3UP6A

Crystal structure of a putative cell adhesion protein (bacova_04078) from bacteroides ovatus atcc 8483 at 2.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
324
structure length
322
Chain Sequence
b'TRAQLSIDLVNNVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BACOVA_04078
publication title Crystal structure of a hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483] (ZP_02067074.1, SP17169A, JCSG 417104) from Bacteroides ovatus ATCC 8483 at 2.80 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
total genus 73
structure length 322
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A01
2.60.40.3380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A02
3R4RA 4JG5A 4GPVA 5DHMC 3UP6A 4JRFA 4RDBA
chains in the Genus database with same CATH superfamily
4FJZA 5SWZE 1UWFA 3HRZC 1I9EA 5AB1A 5F96L 1P9MC 5KVFL 5B3JF 5HHME 3T1FA 3IGKA 2FWLB 3P0VH 5KVDL 4NNXB 1DN2A 1NLBL 3MX0A 4KITB 1YN6B 3S8GB 1CYXA 3GSQB 3DURB 4JFFD 2DBJA 4HKXB 1UACL 4NO0D 3ZZ1A 1NCNA 4L8SC 1RZGB 5JLZB 3BT2L 1OAZH 3CSGA 4FA8A 5IW6B 4PJBA 1D2PA 3FSWA 4D9QE 1DVFD 1DEDA 2P8LB 2XN9B 5E2UL 3QZPA 4NZTL 3SD5A 1HAWA 2ICCA 4PRAB 3CLEL 4XCFH 2OMVB 3RTQA 1KFAH 4DN3L 1Q1JL 2R69A 1GC1H 5FS5A 4PS3A 1T20B 2OSLA 4BFRA 4U0RB 4RQQA 1AIFB 3EO1A 4OCMC 1R3IH 4OF5A 5ISZA 3OV6A 1FO0H 1NCCH 3GZQA 3RE0A 3GLAA 3MUGB 4RZCA 2XN1A 2HJKA 1CFVH 1FPTL 2LAGB 4ALAH 1OKEA 5DA4A 1NAML 3KYAA 1J1OL 5DJDA 1SYSA 3G6JE 3VD5A 4HV8B 3MZTA 3MXWL 2D7TH 5BRZA 4FHKA 3OSVA 3WEBA 2IWKA 5F9OH 1FIGL 1Q0YL 4I0PA 4E9YA 4U3SA 2XU9A 3EHBB 5FHAL 1KN2L 3KLAA 1G6VK 3B8YA 2Y1AA 4JPWL 3D6GA 3D69B 4IU3B 1F90L 1XV8A 1BD2D 4PUBL 4Z7VE 4CSTA 4N3TA 4ZUSB 2EKJA 2VN7A 2AEIT 1IT9L 4R2GC 3FT4B 3VACA 2CGRL 2O6CA 3TBSA 5TTRA 2RA1A 2WWMC 4HQQL 5DDHA 1BJ1J 4N5ED 3D0LB 5DMIL 4TULL 3EGSB 3VYPA 3OHXB 4JL2A 3FBQA 3BH9A 4PJ8B 1Q9LB 2ATAA 2C9QA 2YO3A 4KDTA 1UD4A 4JAMB 4F9LC 1K2DB 2DQEL 1F6AB 5H4YA 4Y4FB 5F2FA 3E8UH 4NKIH 3BZEA 4Y1AA 2Y2YA 2YOCA 3WY4A 3G9VA 3RUGE 3ZYOA 2D31B 3ARBB 4OZHF 4A2EA 2SODB 4ZOCA 3O2WH 3N40F 5GRXG 5EZLB 2H2PD 2RALA 2W65A 4YAQB 3ZDZE 2DYSB 1NSNL 4JQIL 1MW3A 