AH 4GW1B 1JWUA 3SY0A 2JJTC 4QHKI 1B0RA 4PJCF 3KJ6H 3MUGA 2PXYB 4R0LC 4JN1H 1MCQA 3HUJE 2YPKA 3PWNA 5MP6H 2Q3AA 1QLFA 1H3UA 3SDDA 3MOAL 4YK4B 4JZJB 5DUBA 4UOW1 1RIHH 3U0TB 3VG0H 1RFDH 3FHQA 4KROC 5JORA 2N7AA 1VEOA 3F6IA 4X4YB 4G8GA 3R4DA 3S3PA 5K9KA 2BP3A 1SJVA 1G84A 4P2CG 3BW9B 4OF7A 1G7QA 4YX2L 5I1KL 1K2DA 4WEBH 4Y16D 4HD9A 1EFQA 4HAFA 3KXFA 3KPSD 4N8VB 5HI3C 3VFMB 2YD6A 4QO1A 5ESVA 1E4WL 1IZKA 1NCBH 1A6UH 1Y0LB 2IANE 2OBGA 4J7RA 4OD1L 2HTLD 3QDGB 2H8PA 3X12B 3I75B 5E99H 1CDUA 2GAZB 3REVB 1LO0H 3P4NB 3ROOB 4JO2L 3D85D 1IEBA 3VW3H 2A2QT 3DV4A 3O4OB 1S7SA 3EAKA 2WNGA 3CSGA 5BV7H 2FO4A 1I8MB 1XH3B 1IBGL 4CRPA 4HUXB 3F5WA 1ZA3A 5HJ3A 1T4KB 3P30L 4J4PA 4LF3A 3SGKC 4EVNA 5L9DH 2ZG1A 1CICA 5FM8A 2PUQT 3KLHC 2E27L 3ULVE 1HDMB 3EYSL 4ONOA 3MCG1 5HYSB 1WEJH 3OWEA 5I30H 1VESA 2BNQE 1OCWH 1T2QH 5C08E 3FQXA 2VLLB 4X7FC 5GRUL 1G9ML 1YQVH 4OTXH 1DANT 2VZOA 2APXA 1NL0H 2GJ6D 4WI5A 4M48L 2FB4H 3HN3A 4HKZB 1HHIA 4LVNC 3VRIA 1PSKH 3D39D 3NPZB 2BNRE 2N7BA 4LFHG 1ZLSL 3WBDA 1UWEH 1S78C 4P57B 4KJPC 1EVTC 3WNKA 2A0LD 2OK0H 3MCKB 4YHKL 1F6LL 2Y25A 1KLGB 2A6JB 1CK0H 2ED9A 2R1WB 4YFLI 4MD0A 3JV6A 2HN7B 4OZHA 2PYEA 1N7MH 1FO0L 4YDLC 4JRXA 1RIUL 4NC0B 1BFOB 1PKQE 1RAMA 1LEIA 1R3IL 4HMEA 4XWGL 1VFUA 3DMMC 3A6CL 4WUUE 3RA7L 3H2WA 4QRTA 4ZO7A 3MRDA 1P9MC 1QSEE 3GMOB 5I74C 5GIRB 3HPLA 4UQ2B 4P3CL 1S5IL 3TBTA 3FTGA 4LEXH 5CGMA 2X70A 3O2DH 4MDJA 2JB5L 3IAPA 5EU6A 1CYGA 2R23B 4DVRH 2JTDA 4HKJA 1B88A 2E9JA 1WV7T 1ZHLA 2HH0L 5GS3A 5JIPA 4Y8DC 4ONGL 1X5XA 4N0YH 2CKBB 2CXGA 1MJ8H 1DFBL 4AT6B 4L8SA 1BIIA 5E1AB 2GTZA 1RJLB 4WW2F 3G6AB 1JGEB 3HZKB 4JFDB 4FQXA 2VLJB 4BH7B 5JTWA 3H3PL 1OP3K 1CFVH 3M45A 4LLUA 2DM4A 4P5MB 2AJSL 7FABH 4TUOA 3P9MA 2X89A 3NCFB 2NXZC 4WWKC 1P5UA 2H1PL 4PRIE 3RPIB 1IM9D 5ENWA 4PRPD 2OL3B 1KJ2H 1I1YB 1Y6MR 4Y4HC 3GKWL 2EICA 1LD9B 3BP5A 1EZVX 5FUOL 5DRXB 4EXPX 3S5LA 1CL7I 2AJXL 4M02A 3HTLX 2J1KA 4HUUB 3U4BH 1Q9LB 1T7ZA 5IW6B 2VABB 3X3GH 2WBJD 5IB1A 5IVZB 2WIIA 4NQUA 1T6WA 1CR9L 1H3TA 5D1QD 3WNMA 2ITDA 4XP6L 1A7QH 2CLVB 4E0RA 4MYWB 5E03A 3NCYS 1KIRB 1D9KA 4R7DB 2V17L 4I77H 3FO2B 3EO0A 2IH3A 2I9LB 5C07B 4OGYH 5DJ0B 2I25N 3EYVB 1PYWB 2IQ9L 3ARWA 3OX8B 4XP4L 3GKZA 4HPOH 4K9EC 3O3BA 1XGTB 3FQWB 4Z78B 1NANH 3LDBB 1DLHB 3BKYH 2R2BB 1UZ6F 5C1MB 2M2DA 3S34H 2VL5B 5CP3A 1Z3GL 2A6IB 1KC5L 1XGPA 4Y0GA 3WDJA 1A1NA 3BWAB 5HPMA 5HHMD 3IDMB 3PDGA 3VFOA 4H1LH 3CMOH 3AREB 5E2WL 4O00A 3S6CA 4WY7H 2F53E 4JKKA 3E8UH 2RCSL 2YWZA 4RGNE 3OR6A 5EOQL 4MD4B 5FKAB 4HG4K 3PHOA 1NGZA 3UJIL 2AEPH 5I19L 4RAUA 4MHHG 1NUDA 2QSCL 4S1DC 4NWTL 4PFEA 3RIAK 4X6CF 3RIFF 3ZKSD 4LARH 3GI9H 3QIUC 2HVJA 1TNNA 1TQBB 4WI7A 2A6KA 5DRZA 1KLFA 3HFMH 1FNGA 1OTSC 5BXFA 1I9IH 3HC0B 5A43C 2DQFA 4WIQA 2X41A 1A6PA 1I8IA 5F6HJ 1AR1C 3UYRL 1PGRB 1XF3B 2VDOL 4WU7B 5D1ZB 5E8PB 4KJWC 2O5XL 2NY3C 2Y7QB 4HIXH 4EN3B 2ZSVA 1FL3B 3V4UL 4PJ7B 5IUSA 2EE3A 3L5IA 1T1WA 5FDYA 1OP3H 4YFDB 1HINL 2Y06H 3QDME 3B3IB 2G5BB 1UQSA 1KTDB 4QXGH 5SWZA 1YMMB 1RMFH 2FH6A 2AW2A 3ZDZE 5CSZB 5BO1L 2NLJB 2BSSA 5TE6L 2LU7A 1I9JH 1TZGH 4CJ1A 4M3KB 1T66D 4HIJA 3DV6B 3MV9E 2VLRD 1W72H 2FSEA 5AAWA 1IAMA 1RJYA 5DEGB 2V5SA 4HHAA 3BKJH 5E9DA 3WJLC 3MRCA 3BKCL 3GUTB 1NMAL 5CFHA 3VXUA 3LHPH 3UTZB 1SMAA 3V8CA 2V5MA 5C0FB 3CU1A 3C60B 3D6GA 5MI0B 5KTEH 3LRSA 4ZO6A 4Z7UF 1QKZL 4RDQF 3MZGB 1K4DB 4XCYB 4UT9H 4DN4L 2Y72A 1MI5D 5D72L 3EDKA 1NKOA 2OR7A 2GQHA 4OM0H 4P5TC 5E6IC 4LVOC 1WC7B 4LSRL 1O5DT 2F9BT 2WIMA 3IXAB 4L3EA 4NYLB 1HKFA 4YDIL 3PJSA 3T1FB 1CBVL 1OSZA 5J7CC 3PIQB 3O6ML 2R4RH 2GKIA 5IWLA 4JKWA 4GH7B 3HAEG 2J4WL 3VG9B 5BQ7B 4LMQI 5KVFH 4KK5C 5CJBA 3RQ3A 3CFKA 1S78D 5HYJA 3B9VA 1GIGH 1HZHL 1T0NB 3HG1A 3W11C 4KJPD 3T0VA 1YNTA 1FCCA 4NKOB 2EYRB 2V9TA 1FZOA 5F9DC 3K8KA 1MFDH 4O5LL 5KSBB 5SV4A 1F4AA 5AUMB 1EFXB 2I60L 3OB0K 1INEH 2XTLA 4FS0A 1R5IA 5EA0L 5JO5B 2VDRL 3QO1B 4GG8B 1NEZA 4YPJA 1MCOL 4PJFB 5IVXF 4D9LH 1U8JB 1Z5LB 4OLWL 5KVMC 2DQTL 3QPXL 5DJ2B 4M93B 4J3XA 5IHZA 1HHHA 3DO7B 3RWIB 2D03H 4P5KA 2B39A 1FIGH 1GVIA 5C0AA 1NBYA 1P7QD 1WFNA 5DGRA 1UGNA 1S3KL 4O02L 4L8DB 5ESQA 2DWDA 1FLRL 4XMLL 4PJXF 4PGDB 1U3HA 3KDMB 4NFDA 5MEOA 3QUYB 2DM2A 1S7XA 2P45B 3QUKA 4TVSa 1XCTB 4K3JH 4P2RB 4XVUD 4XXCC 5DTFA 5JNYA 2L7JA 1P7KA 5C0CA 2GJJA 5A2LH 3TCLB 4FP8L 1E4XI 1FC1A 2NY7L 4XX1G 2FX8H 3GEWB 3I6LD 3EIFA 4X83A 5I71C 1C12A 1YEDA 2HT2D 1AGFB 4L4TE 