3UP5A

Crystal structure of otemo complex with fad and nadp (form 4)
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
540
structure length
537
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords OTEMO
total genus 188
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3up5A01
4H2PA 2CVJA 4FK1C 5JCMA 4BK2A 2XFPA 2WP9A 1Y0PA 1PJ7A 1PS9A 2GMJA 4BJYA 5FS7A 3CNTA 1YQ4A 3DGHA 3QFBA 4H4WA 3BHKA 3I3LA 2XLTA 3GDNA 2X8HA 2JAEA 1JRYA 2XVFA 3RNMA 3KKJA 2R4JA 1GEUA 1RYIA 2X3NA 1CC2A 2BXRA 2ZZ0A 3AE7A 2Y6QA 2WDVA 3LZXA 4EM4A 1NDAA 2YR4A 2ZZCA 1YQZA 4JN9A 2J3NA 3UKPA 3M13A 1PJ6A 4H4YA 4AOSA 4C3YA 3ICTA 1YKJA 1KDGA 1OJTA 1Y56A 1PN0A 3IHGA 4Y4LA 5BVAA 3CPIG 3ALLA 4U8LA 2WU5A 1EL9A 1OJAA 2GR3A 3AEFA 4USRA 2YG3A 4U8OA 4U8JA 1ZY8A 2JKCA 2WOWA 1OJ9A 2E5VA 2Q6UA 3LJPA 4ICYA 3VQRA 3UOXA 2A89A 3NK0X 4YSYA 3DJEA 3NLCA 3KU9A 5DBJA 3CNPA 1TYTA 2B9WA 5EOWA 2WHDA 3VRBA 2EQ7A 2YVGA 2H89A 3CN8A 1NHSA 4J2WA 2AQJA 2R45A 3DGZA 4H7UA 1GV4A 2Q0LA 1LQUA 3AEAA 4A9WA 4C3XA 3GYIA 2YR5A 2CULA 3KA7A 5HYMA 2Y6RA 2VVLG 3BNMA 2YG6A 1RP0A 2EQ9A 1D7YA 2WU2A 3GMCA 4IVOB 2IVDA 4TLXA 1D4DA 3KPFA 3CGCA 1BKWA 1AOGA 1IUUA 1REOA 1PXAA 3IF9A 5IPYA 5KXJA 4U8NA 3LXDA 3UOYA 2GEWA 1DJQA 3GDPA 1FL2A 1CJ4A 4YSHA 1COYA 3AEGA 4YXDA 4YKFA 4A65A 3CGEA 4PABA 1FOHA 5JCKA 1CJ2A 3DH9A 2GR0A 2VZ2A 3H8IA 5IQ4A 2GH5A 1S2YA 2QA2A 3BHFA 3F8RA 4J36A 2C3DA 4YTNA 3LOVA 4OVIA 2RGJA 4GDEA 1VDCA 3ZDNA 1F3PA 4AP3A 1JEHA 3GD3A 1CBOA 5C3JA 1D7LA 2YG5A 1PXCA 4U8KA 1K0LA 2DKIA 2V60A 1H84A 2WETA 3AXBA 1L9DA 3RHAA 3S5WA 2XFOA 2FJAA 1E6EA 2R0CA 3BI2A 3GD4A 3QSSA 3NHOX 4NZHA 2R0GA 1BZLA 3LADA 2VQBA 1ZOYA 4Y4MA 1FEAA 2Q7VA 4OPDA 3BI4A 4D03A 5BRTA 1TDEA 3P9UA 4A79A 1MXTA 3EAOA 1PJ5A 2WPCA 2O9ZA 2XLRA 2XCGA 1CL0A 2JB2A 2X50A 2B7SA 4NTEA 4OPLA 2R4EA 3C96A 2XVHA 4H4UA 2OALA 2GVCA 1M64A 2XVEA 3I6DA 4WX1A 4O5UA 2BABA 2I0ZA 3AB1A 2OLOA 3HZLA 5M0ZA 3EF6A 4RG3A 3QJ4A 3V3NA 1NHRA 3NG7X 4NTCA 1B4VA 3ABVA 3NRNA 4NEVA 1ELIA 3EANA 2YWLA 4H2RA 2QCUA 3RP8A 2XLSA 2XVJA 1E1NA 1L0VA 4A99A 1EL5A 3NH3X 4K7ZA 1BWCA 3GWFA 1UKVG 2XVIA 3P4PA 4UDQA 1TYPA 2WDRA 3EPTA 2YQUA 5HXIA 3AE8A 4APNA 4DGKA 3G5QA 4OCGA 2JB1A 2OA1A 3K7QX 3DMEA 3UOZA 2BC0A 4B65A 4U2LA 3AYLA 3M0OA 5L46A 1FEBA 2BS3A 4XWZA 3NKSA 4A6NA 1DOEA 2Z5XA 1FECA 3FG2P 3KD9A 3IC9A 3BI5A 2C7GA 2YVFA 4XXGA 4GDPA 3UKQA 2NPXA 4N9XA 1PBFA 1XPQA 5KWFA 2NVKX 4GUVA 4TM3A 4EMJA 2VVMA 1N4WA 2GQFA 2GMHA 4PAAA 1NG4A 4ADWA 2C73A 2A87A 4TLZA 1GRHA 4H4QA 3DJGX 3DK4A 4AOXA 1F6MA 2WOVA 1XANA 4EQRA 2A8XA 1LVLA 1VQWA 1D5TA 2WESA 2WOIA 3LB8A 4UP3A 1NHPA 1LPFA 4E0VA 1KSSA 1BF3A 4YWOA 1H82A 1XHCA 3UOVA 4CCRA 4YSXA 2R9ZA 2FBWA 3DJJA 4K5RA 4X9NA 1GNDA 2JB3A 3UCLA 1L9CA 3K30A 4EQWA 1LV0A 1PBCA 2BA9A 3RP6A 2WDQA 1GXFA 3ITJA 2BCGG 2B9YA 4B68A 1H6VA 1DOBA 2C65A 2YM1A 1P2EA 3CIRA 2ACZA 4GCMA 4H4XA 1YQ3A 4HA6A 3L8KA 4IA5A 4AT2A 1VG0A 1B5QA 4J34A 4ZCDA 3CNSA 1O94A 3F8PA 3P1WA 1GREA 2XFQA 2XFUA 4GRTA 4YKGA 3OC4A 2BYBA 4U2TA 1E1MA 3QVRA 1BGNA 1KSUA 3AE4A 5FS9A 2BS4A 1H83A 2PYXA 3AD7B 2YLTA 3UTHA 3URHA 3GMBA 4DSGA 1ZMDA 2X8GA 5JCLA 1LJ1A 3K7MX 5GSNA 2Z5YA 1ZX9A 4I59A 2YLWA 4H4VA 3UTFA 1P2HA 1QO8A 4H4ZA 3SFDA 2GRTA 1DNCA 2C72A 1PBDA 3COXA 4CBQA 3CGBA 3LZWA 1NEKA 4FX9A 4LU6A 3VR8A 3GYJA 3WE0A 1TDKA 1MO9A 3FPZA 4K2XA 5U1OA 3SM8A 4B69A 2VRMA 1JNRA 3QFAA 4B67A 2H88A 1ZOVA 1CC4A 3T37A 1LTXR 4H2QA 4FDCB 4DSHA 1H7WA 1YY5A 3AECA 3AYIA 3GRTA 2YLSA 2QAEA 4B64A 4Z26A 5BULA 1IUTA 1S2QA 4NTDA 4OPCA 3ICRA 5J60A 2VOUA 1E1KA 3JSKA 2EQ6A 1Q1WA 3L1RA 1TDNA 2ARDA 4H4SA 1ZK7A 4YTPA 4CRTA 3NTAA 2YG7A 4XWRA 1F8RA 2AR8A 2C76A 3AE5A 1JNZA 2YLRA 2YLXA 3D8XA 4FK1A 3UKFA 2XLUA 1PBBA 3P4SA 4USQA 1ZKQA 5CKUA 4JY3A 4ZCCA 1E1LA 3NN6X 1OJCA 2C75A 2TMDA 3QSEA 4M52A 1GERA 3PVCA 3ADAB 3G5SA 4Z2TA 1S3BA 4EIQA 3GWDA 4IA6A 4EMIA 4H4TA 3AD9B 4NEWA 1B37A 1IJHA 2FJEA 2V6OA 5ER0A 4JY2A 1D4EA 4IVMB 4K8DA 1GOSA 2X8CA 2YAUA 4EM3A 5IQ1A 4U8MA 2GV8A 2YR6A 3AYJA 4H4RA 2OAMA 1NENA 1N4VA 3ICSA 5JCIA 3VRAA 4C77A 1TRBA 2WPFA 1O95A 4EMWA 4U2SA 5C2TA 4C5OA 1ZDLA 2XFNA 5EB5A 5HY5A 1PXBA 3UTEA 2WS3A 4O5QA 2R0PA 3SQPA 3AEEA 1EL8A 4JDRA 4Z43A 3DK9A 3NYFA 1DOCA 3V3OA 1MOKA 5KVIA 1GRGA 4UDPA 5EBKA 4H50A 1RSGA 3H4KA 4CY8A 3GRSA 1B8SA 4I58A 4Y4NA 5HHFA 3NK1X 3VR9A 3AEBA 4A6NB 4DNAA 2CDUA 3CNDA 3UKKA 1TDOA 2R46A 2BCPA 4C74A 2AAQA 1LQTA 4CNKA 3IHMA 1GRTA 5FMHA 1GESA 5M10A 1GRFA 1DODA 2RGHA 2UZZA 2YVJA 2FJDA 4JNAA 4A5LA 2YG4A 1S3EA 4LA1A 1NHQA 2DKHA 3NGCX 3SGLA 3B6DA 2C3CA 4BK1A 4CCQA 2C64A 4OPUA 4JQ9A 4ZN0A 3ATRA 4J56A 3ISHA 3UP5A 2WEUA 2VVLA 1NPXA 3NYCA 3OZ2A 1GPEA 1KNPA 3O0HA 1CC6A 3IWAA 2V5ZA 4TM1A 4RG4A 2VRLA 1H81A 1K0JA 2APGA 3FMWA 3UP4A 4AT0A 1DJNA 2IVEA 4HB9A 1NG3A 2BK3A 2BACA 4Z2UA 4OPTA 4KX6A 2B7RA 4A7AA 1JRZA 2GR2A 2OLNA 3CTYA 2GB0A 1ONFA 3UKHA 5KOWA 5U63A 2TPRA 3C4AA 5GRTA 2E1MA 3AWIA 1IUWA 1Z6LA 2IIDA 2XDOA 1W4XA 1GETA 2E4GA 3QVPA 4UDRA 5KOXA 3ZYXA 1E39A 1TDFA 2PHHA 3DJDA 3ALMA 1K0IA 3FIMB 1F8SA 2GR1A 2GQWA 1EBDA 3H8LA 3UTGA 2Q0KA 1F8WA 3RP7A 2BK5A 2BS2A 3NIXA 2BXSA 2WP5A 2W0HA 2XYOA 5TR3A 2JK6A 3REDA 2RABA 1GT8A 1JU2A 5LV9A 3AE6A 4Z44A 1PBEA 5KVHA 4U8PA 2CFYA 2XLPA 4WCTA 2ZBWA 3V76A 1ZMCA 4X4JA 2WPEA 4AP1A 3P4QA 1KF6A 4Z24A 2BK4A 2JBVA 3NYEA 4J57A 4BURA 3DA1A 3PO7A 1GTEA 2FJBA 5JCNA 3NTDA 4P9SA 4YT0A 3UKLA 1DXLA 1N1PA 3NK2X 1HYUA 4K22A 1SEZA 4EIPA 4YSZA 4MJWA 3NN0X 1D4CA 1H7XA 1O5WA 3AE9A 3KLJA 3ATQA 1Q1RA 3KVEA 4U8IA 4OPIA 1JRXA 4CNJA 2C67A 3C4NA 3GSIA 2C66A 1CHUA 3NT6A 4X9MA 1FCDA 1L9EA 1QJDA 1X31B 5FS8A 2YM2A 3PS9A 4RSLA 4Z25A 3ALJA 4TM4A 4D04A 3DK8A 1PDHA 3B3RA 3AD8B 4EQSA 1KFYA 1KNRA 1IUXA 3AE1A 1XDIA 3CPJG 5U25A 3FBSA 4BK3A 4Z2RA 1PHHA 3AE2A 5FS6A 2GF3A 5EB4A 3VRDB 2BC1A 2QA1A 2EQ8A 1M6IA 4J31A 2C70A 1GALA 4REKA 3D1CA 4J33A 1GSNA 4B63A 4BJZA 1EL7A 2VQ7A 1JOAA 4B66A 1CJ3A 1GTHA 2YLZA 3BNUA 3CGDA 1V59A 5KRQA 2V61A 4KPRA 1Y56B 1VG9A 3E1TA 5CQFA 4BV6A 1E7PA 1GRAA 1GRBA 2WBAA 3P4RA 3AEDA 3CNJA 1VRQB 1Q9IA 2V3AA 3F8DA 2B76A 2HQMA 4TM0A 3Q9TA 2GAHB 1IUVA 5J7XA 4H2NA 4K5SA 1QLBA 4H4PA 2WQYA 2WP6A 3SFEA 4IV9A 1CF3A 1IUSA 3G5RA 4GF7A 4JNQA 4LIIA 1H86A 2GAGB 2X99A 4YTMA 3K7TA 4CY6A 1CJCA 1N4UA 1OJDA 2RGOA 2ZZBA 3S61A 4B1BA 3Q6JA 4ECHA 1ZP0A 4GR1A 3CPHG 3M12A 3NNEA 2B9XA 2V3BA 3II4A 3R9UA 3QSMA 1K4QA 4OPGA 1BGJA 5BUKA 4EQXA 1NAAA 2F5ZA 3AE3A 3UKAA
