3UP5A

Crystal structure of otemo complex with fad and nadp (form 4)
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
540
structure length
537
Chain Sequence
b'KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 188
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3up5A01
1OJ9A 4Z24A 4BK1A 4UDPA 2WQYA 3DJDA 1GNDA 3FBSA 3UKQA 5JCNA 1NHQA 1SEZA 1ZOVA 3AE5A 2VRMA 3UOYA 1TDKA 1LV0A 2DKIA 2V60A 2WU5A 2YAUA 1TRBA 2GVCA 2YLTA 3UTHA 2XLUA 4ZCDA 3FIMB 3M12A 2C67A 1ZDLA 2R0GA 4YSHA 3OC4A 3ICSA 4K22A 2TPRA 1GRTA 4DGKA 2YQUA 4C5OA 5KXJA 2X50A 2YLZA 1GRBA 3C96A 4X9MA 1Q1WA 2GQWA 2OLNA 1IUVA 4J34A 4EQXA 1TDFA 4UDQA 4Z26A 2WDQA 2YG5A 2EQ6A 5HXIA 3EF6A 3FPZA 3KD9A 5FS6A 4H4QA 3F8PA 1NG4A 4H50A 4K7ZA 4CBQA 4YTNA 4EMJA 1XANA 2GR2A 2XFUA 3ATRA 4H4PA 3PO7A 1GRAA 2JKCA 3ICTA 3F8RA 4K5SA 5JCMA 2WPFA 1P2EA 2XLSA 1D4EA 3KVEA 3NK0X 4A7AA 3WE0A 3CNDA 2J3NA 2OLOA 4A5LA 4Z2UA 2VQBA 2YVFA 4B66A 5EB5A 1BGNA 1H86A 4H4YA 2Q0LA 3RHAA 1K0IA 1H81A 2GAHB 2YLXA 4H4UA 4YKFA 1Y56B 2Z5XA 3RP7A 1PJ7A 2C76A 2YG6A 3AEDA 3C4AA 4B65A 2GR3A 4Y4NA 1PBBA 2WU2A 3DH9A 2EQ9A 3BNMA 2XVJA 3LJPA 1NPXA 3NN6X 2YR4A 1K0LA 2XFNA 3JSKA 3P4SA 5EB4A 4A79A 4C3YA 4DSGA 4J2WA 1Y0PA 3AB1A 3DK4A 5IQ4A 4YWOA 3NT6A 1S2QA 3ALJA 3AE1A 3BI2A 5JCIA 2QA1A 1JOAA 2CVJA 3NLCA 3SQPA 3DMEA 4C77A 3H8IA 1B5QA 4YTPA 4U8PA 5U1OA 1S3EA 4BK3A 3CPJG 3ATQA 4H2RA 1GETA 4U8KA 3BHFA 2ARDA 5M0ZA 3VR9A 4U8OA 2WEUA 4ADWA 1VQWA 2YG3A 1AOGA 1Y56A 5JCLA 3QVRA 2V3AA 1HYUA 2BK5A 4FK1C 1E1NA 3AE3A 3UTGA 3UKPA 2BK4A 1F8WA 2UZZA 1IUTA 1E1LA 4KPRA 1PBDA 3LXDA 4NTEA 3UKHA 3UP4A 5FS9A 4GCMA 4YTMA 2XCGA 5HY5A 3VQRA 4C74A 1IUSA 1L0VA 1GT8A 4ECHA 3DGZA 2ZZBA 1OJDA 1XHCA 4JNQA 4LIIA 3AE2A 1DJQA 2H89A 2X99A 2TMDA 4HB9A 1PS9A 1S2YA 1F8RA 1XDIA 4ICYA 3UP5A 2WOVA 3QFBA 2WBAA 1TYTA 1PXCA 4Z2RA 1D7YA 3KA7A 1F6MA 4JY2A 1XPQA 2XFQA 3COXA 5KWFA 1EL8A 4I59A 2XVFA 2ZBWA 1TDNA 1ZX9A 2WS3A 1CJCA 2ZZ0A 5KVHA 1RSGA 4U2SA 3GMBA 2EQ8A 3AEGA 3NK1X 1OJTA 3GYIA 1CJ4A 2FBWA 5IQ1A 5BULA 3AEFA 3VRBA 4TM1A 2H88A 3D1CA 5KRQA 2VVLA 2EQ7A 1Q9IA 3ADAB 5L46A 3AE6A 3GWFA 4H4ZA 3DJGX 2PYXA 1BKWA 4BURA 2WPCA 4HA6A 5TR3A 4EQRA 3M0OA 3DK8A 4YKGA 4U8JA 3BI4A 2WETA 3I3LA 2XLTA 2B9WA 5DBJA 1KF6A 1ZP0A 2X8HA 2JK6A 2QCUA 3CGDA 1NENA 1EL7A 2IIDA 4M52A 1KNRA 2FJEA 3CGBA 1PBCA 3I6DA 3GD4A 3OZ2A 3DK9A 4EMIA 4JNAA 4H4WA 3SFEA 2C65A 4B63A 4U2TA 3RP6A 1JU2A 4GUVA 1GXFA 1ELIA 1JRXA 1YY5A 2VRLA 3SFDA 4RG3A 2VVMA 3Q9TA 3ALLA 3P4RA 3PVCA 4K5RA 2BXRA 1ZOYA 1NHRA 2BK3A 3KKJA 2BXSA 4A9WA 5J7XA 3P1WA 3LOVA 4U8NA 3AYIA 1IJHA 1E6EA 1NAAA 4K2XA 2BS4A 4IA6A 4XWRA 3GDPA 4I58A 5KVIA 1L9EA 2BYBA 5KOWA 5BUKA 4K8DA 3SGLA 2A87A 3G5RA 2B76A 4J33A 2E5VA 1GV4A 3AECA 2WHDA 3H8LA 2YLWA 1CJ3A 3NK2X 4AT2A 3HZLA 3IHMA 1VG0A 1E7PA 4GR1A 1GOSA 4YSYA 4N9XA 3L1RA 2Z5YA 2RGJA 4FDCB 4IV9A 3S5WA 1JRZA 2BS3A 2FJDA 2Q6UA 3GD3A 1N4UA 1GERA 4BK2A 2ACZA 1GTEA 3QFAA 1BZLA 1ONFA 4TM4A 2C70A 1QO8A 4OPUA 1NHPA 3ABVA 2X3NA 3ISHA 1MXTA 4GDPA 3UOZA 1O94A 2YG7A 4H4XA 2R4JA 4PABA 4C3XA 1YQ4A 3T37A 4DNAA 1RP0A 1D4CA 3NYCA 1L9CA 4LU6A 4CY6A 4GDEA 1NG3A 4EIQA 1UKVG 2GR1A 1ZK7A 1O95A 3NN0X 1TDOA 2GEWA 3ZYXA 1DJNA 1PBFA 1CL0A 1BWCA 3AE8A 2NPXA 3H4KA 4BJZA 2F5ZA 3NTDA 1BGJA 3B3RA 2YWLA 2GV8A 4H2QA 3NH3X 4TLXA 3FG2P 4USQA 3V76A 4YT0A 1H6VA 1N4WA 2BC0A 1W4XA 3LZXA 3Q6JA 2OA1A 5EOWA 3AD9B 1JNZA 2YVGA 2V3BA 1FEAA 3NYFA 3S61A 4AP3A 3KLJA 1LPFA 2WPEA 3AWIA 4APNA 2Q7VA 3CIRA 3NHOX 3NG7X 4XWZA 3D8XA 4H4SA 4CNKA 2FJAA 4JN9A 2I0ZA 4D03A 2A8XA 2CULA 2Y6RA 4D04A 1VRQB 3P9UA 4ZCCA 2GR0A 2BC1A 2W0HA 4OPGA 1H83A 2CDUA 4Z44A 5KOXA 2R46A 4WCTA 2RGHA 3BI5A 2XLPA 3IC9A 5LV9A 3QSMA 2YM1A 4J57A 2O9ZA 4X9NA 2JB1A 2R0PA 1COYA 1K4QA 3AE4A 2B9YA 4WX1A 1H7XA 2C73A 2NVKX 4YSXA 3SM8A 2FJBA 4UP3A 2GAGB 2C66A 4U2LA 3AE7A 3VRDB 5EBKA 3CN8A 3UTFA 2XFOA 4J56A 1PJ5A 2CFYA 1KNPA 4H2NA 4NTDA 4OPLA 1VDCA 3AEBA 1PBEA 4A65A 3EAOA 1YKJA 4GF7A 1FEBA 1B8SA 1E1MA 2WESA 5GRTA 1OJAA 2QA2A 1F3PA 2VQ7A 2YVJA 4E0VA 2YR5A 2Y6QA 4EQSA 1NEKA 2A89A 1K0JA 1OJCA 3QVPA 3GRTA 1GRGA 1B4VA 1IUWA 1YQZA 3AXBA 1ZMDA 4MJWA 2QAEA 2HQMA 1PXBA 3G5QA 4RG4A 4TM0A 5CQFA 2WP9A 1CC6A 3FMWA 3BNUA 1GALA 3CTYA 1D4DA 1LVLA 3NIXA 2V61A 4CRTA 4REKA 4AP1A 3PS9A 2B7SA 1N4VA 3IF9A 3BHKA 3F8DA 3K7TA 4OCGA 1MO9A 1FCDA 1PHHA 4PAAA 3UKFA 1E1KA 2GRTA 4OPDA 1H7WA 2PHHA 3V3OA 3G5SA 1DOCA 2AAQA 3CNSA 4U8LA 5U63A 2WP5A 5FS8A 4H4VA 5BRTA 1EBDA 1EL5A 4YSZA 1V59A 5FS7A 2BA9A 4CCRA 1CBOA 4O5QA 1RYIA 2WOIA 2C3CA 4Y4MA 2YLRA 3K7QX 5U25A 2GH5A 1EL9A 2VVLG 1P2HA 2YR6A 2YG4A 2OAMA 3II4A 2E4GA 3K7MX 2C3DA 1CC2A 3P4QA 1BF3A 2Q0KA 3CGEA 5HHFA 1REOA 4B69A 2X8CA 4YXDA 3NNEA 3QSSA 2JBVA 2E1MA 1KFYA 2APGA 1GREA 3ITJA 3UKLA 1M6IA 3AYJA 3ZDNA 2XYOA 1H84A 3AE9A 1GPEA 4IA5A 3DJJA 2WDRA 4O5UA 1L9DA 2R9ZA 4OPCA 4BJYA 1KDGA 2GQFA 3UKKA 2GMJA 3NGCX 2JB2A 4CCQA 3AYLA 4USRA 1H82A 1GRHA 1GRFA 4Z43A 3LZWA 4KX6A 4EQWA 2C7GA 1Q1RA 3B6DA 4RSLA 1PDHA 4J31A 1FECA 4H4RA 2IVEA 4IVOB 2B7RA 2R0CA 1FOHA 4Y4LA 5CKUA 4B1BA 1D5TA 3CNPA 1ZMCA 3C4NA 1LTXR 4JQ9A 2C64A 4H7UA 3DGHA 3ALMA 2OALA 5JCKA 4B64A 1N1PA 4BV6A 3L8KA 1DOEA 2BACA 4A99A 3NTAA 4FX9A 2C72A 2XDOA 1MOKA 2WDVA 3QSEA 2JB3A 1DNCA 4JDRA 3DJEA 2B9XA 3CNJA 2GMHA 1CF3A 5C3JA 2BCPA 4X4JA 3UKAA 2XVEA 1QJDA 2V6OA 4NEWA 4U8IA 3E1TA 3KU9A 1GEUA 3LADA 1QLBA 3GYJA 1O5WA 4NZHA 4NTCA 3V3NA 3VR8A 1D7LA 3CGCA 2BS2A 1IUUA 3URHA 4UDRA 5J60A 5M10A 3RNMA 1Z6LA 1F8SA 3NYEA 3IHGA 2YM2A 2AR8A 3GRSA 4GRTA 2R4EA 4OPTA 1E39A 2C75A 3AEEA 1PN0A 1ZKQA 4EM4A 2RABA 2XVIA 2VOUA 4FK1A 3REDA 3LB8A 1KSSA 2XFPA 3KPFA 4OVIA 3EANA 4JY3A 3DA1A 4AT0A 4Z2TA 3UOVA 4NEVA 2WOWA 1JRYA 3NKSA 2GB0A 5HYMA 5GSNA 2VZ2A 4TLZA 1JNRA 3O0HA 3CPHG 3UCLA 4OPIA 1FL2A 1S3BA 2GF3A 3QJ4A 2V5ZA 4B67A 2XVHA 3NRNA 4A6NB 4P9SA 5FMHA 1JEHA 1DODA 1DOBA 4EM3A 1NHSA 5IPYA 1GESA 1YQ3A 4AOXA 1GSNA 4EIPA 1CC4A 4U8MA 3VRAA 5BVAA 1VG9A 3UOXA 1PJ6A 4J36A 2BCGG 3AD8B 3GDNA 2JAEA 1DXLA 4DSHA 3CNTA 5C2TA 4Z25A 3AD7B 1CHUA 1GTHA 3UTEA 2XLRA 1B37A 1TDEA 1TYPA 1ZY8A 2WP6A 4H4TA 4LA1A 4EMWA 2ZZCA 3IWAA 4AOSA 2AQJA 3R9UA 1NDAA 3AEAA 3EPTA 1LJ1A 1X31B 1IUXA 2BABA 2R45A 3K30A 3P4PA 4ZN0A 2X8GA 2RGOA 4TM3A 2YLSA 2IVDA 3RP8A 4B68A 1M64A 3GSIA 1KSUA 3ICRA 4H2PA 1CJ2A 3CPIG 4IVMB 4XXGA 3GMCA 4CY8A 2DKHA 3M13A 1PXAA 5ER0A 3GWDA 4CNJA 4A6NA 1LQTA 1LQUA