4DQOH 2ESVB 1YC8A 3M07A 4ZS6C 4Z7OE 5ACZA 2K9UA 4DWHA 4XPHL 3IB4A 4F33B 3KPQA 4U1GB 1WBYA 3MLWL 1A6VH 2HFFB 2HKFL 4NN7B 1R3KB 4OCSH 3KYOA 4BM7A 1RVFH 3BQUA 3TJEL 1BVLA 1KG0A 4JHAH 1BM3H 1LDPH 3U36A 1RI8A 3OKKA 2D4DA 4IRJC 3DX9B 1S7RA 2NXZD 3QEQA 5GRXG 3BP4B 4RMQA 3REWA 2HLAA 4N1HB 4PJEA 5K59E 3GSXB 4DGVL 4YHPA 4M61A 3PNWB 3RTQC 1A3QA 3CDGA 2XFXB 1I1RA 2L0DA 1U8NA 4Q6IC 5D2LB 2KQMA 3GSVB 2DOCA 3N0PB 1GGIL 3AXLB 4OIBA 4YXLL 2F19H 4A6YH 5L2JB 5HD8C 1N2RB 2HTKC 3QI9C 4U1IA 5GRYA 3D39B 1L4IA 3K4DA 4M5ZL 1YJDC 1INQB 2EH8H 4L8BA 1V3LA 4CBPA 2HFGL 4CGTA 1FVEA 5J1AB 1AO7D 3EOTH 1OTUC 1OM3H 5IK3A 1KB5L 1RZ8A 3QQNA 3TIDA 5JA9A 1RJZB 4BSJA 5I1EL 4LBEA 4MA3B 4LSPH 1WITA 3HNTH 5DJ8A 3O0RL 1ZGLA 3VFUB 4MD5A 1I3UA 5DQJB 1XGRB 5I8CB 4PJ9C 3EFFA 3VMOA 1XR8A 1OARL 4P2OC 3K1DA 3VXTB 3SJVD 4ZPVA 1OWWA 1JWMB 2VYRE 4JREB 1C5DA 1YYLH 4F7EB 1OQOA 3OB0H 3G04B 2YD8A 3BEWA 1IAOB 1LEKA 4MCYA 2VXSH 2ORBL 5MEND 2WQRA 5TF1H 3BPLB 3BIKA 4QCIB 4XPBH 1TETH 5HVWA 2HJLB 3FRPA 5TGBB 3VXSE 4YBQD 3RWHA 3WNNA 1P84K 1FJ1A 4UBDC 5DYOA 4GKNA 4ODBD 3VXOB 2E7MA 1DE4A 1PZUB 3RU8L 1RIVL 1JGVH 2A9ML 4BH8A 4WHYG 2ZUQB 3MO1B 5FFLA 1NC2B 3HZMB 3LSOB 5EOCH 1A0QL 1XAUA 2GYSA 4QTIH 4UDTA 4ODVH 3VFRB 3G5XB 4QY8B 3VA6A 2P7TA 1MREL 5ISZD 2HKHL 1A7OL 1J1PL 1Y6NR 1A5FH 1DR9A 2F74B 4RFEB 2VAAB 1NDMA 1D5IH 4OB5L 3P4OA 1V05A 1U91B 4CMHC 3G08B 4MAYB 4HK3N 5KS9B 5B8CB 2GSGB 4WW2C 5E08L 4OLVL 1FC2D 3DURB 2ATKB 5C0BA 1IEHA 4RAVB 3V5DB 3AB0C 2CLRB 2FGWH 2DL9A 4PJ5E 5FCUL 4MSWA 5MEQB 4I8DA 5DO2C 4OUOA 2FHCA 1GHFH 1QLRB 3VD5A 2ZSWA 3VXPB 3DETC 3HR5B 4YGVB 5EOTB 4UDUA 3BZFB 1AXSA 1TJHL 2GY5A 1IILE 4PTTA 1LE5A 5H35B 3CAFA 5L6YL 2BRQA 3MNWA 5JQ6H 4NO5A 1FBIL 3VJ6A 4K2UL 2WK2A 2VWEC 4S0TD 5GRZA 3AAZA 2UZIL 4LVHC 4NUGH 4HS8L 4QRPE 3RGVA 3FFCB 2WINB 1T1YA 1G7HA 5DUML 5GGTH 1CFNA 4JY4B 4X6BA 1GGCL 1QFWH 4K3HA 3NAAL 1YEIH 3G9VA 1VACB 3CPLA 2EIBA 4AENA 5CINL 3V4VH 2CIIA 1P6FA 1KJ3L 1X7QA 1EEYA 2XA3A 1Y18B 2E8ZA 2C7UA 3LKRA 4NP4L 4P5TD 2XQBL 5E6ID 1MIEH 2DJ4A 2DIAA 2C3VA 2R1YA 4OJFH 1J05B 3H9SD 3L5XH 1Q0YL 1A2YB 1IGFH 4LRIA 3BWUC 3MA7A 3WL9A 4BUHA 1UM6L 1B4RA 5CS7A 1UB6A 5HHMB 1MFBH 4AEFA 5E7BA 4EBQH 3Q1SL 2SEBB 1NDGA 4KK5D 1DQJB 3OKLB 2GTWB 3EYOB 4AEIL 1N0XH 1HCVA 4NHUA 3OG6B 3IF1B 4NHCH 5JHDB 1SM3H 4MJ6B 3O81A 3UDWA 2DQHH 5C70A 4LIQH 4R4FH 1K4CB 3DVGB 1ETZA 3ILPB 3MXVH 2NY4D 4M6OH 3L3KA 3MJ8B 3IAGC 3EYFB 4MDIA 5ALCH 4HZLB 3O6FB 2YKLL 4NUJB 4CVZB 4I48B 4Q97A 3V7AE 5B38A 2PXYA 3HI1A 5KJRH 1JZ6A 4BK4A 2NY5C 1NMBH 3C5SB 3HUJF 1JPSH 1YPZE 3OJVC 3V0WL 2JJWA 2DLHA 2PO6A 3I02A 4IIQA 1CLZH 1S7VB 3CSYB 5B4MD 3U0TA 1RZJL 2VN4A 1UXWB 4URTB 1NCWH 1D6VL 3JZ7A 4WFFD 4JY5L 1B9ZA 4M1CC 1MH5A 4YZFF 4FMKA 5E2UL 5F1SA 1JTOA 2XN9D 3PWPD 1QNZH 1QPXA 4ZDHB 1DDHA 5KSAD 3G6DH 4RZCA 2P8PB 3FJTA 5ACLA 4B53A 3FONB 2EDDA 5I16A 3MSPA 1ROWA 3VFMA 4G9FD 3ZE2E 1KELL 3C08L 1G7JA 1Y0LA 4O58H 4ZSOE 3PHQB 5J8OA 5ILTL 1LWRA 3LEVL 5L0QC 3NCJH 3I75A 2GAZA 4EDWH 3REVA 2XA8L 3P4NA 3BIAX 4X4XB 4UB0H 5D7IB 32C2A 2FJGB 4XC3L 3TNMB 3KLDA 4LLQA 5E94A 4IDJH 5F7LB 4YNYB 5H2BA 1NFKA 2VKWA 3VA2C 4YJZL 3THML 1CGXA 4IRJD 4LQFL 1HKLH 3QO0B 4GAJL 3MR9A 4WFGD 3WD5H 2OYPA 2IEPA 3AU1B 1M4KA 4FQJL 3D0VB 1MI5B 2YD1A 3WUWB 1VFBB 1OWRM 2ERJB 2BFVH 4PRNB 4R9HA 5ID1B 3W5NA 3MBEC 2DI7A 4KDTA 1Q9KA 5GSVB 4ZMAT 1HDMA 2CGRL 3PV7A 3ULVF 5HYQB 3RPKA 4JDVB 3FO0L 1CDCA 5CGYC 4ZXBA 1ZTXL 5CJXA 2VLLA 4IOFC 1MCJA 1BEYL 3VH8A 3V2AR 2HTKD 4HJ0D 5EU5B 1MCLA 3L3JA 3QEGL 5KSUA 2VDNL 1RUKL 3EO1B 4GAYA 2YPVH 4KTYA 3JBG7 4QHNB 4M7JL 4J3UA 3HNSH 5T3ZD 2EYSB 3D3VD 4OGXL 3U9UA 3W0WD 4NO2A 3MCKA 3PV6B 1P6AB 2DYPD 1QTYT 3FQUB 4GKZB 4GAFB 4L4VE 2R1WA 4I3GA 3ETBF 1GC1H 2GK2A 4GKSA 3TH2T 1FVCB 2BVPB 2WMPA 1SY6A 2AK1L 1U95A 5A2FA 3L95A 2EDJA 5HHPA 4MAUH 3VGEA 3GGWB 3EUUA 1CVSC 4FA8A 4ZNEE 5JR1H 3CNKA 4YQXL 4UBDD 4WUKH 3S4SA 5AZ2L 4KHTH 5FK9B 1CL7L 2BVTA 3OAUH 5FGCE 3LPFA 1TQCC 2CIKB 3HC3L 4FABH 1YZZA 5D70L 3WIHH 5TFSH 5IF0A 1X5AA 3QAZB 3O9WA 4Z7VB 3BXNB 2GHWB 1XF4A 4M00A 3O3DB 2NYYD 4HKXA 2G2RA 4NJ9L 4ONFL 5FO8A 4YO0A 4D0BB 4PB9H 3OHXA 2MCG1 1AIFB 1BVKA 4JFDA 1I9RH 2ITCB 1JL8A 2P8MB 2VLJA 3BIBX 3LEXA 4P46B 1RUPL 3O2VL 4OGAD 2UWEB 3PL6D 1CXHA 3BDYH 3VRLE 1MCKA 3WO4C 2CJUH 2YD2A 4P23C 1KN4L 3NH7H 5MHSE 1UACH 1AD0B 3ZSSA 2WWKO 4MZ3A 5CEXB 3RPIA 5I8KH 1YEFL 3TWCL 1JPFA 1BFTA 1JNLL 1CLYH 