chains in the Genus database with same CATH superfamily
4H2PA 2CVJA 4FK1C 5JCMA 4BK2A 2XFPA 2WP9A 1Y0PA 1PJ7A 1PS9A 2GMJA 4BJYA 5FS7A 3CNTA 1YQ4A 3DGHA 3QFBA 4H4WA 3BHKA 3I3LA 2XLTA 3GDNA 2X8HA 2JAEA 1JRYA 2XVFA 3RNMA 3KKJA 2R4JA 1GEUA 1RYIA 3T2YA 2X3NA 1CC2A 2BXRA 2ZZ0A 3AE7A 2Y6QA 2WDVA 3LZXA 4EM4A 1NDAA 2YR4A 2ZZCA 1YQZA 4JN9A 2J3NA 3UKPA 3M13A 1PJ6A 4H4YA 4AOSA 4C3YA 3ICTA 1YKJA 1KDGA 1OJTA 1Y56A 1PN0A 3IHGA 4Y4LA 5BVAA 3CPIG 3ALLA 4U8LA 2WU5A 1EL9A 1OJAA 2GR3A 3AEFA 4USRA 2YG3A 4U8OA 4U8JA 1ZY8A 2JKCA 2WOWA 1OJ9A 2E5VA 2Q6UA 3LJPA 4ICYA 3VQRA 3UOXA 2A89A 3NK0X 4YSYA 3DJEA 3NLCA 3KU9A 5DBJA 3CNPA 1TYTA 2B9WA 5EOWA 2WHDA 3VRBA 2EQ7A 2YVGA 2H89A 3CN8A 1NHSA 4J2WA 2AQJA 2R45A 3DGZA 4H7UA 1GV4A 4II2A 2Q0LA 1LQUA 3AEAA 4A9WA 4C3XA 3GYIA 2YR5A 2CULA 3KA7A 5HYMA 2Y6RA 2VVLG 3BNMA 4G6GA 2YG6A 1RP0A 2EQ9A 1D7YA 2WU2A 3GMCA 4IVOB 2IVDA 4TLXA 1D4DA 3KPFA 3CGCA 1BKWA 1AOGA 1IUUA 1REOA 1PXAA 3IF9A 5IPYA 5KXJA 4U8NA 3LXDA 3UOYA 2GEWA 1DJQA 3GDPA 1FL2A 1CJ4A 4YSHA 1COYA 3AEGA 4YXDA 4YKFA 4A65A 3CGEA 4PABA 1FOHA 5JCKA 1CJ2A 3DH9A 2GR0A 2VZ2A 3H8IA 5IQ4A 2GH5A 1S2YA 2QA2A 3BHFA 3F8RA 4J36A 2C3DA 4YTNA 3LOVA 4OVIA 2BRAA 2RGJA 4GDEA 1VDCA 3ZDNA 4G6HA 1F3PA 4AP3A 1JEHA 3GD3A 1CBOA 5C3JA 1D7LA 2YG5A 1PXCA 4U8KA 1K0LA 2DKIA 2V60A 1H84A 2WETA 3AXBA 1L9DA 3RHAA 3S5WA 2XFOA 2FJAA 1E6EA 2R0CA 3BI2A 3GD4A 3QSSA 3NHOX 4NZHA 3KPKA 2R0GA 1BZLA 3LADA 2VQBA 1ZOYA 4Y4MA 1FEAA 2Q7VA 4OPDA 3BI4A 4D03A 5BRTA 1TDEA 3P9UA 4A79A 1MXTA 3EAOA 1PJ5A 2WPCA 2O9ZA 2XLRA 2XCGA 1CL0A 4GAVA 2JB2A 2X50A 2B7SA 4NTEA 4OPLA 2R4EA 3C96A 2XVHA 4H4UA 2OALA 3T2KA 2GVCA 1M64A 3SX6A 2XVEA 3I6DA 4WX1A 4O5UA 2BABA 2I0ZA 3AB1A 2OLOA 3HZLA 5M0ZA 3EF6A 4RG3A 3SY4A 3QJ4A 3V3NA 1NHRA 3NG7X 4NTCA 1B4VA 4G73A 3ABVA 3NRNA 4NEVA 1ELIA 3EANA 2YWLA 4H2RA 2QCUA 3RP8A 2XLSA 2XVJA 1E1NA 1L0VA 4A99A 1EL5A 3NH3X 4K7ZA 1BWCA 3GWFA 4NNJA 1UKVG 2XVIA 3P4PA 4UDQA 1TYPA 2WDRA 3EPTA 5KMQA 2YQUA 5HXIA 3AE8A 4APNA 4DGKA 3G5QA 4OCGA 2JB1A 2OA1A 3K7QX 3DMEA 3UOZA 2BC0A 4B65A 4U2LA 3T0KA 3AYLA 3M0OA 5L46A 1FEBA 2BS3A 5KNLA 4XWZA 3NKSA 4A6NA 1DOEA 2Z5XA 1FECA 3FG2P 3KD9A 3IC9A 3BI5A 2C7GA 2YVFA 4XXGA 4GDPA 3UKQA 2NPXA 4N9XA 1PBFA 1XPQA 5KWFA 2NVKX 4GUVA 4TM3A 5KMSA 4EMJA 2VVMA 1N4WA 2GQFA 2GMHA 4PAAA 1NG4A 4ADWA 2C73A 2A87A 4TLZA 1GRHA 4H4QA 3DJGX 3DK4A 4AOXA 1F6MA 2WOVA 1XANA 4EQRA 2A8XA 1LVLA 1VQWA 1D5TA 2WESA 2WOIA 3LB8A 4UP3A 1NHPA 1LPFA 4E0VA 1KSSA 1BF3A 4YWOA 1H82A 1XHCA 3UOVA 4CCRA 4YSXA 2R9ZA 2FBWA 3DJJA 4K5RA 4X9NA 1GNDA 2JB3A 3UCLA 1L9CA 3K30A 4EQWA 1LV0A 1PBCA 2BA9A 3RP6A 2WDQA 1GXFA 3ITJA 2BCGG 2B9YA 4B68A 1H6VA 1DOBA 2C65A 2YM1A 1P2EA 3CIRA 2ACZA 4GCMA 4H4XA 1YQ3A 4HA6A 3L8KA 4IA5A 4AT2A 1VG0A 1B5QA 4J34A 4ZCDA 3CNSA 1O94A 3F8PA 3P1WA 3SZWA 1GREA 2XFQA 2XFUA 4GRTA 4YKGA 3OC4A 2BYBA 4U2TA 1E1MA 3QVRA 1BGNA 1KSUA 3AE4A 5FS9A 2BS4A 1H83A 2PYXA 3AD7B 2YLTA 3UTHA 3URHA 3GMBA 4DSGA 3T2ZA 1ZMDA 2X8GA 5JCLA 1LJ1A 3K7MX 5GSNA 2Z5YA 1ZX9A 4I59A 2YLWA 4H4VA 3UTFA 1P2HA 1QO8A 4H4ZA 3SFDA 2GRTA 1DNCA 2C72A 1PBDA 3COXA 4CBQA 3CGBA 3LZWA 1NEKA 4FX9A 4LU6A 3VR8A 3GYJA 3WE0A 1TDKA 1MO9A 3FPZA 4K2XA 5U1OA 3SM8A 4B69A 2VRMA 1JNRA 3QFAA 4B67A 2H88A 1ZOVA 1CC4A 3T37A 1LTXR 4H2QA 4FDCB 4DSHA 1H7WA 1YY5A 3AECA 3AYIA 3GRTA 2YLSA 2QAEA 4B64A 4Z26A 5BULA 1IUTA 1S2QA 4II3A 4NTDA 4OPCA 3ICRA 5J60A 2VOUA 1E1KA 3JSKA 3SYIA 2EQ6A 1Q1WA 3L1RA 1TDNA 2ARDA 4H4SA 1ZK7A 4YTPA 4CRTA 3NTAA 2YG7A 4XWRA 1F8RA 3HYWA 2AR8A 2C76A 3AE5A 1JNZA 2YLRA 2YLXA 3D8XA 4FK1A 3UKFA 2XLUA 1PBBA 3HYXA 3P4SA 4USQA 1ZKQA 5CKUA 4JY3A 4ZCCA 1E1LA 3NN6X 1OJCA 2C75A 2TMDA 3QSEA 4M52A 1GERA 3PVCA 3ADAB 3G5SA 4Z2TA 1S3BA 3T14A 4EIQA 3GWDA 4IA6A 4EMIA 4H4TA 3AD9B 4NEWA 1B37A 1IJHA 2FJEA 2V6OA 5ER0A 4JY2A 1D4EA 4IVMB 4K8DA 1GOSA 2X8CA 2YAUA 4EM3A 5IQ1A 4U8MA 2GV8A 2YR6A 3AYJA 4H4RA 2OAMA 1NENA 1N4VA 3ICSA 5JCIA 3SZCA 3VRAA 4C77A 1TRBA 2WPFA 1O95A 4EMWA 4U2SA 5C2TA 4C5OA 1ZDLA 2XFNA 5EB5A 5HY5A 1PXBA 3UTEA 2WS3A 4O5QA 2R0PA 3SQPA 3AEEA 1EL8A 4JDRA 4Z43A 3DK9A 3NYFA 1DOCA 3V3OA 1MOKA 5KVIA 2C4CA 1GRGA 4UDPA 5EBKA 4H50A 1RSGA 3H4KA 4CY8A 3GRSA 1B8SA 4I58A 4Y4NA 5HHFA 3NK1X 3VR9A 3AEBA 4A6NB 4DNAA 2CDUA 3CNDA 3UKKA 1TDOA 2R46A 2BCPA 4C74A 2AAQA 1LQTA 4CNKA 3IHMA 1GRTA 5FMHA 3SXIA 1GESA 5M10A 1GRFA 1DODA 2RGHA 2UZZA 2YVJA 2FJDA 4JNAA 4A5LA 2YG4A 1S3EA 4LA1A 1NHQA 2DKHA 3NGCX 3SGLA 3B6DA 2C3CA 4BK1A 4CCQA 2C64A 4OPUA 4JQ9A 4ZN0A 3ATRA 4J56A 3ISHA 3UP5A 2WEUA 2VVLA 1NPXA 3NYCA 3OZ2A 1GPEA 1KNPA 3O0HA 1CC6A 3IWAA 2V5ZA 4TM1A 4RG4A 2VRLA 1H81A 1K0JA 2APGA 3FMWA 3UP4A 4AT0A 1DJNA 2IVEA 4HB9A 1NG3A 2BK3A 2BACA 4Z2UA 4G9KA 4OPTA 4KX6A 2B7RA 4A7AA 1JRZA 2GR2A 2OLNA 3CTYA 2GB0A 1ONFA 3UKHA 5KOWA 5U63A 2TPRA 3C4AA 5GRTA 2E1MA 3AWIA 1IUWA 1Z6LA 2IIDA 2XDOA 3HYVA 1W4XA 1GETA 2E4GA 3QVPA 4UDRA 5KOXA 3ZYXA 1E39A 1TDFA 2PHHA 3DJDA 3ALMA 1K0IA 3FIMB 1F8SA 2GR1A 2GQWA 1EBDA 3H8LA 3UTGA 2Q0KA 1F8WA 3RP7A 2BK5A 2BS2A 3NIXA 2BXSA 2WP5A 2W0HA 2XYOA 5TR3A 2JK6A 3REDA 2RABA 1GT8A 1JU2A 5LV9A 3AE6A 4NWZA 4Z44A 1PBEA 5KMPA 4U8PA 5KVHA 2CFYA 2XLPA 4WCTA 2ZBWA 3V76A 1ZMCA 4X4JA 2WPEA 3SZ0A 3P4QA 1KF6A 4Z24A 4AP1A 2BK4A 2JBVA 3NYEA 4J57A 4BURA 3DA1A 3PO7A 1GTEA 2FJBA 5JCNA 3NTDA 4P9SA 4YT0A 3UKLA 1DXLA 1N1PA 5KMRA 3NK2X 1HYUA 4K22A 1SEZA 4EIPA 4YSZA 4MJWA 4GAPA 3T31A 3NN0X 1D4CA 1H7XA 1O5WA 3AE9A 3KLJA 3ATQA 1Q1RA 3KVEA 4U8IA 4OPIA 1JRXA 4CNJA 2C67A 3C4NA 