chains in the Genus database with same CATH superfamily
1OJ9A 4Z24A 5KNLA 4BK1A 4UDPA 2WQYA 3DJDA 1GNDA 3FBSA 3UKQA 3SYIA 5JCNA 1NHQA 1SEZA 1ZOVA 3AE5A 2VRMA 3UOYA 1TDKA 1LV0A 2DKIA 2V60A 2WU5A 2YAUA 1TRBA 2GVCA 2YLTA 3UTHA 2XLUA 4ZCDA 3FIMB 3M12A 2C67A 1ZDLA 2R0GA 4YSHA 3OC4A 3ICSA 4K22A 2TPRA 1GRTA 4DGKA 2YQUA 4C5OA 5KXJA 2X50A 2YLZA 1GRBA 3C96A 4X9MA 1Q1WA 2GQWA 2OLNA 1IUVA 4J34A 4EQXA 1TDFA 4UDQA 4Z26A 2WDQA 2YG5A 2EQ6A 5HXIA 3EF6A 3FPZA 3KD9A 5FS6A 4H4QA 3F8PA 1NG4A 4H50A 4K7ZA 4CBQA 4YTNA 4EMJA 1XANA 2GR2A 2XFUA 3ATRA 4H4PA 3PO7A 1GRAA 2JKCA 3ICTA 3F8RA 4K5SA 5JCMA 2WPFA 1P2EA 2XLSA 1D4EA 3KVEA 3NK0X 4A7AA 3WE0A 3CNDA 2J3NA 2OLOA 4A5LA 4Z2UA 2VQBA 2YVFA 4B66A 5EB5A 1BGNA 1H86A 4H4YA 2Q0LA 3RHAA 1K0IA 1H81A 2GAHB 2YLXA 4H4UA 4YKFA 1Y56B 2Z5XA 3RP7A 1PJ7A 2C76A 2YG6A 3AEDA 3C4AA 4B65A 2GR3A 4Y4NA 1PBBA 2WU2A 3DH9A 2EQ9A 3BNMA 2XVJA 3LJPA 1NPXA 3NN6X 2YR4A 1K0LA 2XFNA 3JSKA 3P4SA 5EB4A 4A79A 4C3YA 4DSGA 4J2WA 1Y0PA 3AB1A 3DK4A 5IQ4A 4YWOA 3NT6A 1S2QA 3ALJA 3AE1A 3BI2A 5JCIA 2QA1A 1JOAA 2CVJA 3NLCA 3SQPA 3DMEA 4C77A 3H8IA 1B5QA 4YTPA 4U8PA 5U1OA 1S3EA 4BK3A 3CPJG 3ATQA 4H2RA 1GETA 2C4CA 3BHFA 2ARDA 4U8KA 5KMRA 5M0ZA 3VR9A 4U8OA 2WEUA 4GAVA 1VQWA 2YG3A 3T0KA 4ADWA 1AOGA 1Y56A 5JCLA 3QVRA 2V3AA 1HYUA 2BK5A 4FK1C 1E1NA 3AE3A 3UTGA 3UKPA 2BK4A 1F8WA 2UZZA 1IUTA 1E1LA 4KPRA 1PBDA 3LXDA 4NTEA 3UKHA 3UP4A 5FS9A 4GCMA 4YTMA 2XCGA 5HY5A 3VQRA 4C74A 1IUSA 1L0VA 1GT8A 4ECHA 3DGZA 2ZZBA 1OJDA 1XHCA 4JNQA 4LIIA 3AE2A 1DJQA 2H89A 2X99A 2TMDA 4HB9A 1PS9A 1S2YA 1F8RA 1XDIA 4ICYA 3S5WA 3UP5A 2WOVA 3QFBA 2WBAA 1TYTA 1PXCA 4Z2RA 1D7YA 3KA7A 1F6MA 4JY2A 1XPQA 2XFQA 3COXA 3SZWA 5KWFA 1EL8A 4I59A 2BRAA 2XVFA 2ZBWA 1TDNA 1ZX9A 2WS3A 1CJCA 2ZZ0A 5KVHA 1RSGA 4U2SA 3GMBA 2EQ8A 3AEGA 3NK1X 1OJTA 3GYIA 1CJ4A 2FBWA 5IQ1A 5BULA 3AEFA 3VRBA 3SZCA 4TM1A 2H88A 3D1CA 5KRQA 2BRYA 2EQ7A 2VVLA 3HYWA 1Q9IA 3ADAB 5L46A 3AE6A 3GWFA 4H4ZA 3DJGX 2PYXA 1BKWA 4BURA 2WPCA 4HA6A 5TR3A 4EQRA 3M0OA 3DK8A 4YKGA 4U8JA 3BI4A 2WETA 3I3LA 2XLTA 2B9WA 5DBJA 1KF6A 1ZP0A 2X8HA 3SZ0A 2JK6A 2QCUA 3CGDA 1NENA 1EL7A 2IIDA 4M52A 1KNRA 2FJEA 3CGBA 1PBCA 3I6DA 3GD4A 3OZ2A 3DK9A 4EMIA 4JNAA 4H4WA 3SFEA 2C65A 4B63A 4NNJA 4U2TA 3RP6A 1JU2A 4GUVA 1GXFA 1ELIA 1JRXA 1YY5A 2VRLA 3SFDA 4RG3A 2VVMA 3Q9TA 3ALLA 3P4RA 3PVCA 4K5RA 2BXRA 1ZOYA 1NHRA 4NWZA 2BK3A 3KKJA 2BXSA 4A9WA 5J7XA 3P1WA 3T14A 3LOVA 4U8NA 3AYIA 1IJHA 1E6EA 1NAAA 4K2XA 2BS4A 4IA6A 4XWRA 3GDPA 4I58A 5KVIA 1L9EA 2BYBA 5KOWA 5BUKA 4K8DA 3SGLA 5KMPA 2A87A 3G5RA 2B76A 4J33A 2E5VA 1GV4A 3AECA 2WHDA 3H8LA 2YLWA 1CJ3A 3NK2X 4AT2A 3HZLA 3IHMA 1VG0A 1E7PA 4GR1A 1GOSA 4YSYA 4G6HA 3L1RA 2Z5YA 2RGJA 4FDCB 4IV9A 4N9XA 1JRZA 2BS3A 2FJDA 2Q6UA 3GD3A 1N4UA 1GERA 4BK2A 2ACZA 1GTEA 3QFAA 1BZLA 1ONFA 4TM4A 3T2ZA 2C70A 1QO8A 4OPUA 1NHPA 3ABVA 2X3NA 3ISHA 1MXTA 4G73A 4GDPA 3UOZA 1O94A 2YG7A 4H4XA 2R4JA 4G6GA 4PABA 1YQ4A 3T37A 4C3XA 4DNAA 1RP0A 3HYVA 1D4CA 3NYCA 1L9CA 3HYXA 4LU6A 4CY6A 4GDEA 1NG3A 3T2KA 4EIQA 1UKVG 2GR1A 1ZK7A 1O95A 3NN0X 1TDOA 2GEWA 3ZYXA 1DJNA 1PBFA 1CL0A 1BWCA 3AE8A 3SZFA 2NPXA 3H4KA 4BJZA 2F5ZA 3NTDA 1BGJA 3B3RA 2YWLA 3KPKA 2GV8A 4H2QA 3NH3X 4TLXA 3FG2P 4USQA 3V76A 4YT0A 1H6VA 1N4WA 2BC0A 1W4XA 3LZXA 3Q6JA 2OA1A 5EOWA 3AD9B 1JNZA 2YVGA 2V3BA 1FEAA 3NYFA 4GAPA 3S61A 4AP3A 3KLJA 1LPFA 2WPEA 3AWIA 4APNA 2Q7VA 3CIRA 3NHOX 3NG7X 4XWZA 3D8XA 4H4SA 4CNKA 2FJAA 4JN9A 2I0ZA 4D03A 2A8XA 2CULA 2Y6RA 4D04A 1VRQB 3P9UA 4ZCCA 2GR0A 2BC1A 2W0HA 4OPGA 1H83A 2CDUA 4Z44A 5KOXA 2R46A 4WCTA 2RGHA 3BI5A 2XLPA 3CMMA 3IC9A 5LV9A 3QSMA 2YM1A 4J57A 2O9ZA 4X9NA 2JB1A 2R0PA 1COYA 1K4QA 3AE4A 2B9YA 4WX1A 1H7XA 2C73A 2NVKX 4YSXA 3SM8A 2FJBA 4UP3A 2GAGB 2C66A 4U2LA 3AE7A 3VRDB 5EBKA 3CN8A 3UTFA 2XFOA 4J56A 1PJ5A 2CFYA 1KNPA 4H2NA 4NTDA 4OPLA 1VDCA 3AEBA 1PBEA 4A65A 3EAOA 1YKJA 4GF7A 1FEBA 1B8SA 1E1MA 2WESA 5GRTA 1OJAA 2QA2A 1F3PA 2VQ7A 2YVJA 4E0VA 2YR5A 2Y6QA 4EQSA 1NEKA 2A89A 1K0JA 1OJCA 3QVPA 3GRTA 1GRGA 1B4VA 1IUWA 1YQZA 3AXBA 1ZMDA 4MJWA 2QAEA 2HQMA 1PXBA 3G5QA 4RG4A 4TM0A 5CQFA 2WP9A 1CC6A 3FMWA 3BNUA 1GALA 3CTYA 1D4DA 1LVLA 3NIXA 2V61A 4CRTA 4REKA 4AP1A 3PS9A 2B7SA 1N4VA 3IF9A 3BHKA 3F8DA 3K7TA 4OCGA 1MO9A 1FCDA 1PHHA 4PAAA 3UKFA 1E1KA 2GRTA 4OPDA 1H7WA 2PHHA 3V3OA 3G5SA 1DOCA 2AAQA 3CNSA 4U8LA 5U63A 2WP5A 5FS8A 4H4VA 5BRTA 1EBDA 1EL5A 4YSZA 1V59A 5FS7A 2BA9A 4CCRA 1CBOA 4O5QA 1RYIA 2WOIA 2C3CA 4Y4MA 2YLRA 3K7QX 5U25A 2GH5A 1EL9A 2VVLG 1P2HA 2YR6A 2YG4A 2OAMA 3II4A 2E4GA 3K7MX 5KMSA 2C3DA 1CC2A 3P4QA 1BF3A 2Q0KA 3CGEA 5HHFA 1REOA 4B69A 2X8CA 4YXDA 3NNEA 3QSSA 2JBVA 2E1MA 3GYXA 1KFYA 2APGA 1GREA 3ITJA 3UKLA 1M6IA 3AYJA 3ZDNA 2XYOA 1H84A 3AE9A 1GPEA 4IA5A 3DJJA 2WDRA 4O5UA 1L9DA 2R9ZA 4OPCA 4BJYA 1KDGA 2GQFA 3T2YA 3UKKA 2GMJA 3NGCX 2JB2A 4CCQA 3AYLA 4USRA 1H82A 1GRHA 1GRFA 4Z43A 3LZWA 4KX6A 4EQWA 2C7GA 1Q1RA 3B6DA 4RSLA 1PDHA 4J31A 1FECA 4H4RA 2IVEA 4IVOB 2B7RA 2R0CA 1FOHA 4Y4LA 5CKUA 4B1BA 1D5TA 3CNPA 3SY4A 1ZMCA 3C4NA 1LTXR 4JQ9A 2C64A 4H7UA 3DGHA 3ALMA 2OALA 5JCKA 4B64A 1N1PA 4BV6A 3L8KA 1DOEA 2BACA 4A99A 3NTAA 4FX9A 2C72A 2XDOA 1MOKA 2WDVA 3QSEA 2JB3A 1DNCA 4JDRA 3DJEA 2B9XA 3CNJA 2GMHA 1CF3A 5C3JA 2BCPA 4X4JA 3UKAA 3T31A 2XVEA 1QJDA 2V6OA 4NEWA 4U8IA 3E1TA 3KU9A 1GEUA 3LADA 1QLBA 4II2A 3GYJA 1O5WA 4NZHA 4NTCA 3V3NA 3VR8A 1D7LA 3CGCA 2BS2A 1IUUA 4II3A 3URHA 3SXIA 4UDRA 5J60A 5M10A 3RNMA 1Z6LA 1F8SA 3NYEA 3IHGA 2YM2A 2AR8A 