1J87A 1LD9A 3IKKA 2F5BL 4IHOB 3TBVB 2IANA 4HUUA 3T65A 5GGQH 1HIMH 3RHWK 4JFXA 1CXLA 4M4RA 5HGAB 4MXWL 25C8L 4LPXA 1H15A 2AVGA 5F3BB 1U0QA 4Y4FC 2CLVA 2IJ0C 3QJHB 1FPTH 4LCUB 1M71A 3DUUB 4Y5XC 2ZJSH 3UJJH 1MHPH 3B8YA 2HG5B 5C07A 4AM0A 3RVTC 5CKGA 1MFAL 4K9EH 3T0EE 4MA8H 2DB8A 5H37H 5B39G 2IF7A 2Z8VC 1YNKL 1FGNL 4EI5A 3QDGE 3MRRA 4J1UB 1RURL 3BPNC 3R0NA 1KLUB 1XGTA 2O26U 1ZHKB 5EN2B 1MCEA 1JHKH 1JFQL 2BNQA 5IR1B 3BH8B 5MENB 5IJKC 5JW5A 1SJHA 3IJYA 2VL5A 1KN2L 4G7YL 4Z0BH 3OV6A 4JFOB 4JG0L 3SDXB 3VXRB 4G80B 1KCLA 1UYWL 5GGUB 4ORGB 3J7HA 3QA3A 4XMKL 3C6SB 4FXLA 4PUBL 2Q86B 3T0AA 2BNRA 1S9YB 3GBMH 5E4EC 5F7FA 3ZT7A 2H2PD 2VQ1A 2CRMA 3PP4H 5BZDA 1J1XH 4MGXA 5CKAA 2Z0BA 4KGJA 5KW9L 3CK0H 1BX2A 1A3LH 3IFNL 1LP9B 2WUBL 3ZKQD 1G7PA 4APQA 2IPKB 4ELMB 1FORL 2J6EL 3CD4A 4U1SA 5ISZB 4OIIL 5IESH 4LSVL 4S1QH 2FL5B 3WKMH 3MV8E 2IC2A 4NNPH 1KT2A 1HQ4A 2YD4A 1A3RL 3T2QA 4PJDE 2DQGH 4FFWD 3MCLL 2Z92B 4JDTH 2PR4H 4Y5YB 1MCWM 1XF3A 3OXRA 4N0UA 2Y7QA 5BRZD 1MEXH 4HZAA 1NFIB 5TDNA 4BZYA 3TBWB 2XY2A 1MCSA 4I18C 5D5MB 3HE6B 2WUCH 5EIIB 4KXZI 5JOPD 2BDNH 2VJXA 2GK0A 4ZD3H 1ORQA 3FQTA 1R3LA 4X6EB 1JK8A 3TVMB 4PTUA 5KG9A 2OZ4L 3ZDZF 5BZWA 4RISL 2ARJQ 1JVKA 2VUYA 5D7JD 2G9HB 3G5ZA 2BNUB 2QQKL 4PGZA 3QG6A 1QSVA 4L9LB 1JGLL 3KNBB 4UU9B 4QRRD 2J7LA 1LE9B 1CDIA 2BY2A 2NR6C 3RVUC 2Q76A 3MBXH 3MROA 2D2OA 3UC0H 9CGTA 1S9XA 3B2VH 4ONHB 1JCKA 3MBED 4LDOB 1H8SA 4K23L 4PRIA 5I1HH 3AS2A 1VENA 2IBBA 3H9SB 5F8RC 4UTAH 3CVIL 5CGYD 3FCTA 5F3HB 1LDSA 3GHBL 1WC7A 3IXAA 4NYLA 3T1FA 3QQ4B 4IOFD 3HPJB 1MRCH 4KAQL 4U6HB 3V5HA 4ZFZB 3L6FB 1HILB 5ICZA 5TQ2L 4C56E 2WBKA 3EKCA 1LMKA 4RGOL 4U0QB 5CILL 1SJEB 1MRFL 5DD6B 3DXAD 4Y5VA 1KACB 4BKLA 4UNVA 1RSFA 2ZP0T 1IQWH 5HYEA 2VIRB 2VZVA 3O2WH 4R97B 1A4JB 1CD0A 1JPGA 2CK0L 5FEBA 2AXHA 3WIIL 3G5YB 5IB2B 4FMFA 3SOBH 1GAFH 1IVLA 5KSBA 3VWJD 1HH6A 5AUMA 2JELL 2VLKD 1V7ML 1CS6A 3DARA 3SDCA 3F7VA 5DT1L 3FB6A 4ZFFA 3MRPB 3QUMB 1JNHA 5TPWH 4F58L 1EAPA 4GRLC 1FGVH 4XCNA 5F6IB 5IB5B 5IROC 2VB5A 5IT2H 4NQED 4L8DA 4UIKL 4ZFOA 3KDMA 3K74B 4OD2B 2BVOA 1IGTA 5BS0A 4KU1A 2KUTA 5HI4C 4P2RA 4XVJL 4BZ1H 5KSAB 5DURB 3M8OH 2PYFA 4N8CH 4PREB 3I50L 2IMMA 2P5EB 4JRYB 4ZPTA 4OZGB 3IETA 4BZ2H 1UWGL 4XBGB 1FIEA 4U7MA 2ESVA 4GBXA 4Z7OF 3TA3B 4NZUL 3HS0B 3ARDC 4F33A 4KKCC 2XZQH 1YYML 4DN3L 4HGWB 2HFFA 4HC1H 3B9KB 1CF8L 1R3KA 1RQ5A 3SE9H 4HUWB 2BERA 2R4SH 2LVEA 3RJQB 5J1SC 1U58B 4P23D 1T0MB 5AZEL 3BISA 4JM4L 1KPUB 3OZ9L 3GMPB 2P8LA 3HZVB 4NO3A 3Q6GH 1F6FB 1G0DA 4F57H 3TO4C 1DN2A 4GRMB 4L8CA 3MUZ1 3GSXA 5K59F 4J3SA 3D48R 1AXTH 1KENL 5J1TC 4FHBD 4HWZB 4I5BB 4U1JB 5D2LA 4ZUTA 2JJSA 2X4NA 1W0VA 3T0DA 2G60L 2W60A 3L9RA 5I1JH 2HMIC 4Z95H 4Y2DA 2XTJB 1M7DA 4JLRB 1KTLB 5L2JA 5EZIH 2EC8A 4UV7H 1YJDH 4I0PA 1C16B 1FFQA 4W6XB 5LKNA 3BGFC 1MAMH 1T1XA 4Y4FD 4UIMB 1VERA 1X4YA 4RWHA 2LABA 5T3ZH 4ODWB 5EWIL 2DAVA 4N8VG 3D3VB 3DVIA 3RI5F 4Z6AT 5KVEL 2DIBA 3RVTD 2WZPD 1BQUA 2Z93B 4LLMA 3T4AB 4X8JA 4LFHD 2FHFA 4MA3A 1NGQL 2WBWB 3BE1H 3T04D 1OGTB 3VGHA 2ARJA 1E6OH 3MRQA 2FX7L 1EHLL 1EEUA 1JRHL 2FRGP 5I8CA 3HNVL 3S36X 3VXTA 3C2AL 5JDJA 2Y6SC 4LU5H 3C5ZC 3SE8L 4P4RA 4LCWE 1FRGL 4DUWA 2ZOLB 5DQ9B 5DD0L 3IDNB 3BP7A 3OKMA 2NW2B 3RWGB 1B0GA 4GW4B 4I2XB 4W81A 5ALBH 1DVFD 2UY6A 2DLFH 5FHAL 1VKXA 1IM3A 5FHBH 5T1LD 5E70A 1IC4H 2IADB 1R5WB 4NJAL 1MHEA 5IHUL 1XZ0B 4NN5C 5DJZA 3RZCC 5HYSG 5INCB 4LHUB 3S35H 5I15L 5IMOB 4P2QB 4XPTH 2OTWB 3MRJB 2YA0A 4BYHA 3LSOA 4UNTA 4YIQB 2H2SC 3LV3A 4N68A 1I3GH 1YY8B 4OLZL 5I73C 2NTFB 3R06A 5E8NA 5BCAA 1Y6KR 3DGGA 4JAMB 4OZFB 1F3RB 2J8OA 1IAII 2F74A 3G9AB 5LAXA 3RDTA 5CCKH 3BI9X 3EOAB 4RFEA 4OSUH 4GRWH 3VFTA 3L7FB 2CRYA 4ZFGH 1G6RH 2I24N 1PQZA 4PJBE 3KLAB 1T2JA 1NAKH 2VXVL 3PL6B 2JIXA 1FH5L 4FQIL 1IEAB 3BD5A 5EU7C 5IEKA 4GKOA 1N64L 1U8PB 4DCQB 3TNNB 4F7MB 4HIHA 1DBJH 2K3TA 1IAKB 3MOBL 1TPXC 1P4BL 3SDAD 5LQBH 5M7QA 5HGDA 4OQ1A 1C1EH 1NLDL 1FHGA 5IFHH 4YE4L 3MLVL 1KV3A 2G5RA 3V6OC 1F13A 5J9PA 4UV4L 2F5AH 1J0YA 5DEFA 1QBML 1ZVSA 1ZLUK 3SGJC 5H35A 2FECI 4YHZL 4L4TA 1F02I 2JE8A 1U6AL 3VXQB 2GEEA 4FNLL 4D0CA 3BHBB 1XCQB 4L1DA 5I66B 1NAMB 3BJ91 3KYMB 4M7ZB 3FFCA 2OSLB 3VD9A 5FECB 5EC2B 4LASH 3KPSE 5CD3B 4Q74A 4JY4A 2DWEB 2X1QA 3EBAA 5DMJB 1DBBL 4N5EC 4Z7WB 1D5MA 2N1KA 2I07B 5F7EH 4U6VH 1OLLA 3H0TB 4K7FB 4EOWL 5E8DL 2IQAA 1A21A 2KZWA 1Y18A 3MOAH 3C6LC 2X09A 4HAGA 2FD6H 