3GSIA 2C66A 1CHUA 3NT6A 4X9MA 1FCDA 1L9EA 1QJDA 1X31B 5FS8A 2YM2A 3PS9A 4RSLA 4Z25A 3ALJA 4TM4A 4D04A 3DK8A 2BRYA 1PDHA 3B3RA 3AD8B 4EQSA 1KFYA 1KNRA 1IUXA 3AE1A 1XDIA 3CPJG 5U25A 3FBSA 4BK3A 4Z2RA 1PHHA 3AE2A 5FS6A 2GF3A 5EB4A 3VRDB 2BC1A 2QA1A 2EQ8A 3CMMA 1M6IA 4J31A 2C70A 1GALA 4REKA 3D1CA 4J33A 1GSNA 4B63A 4BJZA 1EL7A 2VQ7A 1JOAA 4B66A 1CJ3A 1GTHA 4G74A 2YLZA 3BNUA 3CGDA 1V59A 3SZFA 5KRQA 2V61A 4KPRA 1Y56B 1VG9A 3E1TA 5CQFA 4BV6A 1E7PA 1GRAA 1GRBA 2WBAA 3P4RA 3AEDA 3CNJA 1VRQB 1Q9IA 2V3AA 3F8DA 2B76A 2HQMA 4TM0A 3Q9TA 2GAHB 1IUVA 5J7XA 4H2NA 4K5SA 1QLBA 4H4PA 2WQYA 2WP6A 3SFEA 4IV9A 1CF3A 1IUSA 3G5RA 4GF7A 4JNQA 4LIIA 3GYXA 1H86A 2GAGB 2X99A 4YTMA 3K7TA 4CY6A 1CJCA 1N4UA 1OJDA 2RGOA 2ZZBA 3S61A 4B1BA 3Q6JA 4ECHA 1ZP0A 4GR1A 3CPHG 3M12A 3NNEA 2B9XA 2V3BA 3II4A 3R9UA 3QSMA 1K4QA 4OPGA 1BGJA 5BUKA 4EQXA 1NAAA 2F5ZA 3AE3A 3UKAA
chains in the Genus database with same CATH topology
4H2PA 2CVJA 4FK1C 5JCMA 4BK2A 2XFPA 2WP9A 1Y0PA 1PJ7A 1PS9A 2GMJA 4BJYA 5FS7A 3CNTA 1YQ4A 3DGHA 3QFBA 4H4WA 3BHKA 3I3LA 2XLTA 3GDNA 2X8HA 2JAEA 1JRYA 2XVFA 3RNMA 3KKJA 2R4JA 1GEUA 1RYIA 3T2YA 2X3NA 1CC2A 2BXRA 2ZZ0A 3AE7A 2Y6QA 2WDVA 3LZXA 4EM4A 1NDAA 2YR4A 2ZZCA 1YQZA 4JN9A 2J3NA 3UKPA 3M13A 1PJ6A 4H4YA 4AOSA 4C3YA 3ICTA 1YKJA 1KDGA 1OJTA 1Y56A 1PN0A 3IHGA 4Y4LA 5BVAA 3CPIG 3ALLA 4U8LA 2WU5A 1EL9A 1OJAA 2GR3A 3AEFA 4USRA 2YG3A 4U8OA 4U8JA 1ZY8A 2JKCA 2WOWA 1OJ9A 2E5VA 2Q6UA 3LJPA 4ICYA 3VQRA 3UOXA 2A89A 3NK0X 4YSYA 3DJEA 3NLCA 3KU9A 5DBJA 3CNPA 1TYTA 2B9WA 5EOWA 2WHDA 3VRBA 2EQ7A 2YVGA 2H89A 3CN8A 1NHSA 4J2WA 2AQJA 2R45A 3DGZA 4H7UA 1GV4A 4II2A 2Q0LA 1LQUA 3AEAA 4A9WA 4C3XA 3GYIA 2YR5A 2CULA 3KA7A 5HYMA 2Y6RA 2VVLG 3BNMA 4G6GA 2YG6A 1RP0A 2EQ9A 1D7YA 2WU2A 3GMCA 4IVOB 2IVDA 4TLXA 1D4DA 3KPFA 3CGCA 1BKWA 1AOGA 1IUUA 1REOA 1PXAA 3IF9A 5IPYA 5KXJA 4U8NA 3LXDA 3UOYA 2GEWA 1DJQA 3GDPA 1FL2A 1CJ4A 4YSHA 1COYA 3AEGA 4YXDA 4YKFA 4A65A 3CGEA 4PABA 1FOHA 5JCKA 1CJ2A 3DH9A 2GR0A 2VZ2A 3H8IA 5IQ4A 2GH5A 1S2YA 2QA2A 3BHFA 3F8RA 4J36A 2C3DA 4YTNA 3LOVA 4OVIA 2BRAA 2RGJA 4GDEA 1VDCA 3ZDNA 4G6HA 1F3PA 4AP3A 1JEHA 3GD3A 1CBOA 5C3JA 1D7LA 2YG5A 1PXCA 4U8KA 1K0LA 2DKIA 2V60A 1H84A 2WETA 3AXBA 1L9DA 3RHAA 3S5WA 2XFOA 2FJAA 1E6EA 2R0CA 3BI2A 3GD4A 3QSSA 3NHOX 4NZHA 3KPKA 2R0GA 1BZLA 3LADA 2VQBA 1ZOYA 4Y4MA 1FEAA 2Q7VA 4OPDA 3BI4A 4D03A 5BRTA 1TDEA 3P9UA 4A79A 1MXTA 3EAOA 1PJ5A 2WPCA 2O9ZA 2XLRA 2XCGA 1CL0A 4GAVA 2JB2A 2X50A 2B7SA 4NTEA 4OPLA 2R4EA 3C96A 2XVHA 4H4UA 2OALA 3T2KA 2GVCA 1M64A 3SX6A 2XVEA 3I6DA 4WX1A 4O5UA 2BABA 2I0ZA 3AB1A 2OLOA 3HZLA 5M0ZA 3EF6A 4RG3A 3SY4A 3QJ4A 3V3NA 1NHRA 3NG7X 4NTCA 1B4VA 4G73A 3ABVA 3NRNA 4NEVA 1ELIA 3EANA 2YWLA 4H2RA 2QCUA 3RP8A 2XLSA 2XVJA 1E1NA 1L0VA 4A99A 1EL5A 3NH3X 4K7ZA 1BWCA 3GWFA 4NNJA 1UKVG 2XVIA 3P4PA 4UDQA 1TYPA 2WDRA 3EPTA 5KMQA 2YQUA 5HXIA 3AE8A 4APNA 4DGKA 3G5QA 4OCGA 2JB1A 2OA1A 3K7QX 3DMEA 3UOZA 2BC0A 4B65A 4U2LA 3T0KA 3AYLA 3M0OA 5L46A 1FEBA 2BS3A 5KNLA 4XWZA 3NKSA 4A6NA 1DOEA 2Z5XA 1FECA 3FG2P 3KD9A 3IC9A 3BI5A 2C7GA 2YVFA 4XXGA 4GDPA 3UKQA 2NPXA 4N9XA 1PBFA 1XPQA 5KWFA 2NVKX 4GUVA 4TM3A 5KMSA 4EMJA 2VVMA 1N4WA 2GQFA 2GMHA 4PAAA 1NG4A 4ADWA 2C73A 2A87A 4TLZA 1GRHA 4H4QA 3DJGX 3DK4A 4AOXA 1F6MA 2WOVA 1XANA 4EQRA 2A8XA 1LVLA 1VQWA 1D5TA 2WESA 2WOIA 3LB8A 4UP3A 1NHPA 1LPFA 4E0VA 1KSSA 1BF3A 4YWOA 1H82A 1XHCA 3UOVA 4CCRA 4YSXA 2R9ZA 2FBWA 3DJJA 4K5RA 4X9NA 1GNDA 2JB3A 3UCLA 1L9CA 3K30A 4EQWA 1LV0A 1PBCA 2BA9A 3RP6A 2WDQA 1GXFA 3ITJA 2BCGG 2B9YA 4B68A 1H6VA 1DOBA 2C65A 2YM1A 1P2EA 3CIRA 2ACZA 4GCMA 4H4XA 1YQ3A 4HA6A 3L8KA 4IA5A 4AT2A 1VG0A 1B5QA 4J34A 4ZCDA 3CNSA 1O94A 3F8PA 3P1WA 3SZWA 1GREA 2XFQA 2XFUA 4GRTA 4YKGA 3OC4A 2BYBA 4U2TA 1E1MA 3QVRA 1BGNA 1KSUA 3AE4A 5FS9A 2BS4A 1H83A 2PYXA 3AD7B 2YLTA 3UTHA 3URHA 3GMBA 4DSGA 3T2ZA 1ZMDA 2X8GA 5JCLA 1LJ1A 3K7MX 5GSNA 2Z5YA 1ZX9A 4I59A 2YLWA 4H4VA 3UTFA 1P2HA 1QO8A 4H4ZA 3SFDA 2GRTA 1DNCA 2C72A 1PBDA 3COXA 4CBQA 3CGBA 3LZWA 1NEKA 4FX9A 4LU6A 3VR8A 3GYJA 3WE0A 1TDKA 1MO9A 3FPZA 4K2XA 5U1OA 3SM8A 4B69A 2VRMA 1JNRA 3QFAA 4B67A 2H88A 1ZOVA 1CC4A 3T37A 1LTXR 4H2QA 4FDCB 4DSHA 1H7WA 1YY5A 3AECA 3AYIA 3GRTA 2YLSA 2QAEA 4B64A 4Z26A 5BULA 1IUTA 1S2QA 4II3A 4NTDA 4OPCA 3ICRA 5J60A 2VOUA 1E1KA 3JSKA 3SYIA 2EQ6A 1Q1WA 3L1RA 1TDNA 2ARDA 4H4SA 1ZK7A 4YTPA 4CRTA 3NTAA 2YG7A 4XWRA 1F8RA 3HYWA 2AR8A 2C76A 3AE5A 1JNZA 2YLRA 2YLXA 3D8XA 4FK1A 3UKFA 2XLUA 1PBBA 3HYXA 3P4SA 4USQA 1ZKQA 5CKUA 4JY3A 4ZCCA 1E1LA 3NN6X 1OJCA 2C75A 2TMDA 3QSEA 4M52A 1GERA 3PVCA 3ADAB 3G5SA 4Z2TA 1S3BA 3T14A 4EIQA 3GWDA 4IA6A 4EMIA 4H4TA 3AD9B 4NEWA 1B37A 1IJHA 2FJEA 2V6OA 5ER0A 4JY2A 1D4EA 4IVMB 4K8DA 1GOSA 2X8CA 2YAUA 4EM3A 5IQ1A 4U8MA 2GV8A 2YR6A 3AYJA 4H4RA 2OAMA 1NENA 1N4VA 3ICSA 5JCIA 3SZCA 3VRAA 4C77A 1TRBA 2WPFA 1O95A 4EMWA 4U2SA 5C2TA 4C5OA 1ZDLA 2XFNA 5EB5A 5HY5A 1PXBA 3UTEA 2WS3A 4O5QA 2R0PA 3SQPA 3AEEA 1EL8A 4JDRA 4Z43A 3DK9A 3NYFA 1DOCA 3V3OA 1MOKA 5KVIA 2C4CA 1GRGA 4UDPA 5EBKA 4H50A 1RSGA 3H4KA 4CY8A 3GRSA 1B8SA 4I58A 4Y4NA 5HHFA 3NK1X 3VR9A 3AEBA 4A6NB 4DNAA 2CDUA 3CNDA 3UKKA 1TDOA 2R46A 2BCPA 4C74A 2AAQA 1LQTA 4CNKA 3IHMA 1GRTA 5FMHA 3SXIA 1GESA 5M10A 1GRFA 1DODA 2RGHA 2UZZA 2YVJA 2FJDA 4JNAA 4A5LA 2YG4A 1S3EA 4LA1A 1NHQA 2DKHA 3NGCX 3SGLA 3B6DA 2C3CA 4BK1A 4CCQA 2C64A 4OPUA 4JQ9A 4ZN0A 3ATRA 4J56A 3ISHA 3UP5A 2WEUA 2VVLA 1NPXA 3NYCA 3OZ2A 1GPEA 1KNPA 3O0HA 1CC6A 3IWAA 2V5ZA 4TM1A 4RG4A 2VRLA 1H81A 1K0JA 2APGA 3FMWA 3UP4A 4AT0A 1DJNA 2IVEA 4HB9A 1NG3A 2BK3A 2BACA 4Z2UA 4G9KA 4OPTA 4KX6A 2B7RA 4A7AA 1JRZA 2GR2A 2OLNA 3CTYA 2GB0A 1ONFA 3UKHA 5KOWA 5U63A 2TPRA 3C4AA 5GRTA 2E1MA 3AWIA 1IUWA 1Z6LA 2IIDA 2XDOA 3HYVA 1W4XA 1GETA 2E4GA 3QVPA 4UDRA 5KOXA 3ZYXA 1E39A 1TDFA 2PHHA 3DJDA 3ALMA 1K0IA 3FIMB 1F8SA 2GR1A 2GQWA 1EBDA 3H8LA 3UTGA 2Q0KA 1F8WA 3RP7A 2BK5A 2BS2A 3NIXA 2BXSA 2WP5A 2W0HA 