3GRSA 4GRTA 2R4EA 4OPTA 1E39A 2C75A 3AEEA 1PN0A 1ZKQA 3SX6A 4EM4A 2RABA 2XVIA 2VOUA 4FK1A 4G9KA 3LB8A 3REDA 1KSSA 2XFPA 3KPFA 4OVIA 3EANA 4JY3A 3DA1A 4AT0A 4Z2TA 3UOVA 4NEVA 2WOWA 1JRYA 3NKSA 2GB0A 5HYMA 5GSNA 2VZ2A 4TLZA 1JNRA 3O0HA 3CPHG 3UCLA 4OPIA 1FL2A 1S3BA 2GF3A 3QJ4A 2V5ZA 4B67A 2XVHA 3NRNA 4A6NB 4P9SA 5FMHA 1JEHA 1DODA 1DOBA 4EM3A 1NHSA 5IPYA 1GESA 1YQ3A 4AOXA 1GSNA 4EIPA 1CC4A 4U8MA 3VRAA 5BVAA 5KMQA 1VG9A 3UOXA 1PJ6A 4J36A 2BCGG 3AD8B 3GDNA 2JAEA 1DXLA 4DSHA 3CNTA 5C2TA 4Z25A 3AD7B 1CHUA 1GTHA 3UTEA 2XLRA 1B37A 1TDEA 1TYPA 1ZY8A 2WP6A 4H4TA 4LA1A 4EMWA 2ZZCA 3IWAA 4AOSA 2AQJA 3R9UA 4G74A 1NDAA 3AEAA 3EPTA 1LJ1A 1X31B 1IUXA 2BABA 2R45A 3K30A 3P4PA 4ZN0A 2X8GA 2RGOA 4TM3A 2YLSA 2IVDA 3RP8A 4B68A 1M64A 3GSIA 1KSUA 3ICRA 4H2PA 1CJ2A 3CPIG 4IVMB 4XXGA 3GMCA 4CY8A 2DKHA 3M13A 1PXAA 5ER0A 3GWDA 4CNJA 4A6NA 1LQTA 1LQUA
chains in the Genus database with same CATH topology
1OJ9A 4Z24A 5KNLA 4BK1A 4UDPA 2WQYA 3DJDA 1GNDA 3FBSA 3UKQA 3SYIA 5JCNA 1NHQA 1SEZA 1ZOVA 3AE5A 2VRMA 3UOYA 1TDKA 1LV0A 2DKIA 2V60A 2WU5A 2YAUA 1TRBA 2GVCA 2YLTA 3UTHA 2XLUA 4ZCDA 3FIMB 3M12A 2C67A 1ZDLA 2R0GA 4YSHA 3OC4A 3ICSA 4K22A 2TPRA 1GRTA 4DGKA 2YQUA 4C5OA 5KXJA 2X50A 2YLZA 1GRBA 3C96A 4X9MA 1Q1WA 2GQWA 2OLNA 1IUVA 4J34A 4EQXA 1TDFA 4UDQA 4Z26A 2WDQA 2YG5A 2EQ6A 5HXIA 3EF6A 3FPZA 3KD9A 5FS6A 4H4QA 3F8PA 1NG4A 4H50A 4K7ZA 4CBQA 4YTNA 4EMJA 1XANA 2GR2A 2XFUA 3ATRA 4H4PA 3PO7A 1GRAA 2JKCA 3ICTA 3F8RA 4K5SA 5JCMA 2WPFA 1P2EA 2XLSA 1D4EA 3KVEA 3NK0X 4A7AA 3WE0A 3CNDA 2J3NA 2OLOA 4A5LA 4Z2UA 2VQBA 2YVFA 4B66A 5EB5A 1BGNA 1H86A 4H4YA 2Q0LA 3RHAA 1K0IA 1H81A 2GAHB 2YLXA 4H4UA 4YKFA 1Y56B 2Z5XA 3RP7A 1PJ7A 2C76A 2YG6A 3AEDA 3C4AA 4B65A 2GR3A 4Y4NA 1PBBA 2WU2A 3DH9A 2EQ9A 3BNMA 2XVJA 3LJPA 1NPXA 3NN6X 2YR4A 1K0LA 2XFNA 3JSKA 3P4SA 5EB4A 4A79A 4C3YA 4DSGA 4J2WA 1Y0PA 3AB1A 3DK4A 5IQ4A 4YWOA 3NT6A 1S2QA 3ALJA 3AE1A 3BI2A 5JCIA 2QA1A 1JOAA 2CVJA 3NLCA 3SQPA 3DMEA 4C77A 3H8IA 1B5QA 4YTPA 4U8PA 5U1OA 1S3EA 4BK3A 3CPJG 3ATQA 4H2RA 1GETA 2C4CA 3BHFA 2ARDA 4U8KA 5KMRA 5M0ZA 3VR9A 4U8OA 2WEUA 4GAVA 1VQWA 2YG3A 3T0KA 4ADWA 1AOGA 1Y56A 5JCLA 3QVRA 2V3AA 1HYUA 2BK5A 4FK1C 1E1NA 3AE3A 3UTGA 3UKPA 2BK4A 1F8WA 2UZZA 1IUTA 1E1LA 4KPRA 1PBDA 3LXDA 4NTEA 3UKHA 3UP4A 5FS9A 4GCMA 4YTMA 2XCGA 5HY5A 3VQRA 4C74A 1IUSA 1L0VA 1GT8A 4ECHA 3DGZA 2ZZBA 1OJDA 1XHCA 4JNQA 4LIIA 3AE2A 1DJQA 2H89A 2X99A 2TMDA 4HB9A 1PS9A 1S2YA 1F8RA 1XDIA 4ICYA 3S5WA 3UP5A 2WOVA 3QFBA 2WBAA 1TYTA 1PXCA 4Z2RA 1D7YA 3KA7A 1F6MA 4JY2A 1XPQA 2XFQA 3COXA 3SZWA 5KWFA 1EL8A 4I59A 2BRAA 2XVFA 2ZBWA 1TDNA 1ZX9A 2WS3A 1CJCA 2ZZ0A 5KVHA 1RSGA 4U2SA 3GMBA 2EQ8A 3AEGA 3NK1X 1OJTA 3GYIA 1CJ4A 2FBWA 5IQ1A 5BULA 3AEFA 3VRBA 3SZCA 4TM1A 2H88A 3D1CA 5KRQA 2BRYA 2EQ7A 2VVLA 3HYWA 1Q9IA 3ADAB 5L46A 3AE6A 3GWFA 4H4ZA 3DJGX 2PYXA 1BKWA 4BURA 2WPCA 4HA6A 5TR3A 4EQRA 3M0OA 3DK8A 4YKGA 4U8JA 3BI4A 2WETA 3I3LA 2XLTA 2B9WA 5DBJA 1KF6A 1ZP0A 2X8HA 3SZ0A 2JK6A 2QCUA 3CGDA 1NENA 1EL7A 2IIDA 4M52A 1KNRA 2FJEA 3CGBA 1PBCA 3I6DA 3GD4A 3OZ2A 3DK9A 4EMIA 4JNAA 4H4WA 3SFEA 2C65A 4B63A 4NNJA 4U2TA 3RP6A 1JU2A 4GUVA 1GXFA 1ELIA 1JRXA 1YY5A 2VRLA 3SFDA 4RG3A 2VVMA 3Q9TA 3ALLA 3P4RA 3PVCA 4K5RA 2BXRA 1ZOYA 1NHRA 4NWZA 2BK3A 3KKJA 2BXSA 4A9WA 5J7XA 3P1WA 3T14A 3LOVA 4U8NA 3AYIA 1IJHA 1E6EA 1NAAA 4K2XA 2BS4A 4IA6A 4XWRA 3GDPA 4I58A 5KVIA 1L9EA 2BYBA 5KOWA 5BUKA 4K8DA 3SGLA 5KMPA 2A87A 3G5RA 2B76A 4J33A 2E5VA 1GV4A 3AECA 2WHDA 3H8LA 2YLWA 1CJ3A 3NK2X 4AT2A 3HZLA 3IHMA 1VG0A 1E7PA 4GR1A 1GOSA 4YSYA 4G6HA 3L1RA 2Z5YA 2RGJA 4FDCB 4IV9A 4N9XA 1JRZA 2BS3A 2FJDA 2Q6UA 3GD3A 1N4UA 1GERA 4BK2A 2ACZA 1GTEA 3QFAA 1BZLA 1ONFA 4TM4A 3T2ZA 2C70A 1QO8A 4OPUA 1NHPA 3ABVA 2X3NA 3ISHA 1MXTA 4G73A 4GDPA 3UOZA 1O94A 2YG7A 4H4XA 2R4JA 4G6GA 4PABA 1YQ4A 3T37A 4C3XA 4DNAA 1RP0A 3HYVA 1D4CA 3NYCA 1L9CA 3HYXA 4LU6A 4CY6A 4GDEA 1NG3A 3T2KA 4EIQA 1UKVG 2GR1A 1ZK7A 1O95A 3NN0X 1TDOA 2GEWA 3ZYXA 1DJNA 1PBFA 1CL0A 1BWCA 3AE8A 3SZFA 2NPXA 3H4KA 4BJZA 2F5ZA 3NTDA 1BGJA 3B3RA 2YWLA 3KPKA 2GV8A 4H2QA 3NH3X 4TLXA 3FG2P 4USQA 3V76A 4YT0A 1H6VA 1N4WA 2BC0A 1W4XA 3LZXA 3Q6JA 2OA1A 5EOWA 3AD9B 1JNZA 2YVGA 2V3BA 1FEAA 3NYFA 4GAPA 3S61A 4AP3A 3KLJA 1LPFA 2WPEA 3AWIA 4APNA 2Q7VA 3CIRA 3NHOX 3NG7X 4XWZA 3D8XA 4H4SA 4CNKA 2FJAA 4JN9A 2I0ZA 4D03A 2A8XA 2CULA 2Y6RA 4D04A 1VRQB 3P9UA 4ZCCA 2GR0A 2BC1A 2W0HA 4OPGA 1H83A 2CDUA 4Z44A 5KOXA 2R46A 4WCTA 2RGHA 3BI5A 2XLPA 3CMMA 3IC9A 5LV9A 3QSMA 2YM1A 4J57A 2O9ZA 4X9NA 2JB1A 2R0PA 1COYA 1K4QA 3AE4A 2B9YA 4WX1A 1H7XA 2C73A 2NVKX 4YSXA 3SM8A 2FJBA 4UP3A 2GAGB 2C66A 4U2LA 3AE7A 3VRDB 5EBKA 3CN8A 3UTFA 2XFOA 4J56A 1PJ5A 2CFYA 1KNPA 4H2NA 4NTDA 4OPLA 1VDCA 3AEBA 1PBEA 4A65A 3EAOA 1YKJA 4GF7A 1FEBA 1B8SA 1E1MA 2WESA 5GRTA 1OJAA 2QA2A 1F3PA 2VQ7A 2YVJA 4E0VA 2YR5A 2Y6QA 4EQSA 1NEKA 2A89A 1K0JA 1OJCA 3QVPA 3GRTA 1GRGA 1B4VA 1IUWA 1YQZA 3AXBA 1ZMDA 4MJWA 2QAEA 2HQMA 1PXBA 3G5QA 4RG4A 4TM0A 5CQFA 2WP9A 1CC6A 3FMWA 3BNUA 1GALA 3CTYA 1D4DA 1LVLA 3NIXA 2V61A 4CRTA 4REKA 4AP1A 3PS9A 2B7SA 1N4VA 3IF9A 3BHKA 3F8DA 3K7TA 4OCGA 1MO9A 1FCDA 1PHHA 4PAAA 3UKFA 1E1KA 2GRTA 4OPDA 1H7WA 2PHHA 3V3OA 3G5SA 1DOCA 2AAQA 3CNSA 4U8LA 5U63A 2WP5A 5FS8A 4H4VA 5BRTA 1EBDA 1EL5A 4YSZA 1V59A 5FS7A 2BA9A 4CCRA 1CBOA 4O5QA 1RYIA 2WOIA 2C3CA 4Y4MA 2YLRA 3K7QX 5U25A 2GH5A 1EL9A 2VVLG 1P2HA 2YR6A 2YG4A 2OAMA 3II4A 2E4GA 3K7MX 5KMSA 2C3DA 1CC2A 3P4QA 1BF3A 2Q0KA 3CGEA 5HHFA 1REOA 4B69A 2X8CA 4YXDA 3NNEA 3QSSA 2JBVA 2E1MA 3GYXA 1KFYA 2APGA 1GREA 3ITJA 3UKLA 1M6IA 3AYJA 3ZDNA 2XYOA 1H84A 3AE9A 1GPEA 4IA5A 3DJJA 2WDRA 4O5UA 1L9DA 2R9ZA 4OPCA 4BJYA 1KDGA 2GQFA 3T2YA 3UKKA 2GMJA 3NGCX 2JB2A 4CCQA 3AYLA 4USRA 1H82A 1GRHA 1GRFA 4Z43A 3LZWA 4KX6A 4EQWA 2C7GA 1Q1RA 3B6DA 4RSLA 1PDHA 4J31A 1FECA 4H4RA 2IVEA 4IVOB 2B7RA 2R0CA 1FOHA 4Y4LA 5CKUA 4B1BA 1D5TA 3CNPA 3SY4A 1ZMCA 