3PXJA 3S35H 3CZEA 4N8VB 4MHHG 4R83A 4X9HA 4H44C 4AUUA 3CFJB 3GMNB 2QJDA 1ZTXL 4ZXBC 5JHMA 5K5YA 5HDBE 4IKKA 3IKKA 2HPTA 1UEMA 4XVJL 5B1JA 4F8OA 1JHKH 3M1BB 2KC0A 3S3BB 2YRZA 4NLAA 3H4HA 1QEWB 1VF5C 1DVYA 4PB0L 5EZOH 2WSKA 3AG3B 2J1KA 5AVWB 3TZVC 5EU5B 4DEWA 2IQAA 4ONFH 1J8HA 2ZF9A 4K7FA 1FL3B 2FEEI 2NLJB 5C09B 4MZRA 3SKMA 4D8PA 3G04A 1ULVA 2X89D 5KVGH 1RCYA 2NY1C 3VFOA 2Q7AA 1NAMB 1CDIA 2ADJB 2CHNA 3GIVA 4LP5A 3REVB 2HWZL 4QHKI 4DERA 2ADGB 2ARJA 4IRJA 2CBMA 3ARFB 3ISRA 5TF0A 1MRFL 4OJFH 2P1YA 1PKQE 4JO4H 4UV4L 1TT6A 5T3ZL 1V8HA 3UZVB 3RKDD 4HVBA 4HEPG 3UBXA 5A2LH 2HJFB 4LVEA 2AJ3B 4OD2B 4BZ2H 3ZK0A 2Y7MA 3KJ4B 1E7VA 2FQFA 3IDIA 3ECBB 5F7EL 4RX4A 1F11A 2Z7UA 5CLXA 1QP1A 3NIGB 2EZ0C 5AW7B 1A6TA 1EX0A 2ENSA 1FNSH 1TTAA 3A5VA 3K6SB 1MFNA 4UOJA 1AD9A 4FNLH 5K33A 5PCYA 2HFFA 5LGJB 1UB5B 1U2HA 5EUKA 4ZO9A 1A4BA 3L7FB 4HUNB 3VXSE 2M8XA 2YMXH 5C9JB 1YQVL 3VWJB 1NC4B 1BEXA 6PCYA 5IJKC 2J8UA 1DO5A 1SLXA 4XP4L 1A14L 3L4WA 5I8EA 4TNFA 3CSBA 2JXMA 4JUTA 3UBGA 3CFIC 3AREA 4ZQKA 4WHDA 2XKSA 5FUOH 3NQIA 1KJ3H 4KH9A 3RNKB 4UAOB 4JKLA 1P84K 1FLRH 3PP3K 1AKJA 5GS0H 4ZO6A 1EANA 1EVTC 1F8TL 4HEMA 4AM0Q 5FYKH 2G2RA 4AL8L 4XNDA 5D1XE 3RA7H 4AGPA 2NTFA 4JGMA 5KSVA 5I71B 2Z4QB 3L48A 3MNZB 5FYJD 1GHFH 4PJDE 4LCWA 1ZHNB 4TL4A 3UYPA 4BIKA 3K72B 3EYVB 4LESA 1ZV5A 2XG4A 4XBGB 5JIDA 4Z76B 4HWBH 2BWQA 2WQWA 2ZD0A 3HR5A 3U7YL 3SE8H 2DW5A 2EEFA 4O9HH 2AXGA 2CNYA 3P4OB 3NCEB 4UM9B 2CDGB 1IE5A 3TJEL 3D5OF 2ENQA 5DJ2A 2C9UA 4XP9H 1S7WB 2QQNH 4Q0XL 4Q2ZB 5BV7C 1C5DB 1KPVB 3SDDD 1YECH 1KCUH 2N0KA 5C0IA 3B7UX 4Z1PA 3CVBA 1KBWA 4WUUD 5DD5H 4MLSA 5DZNA 1R33A 3CSTA 5EPMA 2V2TA 4BM7A 3IMWA 1QBAA 3FFCE 3MLPA 1K5NA 4K9JA 3ZZQA 3S5YA 3F6IA 3F7RA 3FH8A 2AITA 4JJ5B 2JKNA 1S9KC 3PWJB 3X2QB 2OFQA 5J3HD 4MXWH 3AQDA 3WKMH 1W0VB 4Q6IA 2A6KB 4OLWL 4OV5A 1QZ1A 3CN2A 4UM8A 5LCVA 3IE9A 1RLWA 1AC0A 1VIWA 4PRPA 3SE9L 2FEJA 3T08A 1S8DA 1PG7L 3CAFA 1PSKH 1FVEA 2P42B 2GJRA 3PAVA 4N2BA 1IEHA 3ECWA 3ZKND 3WNOA 1R5WA 5DFWH 1RD6A 4M5SA 3ZTNH 3NFNA 3W56A 4XC3L 2I69A 2VIRB 3L5JA 2PW1A 1U36A 4R96B 4G8IB 2WLLA 2BNRB 5KSAD 2VDMH 2ZYHA 3NJXA 2VDNH 5ERWB 