2XYOA 5TR3A 2JK6A 3REDA 2RABA 1GT8A 1JU2A 5LV9A 3AE6A 4NWZA 4Z44A 1PBEA 5KMPA 4U8PA 5KVHA 2CFYA 2XLPA 4WCTA 2ZBWA 3V76A 1ZMCA 4X4JA 2WPEA 3SZ0A 3P4QA 1KF6A 4Z24A 4AP1A 2BK4A 2JBVA 3NYEA 4J57A 4BURA 3DA1A 3PO7A 1GTEA 2FJBA 5JCNA 3NTDA 4P9SA 4YT0A 3UKLA 1DXLA 1N1PA 5KMRA 3NK2X 1HYUA 4K22A 1SEZA 4EIPA 4YSZA 4MJWA 4GAPA 3T31A 3NN0X 1D4CA 1H7XA 1O5WA 3AE9A 3KLJA 3ATQA 1Q1RA 3KVEA 4U8IA 4OPIA 1JRXA 4CNJA 2C67A 3C4NA 3GSIA 2C66A 1CHUA 3NT6A 4X9MA 1FCDA 1L9EA 1QJDA 1X31B 5FS8A 2YM2A 3PS9A 4RSLA 4Z25A 3ALJA 4TM4A 4D04A 3DK8A 2BRYA 1PDHA 3B3RA 3AD8B 4EQSA 1KFYA 1KNRA 1IUXA 3AE1A 1XDIA 3CPJG 5U25A 3FBSA 4BK3A 4Z2RA 1PHHA 3AE2A 5FS6A 2GF3A 5EB4A 3VRDB 2BC1A 2QA1A 2EQ8A 3CMMA 1M6IA 4J31A 2C70A 1GALA 4REKA 3D1CA 4J33A 1GSNA 4B63A 4BJZA 1EL7A 2VQ7A 1JOAA 4B66A 1CJ3A 1GTHA 4G74A 2YLZA 3BNUA 3CGDA 1V59A 3SZFA 5KRQA 2V61A 4KPRA 1Y56B 1VG9A 3E1TA 5CQFA 4BV6A 1E7PA 1GRAA 1GRBA 2WBAA 3P4RA 3AEDA 3CNJA 1VRQB 1Q9IA 2V3AA 3F8DA 2B76A 2HQMA 4TM0A 3Q9TA 2GAHB 1IUVA 5J7XA 4H2NA 4K5SA 1QLBA 4H4PA 2WQYA 2WP6A 3SFEA 4IV9A 1CF3A 1IUSA 3G5RA 4GF7A 4JNQA 4LIIA 3GYXA 1H86A 2GAGB 2X99A 4YTMA 3K7TA 4CY6A 1CJCA 1N4UA 1OJDA 2RGOA 2ZZBA 3S61A 4B1BA 3Q6JA 4ECHA 1ZP0A 4GR1A 3CPHG 3M12A 3NNEA 2B9XA 2V3BA 3II4A 3R9UA 3QSMA 1K4QA 4OPGA 1BGJA 5BUKA 4EQXA 1NAAA 2F5ZA 3AE3A 3UKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2P A;  2CVJ A;  4FK1 C;  5JCM A;  4BK2 A;  2XFP A;  2WP9 A;  1Y0P A;  1PJ7 A;  1PS9 A;  2GMJ A;  4BJY A;  5FS7 A;  3CNT A;  1YQ4 A;  3DGH A;  3QFB A;  4H4W A;  3BHK A;  3I3L A;  2XLT A;  3GDN A;  2X8H A;  2JAE A;  1JRY A;  2XVF A;  3RNM A;  3KKJ A;  2R4J A;  1GEU A;  1RYI A;  2X3N A;  1CC2 A;  2BXR A;  2ZZ0 A;  3AE7 A;  2Y6Q A;  2WDV A;  3LZX A;  4EM4 A;  1NDA A;  2YR4 A;  2ZZC A;  1YQZ A;  4JN9 A;  2J3N A;  3UKP A;  3M13 A;  1PJ6 A;  4H4Y A;  4AOS A;  4C3Y A;  3ICT A;  1YKJ A;  1KDG A;  1OJT A;  1Y56 A;  1PN0 A;  3IHG A;  4Y4L A;  5BVA A;  3CPI G;  3ALL A;  4U8L A;  2WU5 A;  1EL9 A;  1OJA A;  2GR3 A;  3AEF A;  4USR A;  2YG3 A;  4U8O A;  4U8J A;  1ZY8 A;  2JKC A;  2WOW A;  1OJ9 A;  2E5V A;  2Q6U A;  3LJP A;  4ICY A;  3VQR A;  3UOX A;  2A89 A;  3NK0 X;  4YSY A;  3DJE A;  3NLC A;  3KU9 A;  5DBJ A;  3CNP A;  1TYT A;  2B9W A;  5EOW A;  2WHD A;  3VRB A;  2EQ7 A;  2YVG A;  2H89 A;  3CN8 A;  1NHS A;  4J2W A;  2AQJ A;  2R45 A;  3DGZ A;  4H7U A;  1GV4 A;  2Q0L A;  1LQU A;  3AEA A;  4A9W A;  4C3X A;  3GYI A;  2YR5 A;  2CUL A;  3KA7 A;  5HYM A;  2Y6R A;  2VVL G;  3BNM A;  2YG6 A;  1RP0 A;  2EQ9 A;  1D7Y A;  2WU2 A;  3GMC A;  4IVO B;  2IVD A;  4TLX A;  1D4D A;  3KPF A;  3CGC A;  1BKW A;  1AOG A;  1IUU A;  1REO A;  1PXA A;  3IF9 A;  5IPY A;  5KXJ A;  4U8N A;  3LXD A;  3UOY A;  2GEW A;  1DJQ A;  3GDP A;  1FL2 A;  1CJ4 A;  4YSH A;  1COY A;  3AEG A;  4YXD A;  4YKF A;  4A65 A;  3CGE A;  4PAB A;  1FOH A;  5JCK A;  1CJ2 A;  3DH9 A;  2GR0 A;  2VZ2 A;  3H8I A;  5IQ4 A;  2GH5 A;  1S2Y A;  2QA2 A;  3BHF A;  3F8R A;  4J36 A;  2C3D A;  4YTN A;  3LOV A;  4OVI A;  2RGJ A;  4GDE A;  1VDC A;  3ZDN A;  1F3P A;  4AP3 A;  1JEH A;  3GD3 A;  1CBO A;  5C3J A;  1D7L A;  2YG5 A;  1PXC A;  4U8K A;  1K0L A;  2DKI A;  2V60 A;  1H84 A;  2WET A;  3AXB A;  1L9D A;  3RHA A;  3S5W A;  2XFO A;  2FJA A;  1E6E A;  2R0C A;  3BI2 A;  3GD4 A;  3QSS A;  3NHO X;  4NZH A;  2R0G A;  1BZL A;  3LAD A;  2VQB A;  1ZOY A;  4Y4M A;  1FEA A;  2Q7V A;  4OPD A;  3BI4 A;  4D03 A;  5BRT A;  1TDE A;  3P9U A;  4A79 A;  1MXT A;  3EAO A;  1PJ5 A;  2WPC A;  2O9Z A;  2XLR A;  2XCG A;  1CL0 A;  2JB2 A;  2X50 A;  2B7S A;  4NTE A;  4OPL A;  2R4E A;  3C96 A;  2XVH A;  4H4U A;  2OAL A;  2GVC A;  1M64 A;  2XVE A;  3I6D A;  4WX1 A;  4O5U A;  2BAB A;  2I0Z A;  3AB1 A;  2OLO A;  3HZL A;  5M0Z A;  3EF6 A;  4RG3 A;  3QJ4 A;  3V3N A;  1NHR A;  3NG7 X;  4NTC A;  1B4V A;  3ABV A;  3NRN A;  4NEV A;  1ELI A;  3EAN A;  2YWL A;  4H2R A;  2QCU A;  3RP8 A;  2XLS A;  2XVJ A;  1E1N A;  1L0V A;  4A99 A;  1EL5 A;  3NH3 X;  4K7Z A;  1BWC A;  3GWF A;  1UKV G;  2XVI A;  3P4P A;  4UDQ A;  1TYP A;  2WDR A;  3EPT A;  2YQU A;  5HXI A;  3AE8 A;  4APN A;  4DGK A;  3G5Q A;  4OCG A;  2JB1 A;  2OA1 A;  3K7Q X;  3DME A;  3UOZ A;  2BC0 A;  4B65 A;  4U2L A;  3AYL A;  3M0O A;  5L46 A;  1FEB A;  2BS3 A;  4XWZ A;  3NKS A;  4A6N A;  1DOE A;  2Z5X A;  1FEC A;  3FG2 P;  3KD9 A;  3IC9 A;  3BI5 A;  2C7G A;  2YVF A;  4XXG A;  4GDP A;  3UKQ A;  2NPX A;  4N9X A;  1PBF A;  1XPQ A;  5KWF A;  2NVK X;  4GUV A;  4TM3 A;  4EMJ A;  2VVM A;  1N4W A;  2GQF A;  2GMH A;  4PAA A;  1NG4 A;  4ADW A;  2C73 A;  2A87 A;  4TLZ A;  1GRH A;  4H4Q A;  3DJG X;  3DK4 A;  4AOX A;  1F6M A;  2WOV A;  1XAN A;  4EQR A;  2A8X A;  1LVL A;  1VQW A;  1D5T A;  2WES A;  2WOI A;  3LB8 A;  4UP3 A;  1NHP A;  1LPF A;  4E0V A;  1KSS A;  1BF3 A;  4YWO A;  1H82 A;  1XHC A;  3UOV A;  4CCR A;  4YSX A;  2R9Z A;  2FBW A;  3DJJ A;  4K5R A;  4X9N A;  1GND A;  2JB3 A;  3UCL A;  1L9C A;  3K30 A;  4EQW A;  1LV0 A;  1PBC A;  2BA9 A;  3RP6 A;  2WDQ A;  1GXF A;  3ITJ A;  2BCG G;  2B9Y A;  4B68 A;  1H6V A;  1DOB A;  2C65 A;  2YM1 A;  1P2E A;  3CIR A;  2ACZ A;  4GCM A;  4H4X A;  1YQ3 A;  4HA6 A;  3L8K A;  4IA5 A;  4AT2 A;  1VG0 A;  1B5Q A;  4J34 A;  4ZCD A;  3CNS A;  1O94 A;  3F8P A;  3P1W A;  1GRE A;  2XFQ A;  2XFU A;  4GRT A;  4YKG A;  3OC4 A;  2BYB A;  4U2T A;  1E1M A;  3QVR A;  1BGN A;  1KSU A;  3AE4 A;  5FS9 A;  2BS4 A;  1H83 A;  2PYX A;  3AD7 B;  2YLT A;  3UTH A;  3URH A;  3GMB A;  4DSG A;  1ZMD A;  2X8G A;  5JCL A;  1LJ1 A;  3K7M X;  5GSN A;  2Z5Y A;  1ZX9 A;  4I59 A;  2YLW A;  4H4V A;  3UTF A;  1P2H A;  1QO8 A;  4H4Z A;  3SFD A;  2GRT A;  1DNC A;  2C72 A;  1PBD A;  3COX A;  4CBQ A;  3CGB A;  3LZW A;  1NEK A;  4FX9 A;  4LU6 A;  3VR8 A;  3GYJ A;  3WE0 A;  1TDK A;  1MO9 A;  3FPZ A;  4K2X