3C4NA 1LTXR 4JQ9A 2C64A 4H7UA 3DGHA 3ALMA 2OALA 5JCKA 4B64A 1N1PA 4BV6A 3L8KA 1DOEA 2BACA 4A99A 3NTAA 4FX9A 2C72A 2XDOA 1MOKA 2WDVA 3QSEA 2JB3A 1DNCA 4JDRA 3DJEA 2B9XA 3CNJA 2GMHA 1CF3A 5C3JA 2BCPA 4X4JA 3UKAA 3T31A 2XVEA 1QJDA 2V6OA 4NEWA 4U8IA 3E1TA 3KU9A 1GEUA 3LADA 1QLBA 4II2A 3GYJA 1O5WA 4NZHA 4NTCA 3V3NA 3VR8A 1D7LA 3CGCA 2BS2A 1IUUA 4II3A 3URHA 3SXIA 4UDRA 5J60A 5M10A 3RNMA 1Z6LA 1F8SA 3NYEA 3IHGA 2YM2A 2AR8A 3GRSA 4GRTA 2R4EA 4OPTA 1E39A 2C75A 3AEEA 1PN0A 1ZKQA 3SX6A 4EM4A 2RABA 2XVIA 2VOUA 4FK1A 4G9KA 3LB8A 3REDA 1KSSA 2XFPA 3KPFA 4OVIA 3EANA 4JY3A 3DA1A 4AT0A 4Z2TA 3UOVA 4NEVA 2WOWA 1JRYA 3NKSA 2GB0A 5HYMA 5GSNA 2VZ2A 4TLZA 1JNRA 3O0HA 3CPHG 3UCLA 4OPIA 1FL2A 1S3BA 2GF3A 3QJ4A 2V5ZA 4B67A 2XVHA 3NRNA 4A6NB 4P9SA 5FMHA 1JEHA 1DODA 1DOBA 4EM3A 1NHSA 5IPYA 1GESA 1YQ3A 4AOXA 1GSNA 4EIPA 1CC4A 4U8MA 3VRAA 5BVAA 5KMQA 1VG9A 3UOXA 1PJ6A 4J36A 2BCGG 3AD8B 3GDNA 2JAEA 1DXLA 4DSHA 3CNTA 5C2TA 4Z25A 3AD7B 1CHUA 1GTHA 3UTEA 2XLRA 1B37A 1TDEA 1TYPA 1ZY8A 2WP6A 4H4TA 4LA1A 4EMWA 2ZZCA 3IWAA 4AOSA 2AQJA 3R9UA 4G74A 1NDAA 3AEAA 3EPTA 1LJ1A 1X31B 1IUXA 2BABA 2R45A 3K30A 3P4PA 4ZN0A 2X8GA 2RGOA 4TM3A 2YLSA 2IVDA 3RP8A 4B68A 1M64A 3GSIA 1KSUA 3ICRA 4H2PA 1CJ2A 3CPIG 4IVMB 4XXGA 3GMCA 4CY8A 2DKHA 3M13A 1PXAA 5ER0A 3GWDA 4CNJA 4A6NA 1LQTA 1LQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ9 A;  4Z24 A;  4BK1 A;  4UDP A;  2WQY A;  3DJD A;  1GND A;  3FBS A;  3UKQ A;  5JCN A;  1NHQ A;  1SEZ A;  1ZOV A;  3AE5 A;  2VRM A;  3UOY A;  1TDK A;  1LV0 A;  2DKI A;  2V60 A;  2WU5 A;  2YAU A;  1TRB A;  2GVC A;  2YLT A;  3UTH A;  2XLU A;  4ZCD A;  3FIM B;  3M12 A;  2C67 A;  1ZDL A;  2R0G A;  4YSH A;  3OC4 A;  3ICS A;  4K22 A;  2TPR A;  1GRT A;  4DGK A;  2YQU A;  4C5O A;  5KXJ A;  2X50 A;  2YLZ A;  1GRB A;  3C96 A;  4X9M A;  1Q1W A;  2GQW A;  2OLN A;  1IUV A;  4J34 A;  4EQX A;  1TDF A;  4UDQ A;  4Z26 A;  2WDQ A;  2YG5 A;  2EQ6 A;  5HXI A;  3EF6 A;  3FPZ A;  3KD9 A;  5FS6 A;  4H4Q A;  3F8P A;  1NG4 A;  4H50 A;  4K7Z A;  4CBQ A;  4YTN A;  4EMJ A;  1XAN A;  2GR2 A;  2XFU A;  3ATR A;  4H4P A;  3PO7 A;  1GRA A;  2JKC A;  3ICT A;  3F8R A;  4K5S A;  5JCM A;  2WPF A;  1P2E A;  2XLS A;  1D4E A;  3KVE A;  3NK0 X;  4A7A A;  3WE0 A;  3CND A;  2J3N A;  2OLO A;  4A5L A;  4Z2U A;  2VQB A;  2YVF A;  4B66 A;  5EB5 A;  1BGN A;  1H86 A;  4H4Y A;  2Q0L A;  3RHA A;  1K0I A;  1H81 A;  2GAH B;  2YLX A;  4H4U A;  4YKF A;  1Y56 B;  2Z5X A;  3RP7 A;  1PJ7 A;  2C76 A;  2YG6 A;  3AED A;  3C4A A;  4B65 A;  2GR3 A;  4Y4N A;  1PBB A;  2WU2 A;  3DH9 A;  2EQ9 A;  3BNM A;  2XVJ A;  3LJP A;  1NPX A;  3NN6 X;  2YR4 A;  1K0L A;  2XFN A;  3JSK A;  3P4S A;  5EB4 A;  4A79 A;  4C3Y A;  4DSG A;  4J2W A;  1Y0P A;  3AB1 A;  3DK4 A;  5IQ4 A;  4YWO A;  3NT6 A;  1S2Q A;  3ALJ A;  3AE1 A;  3BI2 A;  5JCI A;  2QA1 A;  1JOA A;  2CVJ A;  3NLC A;  3SQP A;  3DME A;  4C77 A;  3H8I A;  1B5Q A;  4YTP A;  4U8P A;  5U1O A;  1S3E A;  4BK3 A;  3CPJ G;  3ATQ A;  4H2R A;  1GET A;  4U8K A;  3BHF A;  2ARD A;  5M0Z A;  3VR9 A;  4U8O A;  2WEU A;  4ADW A;  1VQW A;  2YG3 A;  1AOG A;  1Y56 A;  5JCL A;  3QVR A;  2V3A A;  1HYU A;  2BK5 A;  4FK1 C;  1E1N A;  3AE3 A;  3UTG A;  3UKP A;  2BK4 A;  1F8W A;  2UZZ A;  1IUT A;  1E1L A;  4KPR A;  1PBD A;  3LXD A;  4NTE A;  3UKH A;  3UP4 A;  5FS9 A;  4GCM A;  4YTM A;  2XCG A;  5HY5 A;  3VQR A;  4C74 A;  1IUS A;  1L0V A;  1GT8 A;  4ECH A;  3DGZ A;  2ZZB A;  1OJD A;  1XHC A;  4JNQ A;  4LII A;  3AE2 A;  1DJQ A;  2H89 A;  2X99 A;  2TMD A;  4HB9 A;  1PS9 A;  1S2Y A;  1F8R A;  1XDI A;  4ICY A;  3UP5 A;  2WOV A;  3QFB A;  2WBA A;  1TYT A;  1PXC A;  4Z2R A;  1D7Y A;  3KA7 A;  1F6M A;  4JY2 A;  1XPQ A;  2XFQ A;  3COX A;  5KWF A;  1EL8 A;  4I59 A;  2XVF A;  2ZBW A;  1TDN A;  1ZX9 A;  2WS3 A;  1CJC A;  2ZZ0 A;  5KVH A;  1RSG A;  4U2S A;  3GMB A;  2EQ8 A;  3AEG A;  3NK1 X;  1OJT A;  3GYI A;  1CJ4 A;  2FBW A;  5IQ1 A;  5BUL A;  3AEF A;  3VRB A;  4TM1 A;  2H88 A;  3D1C A;  5KRQ A;  2VVL A;  2EQ7 A;  1Q9I A;  3ADA B;  5L46 A;  3AE6 A;  3GWF A;  4H4Z A;  3DJG X;  2PYX A;  1BKW A;  4BUR A;  2WPC A;  4HA6 A;  5TR3 A;  4EQR A;  3M0O A;  3DK8 A;  4YKG A;  4U8J A;  3BI4 A;  2WET A;  3I3L A;  2XLT A;  2B9W A;  5DBJ A;  1KF6 A;  1ZP0 A;  2X8H A;  2JK6 A;  2QCU A;  3CGD A;  1NEN A;  1EL7 A;  2IID A;  4M52 A;  1KNR A;  2FJE A;  3CGB A;  1PBC A;  3I6D A;  3GD4 A;  3OZ2 A;  3DK9 A;  4EMI A;  4JNA A;  4H4W A;  3SFE A;  2C65 A;  4B63 A;  4U2T A;  3RP6 A;  1JU2 A;  4GUV A;  1GXF A;  1ELI A;  1JRX A;  1YY5 A;  2VRL A;  3SFD A;  4RG3 A;  2VVM A;  3Q9T A;  3ALL A;  3P4R A;  3PVC A;  4K5R A;  2BXR A;  1ZOY A;  1NHR A;  2BK3 A;  3KKJ A;  2BXS A;  4A9W A;  5J7X A;  3P1W A;  3LOV A;  4U8N A;  3AYI A;  1IJH A;  1E6E A;  1NAA A;  4K2X A;  2BS4 A;  4IA6 A;  4XWR A;  3GDP A;  4I58 A;  5KVI A;  1L9E A;  2BYB A;  5KOW A;  5BUK A;  4K8D A;  3SGL A;  2A87 A;  3G5R A;  2B76 A;  4J33 A;  2E5V A;  1GV4 A;  3AEC A;  2WHD A;  3H8L A;  2YLW A;  1CJ3 A;  3NK2 X;  4AT2 A;  3HZL A;  3IHM A;  1VG0 A;  1E7P A;  4GR1 A;  1GOS A;  4YSY A;  4N9X A;  3L1R A;  2Z5Y A;  2RGJ A;  4FDC B;  4IV9 A;  3S5W A;  1JRZ A;  2BS3 A;  2FJD A;  2Q6U A;  3GD3 A;  1N4U A;  1GER A;  4BK2 A;  2ACZ A;  1GTE A;  3QFA A;  1BZL A;  1ONF A;  4TM4 A;  2C70 A;  1QO8 A;  4OPU A;  1NHP A;  3ABV A;  2X3N A;  3ISH A;  1MXT A;  4GDP A;  3UOZ A;  1O94 A;  2YG7 A;  4H4X A;  2R4J A;  4PAB A;  4C3X A;  1YQ4 A;  3T37 A;  4DNA A;  1RP0 A;  1D4C A;  3NYC A;  1L9C A;  4LU6 A;  4CY6 A;  4GDE A;  1NG3 A;  4EIQ A;  1UKV G;  2GR1 A;  1ZK7 A;  1O95 A;  3NN0 X;  1TDO A;  2GEW A;  3ZYX A;  1DJN A;  1PBF A;  1CL0 A;  1BWC A;  3AE8 A;  2NPX A;  3H4K A;  4BJZ A;  2F5Z A;  3NTD A;  1BGJ A;  3B3R A;  2YWL A;  2GV8 A;  4H2Q A;  3NH3 X;  4TLX A;  3FG2 P;  4USQ A;  