1ZVYA 4GEIA 4GW4A 4UYPA 3ZVVA 1KIRA 1CXFA 4YSDA 5KYYA 2FGZA 3KCWA 3QIBC 4CC4C 4RDQG 2VISA 3BKYH 3BVTA 5KZCB 4MXVF 2VDKH 5AVTB 3GINA 3B3IA 3T2NL 2ZXQA 3ZKSD 5DLLA 5CJOH 1AXIB 2H0PA 1M05B 2D9CA 4IGBB 3V5KB 3WGVB 1A7NH 3F12A 2W8CA 2VSDA 3QUHA 5FA3A 5GRUL 3HI6L 1L9QA 3F58H 3VSUA 3HS9A 4OM0L 5FHBH 5L4FA 1K6QH 5JHLH 2OK0H 2ATPB 3QQDB 2C9XA 4MZIA 4PGBA 1GY2A 3HZKB 4L8DA 3CVHH 1ETB1 3P3SA 3RNQB 4UT7L 1YA5A 3ULVH 4LAQH 2JKSA 5EU4B 4I88A 4M6OL 2AGJL 1NDTA 1RZKC 3FFOA 4QRRD 3SBRA 4AY0A 2B3RA 1QRNB 2NXYD 4MFHA 2AQQA 1BDYA 3HBQA 1YMMB 1FG2B 1NAKH 1QSFA 3ESUF 3IF1A 3CPUA 5BQ7A 4QUOA 4FQCL 1PDKA 1YY8B 4P48A 1R0AH 4JQVA 1JGEB 4LOUD 3WTWA 3BYTA 1NM9A 3KPMA 3TU6A 1H8LA 5IB1B 2NY7L 3GM8A 1L9SA 2BFGA 4OD1L 4UILH 3V4PL 2WJ7A 3VRLF 1CICC 2KZWA 2CH8A 3TWCL 1QFUL 4PS4L 3NEXA 5HI5D 3HA0A 3CLFL 3EDDA 3SY0A 4LARH 1AYRA 3RY5A 5AAPA 2PYED 2ZUQB 3ZT7A 3VMPA 1SBSH 1HSAA 5L2KD 3RIFK 1A4KA 3A6BL 1F2XK 3AS3A 3UC0L 3G5YB 3WFDH 5JMOC 1V7ML 4FLRA 1LO2L 4QXUL 3SOTA 2UY6B 3WO3B 2DTSA 3QUXD 1YNLH 1VA9A 3X1EA 4Z7QB 1G9NH 3WE6A 2VZVA 3MAWA 3NPSC 3LXBA 2I25N 2FO8A 4UV7L 3FRUA 1GW6A 3BKCL 1QNZL 1KGIA 4HKZB 3VM5A 4U6VL 1CQYA 3QAZB 5LQBL 3VG9C 4PTTB 5SV3A 2CSPA 3DTXA 3H42L 4TSBL 3D12B 5DS8A 2D2OA 4A39A 2B8OT 2BP8B 3CDYA 3TYFB 5JW4Q 1IVTA 2CWRA 3BUTA 3ZR6A 4F3FB 4RISH 3L3GB 3TBWB 2ZPKH 4NUPA 4ODSH 2RAMA 3WY1A 2DM3A 2EDRA 3DC0A 4LHUG 1UGNA 2N4IA 4HF5H 3X13B 2BJMH 4ZO8A 4KJWD 2YXWA 3RTQD 1U8IB 2BMKA 3N85L 2XQYG 1TCRB 3E2HC 2XTJB 3PQYE 5AOLA 3U46A 4X6FA 1XCQA 3N9GH 5HHOB 3QPXL 5ISZD 5HHPB 3GXDA 3RDJA 3VFPA 2EDMA 4OFDA 1WO2A 1NM4A 4GJTB 2A4EA 4MGXA 4ZRGA 5HY9A 4ZAKA 1YAZA 3PWVA 1A7BA 4NAMA 1EAOA 1A8JH 3D3VE 1XF3A 2ZOKB 3KZ8A 1HZKA 3IDXH 1INQB 4KVNL 3S3SA 2EIMB 2IAMA 2K8MA 2P43B 3LRHA 4Y19B 5BRZD 4D8OA 4XI5C 2BY2A 5JYLA 1AOHA 3WGUB 4I0PD 2LU4A 1JPSH 4ZSOE 2A73B 4YX2L 4GW5B 2IALB 1CFNA 3UBXI 2CLZB 2G3NA 5GGSB 2N3JA 5F7KC 4DP1X 4O2EA 5IBUB 3QG6A 3GZKA 5CSZB 3O9WC 1I3VA 5HHVH 2E8YA 3AQZA 4FQ1H 4NQDB 5D96B 5TQ2L 3BUYA 5C0CB 3TESA 3MLZL 3CHRA 1WHPA 2R0WH 4XTRD 4ZFOL 3OZKA 2DWSA 5JXAL 4I1NB 1JWMA 4JFFE 4UANA 2HFEB 4BKSC 2YRLA 1REIA 4FZEH 4QRPA 