A;  5U1O A;  3SM8 A;  4B69 A;  2VRM A;  1JNR A;  3QFA A;  4B67 A;  2H88 A;  1ZOV A;  1CC4 A;  3T37 A;  1LTX R;  4H2Q A;  4FDC B;  4DSH A;  1H7W A;  1YY5 A;  3AEC A;  3AYI A;  3GRT A;  2YLS A;  2QAE A;  4B64 A;  4Z26 A;  5BUL A;  1IUT A;  1S2Q A;  4NTD A;  4OPC A;  3ICR A;  5J60 A;  2VOU A;  1E1K A;  3JSK A;  2EQ6 A;  1Q1W A;  3L1R A;  1TDN A;  2ARD A;  4H4S A;  1ZK7 A;  4YTP A;  4CRT A;  3NTA A;  2YG7 A;  4XWR A;  1F8R A;  2AR8 A;  2C76 A;  3AE5 A;  1JNZ A;  2YLR A;  2YLX A;  3D8X A;  4FK1 A;  3UKF A;  2XLU A;  1PBB A;  3P4S A;  4USQ A;  1ZKQ A;  5CKU A;  4JY3 A;  4ZCC A;  1E1L A;  3NN6 X;  1OJC A;  2C75 A;  2TMD A;  3QSE A;  4M52 A;  1GER A;  3PVC A;  3ADA B;  3G5S A;  4Z2T A;  1S3B A;  4EIQ A;  3GWD A;  4IA6 A;  4EMI A;  4H4T A;  3AD9 B;  4NEW A;  1B37 A;  1IJH A;  2FJE A;  2V6O A;  5ER0 A;  4JY2 A;  1D4E A;  4IVM B;  4K8D A;  1GOS A;  2X8C A;  2YAU A;  4EM3 A;  5IQ1 A;  4U8M A;  2GV8 A;  2YR6 A;  3AYJ A;  4H4R A;  2OAM A;  1NEN A;  1N4V A;  3ICS A;  5JCI A;  3VRA A;  4C77 A;  1TRB A;  2WPF A;  1O95 A;  4EMW A;  4U2S A;  5C2T A;  4C5O A;  1ZDL A;  2XFN A;  5EB5 A;  5HY5 A;  1PXB A;  3UTE A;  2WS3 A;  4O5Q A;  2R0P A;  3SQP A;  3AEE A;  1EL8 A;  4JDR A;  4Z43 A;  3DK9 A;  3NYF A;  1DOC A;  3V3O A;  1MOK A;  5KVI A;  1GRG A;  4UDP A;  5EBK A;  4H50 A;  1RSG A;  3H4K A;  4CY8 A;  3GRS A;  1B8S A;  4I58 A;  4Y4N A;  5HHF A;  3NK1 X;  3VR9 A;  3AEB A;  4A6N B;  4DNA A;  2CDU A;  3CND A;  3UKK A;  1TDO A;  2R46 A;  2BCP A;  4C74 A;  2AAQ A;  1LQT A;  4CNK A;  3IHM A;  1GRT A;  5FMH A;  1GES A;  5M10 A;  1GRF A;  1DOD A;  2RGH A;  2UZZ A;  2YVJ A;  2FJD A;  4JNA A;  4A5L A;  2YG4 A;  1S3E A;  4LA1 A;  1NHQ A;  2DKH A;  3NGC X;  3SGL A;  3B6D A;  2C3C A;  4BK1 A;  4CCQ A;  2C64 A;  4OPU A;  4JQ9 A;  4ZN0 A;  3ATR A;  4J56 A;  3ISH A;  3UP5 A;  2WEU A;  2VVL A;  1NPX A;  3NYC A;  3OZ2 A;  1GPE A;  1KNP A;  3O0H A;  1CC6 A;  3IWA A;  2V5Z A;  4TM1 A;  4RG4 A;  2VRL A;  1H81 A;  1K0J A;  2APG A;  3FMW A;  3UP4 A;  4AT0 A;  1DJN A;  2IVE A;  4HB9 A;  1NG3 A;  2BK3 A;  2BAC A;  4Z2U A;  4OPT A;  4KX6 A;  2B7R A;  4A7A A;  1JRZ A;  2GR2 A;  2OLN A;  3CTY A;  2GB0 A;  1ONF A;  3UKH A;  5KOW A;  5U63 A;  2TPR A;  3C4A A;  5GRT A;  2E1M A;  3AWI A;  1IUW A;  1Z6L A;  2IID A;  2XDO A;  1W4X A;  1GET A;  2E4G A;  3QVP A;  4UDR A;  5KOX A;  3ZYX A;  1E39 A;  1TDF A;  2PHH A;  3DJD A;  3ALM A;  1K0I A;  3FIM B;  1F8S A;  2GR1 A;  2GQW A;  1EBD A;  3H8L A;  3UTG A;  2Q0K A;  1F8W A;  3RP7 A;  2BK5 A;  2BS2 A;  3NIX A;  2BXS A;  2WP5 A;  2W0H A;  2XYO A;  5TR3 A;  2JK6 A;  3RED A;  2RAB A;  1GT8 A;  1JU2 A;  5LV9 A;  3AE6 A;  4Z44 A;  1PBE A;  5KVH A;  4U8P A;  2CFY A;  2XLP A;  4WCT A;  2ZBW A;  3V76 A;  1ZMC A;  4X4J A;  2WPE A;  4AP1 A;  3P4Q A;  1KF6 A;  4Z24 A;  2BK4 A;  2JBV A;  3NYE A;  4J57 A;  4BUR A;  3DA1 A;  3PO7 A;  1GTE A;  2FJB A;  5JCN A;  3NTD A;  4P9S A;  4YT0 A;  3UKL A;  1DXL A;  1N1P A;  3NK2 X;  1HYU A;  4K22 A;  1SEZ A;  4EIP A;  4YSZ A;  4MJW A;  3NN0 X;  1D4C A;  1H7X A;  1O5W A;  3AE9 A;  3KLJ A;  3ATQ A;  1Q1R A;  3KVE A;  4U8I A;  4OPI A;  1JRX A;  4CNJ A;  2C67 A;  3C4N A;  3GSI A;  2C66 A;  1CHU A;  3NT6 A;  4X9M A;  1FCD A;  1L9E A;  1QJD A;  1X31 B;  5FS8 A;  2YM2 A;  3PS9 A;  4RSL A;  4Z25 A;  3ALJ A;  4TM4 A;  4D04 A;  3DK8 A;  1PDH A;  3B3R A;  3AD8 B;  4EQS A;  1KFY A;  1KNR A;  1IUX A;  3AE1 A;  1XDI A;  3CPJ G;  5U25 A;  3FBS A;  4BK3 A;  4Z2R A;  1PHH A;  3AE2 A;  5FS6 A;  2GF3 A;  5EB4 A;  3VRD B;  2BC1 A;  2QA1 A;  2EQ8 A;  1M6I A;  4J31 A;  2C70 A;  1GAL A;  4REK A;  3D1C A;  4J33 A;  1GSN A;  4B63 A;  4BJZ A;  1EL7 A;  2VQ7 A;  1JOA A;  4B66 A;  1CJ3 A;  1GTH A;  2YLZ A;  3BNU A;  3CGD A;  1V59 A;  5KRQ A;  2V61 A;  4KPR A;  1Y56 B;  1VG9 A;  3E1T A;  5CQF A;  4BV6 A;  1E7P A;  1GRA A;  1GRB A;  2WBA A;  3P4R A;  3AED A;  3CNJ A;  1VRQ B;  1Q9I A;  2V3A A;  3F8D A;  2B76 A;  2HQM A;  4TM0 A;  3Q9T A;  2GAH B;  1IUV A;  5J7X A;  4H2N A;  4K5S A;  1QLB A;  4H4P A;  2WQY A;  2WP6 A;  3SFE A;  4IV9 A;  1CF3 A;  1IUS A;  3G5R A;  4GF7 A;  4JNQ A;  4LII A;  1H86 A;  2GAG B;  2X99 A;  4YTM A;  3K7T A;  4CY6 A;  1CJC A;  1N4U A;  1OJD A;  2RGO A;  2ZZB A;  3S61 A;  4B1B A;  3Q6J A;  4ECH A;  1ZP0 A;  4GR1 A;  3CPH G;  3M12 A;  3NNE A;  2B9X A;  2V3B A;  3II4 A;  3R9U A;  3QSM A;  1K4Q A;  4OPG A;  1BGJ A;  5BUK A;  4EQX A;  1NAA A;  2F5Z A;  3AE3 A;  3UKA A; 
#chains in the Genus database with same CATH topology
 4H2P A;  2CVJ A;  4FK1 C;  5JCM A;  4BK2 A;  2XFP A;  2WP9 A;  1Y0P A;  1PJ7 A;  1PS9 A;  2GMJ A;  4BJY A;  5FS7 A;  3CNT A;  1YQ4 A;  3DGH A;  3QFB A;  4H4W A;  3BHK A;  3I3L A;  2XLT A;  3GDN A;  2X8H A;  2JAE A;  1JRY A;  2XVF A;  3RNM A;  3KKJ A;  2R4J A;  1GEU A;  1RYI A;  3T2Y A;  2X3N A;  1CC2 A;  2BXR A;  2ZZ0 A;  3AE7 A;  2Y6Q A;  2WDV A;  3LZX A;  4EM4 A;  1NDA A;  2YR4 A;  2ZZC A;  1YQZ A;  4JN9 A;  2J3N A;  3UKP A;  3M13 A;  1PJ6 A;  4H4Y A;  4AOS A;  4C3Y A;  3ICT A;  1YKJ A;  1KDG A;  1OJT A;  1Y56 A;  1PN0 A;  3IHG A;  4Y4L A;  5BVA A;  3CPI G;  3ALL A;  4U8L A;  2WU5 A;  1EL9 A;  1OJA A;  2GR3 A;  3AEF A;  4USR A;  2YG3 A;  4U8O A;  4U8J A;  1ZY8 A;  2JKC A;  2WOW A;  1OJ9 A;  2E5V A;  2Q6U A;  3LJP A;  4ICY A;  3VQR A;  3UOX A;  2A89 A;  3NK0 X;  4YSY A;  3DJE A;  3NLC A;  3KU9 A;  5DBJ A;  3CNP A;  1TYT A;  2B9W A;  5EOW A;  2WHD A;  3VRB A;  2EQ7 A;  2YVG A;  2H89 A;  3CN8 A;  1NHS A;  4J2W A;  2AQJ A;  2R45 A;  3DGZ A;  4H7U A;  1GV4 A;  4II2 A;  2Q0L A;  1LQU A;  3AEA A;  4A9W A;  4C3X A;  3GYI A;  2YR5 A;  2CUL A;  3KA7 A;  5HYM A;  2Y6R A;  2VVL G;  3BNM A;  4G6G A;  2YG6 A;  1RP0 A;  2EQ9 A;  1D7Y A;  2WU2 A;  3GMC A;  4IVO B;  2IVD A;  4TLX A;  1D4D A;  