5DDHB 1X5KA 2J8UB 1E4XH 3D25B 2Z35A 1FAKT 5HHOD 2F58L 1QRKA 4R26H 2XZCL 5DD3H 1AJ7H 4OCXL 3U30B 2WW8A 3C09C 3L5WA 2R9HC 3L3OA 3QNYB 3DRTA 5CJ5A 4JJ5A 4G8IA 3EYOA 2V7NA 1T03L 1KEML 5TDPA 1HI6A 3IF1A 4LCCA 1JMZA 5JHDA 1T7WA 1QRNB 1ZV5A 4YXHL 1EO8L 3PWJB 2MJWA 1NCCL 1R3HB 5IG7A 4BQCA 2ZKHH 2DS4A 3IT8D 3LN5B 2GJ6E 3CX5K 2Z31C 4HWBH 3T3ME 2ZCHH 3TZVA 4K3DH 1YDPB 2NY5H 3MA9L 5DD5H 4FQ1L 2YHGA 3O6FA 5FGSA 4CVZA 4JQXA 4NM4H 4I48A 3D39E 3MGTB 5F9OH 4GG6B 1DLFH 4KQ4L 2KQNA 3O3EB 3QRFM 1YPZF 5AAMA 3DGCR 3EGSA 3MXWH 3CSYA 3KPMA 2CQVA 3QUZC 2A77H 5BRZB 1UXWA 4JDZB 3T8XA 3K80A 3WCYA 3VXSA 3ECBB 3X3FH 1KB9J 3MV7A 3QEHB 3IRZA 3NA9H 5FO7A 5IFJA 1BBDH 1TFHA 1CGSL 1RZKC 5C7XH 4GO6B 4Q2ZA 1DP0A 4WO4A 3UTPE 1CT8A 3FONA 4YHLH 1QR4A 2AV7A 3AM8C 3A6BL 3DX6B 5EZOH 5EZLA 1FFOB 1EEQA 4HCRH 3E3QE 1L7TH 3W39A 3LKPB 1KCRH 3N9GH 4K7PH 3CLEL 2XYCA 3FMGH 3NCCB 4AEHH 2WLYA 1N6QL 4FQLH 3X13B 3ARDD 2ICWI 4HQQL 2ATPB 4GMSL 2ZPKH 1ZLUH 1BVZA 3NGBC 2YOCA 4WTWA 2WV3A 5D7IA 5HTSA 3ROLA 2I5YH 1TJGL 1N26A 4KMLB 4JQIL 4GJTB 3CFJB 3MODL 1LVEA 1GCFA 4GXVL 1MPAL 5DK2A 4PJ5A 5GGVL 3HLAB 3H42H 3WUWA 3SKMA 1VFBA 4PRNA 1EIBA 1Q0XL 3FO9A 3NCMA 4JFFD 3I2CL 4X5XA 2XIDA 3QCTH 2RBLA 1HXYB 3C8KB 5L2KD 4JDVA 3MLUL 5IKCA 4S11A 3SKNB 3EJJX 1VSCA 1SEQH 3BT2H 1ADQH 5IB4B 3PABB 5CLWA 4E41E 5KS9E 4UILL 4Z0XA 15C8H 3VXNA 2CDGB 1ACYH 4QRPA 4JR9L 4ZS7L 3S36H 3WFBL 4HH8A 4PRPE 4G6JH 3PGFL 3RL1B 4LDLB 3P3YA 3VWJB 4L5FL 1D6EA 1EPFA 4GLRI 3K46A 1DFBH 1AP2B 2XXMB 3VGDA 1BQHA 3QPQC 4P9HH 2C1PA 4MJ5B 3C5ZD 4G6KH 2OP4H 3U4EA 5D2NE 1ZS8A 5DA0B 5GJTH 3WKNA 4CL7A 1OGAD 2P1YA 2FATH 2VDKH 3QCUL 2Q8BH 1OAKH 3RWJA 1YNLH 2IGFL 1QO3B 2OLDA 3DYOA 5C6TH 1C5CH 5K9QG 2DKMA 3KJ4B 2JCCF 3GB7B 3KPLB 1QEWB 1FNEB 4BFGA 4LK4A 4POYA 1I7ZB 4JKPL 1HXMB 4UT6H 3B9AA 4KJYB 3QUXC 4M03A 4NQCB 3CUPA 5K9JH 4ZO9A 2FBJL 5KVGL 3MFFB 4PR5B 4JZOA 2KL6A 5EO0B 2FDBP 5I9QB 1QD0A 5HHME 2EDWA 3O3DA 4M62H 1JF5A 1G7MB 1K8DB 3FOMA 1MLBB 4R3SA 4MJID 3FB5A 2HJKB 1JPTH 1ND0B 1YPZA 5J12B 1F3DJ 2P8MA 3BGMA 4PY7B 4NQDA 3RKDC 4NRYB 4Y4KC 2X44D 3OKNB 2UWEA 5JW4R 2BRRL 3VRLF 2KPNA 3CFIC 4HFUH 4LIQE 1BFVH 4K94C 3O11A 1YEGH 3ALXA 1BAFL 3RGHA 2EDEA 3VFSB 4A2LA 1AGDA 2F15A 4JPVL 1EXUB 4S0SD 3F12A 2BJML 3C8HA 4IHOA 5DHVB 3TBVA 1AI1H 1CFQB 4ZSOA 1VEMA 4KTEL 1EK3A 1OAYL 5ADOH 1J9CT 4XP1H 4QWWC 5F1KC 4J8RB 3ULVL 1FAIH 2P46B 4XGZA 5LGHL 3MRKA 4G8GD 3KAAA 3KYAA 5CIPH 3UTQB 5ITBH 2DQDL 1Q9OB 1GPOL 3QIBA 3OXSB 4N5ED 3KXFD 4G6MH 4G9DA 1U42A 4DGYL 1JN6B 3H7LA 5D71L 3VFPB 2OS7A 5TQ0H 4AG4L 5I18H 1I85A 4J1UA 1H5BB 5CD5D 4ZUVB 2W9EH 5GS0C 3MLPA 5SWSB 2QV2A 2VLRE 3QXUA 5AYQA 1FL5B 2Y5TA 2A6DA 4X5LA 4HJJH 5SX5K 4HJGA 3E6FB 1DBKL 4O51A 4F7PB 1DVFB 3WFEH 5IVNA 5L88H 4JFOA 2R9HD 2HYMA 3VXRA 3QQ3B 1T1ZB 3MYJB 4MNHB 5GGUA 4OAWB 4PIRF 2Q7YA 3NABH 1JNJA 2VXUL 1F4YH 1UJ3B 5IHBA 4J4PD 2R0WL 3ZLQC 4BA8A 1ZT1A 3QRGH 4Q9RH 4WI2A 4LAQL 4M7LL 1VPOL 3V6FA 2XRAL 2EXYD 3ULSB 2Z31D 3BPOC 4YXKL 5E5UB 4NKDB 5DS8A 5FOBB 2QQLH 1L0XA 2X7LB 3K2MC 5D96C 5MERB 3VGAB 4IJ3C 4PJDF 4GOSA 1C08B 3QUZD 5EC1B 5GSRB 4Y5YA 3BDBA 1JYVA 2PW2A 2X4QA 3D0LB 3HMWH 3TGXA 5DR5L 4NCDA 5FA4A 5EPMB 4NQSB 4ZNEA 1KNOA 3OL2A 5C0DB 3SDAB 2IWGA 1FZKB 5KANI 12E8H 1DQMH 2PN5A 2V5TA 1EMTH 1EZVY 1MRDL 4MWFA 2JKXA 2DQCH 1RK0B 4H25B 4KRNA 4GS7B 2EDLA 1OF2B 4R7NA 4O2FB 1RUMH 4MNQB 1INDL 2PYED 4JPWH 1RHHB 2X9YA 3TVMA 4DOHE 4DK6A 2C26A 2C3XA 3K8MA 4TPRH 2E9WA 5ESAB 4Y88A 3VCLB 3UPAA 2D0HA 1W8OA 1L9MA 4JVUA 3UTTB 3RWEA 3W9DA 3OKYA 5BW7C 4X99B 1FQ9C 2GSIB 4L9LA 2Q1EA 4LPWA 4JHZA 1LE9A 4ZUWB 2YA2A 4KMTL 3IFOB 2MFNA 3JV5A 4NZTL 4OLYL 3I6LE 3EYUL 1X5IA 3F58H 4X6DB 1Q1JL 5DQDL 2YPLB 1ES0B 1LO4L 4M1GL 1X5LA 3UROR 3IU3A 1XR9A 4WNQB 4LVEA 3QIWA 3LZFL 1MFEH 1I7UB 1NMCC 4FFZH 1N4XH 4C57C 2VC2L 4E5XB 3IJSB 4EUPB 1HILA 4KROB 3PHSA 2QR0B 1GH7A 3V0VA 4WW1A 2IAMA 1QHPA 3EOYG 5SX5H 1MCIA 1R3JA 3NACH 1U3JA 4AL8H 2VIRA 3BAEL 3BQUC 3OKOA 5GJSL 1QFWM 3IDGA 1XIWB 4ODHH 3FFDB 4XRCB 5I0DA 4HMCA 3S88H 1CGVA 4PRDA 5BMFL 3RWCB 4ZFOL 3T0EA 3KLSA 4U1HB 4ZUSB 1TITA 3T0WA 2YRZA 2DQIH 3QPQD 5AG8A 6FABL 1EJ6A 1OAXH 3QCVL 5GS1A 2IG2L 4YHOH 2GUOB 3ULUC 1K3ZA 3HHRB 3QUMA 5D7KD 2FZ3B 4AY0A 3MNVB 5D1XA 2BVUA 3EHBD 1AO7E 1E6JH 5D7SL 5KZCD 3FT4B 4ENEC 2IPTL 5ANMB 3W5MA 4TOYL 5F6HI 1A6WH 2X1WL 3TF7C 3DSFH 4NPYA 3VRJA 1AHWA 1BWMA 1F4XL 3NZ8B 1CIUA 3KG5A 3PWUA 