3V76 A;  4YT0 A;  1H6V A;  1N4W A;  2BC0 A;  1W4X A;  3LZX A;  3Q6J A;  2OA1 A;  5EOW A;  3AD9 B;  1JNZ A;  2YVG A;  2V3B A;  1FEA A;  3NYF A;  3S61 A;  4AP3 A;  3KLJ A;  1LPF A;  2WPE A;  3AWI A;  4APN A;  2Q7V A;  3CIR A;  3NHO X;  3NG7 X;  4XWZ A;  3D8X A;  4H4S A;  4CNK A;  2FJA A;  4JN9 A;  2I0Z A;  4D03 A;  2A8X A;  2CUL A;  2Y6R A;  4D04 A;  1VRQ B;  3P9U A;  4ZCC A;  2GR0 A;  2BC1 A;  2W0H A;  4OPG A;  1H83 A;  2CDU A;  4Z44 A;  5KOX A;  2R46 A;  4WCT A;  2RGH A;  3BI5 A;  2XLP A;  3IC9 A;  5LV9 A;  3QSM A;  2YM1 A;  4J57 A;  2O9Z A;  4X9N A;  2JB1 A;  2R0P A;  1COY A;  1K4Q A;  3AE4 A;  2B9Y A;  4WX1 A;  1H7X A;  2C73 A;  2NVK X;  4YSX A;  3SM8 A;  2FJB A;  4UP3 A;  2GAG B;  2C66 A;  4U2L A;  3AE7 A;  3VRD B;  5EBK A;  3CN8 A;  3UTF A;  2XFO A;  4J56 A;  1PJ5 A;  2CFY A;  1KNP A;  4H2N A;  4NTD A;  4OPL A;  1VDC A;  3AEB A;  1PBE A;  4A65 A;  3EAO A;  1YKJ A;  4GF7 A;  1FEB A;  1B8S A;  1E1M A;  2WES A;  5GRT A;  1OJA A;  2QA2 A;  1F3P A;  2VQ7 A;  2YVJ A;  4E0V A;  2YR5 A;  2Y6Q A;  4EQS A;  1NEK A;  2A89 A;  1K0J A;  1OJC A;  3QVP A;  3GRT A;  1GRG A;  1B4V A;  1IUW A;  1YQZ A;  3AXB A;  1ZMD A;  4MJW A;  2QAE A;  2HQM A;  1PXB A;  3G5Q A;  4RG4 A;  4TM0 A;  5CQF A;  2WP9 A;  1CC6 A;  3FMW A;  3BNU A;  1GAL A;  3CTY A;  1D4D A;  1LVL A;  3NIX A;  2V61 A;  4CRT A;  4REK A;  4AP1 A;  3PS9 A;  2B7S A;  1N4V A;  3IF9 A;  3BHK A;  3F8D A;  3K7T A;  4OCG A;  1MO9 A;  1FCD A;  1PHH A;  4PAA A;  3UKF A;  1E1K A;  2GRT A;  4OPD A;  1H7W A;  2PHH A;  3V3O A;  3G5S A;  1DOC A;  2AAQ A;  3CNS A;  4U8L A;  5U63 A;  2WP5 A;  5FS8 A;  4H4V A;  5BRT A;  1EBD A;  1EL5 A;  4YSZ A;  1V59 A;  5FS7 A;  2BA9 A;  4CCR A;  1CBO A;  4O5Q A;  1RYI A;  2WOI A;  2C3C A;  4Y4M A;  2YLR A;  3K7Q X;  5U25 A;  2GH5 A;  1EL9 A;  2VVL G;  1P2H A;  2YR6 A;  2YG4 A;  2OAM A;  3II4 A;  2E4G A;  3K7M X;  2C3D A;  1CC2 A;  3P4Q A;  1BF3 A;  2Q0K A;  3CGE A;  5HHF A;  1REO A;  4B69 A;  2X8C A;  4YXD A;  3NNE A;  3QSS A;  2JBV A;  2E1M A;  1KFY A;  2APG A;  1GRE A;  3ITJ A;  3UKL A;  1M6I A;  3AYJ A;  3ZDN A;  2XYO A;  1H84 A;  3AE9 A;  1GPE A;  4IA5 A;  3DJJ A;  2WDR A;  4O5U A;  1L9D A;  2R9Z A;  4OPC A;  4BJY A;  1KDG A;  2GQF A;  3UKK A;  2GMJ A;  3NGC X;  2JB2 A;  4CCQ A;  3AYL A;  4USR A;  1H82 A;  1GRH A;  1GRF A;  4Z43 A;  3LZW A;  4KX6 A;  4EQW A;  2C7G A;  1Q1R A;  3B6D A;  4RSL A;  1PDH A;  4J31 A;  1FEC A;  4H4R A;  2IVE A;  4IVO B;  2B7R A;  2R0C A;  1FOH A;  4Y4L A;  5CKU A;  4B1B A;  1D5T A;  3CNP A;  1ZMC A;  3C4N A;  1LTX R;  4JQ9 A;  2C64 A;  4H7U A;  3DGH A;  3ALM A;  2OAL A;  5JCK A;  4B64 A;  1N1P A;  4BV6 A;  3L8K A;  1DOE A;  2BAC A;  4A99 A;  3NTA A;  4FX9 A;  2C72 A;  2XDO A;  1MOK A;  2WDV A;  3QSE A;  2JB3 A;  1DNC A;  4JDR A;  3DJE A;  2B9X A;  3CNJ A;  2GMH A;  1CF3 A;  5C3J A;  2BCP A;  4X4J A;  3UKA A;  2XVE A;  1QJD A;  2V6O A;  4NEW A;  4U8I A;  3E1T A;  3KU9 A;  1GEU A;  3LAD A;  1QLB A;  3GYJ A;  1O5W A;  4NZH A;  4NTC A;  3V3N A;  3VR8 A;  1D7L A;  3CGC A;  2BS2 A;  1IUU A;  3URH A;  4UDR A;  5J60 A;  5M10 A;  3RNM A;  1Z6L A;  1F8S A;  3NYE A;  3IHG A;  2YM2 A;  2AR8 A;  3GRS A;  4GRT A;  2R4E A;  4OPT A;  1E39 A;  2C75 A;  3AEE A;  1PN0 A;  1ZKQ A;  4EM4 A;  2RAB A;  2XVI A;  2VOU A;  4FK1 A;  3RED A;  3LB8 A;  1KSS A;  2XFP A;  3KPF A;  4OVI A;  3EAN A;  4JY3 A;  3DA1 A;  4AT0 A;  4Z2T A;  3UOV A;  4NEV A;  2WOW A;  1JRY A;  3NKS A;  2GB0 A;  5HYM A;  5GSN A;  2VZ2 A;  4TLZ A;  1JNR A;  3O0H A;  3CPH G;  3UCL A;  4OPI A;  1FL2 A;  1S3B A;  2GF3 A;  3QJ4 A;  2V5Z A;  4B67 A;  2XVH A;  3NRN A;  4A6N B;  4P9S A;  5FMH A;  1JEH A;  1DOD A;  1DOB A;  4EM3 A;  1NHS A;  5IPY A;  1GES A;  1YQ3 A;  4AOX A;  1GSN A;  4EIP A;  1CC4 A;  4U8M A;  3VRA A;  5BVA A;  1VG9 A;  3UOX A;  1PJ6 A;  4J36 A;  2BCG G;  3AD8 B;  3GDN A;  2JAE A;  1DXL A;  4DSH A;  3CNT A;  5C2T A;  4Z25 A;  3AD7 B;  1CHU A;  1GTH A;  3UTE A;  2XLR A;  1B37 A;  1TDE A;  1TYP A;  1ZY8 A;  2WP6 A;  4H4T A;  4LA1 A;  4EMW A;  2ZZC A;  3IWA A;  4AOS A;  2AQJ A;  3R9U A;  1NDA A;  3AEA A;  3EPT A;  1LJ1 A;  1X31 B;  1IUX A;  2BAB A;  2R45 A;  3K30 A;  3P4P A;  4ZN0 A;  2X8G A;  2RGO A;  4TM3 A;  2YLS A;  2IVD A;  3RP8 A;  4B68 A;  1M64 A;  3GSI A;  1KSU A;  3ICR A;  4H2P A;  1CJ2 A;  3CPI G;  4IVM B;  4XXG A;  3GMC A;  4CY8 A;  2DKH A;  3M13 A;  1PXA A;  5ER0 A;  3GWD A;  4CNJ A;  4A6N A;  1LQT A;  1LQU A; 
#chains in the Genus database with same CATH topology
 1OJ9 A;  4Z24 A;  5KNL A;  4BK1 A;  4UDP A;  2WQY A;  3DJD A;  1GND A;  3FBS A;  3UKQ A;  3SYI A;  5JCN A;  1NHQ A;  1SEZ A;  1ZOV A;  3AE5 A;  2VRM A;  3UOY A;  1TDK A;  1LV0 A;  2DKI A;  2V60 A;  2WU5 A;  2YAU A;  1TRB A;  2GVC A;  2YLT A;  3UTH A;  2XLU A;  4ZCD A;  3FIM B;  3M12 A;  2C67 A;  1ZDL A;  2R0G A;  4YSH A;  3OC4 A;  3ICS A;  4K22 A;  2TPR A;  1GRT A;  4DGK A;  2YQU A;  4C5O A;  5KXJ A;  2X50 A;  2YLZ A;  1GRB A;  3C96 A;  4X9M A;  1Q1W A;  2GQW A;  2OLN A;  1IUV A;  4J34 A;  4EQX A;  1TDF A;  4UDQ A;  4Z26 A;  2WDQ A;  2YG5 A;  2EQ6 A;  5HXI A;  3EF6 A;  3FPZ A;  3KD9 A;  5FS6 A;  4H4Q A;  3F8P A;  1NG4 A;  4H50 A;  4K7Z A;  4CBQ A;  4YTN A;  4EMJ A;  1XAN A;  2GR2 A;  2XFU A;  3ATR A;  4H4P A;  3PO7 A;  1GRA A;  2JKC A;  3ICT A;  3F8R A;  4K5S A;  5JCM A;  2WPF A;  1P2E A;  2XLS A;  1D4E A;  3KVE A;  3NK0 X;  4A7A A;  3WE0 A;  3CND A;  2J3N A;  2OLO A;  4A5L A;  4Z2U A;  2VQB A;  2YVF A;  4B66 A;  5EB5 A;  1BGN A;  1H86 A;  4H4Y A;  2Q0L A;  3RHA A;  1K0I A;  1H81 A;  2GAH B;  2YLX A;  4H4U A;  4YKF A;  1Y56 B;  2Z5X A;  3RP7 A;  1PJ7 A;  2C76 A;  2YG6 A;  3AED A;  3C4A A;  4B65 A;  2GR3 A;  4Y4N A;  1PBB A;  2WU2 A;  3DH9 A;  2EQ9 A;  3BNM A;  2XVJ A;  3LJP A;  