3KPF A;  3CGC A;  1BKW A;  1AOG A;  1IUU A;  1REO A;  1PXA A;  3IF9 A;  5IPY A;  5KXJ A;  4U8N A;  3LXD A;  3UOY A;  2GEW A;  1DJQ A;  3GDP A;  1FL2 A;  1CJ4 A;  4YSH A;  1COY A;  3AEG A;  4YXD A;  4YKF A;  4A65 A;  3CGE A;  4PAB A;  1FOH A;  5JCK A;  1CJ2 A;  3DH9 A;  2GR0 A;  2VZ2 A;  3H8I A;  5IQ4 A;  2GH5 A;  1S2Y A;  2QA2 A;  3BHF A;  3F8R A;  4J36 A;  2C3D A;  4YTN A;  3LOV A;  4OVI A;  2BRA A;  2RGJ A;  4GDE A;  1VDC A;  3ZDN A;  4G6H A;  1F3P A;  4AP3 A;  1JEH A;  3GD3 A;  1CBO A;  5C3J A;  1D7L A;  2YG5 A;  1PXC A;  4U8K A;  1K0L A;  2DKI A;  2V60 A;  1H84 A;  2WET A;  3AXB A;  1L9D A;  3RHA A;  3S5W A;  2XFO A;  2FJA A;  1E6E A;  2R0C A;  3BI2 A;  3GD4 A;  3QSS A;  3NHO X;  4NZH A;  3KPK A;  2R0G A;  1BZL A;  3LAD A;  2VQB A;  1ZOY A;  4Y4M A;  1FEA A;  2Q7V A;  4OPD A;  3BI4 A;  4D03 A;  5BRT A;  1TDE A;  3P9U A;  4A79 A;  1MXT A;  3EAO A;  1PJ5 A;  2WPC A;  2O9Z A;  2XLR A;  2XCG A;  1CL0 A;  4GAV A;  2JB2 A;  2X50 A;  2B7S A;  4NTE A;  4OPL A;  2R4E A;  3C96 A;  2XVH A;  4H4U A;  2OAL A;  3T2K A;  2GVC A;  1M64 A;  3SX6 A;  2XVE A;  3I6D A;  4WX1 A;  4O5U A;  2BAB A;  2I0Z A;  3AB1 A;  2OLO A;  3HZL A;  5M0Z A;  3EF6 A;  4RG3 A;  3SY4 A;  3QJ4 A;  3V3N A;  1NHR A;  3NG7 X;  4NTC A;  1B4V A;  4G73 A;  3ABV A;  3NRN A;  4NEV A;  1ELI A;  3EAN A;  2YWL A;  4H2R A;  2QCU A;  3RP8 A;  2XLS A;  2XVJ A;  1E1N A;  1L0V A;  4A99 A;  1EL5 A;  3NH3 X;  4K7Z A;  1BWC A;  3GWF A;  4NNJ A;  1UKV G;  2XVI A;  3P4P A;  4UDQ A;  1TYP A;  2WDR A;  3EPT A;  5KMQ A;  2YQU A;  5HXI A;  3AE8 A;  4APN A;  4DGK A;  3G5Q A;  4OCG A;  2JB1 A;  2OA1 A;  3K7Q X;  3DME A;  3UOZ A;  2BC0 A;  4B65 A;  4U2L A;  3T0K A;  3AYL A;  3M0O A;  5L46 A;  1FEB A;  2BS3 A;  5KNL A;  4XWZ A;  3NKS A;  4A6N A;  1DOE A;  2Z5X A;  1FEC A;  3FG2 P;  3KD9 A;  3IC9 A;  3BI5 A;  2C7G A;  2YVF A;  4XXG A;  4GDP A;  3UKQ A;  2NPX A;  4N9X A;  1PBF A;  1XPQ A;  5KWF A;  2NVK X;  4GUV A;  4TM3 A;  5KMS A;  4EMJ A;  2VVM A;  1N4W A;  2GQF A;  2GMH A;  4PAA A;  1NG4 A;  4ADW A;  2C73 A;  2A87 A;  4TLZ A;  1GRH A;  4H4Q A;  3DJG X;  3DK4 A;  4AOX A;  1F6M A;  2WOV A;  1XAN A;  4EQR A;  2A8X A;  1LVL A;  1VQW A;  1D5T A;  2WES A;  2WOI A;  3LB8 A;  4UP3 A;  1NHP A;  1LPF A;  4E0V A;  1KSS A;  1BF3 A;  4YWO A;  1H82 A;  1XHC A;  3UOV A;  4CCR A;  4YSX A;  2R9Z A;  2FBW A;  3DJJ A;  4K5R A;  4X9N A;  1GND A;  2JB3 A;  3UCL A;  1L9C A;  3K30 A;  4EQW A;  1LV0 A;  1PBC A;  2BA9 A;  3RP6 A;  2WDQ A;  1GXF A;  3ITJ A;  2BCG G;  2B9Y A;  4B68 A;  1H6V A;  1DOB A;  2C65 A;  2YM1 A;  1P2E A;  3CIR A;  2ACZ A;  4GCM A;  4H4X A;  1YQ3 A;  4HA6 A;  3L8K A;  4IA5 A;  4AT2 A;  1VG0 A;  1B5Q A;  4J34 A;  4ZCD A;  3CNS A;  1O94 A;  3F8P A;  3P1W A;  3SZW A;  1GRE A;  2XFQ A;  2XFU A;  4GRT A;  4YKG A;  3OC4 A;  2BYB A;  4U2T A;  1E1M A;  3QVR A;  1BGN A;  1KSU A;  3AE4 A;  5FS9 A;  2BS4 A;  1H83 A;  2PYX A;  3AD7 B;  2YLT A;  3UTH A;  3URH A;  3GMB A;  4DSG A;  3T2Z A;  1ZMD A;  2X8G A;  5JCL A;  1LJ1 A;  3K7M X;  5GSN A;  2Z5Y A;  1ZX9 A;  4I59 A;  2YLW A;  4H4V A;  3UTF A;  1P2H A;  1QO8 A;  4H4Z A;  3SFD A;  2GRT A;  1DNC A;  2C72 A;  1PBD A;  3COX A;  4CBQ A;  3CGB A;  3LZW A;  1NEK A;  4FX9 A;  4LU6 A;  3VR8 A;  3GYJ A;  3WE0 A;  1TDK A;  1MO9 A;  3FPZ A;  4K2X A;  5U1O A;  3SM8 A;  4B69 A;  2VRM A;  1JNR A;  3QFA A;  4B67 A;  2H88 A;  1ZOV A;  1CC4 A;  3T37 A;  1LTX R;  4H2Q A;  4FDC B;  4DSH A;  1H7W A;  1YY5 A;  3AEC A;  3AYI A;  3GRT A;  2YLS A;  2QAE A;  4B64 A;  4Z26 A;  5BUL A;  1IUT A;  1S2Q A;  4II3 A;  4NTD A;  4OPC A;  3ICR A;  5J60 A;  2VOU A;  1E1K A;  3JSK A;  3SYI A;  2EQ6 A;  1Q1W A;  3L1R A;  1TDN A;  2ARD A;  4H4S A;  1ZK7 A;  4YTP A;  4CRT A;  3NTA A;  2YG7 A;  4XWR A;  1F8R A;  3HYW A;  2AR8 A;  2C76 A;  3AE5 A;  1JNZ A;  2YLR A;  2YLX A;  3D8X A;  4FK1 A;  3UKF A;  2XLU A;  1PBB A;  3HYX A;  3P4S A;  4USQ A;  1ZKQ A;  5CKU A;  4JY3 A;  4ZCC A;  1E1L A;  3NN6 X;  1OJC A;  2C75 A;  2TMD A;  3QSE A;  4M52 A;  1GER A;  3PVC A;  3ADA B;  3G5S A;  4Z2T A;  1S3B A;  3T14 A;  4EIQ A;  3GWD A;  4IA6 A;  4EMI A;  4H4T A;  3AD9 B;  4NEW A;  1B37 A;  1IJH A;  2FJE A;  2V6O A;  5ER0 A;  4JY2 A;  1D4E A;  4IVM B;  4K8D A;  1GOS A;  2X8C A;  2YAU A;  4EM3 A;  5IQ1 A;  4U8M A;  2GV8 A;  2YR6 A;  3AYJ A;  4H4R A;  2OAM A;  1NEN A;  1N4V A;  3ICS A;  5JCI A;  3SZC A;  3VRA A;  4C77 A;  1TRB A;  2WPF A;  1O95 A;  4EMW A;  4U2S A;  5C2T A;  4C5O A;  1ZDL A;  2XFN A;  5EB5 A;  5HY5 A;  1PXB A;  3UTE A;  2WS3 A;  4O5Q A;  2R0P A;  3SQP A;  3AEE A;  1EL8 A;  4JDR A;  4Z43 A;  3DK9 A;  3NYF A;  1DOC A;  3V3O A;  1MOK A;  5KVI A;  2C4C A;  1GRG A;  4UDP A;  5EBK A;  4H50 A;  1RSG A;  3H4K A;  4CY8 A;  3GRS A;  1B8S A;  4I58 A;  4Y4N A;  5HHF A;  3NK1 X;  3VR9 A;  3AEB A;  4A6N B;  4DNA A;  2CDU A;  3CND A;  3UKK A;  1TDO A;  2R46 A;  2BCP A;  4C74 A;  2AAQ A;  1LQT A;  4CNK A;  3IHM A;  1GRT A;  5FMH A;  3SXI A;  1GES A;  5M10 A;  1GRF A;  1DOD A;  2RGH A;  2UZZ A;  2YVJ A;  2FJD A;  4JNA A;  4A5L A;  2YG4 A;  1S3E A;  4LA1 A;  1NHQ A;  2DKH A;  3NGC X;  3SGL A;  3B6D A;  2C3C A;  4BK1 A;  4CCQ A;  2C64 A;  4OPU A;  4JQ9 A;  4ZN0 A;  3ATR A;  4J56 A;  3ISH A;  3UP5 A;  2WEU A;  2VVL A;  1NPX A;  3NYC A;  3OZ2 A;  1GPE A;  1KNP A;  3O0H A;  1CC6 A;  3IWA A;  2V5Z A;  4TM1 A;  4RG4 A;  2VRL A;  1H81 A;  1K0J A;  2APG A;  3FMW A;  3UP4 A;  4AT0 A;  1DJN A;  2IVE A;  4HB9 A;  1NG3 A;  2BK3 A;  2BAC A;  4Z2U A;  4G9K A;  4OPT A;  4KX6 A;  2B7R A;  4A7A A;  1JRZ A;  2GR2 A;  2OLN A;  3CTY A;  2GB0 A;  1ONF A;  3UKH A;  5KOW A;  5U63 A;  2TPR A;  3C4A A;  5GRT A;  2E1M A;  3AWI A;  1IUW A;  1Z6L A;  2IID A;  2XDO A;  3HYV A;  1W4X A;  1GET A;  2E4G A;  3QVP A;  4UDR