1DSFH 4DZBA 2A38A 2P5EA 3SJVE 4JPIB 5EUOB 5B3JE 1BD2D 1PD6A 3GSRB 2V2XB 5MENE 1I1CA 4I3SH 4D8PB 4POZC 1YECH 3MYZA 1JNNH 4XBGA 5TH2B 2FEDC 2ID5A 3GO1L 2FR4B 3MRIB 2H26B 3TA3A 3U4AA 1JYWA 1KB5B 4NGHL 4WI3A 4HGWA 3RAJL 3NIFE 4PJDA 2X1XR 5FOJA 1MFCL 3PGCB 4HUWA 5D4QA 3ARGC 4AQOA 5D6CB 4NO0A 3GJEB 2R1XA 3L3HB 4MQTB 2VLMD 3U7YH 5E2VL 4L1HA 5HI5D 5CUSL 5T1MB 3RP1A 3ZTNL 5DC9B 3NCBB 4FOMA 2NY2D 4PP2A 3L3IB 1OB1A 3VU2A 4IS6B 4QXWA 5CP7B 5L2KB 4I0CC 5CZKA 5MEPA 5EB9A 4FZ8L 4I5BA 3CDFA 3MLSL 2R8SL 4G8EB 2VE6B 4OCRH 5EBMA 1YA5A 3ARFB 4ZTPL 4QWWD 2IALB 1I1FB 1KTLA 4JB9L 2ADGA 4NDMA 5J57B 3OAZK 3IDJA 5JPMB 5I76A 4UIMA 4XVTH 5DUPH 1IFHH 3HAEH 2VITA 4PJ7F 5D5ME 4RFNB 3MRHB 5EBLB 1T22B 5FYJU 4HH9B 1A1MB 1DN0B 3DECA 2Y5EA 35C8L 2Z93A 4XI5C 3B6SB 1IKNA 1VGKA 3O2DA 3GJFB 3QH3A 4WDIB 3WSQL 1OAUH 4OLXL 3TT1L 1ZHBB 5C8JB 5GS0D 4U1MA 3QXDB 4KXZH 5DC0A 2QHRL 1D5ZA 4HLJA 5D9SA 3O8XB 4HV8B 1D5BA 1X5FA 4PJGB 4UINL 3KHOA 3DOSA 1T21B 1U8QB 2VMFA 5DJDA 5E9DD 4DKDC 5ID0B 5K9OA 3RGVC 4N0RA 2RAMA 3BRFA 3X14B 43C9B 3VXUD 3WUWG 2IPUK 3K81A 4OM1L 4Z9KB 3EDDA 3GZKA 3DIFB 1R5WA 1TJHH 1DUZA 1SBSL 1TTFA 5L6YH 2VDPL 5IMOA 1EGJH 4P2QA 3H9SE 4PBVC 3MRJA 1KJ2A 2AI0L 3LD8B 3QR2A 3QULA 1CGTA 1FCGA 1PLGL 2X4PB 4X7SH 4BQBA 3UTSD 3ZYJA 2JK5B 2DD8H 1YY8A 4L3ED 1MJUH 2VDML 2W07A 3ARBC 1RK1A 4OZFA 4LHJB 1WFUA 1A7PL 5BVJA 3S96B 5F7HA 3T4YA 1Z9MA 4PJBF 3SKJL 4U3HA 1KJ3H 1EHAA 5L8LB 5HYJD 1LO5A 1HEZA 1K8IB 1GZQB 2M1KA 1WJ3A 4MQ7A 4CN1A 1RZGB 4XP5H 4ZUUB 1ITCA 4P4KB 3IU4H 4U1LB 3KPOA 1IAKA 3CFCL 5LGKA 5F70A 4OQTA 3PQYB 3T77A 3BMVA 3GMNA 3MRBA 5ELIA 1H0DA 1JWUB 3SY0B 4PJFF 3TJHC 2AXGA 1B0RB 3HE7A 4XPGL 3RIAF 2B5IB 3SCMA 3MUGB 5ETUA 1Q9WA 5EUKB 4OT1L 3PWNB 2PXYC 1FFRA 5DMIH 3SDDB 3LAFA 3SKOA 5DUBB 3RNQA 4LP4A 5BOPA 2W91A 3A67L 5C0AD 4WFFE 5C2BH 3BGAA 1A8JH 2CMRH 2VZ1A 4ZAKB 4YK4C 4JZJC 5K9KB 3V52L 1HHJB 2EE6A 4G6FD 2XN9E 4XHQA 3OAZH 3PWPE 1RPQA 1K2DB 3EDEA 4UNUA 5EC2A 4GAGL 4NNYB 3KXFB 3RRQA 5E7FA 3SPVA 1P4LA 1MHCB 5FAAA 4RMUA 4G9FE 5DLML 2BZDA 5C0CD 1LO3H 1R6VA 1X5YA 3GMRA 4K7FA 5ESVB 4KVNL 1WZKA 2Y07H 2DQUL 3O6LL 5GXBB 1EEZB 4Y1AA 4Q0XL 2FIKA 4O9HL 3TV3L 1CZ8H 4IBLT 4LSUL 1IEBB 3J8F7 3VI3F 4PLJD 1NLBL 3Q2CA 1S7SB 1IKFL 2X4SA 4PS4L 3CVHH 4WFGE 4J6RH 4MQSB 5KN5B 1QUNA 3BQUD 2FO4B 3EO9L 5FYKU 3O4OC 2XNAA 1NGWA 3VFVA 5BV7C 1JHLH 5HJ3B 4EVNB 1ZT7B 4KUZH 3ZDYE 1CICB 1IGMH 1TXKA 3TEUA 4H0HB 1R3HA 4KKLC 1G7LA 4WHYH 2A74A 2B1HH 1RUAL 5FYLD 1ZLWH 3FQXB 4RAHA 3S37X 3V4PL 3LN5A 3ULUD 4JO4L 1IGYB 1YDPA 3T3MF 3SE3C 4GQ9H 1SMOA 4XNYH 3D2UD 1HHIB 4LCWA 3VRIB 5D7LD 4XPAL 2ZOKA 5T3ZE 4WCYH 5F72S 3VE0A 2AJYL 3D3VE 3W0WE 4F15B 4C4KT 3FZUC 5DVMA 1E28A 3ECBA 1RZKH 5ICYA 2YC1A 3CCHA 4XBEL 4FZEH 1VFOA 5HVFB 3QEHA 1UADC 4G8FA 2O93L 1ZVYA 3ZTJG 4K3EH 1QFPA 4N9GB 4MD0B 3GMQA 4R2GB 3JV6B 4HPYH 4OZHB 2PYEB 3VWKA 1MVUA 4LPVA 4R8WL 1ZLVK 4JRXB 4ODXA 1E27A 2XY1A 3LKPA 5FKPA 4DFHA 3BSZH 1FG2A 3U48A 4XNXL 1LEIB 3BVNA 1QPPA 3OG4B 1CD1B 4QRTB 1OP9A 2A9NH 3MRDB 5K9QI 1J5OH 1IL1A 3WE6A 3HPLB 1KF9B 1Z2KA 2VZSA 5KOMC 4HXAH 1KBGH 1MJJB 2C4FU 2OJZH 3TBTB 3FTGB 1FO0A 1CD9B 2X70B 2OJEA 4MDJB 3VFGH 4FFYL 5EU6B 3HLAA 2X4UB 2EDYA 4HKJB 2LU4A 2ICES 1EJOL 1ZHLB 3N1PC 3OBAA 5C09B 3WNOA 1SBBA 1BP3B 3CZJA 2AJZA 2AAVA 2LTQB 4D94A 3ET9F 4L8SB 1MJ7L 2VZ3A 3NFSH 1BIIB 4ISVB 5C0EA 4GRWE 3WFCL 2GTZB 3BN9C 5DMYA 3HC4H 1AKJA 1WIPA 5IB4A 4EI6A 4FQXB 1EH9A 4RA3A 1OPGL 1MCPH 2EXWC 5KS9F 5DFWH 5F7NC 1OW0C 4JM2A 4LLUB 2RR3A 1IAIH 5F7DA 4TUOB 3P9LA 5HHXH 2DIJA 4LMQE 2YMXH 4ACPA 2RIKA 3BDXA 1H3WM 2NXYB 1QFUL 5ENWB 3FRUA 5IBTL 2Y4SA 2NX5E 4P99A 2VAJA 3BP5B 3NZHH 3S5LB 4XNZB 1HSBA 1NGPH 5IJVB 4NQXA 4MNGE 4MJ5A 1LK3L 1IQDA 1TTUA 3DHMA 4YPGA 4QYOA 5J56B 5I1LA 4PBXA 1NBZA 3D85A 5IB1B 2WIIB 3P0YL 4GSDL 2ITDB 5DMKB 5KZCB 4X0KA 4E0RB 5M95B 2AK4D 5ICXA 3U7WL 1QSFD 4ERSL 3RGVD 1A7RH 1D9KB 1QO3A 1NSNL 3EO0B 2IH3B 1S7TA 1N3NB 5DGQA 2GCYA 4RRPG 5C0IA 4KY1H 1KXQE 1I4FB 2E7LA 3LS4H 2X2YA 1IMHC 4OBSA 5BVPH 4KJYA 4PRHA 3O3BB 5JXAH 4ODTH 1C7TA 4G3YL 4JHWH 2R0LL 3I3BA 4AMKL 4PR5A 3HMXH 3L1OH 2YUVA 3ARBD 3GSWB 4JO1L 5FGBA 3CGTA 3LDBC 5CP3H 2RJMA 1XGPB 1ZLVH 1DEDA 2HT4C 3NPSB 4A6YA 5J6HA 5HPMB 3MACH 3D18B 1B6UA 4OCWH 3NIDE 4O2CA 4AZ8A 3EW3B 3Q6FB 4NRYA 5J6GB 3FHAA 4U4BA 3AREC 3OR6B 2QQNL 1URLA 4LCIL 2VZTA 4XP9L 4UQ3A 1F4WL 2NZ9C 4KTDL 1FVDA 2W9DH 4R4BA 4RAUB 3DHJA 