1NPX A;  3NN6 X;  2YR4 A;  1K0L A;  2XFN A;  3JSK A;  3P4S A;  5EB4 A;  4A79 A;  4C3Y A;  4DSG A;  4J2W A;  1Y0P A;  3AB1 A;  3DK4 A;  5IQ4 A;  4YWO A;  3NT6 A;  1S2Q A;  3ALJ A;  3AE1 A;  3BI2 A;  5JCI A;  2QA1 A;  1JOA A;  2CVJ A;  3NLC A;  3SQP A;  3DME A;  4C77 A;  3H8I A;  1B5Q A;  4YTP A;  4U8P A;  5U1O A;  1S3E A;  4BK3 A;  3CPJ G;  3ATQ A;  4H2R A;  1GET A;  2C4C A;  3BHF A;  2ARD A;  4U8K A;  5KMR A;  5M0Z A;  3VR9 A;  4U8O A;  2WEU A;  4GAV A;  1VQW A;  2YG3 A;  3T0K A;  4ADW A;  1AOG A;  1Y56 A;  5JCL A;  3QVR A;  2V3A A;  1HYU A;  2BK5 A;  4FK1 C;  1E1N A;  3AE3 A;  3UTG A;  3UKP A;  2BK4 A;  1F8W A;  2UZZ A;  1IUT A;  1E1L A;  4KPR A;  1PBD A;  3LXD A;  4NTE A;  3UKH A;  3UP4 A;  5FS9 A;  4GCM A;  4YTM A;  2XCG A;  5HY5 A;  3VQR A;  4C74 A;  1IUS A;  1L0V A;  1GT8 A;  4ECH A;  3DGZ A;  2ZZB A;  1OJD A;  1XHC A;  4JNQ A;  4LII A;  3AE2 A;  1DJQ A;  2H89 A;  2X99 A;  2TMD A;  4HB9 A;  1PS9 A;  1S2Y A;  1F8R A;  1XDI A;  4ICY A;  3S5W A;  3UP5 A;  2WOV A;  3QFB A;  2WBA A;  1TYT A;  1PXC A;  4Z2R A;  1D7Y A;  3KA7 A;  1F6M A;  4JY2 A;  1XPQ A;  2XFQ A;  3COX A;  3SZW A;  5KWF A;  1EL8 A;  4I59 A;  2BRA A;  2XVF A;  2ZBW A;  1TDN A;  1ZX9 A;  2WS3 A;  1CJC A;  2ZZ0 A;  5KVH A;  1RSG A;  4U2S A;  3GMB A;  2EQ8 A;  3AEG A;  3NK1 X;  1OJT A;  3GYI A;  1CJ4 A;  2FBW A;  5IQ1 A;  5BUL A;  3AEF A;  3VRB A;  3SZC A;  4TM1 A;  2H88 A;  3D1C A;  5KRQ A;  2BRY A;  2EQ7 A;  2VVL A;  3HYW A;  1Q9I A;  3ADA B;  5L46 A;  3AE6 A;  3GWF A;  4H4Z A;  3DJG X;  2PYX A;  1BKW A;  4BUR A;  2WPC A;  4HA6 A;  5TR3 A;  4EQR A;  3M0O A;  3DK8 A;  4YKG A;  4U8J A;  3BI4 A;  2WET A;  3I3L A;  2XLT A;  2B9W A;  5DBJ A;  1KF6 A;  1ZP0 A;  2X8H A;  3SZ0 A;  2JK6 A;  2QCU A;  3CGD A;  1NEN A;  1EL7 A;  2IID A;  4M52 A;  1KNR A;  2FJE A;  3CGB A;  1PBC A;  3I6D A;  3GD4 A;  3OZ2 A;  3DK9 A;  4EMI A;  4JNA A;  4H4W A;  3SFE A;  2C65 A;  4B63 A;  4NNJ A;  4U2T A;  3RP6 A;  1JU2 A;  4GUV A;  1GXF A;  1ELI A;  1JRX A;  1YY5 A;  2VRL A;  3SFD A;  4RG3 A;  2VVM A;  3Q9T A;  3ALL A;  3P4R A;  3PVC A;  4K5R A;  2BXR A;  1ZOY A;  1NHR A;  4NWZ A;  2BK3 A;  3KKJ A;  2BXS A;  4A9W A;  5J7X A;  3P1W A;  3T14 A;  3LOV A;  4U8N A;  3AYI A;  1IJH A;  1E6E A;  1NAA A;  4K2X A;  2BS4 A;  4IA6 A;  4XWR A;  3GDP A;  4I58 A;  5KVI A;  1L9E A;  2BYB A;  5KOW A;  5BUK A;  4K8D A;  3SGL A;  5KMP A;  2A87 A;  3G5R A;  2B76 A;  4J33 A;  2E5V A;  1GV4 A;  3AEC A;  2WHD A;  3H8L A;  2YLW A;  1CJ3 A;  3NK2 X;  4AT2 A;  3HZL A;  3IHM A;  1VG0 A;  1E7P A;  4GR1 A;  1GOS A;  4YSY A;  4G6H A;  3L1R A;  2Z5Y A;  2RGJ A;  4FDC B;  4IV9 A;  4N9X A;  1JRZ A;  2BS3 A;  2FJD A;  2Q6U A;  3GD3 A;  1N4U A;  1GER A;  4BK2 A;  2ACZ A;  1GTE A;  3QFA A;  1BZL A;  1ONF A;  4TM4 A;  3T2Z A;  2C70 A;  1QO8 A;  4OPU A;  1NHP A;  3ABV A;  2X3N A;  3ISH A;  1MXT A;  4G73 A;  4GDP A;  3UOZ A;  1O94 A;  2YG7 A;  4H4X A;  2R4J A;  4G6G A;  4PAB A;  1YQ4 A;  3T37 A;  4C3X A;  4DNA A;  1RP0 A;  3HYV A;  1D4C A;  3NYC A;  1L9C A;  3HYX A;  4LU6 A;  4CY6 A;  4GDE A;  1NG3 A;  3T2K A;  4EIQ A;  1UKV G;  2GR1 A;  1ZK7 A;  1O95 A;  3NN0 X;  1TDO A;  2GEW A;  3ZYX A;  1DJN A;  1PBF A;  1CL0 A;  1BWC A;  3AE8 A;  3SZF A;  2NPX A;  3H4K A;  4BJZ A;  2F5Z A;  3NTD A;  1BGJ A;  3B3R A;  2YWL A;  3KPK A;  2GV8 A;  4H2Q A;  3NH3 X;  4TLX A;  3FG2 P;  4USQ A;  3V76 A;  4YT0 A;  1H6V A;  1N4W A;  2BC0 A;  1W4X A;  3LZX A;  3Q6J A;  2OA1 A;  5EOW A;  3AD9 B;  1JNZ A;  2YVG A;  2V3B A;  1FEA A;  3NYF A;  4GAP A;  3S61 A;  4AP3 A;  3KLJ A;  1LPF A;  2WPE A;  3AWI A;  4APN A;  2Q7V A;  3CIR A;  3NHO X;  3NG7 X;  4XWZ A;  3D8X A;  4H4S A;  4CNK A;  2FJA A;  4JN9 A;  2I0Z A;  4D03 A;  2A8X A;  2CUL A;  2Y6R A;  4D04 A;  1VRQ B;  3P9U A;  4ZCC A;  2GR0 A;  2BC1 A;  2W0H A;  4OPG A;  1H83 A;  2CDU A;  4Z44 A;  5KOX A;  2R46 A;  4WCT A;  2RGH A;  3BI5 A;  2XLP A;  3CMM A;  3IC9 A;  5LV9 A;  3QSM A;  2YM1 A;  4J57 A;  2O9Z A;  4X9N A;  2JB1 A;  2R0P A;  1COY A;  1K4Q A;  3AE4 A;  2B9Y A;  4WX1 A;  1H7X A;  2C73 A;  2NVK X;  4YSX A;  3SM8 A;  2FJB A;  4UP3 A;  2GAG B;  2C66 A;  4U2L A;  3AE7 A;  3VRD B;  5EBK A;  3CN8 A;  3UTF A;  2XFO A;  4J56 A;  1PJ5 A;  2CFY A;  1KNP A;  4H2N A;  4NTD A;  4OPL A;  1VDC A;  3AEB A;  1PBE A;  4A65 A;  3EAO A;  1YKJ A;  4GF7 A;  1FEB A;  1B8S A;  1E1M A;  2WES A;  5GRT A;  1OJA A;  2QA2 A;  1F3P A;  2VQ7 A;  2YVJ A;  4E0V A;  2YR5 A;  2Y6Q A;  4EQS A;  1NEK A;  2A89 A;  1K0J A;  1OJC A;  3QVP A;  3GRT A;  1GRG A;  1B4V A;  1IUW A;  1YQZ A;  3AXB A;  1ZMD A;  4MJW A;  2QAE A;  2HQM A;  1PXB A;  3G5Q A;  4RG4 A;  4TM0 A;  5CQF A;  2WP9 A;  1CC6 A;  3FMW A;  3BNU A;  1GAL A;  3CTY A;  1D4D A;  1LVL A;  3NIX A;  2V61 A;  4CRT A;  4REK A;  4AP1 A;  3PS9 A;  2B7S A;  1N4V A;  3IF9 A;  3BHK A;  3F8D A;  3K7T A;  4OCG A;  1MO9 A;  1FCD A;  1PHH A;  4PAA A;  3UKF A;  1E1K A;  2GRT A;  4OPD A;  1H7W A;  2PHH A;  3V3O A;  3G5S A;  1DOC A;  2AAQ A;  3CNS A;  4U8L A;  5U63 A;  2WP5 A;  5FS8 A;  4H4V A;  5BRT A;  1EBD A;  1EL5 A;  4YSZ A;  1V59 A;  5FS7 A;  2BA9 A;  4CCR A;  1CBO A;  4O5Q A;  1RYI A;  2WOI A;  2C3C A;  4Y4M A;  2YLR A;  3K7Q X;  5U25 A;  2GH5 A;  1EL9 A;  2VVL G;  1P2H A;  2YR6 A;  2YG4 A;  2OAM A;  3II4 A;  2E4G A;  3K7M X;  5KMS A;  2C3D A;  1CC2 A;  3P4Q A;  1BF3 A;  2Q0K A;  3CGE A;  5HHF A;  1REO A;  4B69 A;  2X8C A;  4YXD A;  3NNE A;  3QSS A;  2JBV A;  2E1M A;  3GYX A;  1KFY A;  2APG A;  1GRE A;  3ITJ A;  3UKL A;  1M6I A;  3AYJ A;  3ZDN A;  2XYO A;  1H84 A;  3AE9 A;  1GPE A;  4IA5 A;  3DJJ A;  2WDR A;  4O5U A;  1L9D A;  2R9Z A;  4OPC A;  4BJY A;  1KDG A;  2GQF A;  3T2Y A;  3UKK A;  2GMJ A;  3NGC X;  2JB2 A;  4CCQ A;  3AYL A;  4USR A;  1H82 A;  1GRH A;  1GRF