A;  5KOX A;  3ZYX A;  1E39 A;  1TDF A;  2PHH A;  3DJD A;  3ALM A;  1K0I A;  3FIM B;  1F8S A;  2GR1 A;  2GQW A;  1EBD A;  3H8L A;  3UTG A;  2Q0K A;  1F8W A;  3RP7 A;  2BK5 A;  2BS2 A;  3NIX A;  2BXS A;  2WP5 A;  2W0H A;  2XYO A;  5TR3 A;  2JK6 A;  3RED A;  2RAB A;  1GT8 A;  1JU2 A;  5LV9 A;  3AE6 A;  4NWZ A;  4Z44 A;  1PBE A;  5KMP A;  4U8P A;  5KVH A;  2CFY A;  2XLP A;  4WCT A;  2ZBW A;  3V76 A;  1ZMC A;  4X4J A;  2WPE A;  3SZ0 A;  3P4Q A;  1KF6 A;  4Z24 A;  4AP1 A;  2BK4 A;  2JBV A;  3NYE A;  4J57 A;  4BUR A;  3DA1 A;  3PO7 A;  1GTE A;  2FJB A;  5JCN A;  3NTD A;  4P9S A;  4YT0 A;  3UKL A;  1DXL A;  1N1P A;  5KMR A;  3NK2 X;  1HYU A;  4K22 A;  1SEZ A;  4EIP A;  4YSZ A;  4MJW A;  4GAP A;  3T31 A;  3NN0 X;  1D4C A;  1H7X A;  1O5W A;  3AE9 A;  3KLJ A;  3ATQ A;  1Q1R A;  3KVE A;  4U8I A;  4OPI A;  1JRX A;  4CNJ A;  2C67 A;  3C4N A;  3GSI A;  2C66 A;  1CHU A;  3NT6 A;  4X9M A;  1FCD A;  1L9E A;  1QJD A;  1X31 B;  5FS8 A;  2YM2 A;  3PS9 A;  4RSL A;  4Z25 A;  3ALJ A;  4TM4 A;  4D04 A;  3DK8 A;  2BRY A;  1PDH A;  3B3R A;  3AD8 B;  4EQS A;  1KFY A;  1KNR A;  1IUX A;  3AE1 A;  1XDI A;  3CPJ G;  5U25 A;  3FBS A;  4BK3 A;  4Z2R A;  1PHH A;  3AE2 A;  5FS6 A;  2GF3 A;  5EB4 A;  3VRD B;  2BC1 A;  2QA1 A;  2EQ8 A;  3CMM A;  1M6I A;  4J31 A;  2C70 A;  1GAL A;  4REK A;  3D1C A;  4J33 A;  1GSN A;  4B63 A;  4BJZ A;  1EL7 A;  2VQ7 A;  1JOA A;  4B66 A;  1CJ3 A;  1GTH A;  4G74 A;  2YLZ A;  3BNU A;  3CGD A;  1V59 A;  3SZF A;  5KRQ A;  2V61 A;  4KPR A;  1Y56 B;  1VG9 A;  3E1T A;  5CQF A;  4BV6 A;  1E7P A;  1GRA A;  1GRB A;  2WBA A;  3P4R A;  3AED A;  3CNJ A;  1VRQ B;  1Q9I A;  2V3A A;  3F8D A;  2B76 A;  2HQM A;  4TM0 A;  3Q9T A;  2GAH B;  1IUV A;  5J7X A;  4H2N A;  4K5S A;  1QLB A;  4H4P A;  2WQY A;  2WP6 A;  3SFE A;  4IV9 A;  1CF3 A;  1IUS A;  3G5R A;  4GF7 A;  4JNQ A;  4LII A;  3GYX A;  1H86 A;  2GAG B;  2X99 A;  4YTM A;  3K7T A;  4CY6 A;  1CJC A;  1N4U A;  1OJD A;  2RGO A;  2ZZB A;  3S61 A;  4B1B A;  3Q6J A;  4ECH A;  1ZP0 A;  4GR1 A;  3CPH G;  3M12 A;  3NNE A;  2B9X A;  2V3B A;  3II4 A;  3R9U A;  3QSM A;  1K4Q A;  4OPG A;  1BGJ A;  5BUK A;  4EQX A;  1NAA A;  2F5Z A;  3AE3 A;  3UKA A; 
#chains in the Genus database with same CATH homology
 4H2P A;  2CVJ A;  4FK1 C;  5JCM A;  4BK2 A;  2XFP A;  2WP9 A;  1Y0P A;  1PJ7 A;  1PS9 A;  2GMJ A;  4BJY A;  5FS7 A;  3CNT A;  1YQ4 A;  3DGH A;  3QFB A;  4H4W A;  3BHK A;  3I3L A;  2XLT A;  3GDN A;  2X8H A;  2JAE A;  1JRY A;  2XVF A;  3RNM A;  3KKJ A;  2R4J A;  1GEU A;  1RYI A;  3T2Y A;  2X3N A;  1CC2 A;  2BXR A;  2ZZ0 A;  3AE7 A;  2Y6Q A;  2WDV A;  3LZX A;  4EM4 A;  1NDA A;  2YR4 A;  2ZZC A;  1YQZ A;  4JN9 A;  2J3N A;  3UKP A;  3M13 A;  1PJ6 A;  4H4Y A;  4AOS A;  4C3Y A;  3ICT A;  1YKJ A;  1KDG A;  1OJT A;  1Y56 A;  1PN0 A;  3IHG A;  4Y4L A;  5BVA A;  3CPI G;  3ALL A;  4U8L A;  2WU5 A;  1EL9 A;  1OJA A;  2GR3 A;  3AEF A;  4USR A;  2YG3 A;  4U8O A;  4U8J A;  1ZY8 A;  2JKC A;  2WOW A;  1OJ9 A;  2E5V A;  2Q6U A;  3LJP A;  4ICY A;  3VQR A;  3UOX A;  2A89 A;  3NK0 X;  4YSY A;  3DJE A;  3NLC A;  3KU9 A;  5DBJ A;  3CNP A;  1TYT A;  2B9W A;  5EOW A;  2WHD A;  3VRB A;  2EQ7 A;  2YVG A;  2H89 A;  3CN8 A;  1NHS A;  4J2W A;  2AQJ A;  2R45 A;  3DGZ A;  4H7U A;  1GV4 A;  4II2 A;  2Q0L A;  1LQU A;  3AEA A;  4A9W A;  4C3X A;  3GYI A;  2YR5 A;  2CUL A;  3KA7 A;  5HYM A;  2Y6R A;  2VVL G;  3BNM A;  4G6G A;  2YG6 A;  1RP0 A;  2EQ9 A;  1D7Y A;  2WU2 A;  3GMC A;  4IVO B;  2IVD A;  4TLX A;  1D4D A;  3KPF A;  3CGC A;  1BKW A;  1AOG A;  1IUU A;  1REO A;  1PXA A;  3IF9 A;  5IPY A;  5KXJ A;  4U8N A;  3LXD A;  3UOY A;  2GEW A;  1DJQ A;  3GDP A;  1FL2 A;  1CJ4 A;  4YSH A;  1COY A;  3AEG A;  4YXD A;  4YKF A;  4A65 A;  3CGE A;  4PAB A;  1FOH A;  5JCK A;  1CJ2 A;  3DH9 A;  2GR0 A;  2VZ2 A;  3H8I A;  5IQ4 A;  2GH5 A;  1S2Y A;  2QA2 A;  3BHF A;  3F8R A;  4J36 A;  2C3D A;  4YTN A;  3LOV A;  4OVI A;  2BRA A;  2RGJ A;  4GDE A;  1VDC A;  3ZDN A;  4G6H A;  1F3P A;  4AP3 A;  1JEH A;  3GD3 A;  1CBO A;  5C3J A;  1D7L A;  2YG5 A;  1PXC A;  4U8K A;  1K0L A;  2DKI A;  2V60 A;  1H84 A;  2WET A;  3AXB A;  1L9D A;  3RHA A;  3S5W A;  2XFO A;  2FJA A;  1E6E A;  2R0C A;  3BI2 A;  3GD4 A;  3QSS A;  3NHO X;  4NZH A;  3KPK A;  2R0G A;  1BZL A;  3LAD A;  2VQB A;  1ZOY A;  4Y4M A;  1FEA A;  2Q7V A;  4OPD A;  3BI4 A;  4D03 A;  5BRT A;  1TDE A;  3P9U A;  4A79 A;  1MXT A;  3EAO A;  1PJ5 A;  2WPC A;  2O9Z A;  2XLR A;  2XCG A;  1CL0 A;  4GAV A;  2JB2 A;  2X50 A;  2B7S A;  4NTE A;  4OPL A;  2R4E A;  3C96 A;  2XVH A;  4H4U A;  2OAL A;  3T2K A;  2GVC A;  1M64 A;  3SX6 A;  2XVE A;  3I6D A;  4WX1 A;  4O5U A;  2BAB A;  2I0Z A;  3AB1 A;  2OLO A;  3HZL A;  5M0Z A;  3EF6 A;  4RG3 A;  3SY4 A;  3QJ4 A;  3V3N A;  1NHR A;  3NG7 X;  4NTC A;  1B4V A;  4G73 A;  3ABV A;  3NRN A;  4NEV A;  1ELI A;  3EAN A;  2YWL A;  4H2R A;  2QCU A;  3RP8 A;  2XLS A;  2XVJ A;  1E1N A;  1L0V A;  4A99 A;  1EL5 A;  3NH3 X;  4K7Z A;  1BWC A;  3GWF A;  4NNJ A;  1UKV G;  2XVI A;  3P4P A;  4UDQ A;  1TYP A;  2WDR A;  3EPT A;  5KMQ A;  2YQU A;  5HXI A;  3AE8 A;  4APN A;  4DGK A;  3G5Q A;  4OCG A;  2JB1 A;  2OA1 A;  3K7Q X;  3DME A;  3UOZ A;  2BC0 A;  4B65 A;  4U2L A;  3T0K A;  3AYL A;  3M0O A;  5L46 A;  1FEB A;  2BS3 A;  5KNL A;  4XWZ A;  3NKS A;  4A6N A;  1DOE A;  2Z5X A;  1FEC A;  3FG2 P;  3KD9 A;  3IC9 A;  3BI5 A;  2C7G A;  2YVF A;  4XXG A;  4GDP A;  3UKQ A;  2NPX A;  4N9X A;  1PBF A;  1XPQ A;  5KWF A;  2NVK X;  4GUV A;  4TM3 A;  5KMS A;  4EMJ A;  2VVM A;  1N4W A;  2GQF A;  2GMH A;  4PAA A;  1NG4 A;  4ADW A;  2C73 A;  2A87 A;  4TLZ A;  1GRH A;  4H4Q A;  3DJG X;  3DK4 A;  4AOX A;  1F6M A;  2WOV A;  1XAN A;  4EQR A;  2A8X A;  1LVL A;  1VQW A;  1D5T A;  2WES A;  2WOI A;  3LB8 A;  4UP3 A;  