2NY2B 3ZKMC 4WEUD 4G7YH 2HVJB 1UM5H 3VFSA 3ZHKA 4C83B 2IFFL 4KPHL 1N6UA 2A6KB 4LNRA 1DTUA 5DRZB 1UYWH 4RFOH 1TQBC 3LH2H 3LQAC 3BKMH 4PP1C 5BXFB 3DLQR 2GFBA 2PXYD 2FLRT 3UJTH 2DQFB 4OLEA 1UXSA 4XVSL 4W6YB 5BRZE 2PO6D 4PJAA 1A1OB 3ZHLA 3D9AL 1VDGA 3FAXA 2ZSVB 2ZNWA 1QZ1A 3FT2A 3LKNA 1ZK9A 5D1ZC 3CIQA 3DX8B 4EN3C 5JOPE 4HUVA 2AEQH 1NCTA 5HBBA 3MJ9H 1Q9OA 3C8DA 5C0GB 2EDHA 1UQSB 2B0SL 4JVPA 1P4IL 5SWZB 1S7QA 4XHJD 1FE8L 3P9WB 5FGRA 2AXFA 5GS0H 1OOAA 4KZEL 1A64A 2EDXA 2BSSB 4ZUVA 1JP5A 1WZ1L 4OLUL 1MELA 2C5DC 4Z8FL 5I8OL 5F89A 4HIJB 5DSCA 2W92A 3OPZL 2OR9L 2FSEB 4OFVA 4QRRE 4TULH 1RJYB 4WW2B 4F7PA 3LMJL 4MLIA 4HHAB 1JPST 3MRCB 4E41A 1CU4L 2OTPA 3EDJA 1NKRA 3VXUB 3MYJA 1RZ7H 3S37H 3T2NL 1SVCP 4M8VA 4KHXL 4TSAL 3LRSB 4IRSC 4D9RD 3C60C 5MI0C 2HA1A 4Z5RB 4MVBC 1NGXA 4KKLD 3S8WA 3PGDA 1XMWA 1HN1A 1DJSA 1WQVT 3FQRA 1UENA 5DWUH 4L3EB 5IMMA 3PJSB 3GIZL 4ZXBD 4XT1C 3QFDA 4AJ0A 5CAYB 1F3JA 3DXAE 1LO2H 1B2WH 4MMZC 5D2NA 5D1QA 5KVDL 3I3EA 4R90H 2NY1C 4PJIE 3RBGA 4F9PA 2FEEI 3BPCB 3CFKB 1KPRA 5HYJB 1JWSA 3I84A 3I9GH 3RWDA 3HG1B 1H3PL 1YNTB 4PG2A 1WFOA 2BC4A 5GGTA 4NQSA 3U1SH 4XCCL 4DGIL 5C0DA 1KCSL 2VLKE 4LOUC 1CE1L 3QDJB 1OAZH 3FN9A 3TLRA 2EDBA 2ZG3A 4D9QD 2BOBB 3BZDA 4RGOH 1RK0A 1NEZB 3QWOA 1FZJA 2X10A 3JWDH 4GLRH 2W1NA 5ESAA 5JUEL 1AY1L 4NKIH 1DQDL 5IHZB 1J0KA 3ME0A 2HWZH 4P5KB 4RWYH 1R0AL 3IGAA 4M93C 4NQEE 1NBYB 4K71B 3O45B 4OF0A 3SN6N 3K7UA 5HPOA 4WV1A 4PJXE 2DWDB 1ZEAH 1HHKA 2W59A 3KJ6L 3HI5H 4IMKC 2XKNA 4NRXA 3WLWC 1U3HB 4JN1L 2XWJB 5MEOB 4LHUG 5IGXH 1S7XB 3JWOH 5MP6L 5DTFB 1S8DA 2Y1VA 4KRMB 4WWID 3UBXI 5JNYB 4Y16C 3QUYC 1RIHL 3VG0L 2EKSA 4WU5B 1RFDL 3ARSA 3WN5C 2YPLA 5EH1A 4X6CB 5IVOA 1C12B 2JJTA 4OZFG 4WEBL 2I9TA 1FSKB 3O9WD 3QNZA 4R0LA 3PDOA 4C59B 1A9EA 1I7UA 5CSGA 1XGQA 5F44A 1OSPH 1EUTA 3BN9D 1MCWW 3KPQB 1WBYB 4E5XA 3NN8A 3ZKXC 3VFWA 1NCBL 1A6UL 2EXWD 5JDSA 4OD3H 4U1GC 3KYOB 4JFDD 4NSKA 2DLEA 2VLJD 2W65A 3MRLA 4NN7C 1KG0B 4YDVA 5E99L 3U36B 3OKKB 1WCBB 1LO0L 5IQ9B 3QEQB 3REWB 1LGVA 2HLAB 3VW3L 3QHZH 4PJEB 4M61B 4BFBD 4XRCA 3CDGB 5BV7L 4OFYD 5FYLH 1MCNA 2PNDA 1U8NB 3LN9A 3ULUH 1Q38A 5L9DL 4JN2A 3IVKA 2ENSA 2GUOA 5FM5O 3IDIA 1PZ5A 2VLRA 4TTGA 2XG5A 1QBAA 2MCPH 4U1IB 2WLZA 4RGMB 2GIYA 3IXTA 1WEJL 3TN0B 5I30L 4MS8C 1OCWL 1T2QL 1ZHNA 5EORH 2P49B 4L8BB 1YQVL 2C3HA 4OTXL 3FT4A 1NL0L 2FB4L 3SGKA 1RZ8B 1T83C 3TIDB 2A0LC 5C07D 1PSKL 4Z7UB 5IBLC 4DW2H 5T5FH 4OV5B 1AQKH 5DJ8B 1UWEL 4UT7H 3NZ8A 1ZGLB 4MD5B 1TVDA 1I7RA 1J8HA 4EI5D 2C3GA 1DBMH 2OK0L 4ZPVB 5B3JF 1CK0L 4MCYB 2HT4D 2AJ3A 5FM4A 1JIBA 2Y9RT 2BY0A 4JREC 1UC6A 3E3QC 3N1GC 2H26A 1N7ML 2XKSA 3BPLC 5INDA 3QDHA 5LBSH 1FJ1B 1NGQH 2PW1A 3NIFF 3MJ6A 3PGCA 5DYOB 4GKNB 2YEZA 3ARED 1DE4B 4X9GA 1JV5A 5JW4Q 2NZ9D 2D7OA 3RY6C 3L3HA 2ZCKH 4HUNB 2AQ2A 1UM4H 5C0ND 1BZ7B 1LP9F 4IMLA 5A2JH 5HHVH 2VOTA 2ZUQC 1KTRL 3R1GH 4ELMF 4LEOB 3PUCA 3QG7H 4Y19A 3G6JA 4BELD 3P0VH 2F54B 5IVXB 4TUJB 5IEHA 4LEXL 1LNUA 3O2DL 1NDMB 1NQBA 3DMMA 4NWUH 3P4OB 4X9HA 3N1QC 2X9XA 4DVRL 1RZFH 1P9MA 1P7QA 4JRWA 2CLZB 2R2HA 4N0YL 4MAYC 3HCVB 5D1ZD 1G1YA 2D7QA 5C0BB 4IOIA 1MJ8L 4EN3D 5B8CC 3FT3A 1T04A 3IAQA 4XB8A 5D5MF 3VXMA 5EBLA 3WMSA 2RFXA 5JXEC 3EJYD 1YEEH 5IFAH 2ZSWB 3HZYA 1CFVL 3SKUD 2VN7A 7FABL 4UDUB 1W0WA 4U7SA 1AXSB 1YMMD 1WTGT 1ZHBA 5AWNH 3V79C 5FUZH 4PTTB 3O3AA 1CDHA 1J0HA 3LIZH 3MNWB 5GS2D 4NO5B 1F8TL 3CH1A 2AABH 4YFLF 3ZT5A 1KJ2L 2V5YA 3VJ6B 3AAZB 4HV8A 5I8EA 1JHTA 4MX7A 4HT1H 5F93C 2DL2A 2R69H 1AFVL 4U31A 2RB8A 3RHWF 1T21A 4KQ3H 3WO4B 1T1YB 4F37K 1G7HB 3U4BL 1CFNB 4X6BB 43C9A 3X3GL 4WWKA 3LQZA 5DXWA 1F45A 1TENA 3CH8A 2AV1A 5HVHB 3C60D 1B4JH 2D7PA 1A7QL 4AENB 4MVBD 1L7IH 5JMRA 2CIIB 4Y4HA 1GOGA 2EIZA 4QHUA 4JY6A 3H9YA 4C4KO 1ED3A 4I77L 4PRID 2R1YB 5JW4N 4JGJA 5HHOE 1KFAH 4OGYL 3GSNH 1IARB 2APFA 3OF6D 5TE4H 3MA7B 3WL9B 3S3SA 1PDKA 4HPOL 1J18A 4G43A 1UB6B 3RVVD 4KKBD 1QQDA 4XAWH 3JSSA 3S96A 1TTGA 1JZ3A 4X9BA 3BKYL 1AO7A 1EUUA 2EECA 2MPAH 4NHUB 1CLOH 3S34L 4M43H 3SE4C 2COQA 2EH7H 4KKAD 1GZQA 3GRWH 4IOSD 3ORJA 4LOUD 2P42B 4FRWA 4CMMA 3CMOL 2F58H 5FYJD 2VXTH 4WY7L 3PQYA 3L3KB 1LEGA 3E8UL 3NVQA 4PY8I 3OTTA 1L9NA 1EFXD 4MDIB 2FWOA 5F7WC 3SJVA 2HAZA 3FB7A 1O7VA 1QA9A 2AEPL 4JFEB 2AJVH 4CAGA 1AQDA 1K6QH 5H94A 3HI1B 5B38B 1C7SA 2WAHA 4TTDD 5LCVH 5EUKA 4OZIE 3BJLA 1RJCA 4L29A 1F97A 3TP4A 2V7HA 3PWLA 2BSRB 3Q48A 3VDAA 3ZT6A 