A;  4Z43 A;  3LZW A;  4KX6 A;  4EQW A;  2C7G A;  1Q1R A;  3B6D A;  4RSL A;  1PDH A;  4J31 A;  1FEC A;  4H4R A;  2IVE A;  4IVO B;  2B7R A;  2R0C A;  1FOH A;  4Y4L A;  5CKU A;  4B1B A;  1D5T A;  3CNP A;  3SY4 A;  1ZMC A;  3C4N A;  1LTX R;  4JQ9 A;  2C64 A;  4H7U A;  3DGH A;  3ALM A;  2OAL A;  5JCK A;  4B64 A;  1N1P A;  4BV6 A;  3L8K A;  1DOE A;  2BAC A;  4A99 A;  3NTA A;  4FX9 A;  2C72 A;  2XDO A;  1MOK A;  2WDV A;  3QSE A;  2JB3 A;  1DNC A;  4JDR A;  3DJE A;  2B9X A;  3CNJ A;  2GMH A;  1CF3 A;  5C3J A;  2BCP A;  4X4J A;  3UKA A;  3T31 A;  2XVE A;  1QJD A;  2V6O A;  4NEW A;  4U8I A;  3E1T A;  3KU9 A;  1GEU A;  3LAD A;  1QLB A;  4II2 A;  3GYJ A;  1O5W A;  4NZH A;  4NTC A;  3V3N A;  3VR8 A;  1D7L A;  3CGC A;  2BS2 A;  1IUU A;  4II3 A;  3URH A;  3SXI A;  4UDR A;  5J60 A;  5M10 A;  3RNM A;  1Z6L A;  1F8S A;  3NYE A;  3IHG A;  2YM2 A;  2AR8 A;  3GRS A;  4GRT A;  2R4E A;  4OPT A;  1E39 A;  2C75 A;  3AEE A;  1PN0 A;  1ZKQ A;  3SX6 A;  4EM4 A;  2RAB A;  2XVI A;  2VOU A;  4FK1 A;  4G9K A;  3LB8 A;  3RED A;  1KSS A;  2XFP A;  3KPF A;  4OVI A;  3EAN A;  4JY3 A;  3DA1 A;  4AT0 A;  4Z2T A;  3UOV A;  4NEV A;  2WOW A;  1JRY A;  3NKS A;  2GB0 A;  5HYM A;  5GSN A;  2VZ2 A;  4TLZ A;  1JNR A;  3O0H A;  3CPH G;  3UCL A;  4OPI A;  1FL2 A;  1S3B A;  2GF3 A;  3QJ4 A;  2V5Z A;  4B67 A;  2XVH A;  3NRN A;  4A6N B;  4P9S A;  5FMH A;  1JEH A;  1DOD A;  1DOB A;  4EM3 A;  1NHS A;  5IPY A;  1GES A;  1YQ3 A;  4AOX A;  1GSN A;  4EIP A;  1CC4 A;  4U8M A;  3VRA A;  5BVA A;  5KMQ A;  1VG9 A;  3UOX A;  1PJ6 A;  4J36 A;  2BCG G;  3AD8 B;  3GDN A;  2JAE A;  1DXL A;  4DSH A;  3CNT A;  5C2T A;  4Z25 A;  3AD7 B;  1CHU A;  1GTH A;  3UTE A;  2XLR A;  1B37 A;  1TDE A;  1TYP A;  1ZY8 A;  2WP6 A;  4H4T A;  4LA1 A;  4EMW A;  2ZZC A;  3IWA A;  4AOS A;  2AQJ A;  3R9U A;  4G74 A;  1NDA A;  3AEA A;  3EPT A;  1LJ1 A;  1X31 B;  1IUX A;  2BAB A;  2R45 A;  3K30 A;  3P4P A;  4ZN0 A;  2X8G A;  2RGO A;  4TM3 A;  2YLS A;  2IVD A;  3RP8 A;  4B68 A;  1M64 A;  3GSI A;  1KSU A;  3ICR A;  4H2P A;  1CJ2 A;  3CPI G;  4IVM B;  4XXG A;  3GMC A;  4CY8 A;  2DKH A;  3M13 A;  1PXA A;  5ER0 A;  3GWD A;  4CNJ A;  4A6N A;  1LQT A;  1LQU A; 
#chains in the Genus database with same CATH homology
 1OJ9 A;  4Z24 A;  5KNL A;  4BK1 A;  4UDP A;  2WQY A;  3DJD A;  1GND A;  3FBS A;  3UKQ A;  3SYI A;  5JCN A;  1NHQ A;  1SEZ A;  1ZOV A;  3AE5 A;  2VRM A;  3UOY A;  1TDK A;  1LV0 A;  2DKI A;  2V60 A;  2WU5 A;  2YAU A;  1TRB A;  2GVC A;  2YLT A;  3UTH A;  2XLU A;  4ZCD A;  3FIM B;  3M12 A;  2C67 A;  1ZDL A;  2R0G A;  4YSH A;  3OC4 A;  3ICS A;  4K22 A;  2TPR A;  1GRT A;  4DGK A;  2YQU A;  4C5O A;  5KXJ A;  2X50 A;  2YLZ A;  1GRB A;  3C96 A;  4X9M A;  1Q1W A;  2GQW A;  2OLN A;  1IUV A;  4J34 A;  4EQX A;  1TDF A;  4UDQ A;  4Z26 A;  2WDQ A;  2YG5 A;  2EQ6 A;  5HXI A;  3EF6 A;  3FPZ A;  3KD9 A;  5FS6 A;  4H4Q A;  3F8P A;  1NG4 A;  4H50 A;  4K7Z A;  4CBQ A;  4YTN A;  4EMJ A;  1XAN A;  2GR2 A;  2XFU A;  3ATR A;  4H4P A;  3PO7 A;  1GRA A;  2JKC A;  3ICT A;  3F8R A;  4K5S A;  5JCM A;  2WPF A;  1P2E A;  2XLS A;  1D4E A;  3KVE A;  3NK0 X;  4A7A A;  3WE0 A;  3CND A;  2J3N A;  2OLO A;  4A5L A;  4Z2U A;  2VQB A;  2YVF A;  4B66 A;  5EB5 A;  1BGN A;  1H86 A;  4H4Y A;  2Q0L A;  3RHA A;  1K0I A;  1H81 A;  2GAH B;  2YLX A;  4H4U A;  4YKF A;  1Y56 B;  2Z5X A;  3RP7 A;  1PJ7 A;  2C76 A;  2YG6 A;  3AED A;  3C4A A;  4B65 A;  2GR3 A;  4Y4N A;  1PBB A;  2WU2 A;  3DH9 A;  2EQ9 A;  3BNM A;  2XVJ A;  3LJP A;  1NPX A;  3NN6 X;  2YR4 A;  1K0L A;  2XFN A;  3JSK A;  3P4S A;  5EB4 A;  4A79 A;  4C3Y A;  4DSG A;  4J2W A;  1Y0P A;  3AB1 A;  3DK4 A;  5IQ4 A;  4YWO A;  3NT6 A;  1S2Q A;  3ALJ A;  3AE1 A;  3BI2 A;  5JCI A;  2QA1 A;  1JOA A;  2CVJ A;  3NLC A;  3SQP A;  3DME A;  4C77 A;  3H8I A;  1B5Q A;  4YTP A;  4U8P A;  5U1O A;  1S3E A;  4BK3 A;  3CPJ G;  3ATQ A;  4H2R A;  1GET A;  2C4C A;  3BHF A;  2ARD A;  4U8K A;  5KMR A;  5M0Z A;  3VR9 A;  4U8O A;  2WEU A;  4GAV A;  1VQW A;  2YG3 A;  3T0K A;  4ADW A;  1AOG A;  1Y56 A;  5JCL A;  3QVR A;  2V3A A;  1HYU A;  2BK5 A;  4FK1 C;  1E1N A;  3AE3 A;  3UTG A;  3UKP A;  2BK4 A;  1F8W A;  2UZZ A;  1IUT A;  1E1L A;  4KPR A;  1PBD A;  3LXD A;  4NTE A;  3UKH A;  3UP4 A;  5FS9 A;  4GCM A;  4YTM A;  2XCG A;  5HY5 A;  3VQR A;  4C74 A;  1IUS A;  1L0V A;  1GT8 A;  4ECH A;  3DGZ A;  2ZZB A;  1OJD A;  1XHC A;  4JNQ A;  4LII A;  3AE2 A;  1DJQ A;  2H89 A;  2X99 A;  2TMD A;  4HB9 A;  1PS9 A;  1S2Y A;  1F8R A;  1XDI A;  4ICY A;  3S5W A;  3UP5 A;  2WOV A;  3QFB A;  2WBA A;  1TYT A;  1PXC A;  4Z2R A;  1D7Y A;  3KA7 A;  1F6M A;  4JY2 A;  1XPQ A;  2XFQ A;  3COX A;  3SZW A;  5KWF A;  1EL8 A;  4I59 A;  2BRA A;  2XVF A;  2ZBW A;  1TDN A;  1ZX9 A;  2WS3 A;  1CJC A;  2ZZ0 A;  5KVH A;  1RSG A;  4U2S A;  3GMB A;  2EQ8 A;  3AEG A;  3NK1 X;  1OJT A;  3GYI A;  1CJ4 A;  2FBW A;  5IQ1 A;  5BUL A;  3AEF A;  3VRB A;  3SZC A;  4TM1 A;  2H88 A;  3D1C A;  5KRQ A;  2BRY A;  2EQ7 A;  2VVL A;  3HYW A;  1Q9I A;  3ADA B;  5L46 A;  3AE6 A;  3GWF A;  4H4Z A;  3DJG X;  2PYX A;  1BKW A;  4BUR A;  2WPC A;  4HA6 A;  5TR3 A;  4EQR A;  3M0O A;  3DK8 A;  4YKG A;  4U8J A;  3BI4 A;  2WET A;  3I3L A;  2XLT A;  2B9W A;  5DBJ A;  1KF6 A;  1ZP0 A;  2X8H A;  3SZ0 A;  2JK6 A;  2QCU A;  3CGD A;  1NEN A;  1EL7 A;  2IID A;  4M52 A;  1KNR A;  2FJE A;  3CGB A;  1PBC A;  3I6D A;  3GD4 A;  3OZ2 A;  3DK9 A;  4EMI A;  4JNA A;  4H4W A;  3SFE A;  2C65 A;  4B63 A;  4NNJ A;  4U2T A;  3RP6 A;  1JU2 A;  4GUV A;  1GXF A;  1ELI A;  1JRX A;  1YY5 A;  2VRL A;  3SFD A;  4RG3 A;  2VVM A;  3Q9T A;  3ALL A;  3P4R A;  3PVC A;  4K5R A;  2BXR A;  1ZOY A;  1NHR A;  4NWZ A;  2BK3 A;  3KKJ A;  2BXS A;  4A9W A;  5J7X A;  3P1W A;  3T14 A;  3LOV A;  4U8N A;  3AYI A;  1IJH A;  