1NHP A;  1LPF A;  4E0V A;  1KSS A;  1BF3 A;  4YWO A;  1H82 A;  1XHC A;  3UOV A;  4CCR A;  4YSX A;  2R9Z A;  2FBW A;  3DJJ A;  4K5R A;  4X9N A;  1GND A;  2JB3 A;  3UCL A;  1L9C A;  3K30 A;  4EQW A;  1LV0 A;  1PBC A;  2BA9 A;  3RP6 A;  2WDQ A;  1GXF A;  3ITJ A;  2BCG G;  2B9Y A;  4B68 A;  1H6V A;  1DOB A;  2C65 A;  2YM1 A;  1P2E A;  3CIR A;  2ACZ A;  4GCM A;  4H4X A;  1YQ3 A;  4HA6 A;  3L8K A;  4IA5 A;  4AT2 A;  1VG0 A;  1B5Q A;  4J34 A;  4ZCD A;  3CNS A;  1O94 A;  3F8P A;  3P1W A;  3SZW A;  1GRE A;  2XFQ A;  2XFU A;  4GRT A;  4YKG A;  3OC4 A;  2BYB A;  4U2T A;  1E1M A;  3QVR A;  1BGN A;  1KSU A;  3AE4 A;  5FS9 A;  2BS4 A;  1H83 A;  2PYX A;  3AD7 B;  2YLT A;  3UTH A;  3URH A;  3GMB A;  4DSG A;  3T2Z A;  1ZMD A;  2X8G A;  5JCL A;  1LJ1 A;  3K7M X;  5GSN A;  2Z5Y A;  1ZX9 A;  4I59 A;  2YLW A;  4H4V A;  3UTF A;  1P2H A;  1QO8 A;  4H4Z A;  3SFD A;  2GRT A;  1DNC A;  2C72 A;  1PBD A;  3COX A;  4CBQ A;  3CGB A;  3LZW A;  1NEK A;  4FX9 A;  4LU6 A;  3VR8 A;  3GYJ A;  3WE0 A;  1TDK A;  1MO9 A;  3FPZ A;  4K2X A;  5U1O A;  3SM8 A;  4B69 A;  2VRM A;  1JNR A;  3QFA A;  4B67 A;  2H88 A;  1ZOV A;  1CC4 A;  3T37 A;  1LTX R;  4H2Q A;  4FDC B;  4DSH A;  1H7W A;  1YY5 A;  3AEC A;  3AYI A;  3GRT A;  2YLS A;  2QAE A;  4B64 A;  4Z26 A;  5BUL A;  1IUT A;  1S2Q A;  4II3 A;  4NTD A;  4OPC A;  3ICR A;  5J60 A;  2VOU A;  1E1K A;  3JSK A;  3SYI A;  2EQ6 A;  1Q1W A;  3L1R A;  1TDN A;  2ARD A;  4H4S A;  1ZK7 A;  4YTP A;  4CRT A;  3NTA A;  2YG7 A;  4XWR A;  1F8R A;  3HYW A;  2AR8 A;  2C76 A;  3AE5 A;  1JNZ A;  2YLR A;  2YLX A;  3D8X A;  4FK1 A;  3UKF A;  2XLU A;  1PBB A;  3HYX A;  3P4S A;  4USQ A;  1ZKQ A;  5CKU A;  4JY3 A;  4ZCC A;  1E1L A;  3NN6 X;  1OJC A;  2C75 A;  2TMD A;  3QSE A;  4M52 A;  1GER A;  3PVC A;  3ADA B;  3G5S A;  4Z2T A;  1S3B A;  3T14 A;  4EIQ A;  3GWD A;  4IA6 A;  4EMI A;  4H4T A;  3AD9 B;  4NEW A;  1B37 A;  1IJH A;  2FJE A;  2V6O A;  5ER0 A;  4JY2 A;  1D4E A;  4IVM B;  4K8D A;  1GOS A;  2X8C A;  2YAU A;  4EM3 A;  5IQ1 A;  4U8M A;  2GV8 A;  2YR6 A;  3AYJ A;  4H4R A;  2OAM A;  1NEN A;  1N4V A;  3ICS A;  5JCI A;  3SZC A;  3VRA A;  4C77 A;  1TRB A;  2WPF A;  1O95 A;  4EMW A;  4U2S A;  5C2T A;  4C5O A;  1ZDL A;  2XFN A;  5EB5 A;  5HY5 A;  1PXB A;  3UTE A;  2WS3 A;  4O5Q A;  2R0P A;  3SQP A;  3AEE A;  1EL8 A;  4JDR A;  4Z43 A;  3DK9 A;  3NYF A;  1DOC A;  3V3O A;  1MOK A;  5KVI A;  2C4C A;  1GRG A;  4UDP A;  5EBK A;  4H50 A;  1RSG A;  3H4K A;  4CY8 A;  3GRS A;  1B8S A;  4I58 A;  4Y4N A;  5HHF A;  3NK1 X;  3VR9 A;  3AEB A;  4A6N B;  4DNA A;  2CDU A;  3CND A;  3UKK A;  1TDO A;  2R46 A;  2BCP A;  4C74 A;  2AAQ A;  1LQT A;  4CNK A;  3IHM A;  1GRT A;  5FMH A;  3SXI A;  1GES A;  5M10 A;  1GRF A;  1DOD A;  2RGH A;  2UZZ A;  2YVJ A;  2FJD A;  4JNA A;  4A5L A;  2YG4 A;  1S3E A;  4LA1 A;  1NHQ A;  2DKH A;  3NGC X;  3SGL A;  3B6D A;  2C3C A;  4BK1 A;  4CCQ A;  2C64 A;  4OPU A;  4JQ9 A;  4ZN0 A;  3ATR A;  4J56 A;  3ISH A;  3UP5 A;  2WEU A;  2VVL A;  1NPX A;  3NYC A;  3OZ2 A;  1GPE A;  1KNP A;  3O0H A;  1CC6 A;  3IWA A;  2V5Z A;  4TM1 A;  4RG4 A;  2VRL A;  1H81 A;  1K0J A;  2APG A;  3FMW A;  3UP4 A;  4AT0 A;  1DJN A;  2IVE A;  4HB9 A;  1NG3 A;  2BK3 A;  2BAC A;  4Z2U A;  4G9K A;  4OPT A;  4KX6 A;  2B7R A;  4A7A A;  1JRZ A;  2GR2 A;  2OLN A;  3CTY A;  2GB0 A;  1ONF A;  3UKH A;  5KOW A;  5U63 A;  2TPR A;  3C4A A;  5GRT A;  2E1M A;  3AWI A;  1IUW A;  1Z6L A;  2IID A;  2XDO A;  3HYV A;  1W4X A;  1GET A;  2E4G A;  3QVP A;  4UDR A;  5KOX A;  3ZYX A;  1E39 A;  1TDF A;  2PHH A;  3DJD A;  3ALM A;  1K0I A;  3FIM B;  1F8S A;  2GR1 A;  2GQW A;  1EBD A;  3H8L A;  3UTG A;  2Q0K A;  1F8W A;  3RP7 A;  2BK5 A;  2BS2 A;  3NIX A;  2BXS A;  2WP5 A;  2W0H A;  2XYO A;  5TR3 A;  2JK6 A;  3RED A;  2RAB A;  1GT8 A;  1JU2 A;  5LV9 A;  3AE6 A;  4NWZ A;  4Z44 A;  1PBE A;  5KMP A;  4U8P A;  5KVH A;  2CFY A;  2XLP A;  4WCT A;  2ZBW A;  3V76 A;  1ZMC A;  4X4J A;  2WPE A;  3SZ0 A;  3P4Q A;  1KF6 A;  4Z24 A;  4AP1 A;  2BK4 A;  2JBV A;  3NYE A;  4J57 A;  4BUR A;  3DA1 A;  3PO7 A;  1GTE A;  2FJB A;  5JCN A;  3NTD A;  4P9S A;  4YT0 A;  3UKL A;  1DXL A;  1N1P A;  5KMR A;  3NK2 X;  1HYU A;  4K22 A;  1SEZ A;  4EIP A;  4YSZ A;  4MJW A;  4GAP A;  3T31 A;  3NN0 X;  1D4C A;  1H7X A;  1O5W A;  3AE9 A;  3KLJ A;  3ATQ A;  1Q1R A;  3KVE A;  4U8I A;  4OPI A;  1JRX A;  4CNJ A;  2C67 A;  3C4N A;  3GSI A;  2C66 A;  1CHU A;  3NT6 A;  4X9M A;  1FCD A;  1L9E A;  1QJD A;  1X31 B;  5FS8 A;  2YM2 A;  3PS9 A;  4RSL A;  4Z25 A;  3ALJ A;  4TM4 A;  4D04 A;  3DK8 A;  2BRY A;  1PDH A;  3B3R A;  3AD8 B;  4EQS A;  1KFY A;  1KNR A;  1IUX A;  3AE1 A;  1XDI A;  3CPJ G;  5U25 A;  3FBS A;  4BK3 A;  4Z2R A;  1PHH A;  3AE2 A;  5FS6 A;  2GF3 A;  5EB4 A;  3VRD B;  2BC1 A;  2QA1 A;  2EQ8 A;  3CMM A;  1M6I A;  4J31 A;  2C70 A;  1GAL A;  4REK A;  3D1C A;  4J33 A;  1GSN A;  4B63 A;  4BJZ A;  1EL7 A;  2VQ7 A;  1JOA A;  4B66 A;  1CJ3 A;  1GTH A;  4G74 A;  2YLZ A;  3BNU A;  3CGD A;  1V59 A;  3SZF A;  5KRQ A;  2V61 A;  4KPR A;  1Y56 B;  1VG9 A;  3E1T A;  5CQF A;  4BV6 A;  1E7P A;  1GRA A;  1GRB A;  2WBA A;  3P4R A;  3AED A;  3CNJ A;  1VRQ B;  1Q9I A;  2V3A A;  3F8D A;  2B76 A;  2HQM A;  4TM0 A;  3Q9T A;  2GAH B;  1IUV A;  5J7X A;  4H2N A;  4K5S A;  1QLB A;  4H4P A;  2WQY A;  2WP6 A;  3SFE A;  4IV9 A;  1CF3 A;  1IUS A;  3G5R A;  4GF7 A;  4JNQ A;  4LII A;  3GYX A;  1H86 A;  2GAG B;  2X99 A;  4YTM A;  3K7T A;  4CY6 A;  1CJC A;  1N4U A;  1OJD A;  2RGO A;  2ZZB A;  3S61 A;  4B1B A;  3Q6J A;  4ECH A;  1ZP0 A;  4GR1 A;  3CPH G;  3M12 A;  3NNE A;  2B9X A;  2V3B A;  3II4 A;  3R9U A;  3QSM A;  1K4Q A;  4OPG A;  1BGJ A;  5BUK A;  4EQX A;  1NAA A;  2F5Z A;  3AE3 A;  3UKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...