5CBEA 2PO6B 3GI9L 3I02B 4IIQB 5ANME 4CDHA 4LPUA 5E4EB 3WLWD 3L3DA 3HFML 4ZAKA 4QRQA 3VMNA 3W9EA 1HHJA 3IFLH 4KGLA 1V7NH 5F21B 4WI8A 1MH5B 4YZFE 1I9IL 1UZ8A 3PP3K 1MUJA 2YBRA 3QUYD 4NNYA 2QADD 5BS0D 1MHCA 1DDHB 4P2RD 3JVGC 4RZCB 3EOBA 1IGCH 4RIRB 4JQVC 4KRPD 4HIXL 5I16B 5I75B 3JTSA 3QIUA 4UAOB 1T5WA 1UH4A 4OZGF 5DC4B 1KCUH 1G7JB 5E8OB 1WIOA 4LGSB 4H26A 5CBAB 1EEZA 2Y06L 2ESVD 3WXWH 4HBCH 4QXGL 4TYUA 4J12A 1T66C 3MLZH 32C2B 1RMFL 1A6ZB 4LLQB 5E94B 5H2BB 1JYNA 1MCDA 1DBAH 1JF1B 3E6HA 3QXAA 4MA1B 5JW3H 5KN5A 1I9JL 1TZGL 3LEYL 3MR9B 1W72L 2P24A 3BFOA 4M1DH 1ZT7A 3BKJL 4JFFE 1I3VA 2XWBA 3ZDYF 1I8LA 1Q9KB 3BESR 4DUXA 2ERJC 3NFPA 4ZXBB 5KTEL 4H0IA 2W9LA 1IGYA 5GGRA 3RUGA 3VH8B 3INUH 4UT9L 5HDQH 4Y2DD 4H0GA 1IZJA 4G6AD 3L3JB 3MGAA 5KSUB 4F80A 4OM0L 4MS8D 4HIIB 5KAQF 4HXBH 4OI9A 4GAYB 1GGBH 1CTNA 3AUVA 1RY7B 1PX4A 2R4RL 1KPVA 1FNFA 1CQKA 3GK8H 3U9UB 4NO2B 2CRIA 5IOPB 5KVFL 5IBLD 5DRNA 4F3FA 4N9GA 4P5TA 1GIGL 3SO3C 5E6IA 4BSWA 3QNXA 5SWQA 4GKSB 4TQEH 4G5ZH 4UMGA 5T33H 1OGAE 1MFDL 1GC1C 1G9NC 3O41B 1SY6H 5HHQA 3NTCH 3K2UH 1U95B 3L95B 5C0RH 2CD0A 5FUCC 3UMTA 5HHPB 2Q8AH 5F88B 3ARQA 1INEL 1S9VB 4FXGA 1CD1A 4D9LL 3KPRA 4QGYA 4V1DB 1CD8A 2AQ3A 3S4SB 3O4LB 4CVUA 4PGEA 2D03L 1FIGL 1LK2A 2KDGA 4M6NH 4XVUC 2ADFH 1MJJA 5FYKD 1J1OH 1FYTB 5IF0B 3PP3H 4CDGC 1TNMA 2V5RA 1NC2D 3TH4T 2X4UA 2W0FB 3O9WB 4XX1E 2R0ZH 4K3JL 2HT2C 1XF4B 5C09A 4HKXB 2CKBH 4PJCA 2G2RB 4PV9A 4MJIE 3WUZA 4YO0B 5FO8B 3NFNA 5LXGH 4ISVA 5ADPH 3RDTD 2FX8L 1QHOA 3HUJB 3QWQB 4GRWF 5EU7E 3S97C 3OHXB 1BVKB 3LEXB 4M8QA 4DQOL 5HSFA 4MAYD 1Q94A 4F9LC 2JIXD 4ZTOH 2ICCA 4P46C 3IDXH 3UPCA 4XXCA 2EKJA 1A6VL 3V6OE 2XN9A 5JXED 1GGUA 3PWPA 4P59H 1QSZA 2OL3H 1V5JA 2IMNA 4OCSL 2JJUA 4DKEH 1RVFL 2XACC 4M5YH 1JPFB 4JHAL 1BM3L 4G9FA 1P69B 1LDPL 1HSAA 4JCLA 4RQQA 2IANB 5JQHC 3E0GA 2B4CC 5IJVA 5DZNA 5F7MC 3T65B 3QXWA 4JFXB 4U0RB 2QHLA 3L5HA 3SGEI 2VRAA 4KI5D 4NQTA 1H15B 1S9WA 4G8GE 4WI9A 5DMKA 3AGVA 2D7NA 4HC1A 1M71B 5JA8B 3GNMH 2F19L 4IRJA 4A6YL 3FFCD 3KXFE 4Z76A 1MNUH 1KCVH 4KZDH 1N3NA 5EZJA 4AM0B 3RTQA 1I4FA 5TDOA 2EH8L 2Y36H 3OJDB 5I1IH 2GITA 3EOTL 4GFTB 4Q6IA 4EI5B 3MRRB 3MMEB 3HR6A 1OLZA 1OM3L 3DBXB 4MCZA 1A14H 4EUPG 3QHFH 4UOJA 4G7VH 4QOKA 2BNQB 1NPUA 5C08B 4LSPL 3GSWA 5JW5B 1SJHB 3IJYB 3QI9A 2IH1B 5DJYA 3HNTL 1B90A 4RMSA 2B2XH 1EA9C 3D18A 3QA3B 3OGCA 3NIDF 2BNRB 1FDLH 4YBQC 5E00A 1YYLL 1VADA 2VQ1B 3Q6FA 1FNSH 2VXSL 5J6GA 5BZDB 4HK0A 1IRAY 4XNUH 5TF1L 4J23A 3W0WA 4XPBL 5CEZD 2Q87A 1TETL 5JHDD 5GGVY 1BX2B 1P2CA 1G7PB 4APQB 5T1DH 4PJ9A 5L8JB 1MHHA 5JHLH 4MA7H 4U1SB 1C5BH 4C83A 1O7SA 4P2OA 3LQAH 3F8UB 1CFBA 1JGVL 2DLTA 1DL7H 4U1KB 1FNAA 1KT2B 1HQ4B 1JUFA 2BXYA 3O6FD 5EOCL 2VXQH 4QTIL 5CJQH 2CUIA 4ODVL 4YHIA 2OR8A 4IEFB 4WTZA 3OXRB 4N0UB 4WUUB 4QNPE 1A1OA 4HF5H 1WBXB 4JO3H 1QSEB 1A5FL 4Y5YC 5TDNB 3TYGH 1W8NA 3VXSD 3RZCB 1D5IL 3DX8A 1BIHA 3MLTA 3MV7D 2J6EA 3V6ZA 5C0GA 4U3CA 2GK0B 4FN0A 3KHQA 1ORQB 4QGTA 3HE6C 5C6PB 3FQTB 2MOVA 4WO4D 3MV11 1R3LB 3VI4E 2CUMA 4PGCA 3GSUA 1JK8B 3QQ9D 3WYRA 2FGWL 1X5GA 4PTUB 5KG9B 2J2ZA 2JB6A 1QLEH 5GS2H 1F90H 3W82A 5BZWB 4I3RH 1GHFL 3NIGE 1WTLA 1NUGA 1KEGH 1GSMA 1UEMA 4E42A 1CI5A 5I1CH 3LKOA 2X1OA 1CXEA 3G5ZB 3LB6C 4YAQA 3BUYA 3QG6B 3MRNA 4WW2A 3U0WH 4NRZA 2WWKT 1CGWA 1VFAA 5D93B 5AD0A 1F58H 4XAKD 4L9LC 5JQ6L 2HJFA 1NC4A 2AJUH 2Q76B 3MROB 4FXKA 4KRLB 4NUGL 4N5UA 4HLZH 4XMPH 1S9XB 1M6OA 1IC1A 2OZ4A 2CDFA 1H9VA 4Z5RA 2V6HA 4PRIB 2H32B 2PF6A 4MQXC 2X4TA 5GGTL 2XPGA 1FN4A 2ZUWA 1RHFA 2B1AH 3FCTB 2NX5A 5DVNA 1QFWL 5E6YA 1YEIL 3E2HB 4YWGH 5LWYH 3OKEA 3SDYH 3V5HB 3N85H 2AGJH 4S1RH 3V4VL 5ICZB 2YSSB 4MNGA 3UEZA 1MIEL 2I26N 2CH8A 5JPNA 4OJFL 4Y5VB 4BKLB 4EEEA 3L5XL 3WFZA 1IGFL 4PJIF 3BPCA 1JPGB 4V2CB 3OKDA 3TFKD 1MFBL 3LQMA 4R97C 5F7YC 4EBQL 4NZRH 5FYJH 1HH6B 3QDJA 4FTVA 1WCQA 2BXZA 3C6LB 1N0XL 3WIFA 5L8KB 2BOBA 4AIOA 3CXDH 2NY4C 4BSVB 4NHCL 3SDCB 1SM3L 1FFPA 4HX1A 5DRWB 2DQHL 4U6XA 3F7VB 5D7KE 3FB6B 5T5NG 4LIQL 4ZFFB 4R4FL 1JNHB 3EZJB 1EAPB 5EO9A 3MXVL 4XCNB 5B21A 3FL7A 4M6OL 3DWTA 2EE9A 3FN3A 3O45A 1JTPA 5B4MC 5F6IC 4ZFOB 5KJRL 2FIRT 4I9WD 2XWJA 1NMBL 1JPSL 2BVOB 2IG2H 2QADB 1IGTB 5BS0B 3WS3A 4QXUH 3UZVB 4RGNB 2E3VA 1CLZL 3GBNH 4KRPB 2PYFB 2VH5H 2R15A 4WU5A 3KPNA 4TRPH 1BD2E 1NCWL 4ZPTB 2E9BA 4OFDA 3BD4A 5KSAC 3IETB 4X80H 1T20B 4X6CA 4BK5A 1N5AB 2BOCB 3F7QA 4HWBA 3STZA 