1E6E A;  1NAA A;  4K2X A;  2BS4 A;  4IA6 A;  4XWR A;  3GDP A;  4I58 A;  5KVI A;  1L9E A;  2BYB A;  5KOW A;  5BUK A;  4K8D A;  3SGL A;  5KMP A;  2A87 A;  3G5R A;  2B76 A;  4J33 A;  2E5V A;  1GV4 A;  3AEC A;  2WHD A;  3H8L A;  2YLW A;  1CJ3 A;  3NK2 X;  4AT2 A;  3HZL A;  3IHM A;  1VG0 A;  1E7P A;  4GR1 A;  1GOS A;  4YSY A;  4G6H A;  3L1R A;  2Z5Y A;  2RGJ A;  4FDC B;  4IV9 A;  4N9X A;  1JRZ A;  2BS3 A;  2FJD A;  2Q6U A;  3GD3 A;  1N4U A;  1GER A;  4BK2 A;  2ACZ A;  1GTE A;  3QFA A;  1BZL A;  1ONF A;  4TM4 A;  3T2Z A;  2C70 A;  1QO8 A;  4OPU A;  1NHP A;  3ABV A;  2X3N A;  3ISH A;  1MXT A;  4G73 A;  4GDP A;  3UOZ A;  1O94 A;  2YG7 A;  4H4X A;  2R4J A;  4G6G A;  4PAB A;  1YQ4 A;  3T37 A;  4C3X A;  4DNA A;  1RP0 A;  3HYV A;  1D4C A;  3NYC A;  1L9C A;  3HYX A;  4LU6 A;  4CY6 A;  4GDE A;  1NG3 A;  3T2K A;  4EIQ A;  1UKV G;  2GR1 A;  1ZK7 A;  1O95 A;  3NN0 X;  1TDO A;  2GEW A;  3ZYX A;  1DJN A;  1PBF A;  1CL0 A;  1BWC A;  3AE8 A;  3SZF A;  2NPX A;  3H4K A;  4BJZ A;  2F5Z A;  3NTD A;  1BGJ A;  3B3R A;  2YWL A;  3KPK A;  2GV8 A;  4H2Q A;  3NH3 X;  4TLX A;  3FG2 P;  4USQ A;  3V76 A;  4YT0 A;  1H6V A;  1N4W A;  2BC0 A;  1W4X A;  3LZX A;  3Q6J A;  2OA1 A;  5EOW A;  3AD9 B;  1JNZ A;  2YVG A;  2V3B A;  1FEA A;  3NYF A;  4GAP A;  3S61 A;  4AP3 A;  3KLJ A;  1LPF A;  2WPE A;  3AWI A;  4APN A;  2Q7V A;  3CIR A;  3NHO X;  3NG7 X;  4XWZ A;  3D8X A;  4H4S A;  4CNK A;  2FJA A;  4JN9 A;  2I0Z A;  4D03 A;  2A8X A;  2CUL A;  2Y6R A;  4D04 A;  1VRQ B;  3P9U A;  4ZCC A;  2GR0 A;  2BC1 A;  2W0H A;  4OPG A;  1H83 A;  2CDU A;  4Z44 A;  5KOX A;  2R46 A;  4WCT A;  2RGH A;  3BI5 A;  2XLP A;  3CMM A;  3IC9 A;  5LV9 A;  3QSM A;  2YM1 A;  4J57 A;  2O9Z A;  4X9N A;  2JB1 A;  2R0P A;  1COY A;  1K4Q A;  3AE4 A;  2B9Y A;  4WX1 A;  1H7X A;  2C73 A;  2NVK X;  4YSX A;  3SM8 A;  2FJB A;  4UP3 A;  2GAG B;  2C66 A;  4U2L A;  3AE7 A;  3VRD B;  5EBK A;  3CN8 A;  3UTF A;  2XFO A;  4J56 A;  1PJ5 A;  2CFY A;  1KNP A;  4H2N A;  4NTD A;  4OPL A;  1VDC A;  3AEB A;  1PBE A;  4A65 A;  3EAO A;  1YKJ A;  4GF7 A;  1FEB A;  1B8S A;  1E1M A;  2WES A;  5GRT A;  1OJA A;  2QA2 A;  1F3P A;  2VQ7 A;  2YVJ A;  4E0V A;  2YR5 A;  2Y6Q A;  4EQS A;  1NEK A;  2A89 A;  1K0J A;  1OJC A;  3QVP A;  3GRT A;  1GRG A;  1B4V A;  1IUW A;  1YQZ A;  3AXB A;  1ZMD A;  4MJW A;  2QAE A;  2HQM A;  1PXB A;  3G5Q A;  4RG4 A;  4TM0 A;  5CQF A;  2WP9 A;  1CC6 A;  3FMW A;  3BNU A;  1GAL A;  3CTY A;  1D4D A;  1LVL A;  3NIX A;  2V61 A;  4CRT A;  4REK A;  4AP1 A;  3PS9 A;  2B7S A;  1N4V A;  3IF9 A;  3BHK A;  3F8D A;  3K7T A;  4OCG A;  1MO9 A;  1FCD A;  1PHH A;  4PAA A;  3UKF A;  1E1K A;  2GRT A;  4OPD A;  1H7W A;  2PHH A;  3V3O A;  3G5S A;  1DOC A;  2AAQ A;  3CNS A;  4U8L A;  5U63 A;  2WP5 A;  5FS8 A;  4H4V A;  5BRT A;  1EBD A;  1EL5 A;  4YSZ A;  1V59 A;  5FS7 A;  2BA9 A;  4CCR A;  1CBO A;  4O5Q A;  1RYI A;  2WOI A;  2C3C A;  4Y4M A;  2YLR A;  3K7Q X;  5U25 A;  2GH5 A;  1EL9 A;  2VVL G;  1P2H A;  2YR6 A;  2YG4 A;  2OAM A;  3II4 A;  2E4G A;  3K7M X;  5KMS A;  2C3D A;  1CC2 A;  3P4Q A;  1BF3 A;  2Q0K A;  3CGE A;  5HHF A;  1REO A;  4B69 A;  2X8C A;  4YXD A;  3NNE A;  3QSS A;  2JBV A;  2E1M A;  3GYX A;  1KFY A;  2APG A;  1GRE A;  3ITJ A;  3UKL A;  1M6I A;  3AYJ A;  3ZDN A;  2XYO A;  1H84 A;  3AE9 A;  1GPE A;  4IA5 A;  3DJJ A;  2WDR A;  4O5U A;  1L9D A;  2R9Z A;  4OPC A;  4BJY A;  1KDG A;  2GQF A;  3T2Y A;  3UKK A;  2GMJ A;  3NGC X;  2JB2 A;  4CCQ A;  3AYL A;  4USR A;  1H82 A;  1GRH A;  1GRF A;  4Z43 A;  3LZW A;  4KX6 A;  4EQW A;  2C7G A;  1Q1R A;  3B6D A;  4RSL A;  1PDH A;  4J31 A;  1FEC A;  4H4R A;  2IVE A;  4IVO B;  2B7R A;  2R0C A;  1FOH A;  4Y4L A;  5CKU A;  4B1B A;  1D5T A;  3CNP A;  3SY4 A;  1ZMC A;  3C4N A;  1LTX R;  4JQ9 A;  2C64 A;  4H7U A;  3DGH A;  3ALM A;  2OAL A;  5JCK A;  4B64 A;  1N1P A;  4BV6 A;  3L8K A;  1DOE A;  2BAC A;  4A99 A;  3NTA A;  4FX9 A;  2C72 A;  2XDO A;  1MOK A;  2WDV A;  3QSE A;  2JB3 A;  1DNC A;  4JDR A;  3DJE A;  2B9X A;  3CNJ A;  2GMH A;  1CF3 A;  5C3J A;  2BCP A;  4X4J A;  3UKA A;  3T31 A;  2XVE A;  1QJD A;  2V6O A;  4NEW A;  4U8I A;  3E1T A;  3KU9 A;  1GEU A;  3LAD A;  1QLB A;  4II2 A;  3GYJ A;  1O5W A;  4NZH A;  4NTC A;  3V3N A;  3VR8 A;  1D7L A;  3CGC A;  2BS2 A;  1IUU A;  4II3 A;  3URH A;  3SXI A;  4UDR A;  5J60 A;  5M10 A;  3RNM A;  1Z6L A;  1F8S A;  3NYE A;  3IHG A;  2YM2 A;  2AR8 A;  3GRS A;  4GRT A;  2R4E A;  4OPT A;  1E39 A;  2C75 A;  3AEE A;  1PN0 A;  1ZKQ A;  3SX6 A;  4EM4 A;  2RAB A;  2XVI A;  2VOU A;  4FK1 A;  4G9K A;  3LB8 A;  3RED A;  1KSS A;  2XFP A;  3KPF A;  4OVI A;  3EAN A;  4JY3 A;  3DA1 A;  4AT0 A;  4Z2T A;  3UOV A;  4NEV A;  2WOW A;  1JRY A;  3NKS A;  2GB0 A;  5HYM A;  5GSN A;  2VZ2 A;  4TLZ A;  1JNR A;  3O0H A;  3CPH G;  3UCL A;  4OPI A;  1FL2 A;  1S3B A;  2GF3 A;  3QJ4 A;  2V5Z A;  4B67 A;  2XVH A;  3NRN A;  4A6N B;  4P9S A;  5FMH A;  1JEH A;  1DOD A;  1DOB A;  4EM3 A;  1NHS A;  5IPY A;  1GES A;  1YQ3 A;  4AOX A;  1GSN A;  4EIP A;  1CC4 A;  4U8M A;  3VRA A;  5BVA A;  5KMQ A;  1VG9 A;  3UOX A;  1PJ6 A;  4J36 A;  2BCG G;  3AD8 B;  3GDN A;  2JAE A;  1DXL A;  4DSH A;  3CNT A;  5C2T A;  4Z25 A;  3AD7 B;  1CHU A;  1GTH A;  3UTE A;  2XLR A;  1B37 A;  1TDE A;  1TYP A;  1ZY8 A;  2WP6 A;  4H4T A;  4LA1 A;  4EMW A;  2ZZC A;  3IWA A;  4AOS A;  2AQJ A;  3R9U A;  4G74 A;  1NDA A;  3AEA A;  3EPT A;  1LJ1 A;  1X31 B;  1IUX A;  2BAB A;  2R45 A;  3K30 A;  3P4P A;  4ZN0 A;  2X8G A;  2RGO A;  4TM3 A;  2YLS A;  2IVD A;  3RP8 A;  4B68 A;  1M64 A;  3GSI A;  1KSU A;  3ICR A;  4H2P A;  1CJ2 A;  3CPI G;  4IVM B;  4XXG A;  3GMC A;  4CY8 A;  2DKH A;  3M13 A;  1PXA A;  5ER0 A;  3GWD A;  4CNJ A;  4A6N A;  1LQT A;  1LQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...