5SX4H 2APBA 1QNZL 4GBXB 5I0ZA 3SHSA 3G6DL 2YD7A 4LSQH 5DJXA 1IC7H 4JKLA 4O58L 1JGUH 3U82B 1CN4A 3GDBA 3ZE1E 2VLME 3B9KC 4NQDD 3NCJL 4P46D 4EDWL 2P8LB 4NO3B 1WCBA 4W4OC 5IQ9A 4WHTA 4UB0L 4YR6A 2DBLH 4XXDB 4L8CB 4IDJL 1CFTB 3QDMB 1MSPA 4U3XA 5D8JH 1HKLL 3SQOH 3WD5L 2A73B 3MREA 4ZUTB 5HDOA 3KR3H 2X4NB 4HCRA 1W0VB 2P4AB 3L9RB 2W60B 2QBWA 4DKFH 3F6LA 2YRPA 4Y2DB 3WFDH 3DRQA 4EXKA 1AGBA 1M7DB 2BFVL 1ONQA 1T5XA 2MMXA 4I0PB 2DQJH 3MTRA 2XTJC 4HJ0C 1T1XB 5E5MA 3TN0A 4H88H 1JTTA 4IRZH 4K8RC 2RGSA 3LKQA 3FN0H 3H3BC 1MCRA 1BLNA 1JJUA 2IBZX 1QYGH 2J5LB 3U9PH 4LLMB 4X8JB 3QIBD 4DEPC 4Z7UA 3X17A 1HOCA 1TIUA 2ARJB 4M6AA 1QBBA 2PTTA 2YPVL 3MRQB 5D6DC 4OV5A 1EO7A 1S7WA 4ODUB 3HNSL 2L4OA 4KK6D 3TC9A 4R96A 3DSNA 4P4RB 3WEXA 2X05A 1D7FA 3BP7B 3OKMB 3ZDXF 1B0GB 5E9DE 4EDXA 2V2WA 3DXAA 2ED8A 3VXUE 5HY9A 1VKXB 3VXRD 1IM3B 4PJIA 5DVKA 1XGYH 2IPUG 1MHEB 2DDQH 1SEBB 4WI6A 4MAUL 5FYKH 5DJZB 4TSCH 1BZ7A 3B83A 5JR1L 3GIVA 3UTSE 1CDJA 1IT9H 3MRMA 3LV3B 4WUKL 2VSDA 5EU4A 4KHTL 4LEOA 4YHYB 3OAUL 4QRUA 4PJHE 2EDNA 4FABL 4XCEB 3R06B 5E8NB 3WIHL 2F54A 3CDYA 3DGGB 4TUJA 3F7YA 5IVXA 5TFSL 3RDTB 5LAXB 4BJLA 2NYYC 2WP3O 1KGCD 3VFTB 3T2PA 4ZODA 1X5JA 1WZMA 1PQZB 5HYJE 2B20A 2JIXB 2CLZA 4NQEA 4S1SH 3V95A 4OGAC 5IEKB 3HCVA 3PL6C 4H5SB 4LSTH 4BFIA 4PJXA 1QACA 3KYKH 3ARUA 1F5WA 2P5WE 1PEZA 4HIHB 1TJIH 4PB9L 1U8MA 5HGDB 1I9RL 1F2QA 1MWAA 3HE6D 1F6AA 5I1AB 5J9PB 3EJZC 3BDYL 2D9CA 2CJUL 2NPLX 5DEFB 3NH7L 2H6PA 1UACL 3TVMD 1ZVSB 3R0MA 1WK0A 4HKBA 4L4TB 5JIKA 5I8KL 4LGPB 5C0AE 4ODSH 1CXIA 4D0CB 3LB6D 1CLYL 1HH9A 4Y4KB 4Q6YA 4WVRA 3UAJD 4HS6A 1U8HA 4KJQC 4P23A 5GGQL 1HIML 2VQUA 5C0CE 4DAGL 1HQRA 1BQLH 2C9AA 4M7ZC 3HRZA 4LLWA 4UUJB 5I1DB 4N0FA 1D5MB 4X6DF 1FPTL 1S9KC 4MQXD 2IQAB 2PETA 2ZJSL 3UJJL 1JGDB 3FOLA 4CW1A 4IDLA 1MHPL 3QIWD 4K9EL 4MA8L 1TCRA 3KS0H 2Z35B 2BCKA 3V52H 1BF2A 1GRWA 4H20H 2W0PA 3RY5A 5HGHA 1WWBX 3ARPA 4Y4FA 2VQTA 3L5WB 5GRJH 2EZ0C 3L3OB 3U30C 3OR7A 4Y5XA 2J12B 3DRTB 1A6AA 3FO1A 3H7BA 4JJ5B 1JHKL 2KBGA 2IAMD 4G8IB 2V7NB 1JZ7A 1TZHA 5DVOA 1X3DA 5TDPB 1NBVH 1HI6B 4OIAA 5CEZH 2H2PC 4LCCB 4PJEE 2ARWA 2HRPH 4Z0BL 2DQEH 2DMKA 5CIPA 3S5LG 5AYUH 3UXFA 1KIQA 3S98A 4B7IA 5FYLE 5CZVH 5IG7B 4JFHD 4XCFH 3GSOB 3WJJC 3ULUE 4TVPD 3GBML 3C5JA 4KFZC 3PP4L 1J1XL 3SEPA 3TZVB 5IJKA 1SYVA 4JFEA 3CK0L 3RVXC 1A3LL 5D7LE 3NA4A 4OZIF 2BSRA 1NCUA 5D1XD 4FFWC 5BJTA 1EERB 3EGSB 1DQLH 3KPMB 5IESL 4S1QL 5FCSH 3LS5H 3WKML 5T1LA 1KJVA 5C0JA 3BZEA 5HDLA 3AROA 3HB3D 4MXQD 3Q0HA 4XC1H 3T8XB 5FO9B 3W2DH 3VXSB 3DUSA 4MMXC 3MV7B 1KXVC 2R2CA 4H8WH 1CLCA 2DQGL 4QEGA 5FO7B 5GPRA 5IFJB 4JJHA 4JO4H 4MB3A 4JDTL 2PR4L 4Q2ZB 4JFYA 4WO4B 5CEYA 4PB0H 1CT8B 5DURD 4UTBH 4RIRA 1RU9H 2AV7B 1BOGB 1MEXL 5ACMA 5EZLB 3C9NA 2P5ED 4JRYD 2Q7NA 1ZT4A 1YEJH 4JPKH 5E8OA 4HIEA 3W39B 4J2XA 1ZANH 5CBAA 4PPTA 3WLBA 2WUCL 1SYSA 2BDNL 4WJ5B 4ZD3L 2VSCA 4IJ3B 4DFIA 5FV1L 5D7JC 3TA3D 2IFGA 3ROLB 3E1F1 1A6ZA 3L3GA 3B9KD 2AKRA 4YUEH 1JF1A 3VDCA 5F9WB 4FQQA 4I18A 4ZNCD 3OGOE 4X7TB 1ZWIA 4OF5A 5DK2B 4PJ5B 3ILQD 3WXVH 3SKMB 3L7EA 1B6DA 2ZUVA 4CADA 3FO9B 1NJ9A 5E8EB 5C2UB 4X5XB 5F9JB 3AS0A 1RULH 2J88H 3ABZA 3U46A 3MBXL 3CLFH 1IC5H 5IKCB 3H9HB 2A1WH 3B2VL 4TUKH 1ZAGA 2LFGA 2XTJD 5I1HL 4UZGA 3TCXA 4UTAL 2D0FA 4Z0XB 5K93A 4Z77A 2VISA 4HIIA 2XWTB 3VXNB 4K8RD 5T3XD 4QRPB 1MRCL 4KVCH 4EJ1C 3QFJA 1PKOA 1L6XA 5DD1H 5T1KB 5IOPA 1D6EB 2DLGA 3GBLA 1QBLH 2OQJA 4GXUN 3CJJA 1IQWL 3O2WL 3VWJC 1BQHB 4F8QA 1G9NH 3TBSA 1WBZA 3ZL4H 2C1PB 4YHML 1OAQH 2G75A 3O41A 3SOBL 2UYLA 4P9HC 3U4EB 1ZS8B 1GAFL 4YHNA 1WIUA 4PJGF 2HFEA 4FQCH 2QKIA 3Q5TA 2AK4E 4NQVA 2APWA 1QSFE 3EZ8A 5F88A 1YN6A 4OF6A 4NNXA 1S9VA 3RWJB 4Q9CA 4GUPA 3CDCA 3MRGA 2JCCE 5TPWL 2O5ZL 4V1DA 5L7XH 5F96H 2VDQH 3O4LA 1FGVL 1NFDE 3KJ4C 4QHLA 1MIMH 3KVQA 5IT2L 2YS4A 3CUPB 5IQ7H 4LHUD 1YC7A 1FYTA 4P2QD 4QKXB 4JZOB 2W0FA 2EDRA 1ZSDB 4NKMA 5C3LD 2ADIB 4F2MB 5LGJB 3M8OL 4F7TA 5FB8A 5EBWA 4GRLA 2O61A 4N8CL 1PG7X 5H8DA 5I9QC 3FOMB 4R3SB 3FB5B 3HUJA 4FQ2H 4KI1A 5IROA 2VO5A 3RZWA 1YPZB 4X5WB 1XF5B 4BZ2L 3BGMB 4N0CC 4NQDB 1EHNA 5J12C 1X4ZA 2PKDA 1BPVA 2I27N 4XZUA 2XZQL 4U6YA 4M7LT 3O11B 1NCNA 4MHHI 4HC1L 2O5YH 1NEZG 5GQBA 3SE9L 3EJZD 2R4SL 1II4E 1AGDB 1ACZA 3F12B 2B4CH 2NCMA 5DJCA 3Q6GL 5HGBA 4JG1H 4F57L 4ZSOB 3LY6A 4FFVD 4EQ2A 3ARDA 4Q9QH 4HWEH 1AXTL 1CTOA 5CJOH 1T7XA 3B43A 2FJHA 1NCAH 4OGZA 3KGRA 1U2HA