3NJKA 3TN0C 4AT6A 1CE6A 3OKEA 4L1BA 4Z3FA 4NQTA 4Y16A 2EC9T 1UM4H 3CCHB 1AGDB 4Y1AD 5DEGA 3VE0B 5L2JB 5I6OA 1HHJA 3FCBA 3WXVL 2P48B 4WK0B 4HHAA 4X6DB 5BVPL 3EOTH 3MJ9L 4HH9B 2XG5A 1L7IH 2EIZB 4AG4H 1NCBH 1RSFA 1ERNA 4I8DA 1CDHA 1D7BA 1A7OH 1NIFA 1TLKA 7FABH 4HIQA 4QAMB 1RZ7H 3U30C 1MHEB 1U8LB 1NEUA 1NUNB 4ILDA 4XMWA 4YHZH 4BWTA 3AMLA 3BIBX 2APSA 3U4AA 4LEOA 1AG6A 1OAYL 1L0QA 3C6LC 2KPNA 1TIUA 3N50A 4LK4A 1A5FL 3ZMRA 2JF1A 1PGRB 3CU1A 4IJ3C 5F72S 3QJVB 4FQXA 1NPNA 2GC7C 4N6RB 5DLMH 5DZOA 5DJ0A 5I23A 3TO2A 4ODVH 4RAVB 3C87A 5DO2C 1J8HD 1RMFH 2Y2WA 3EO0A 4OJEH 1FSKB 5E5RB 2D3LA 1K3IA 4I87A 5HYJA 1AQMA 2R27A 1EGJL 1OV8A 1T3FA 4PMEA 3IJHA 2IGLA 3FU8A 5CD3A 4XO8A 3N41B 4J3BA 2B5IC 3BH8A 3ZL1A 1ZPLA 2XA3A 1SLVA 4IRJD 1IM3D 3VWKA 3WXWL 1M3JA 2B77A 1HKFA 3O6LL 3Q2VA 1A0QL 3CFEA 4Q9QH 1IBYA 4ONGH 2ZSWA 3CFKB 1KTBA 1IAOB 1ANUA 2WBJB 3QJFB 3KGUA 5MHSD 4HIJA 4RX4D 2FATH 4KTGA 2VR3A 4FFTA 2VH5L 3LRSA 1ASOA 1D5IL 1IBZA 3GKZA 4FL4B 2IOOA 1PYWA 1ZA3B 4ANKA 3DX9A 4AGNA 4YHPB 5A3ID 3WD5L 3KYOB 3LIZH 3FQXA 4CU6A 3P9LA 4YHMH 2OYLA 3SDXA 5B7FA 3B6SB 3AXIA 4B0MB 2BX5A 3WKNA 4ELMF 1PCSA 1D9KC 35C8H 3WCYA 1MW0A 2W9DL 4PV8A 4ZFOB 2EILB 3UPAA 4HPYL 1ACYH 2QSTA 3MDJA 1QABA 4LMQI 5TE6L 4UT6H 3CH1B 3SBWC 1DLFL 2WXFA 4GRWB 4HWZB 4QYAA 4EI6A 3EFFB 1J9SA 3ARED 4PCKA 3U0WL 3MRPB 4PG9A 2W80C 1L9PA 4PR5B 2AJVH 2Z8VC 1V7NL 3B2VH 1JWUB 3V4VH 3ROLB 4J3OC 3BAWA 1L0YA 5F1NA 1AKJD 3FCUB 3L95A 5IEKA 1VPOL 1G4MA 4IU2A 1P2CA 4JZOA 3PV7A 3V6ZA 4GI9A 4A68A 1MAKA 3FUKA 1B0IA 4HMCA 1GGCL 3UJJL 4LCWD 4WEEA 1NINA 2LU7A 4K71C 3FYIB 3FU6A 4JG1L 2C9AA 5MENA 1UZ8A 2EUZA 2VXUL 3HB3D 4OIIL 2JNZA 5FGBC 2RQ8A 3SE4C 1H15A 2BRRH 3R19A 4OAWB 4JR9H 1ZT1A 1QR1B 5JUEH 5E1QA 5EOTB 4XNAA 1J0YA 3BUBA 2BNQB 3NBNA 2IPKB 4ODWB 5ITFB 4KNSA 3GI8H 2WIIB 2CKBL 4P2CG 2AJXL 2TRYA 5DUBA 3CDZA 2BP3A 1SY6L 2CMRL 3QHFH 2BY3A 1QSEE 4L9LB 2NNAA 2QVMA 4FQJL 1N12A 4AIZB 5K9OA 1INDL 1IC7L 4ABUA 1ZV2A 1NC2A 3B5HA 1IBDA 5DHXB 4N22A 1XH3A 1AS7A 1MH5A 3L9EA 2VXVH 4BKLA 4PG2C 2VSCA 4AH2A 1I7RB 2V7HA 1RZ8A 3PWLB 3STBA 4NHCL 3S8FB 3TCLB 4PRPD 1E4XI 1IAMA 2UV3A 3BCFA 1N7MH 1RSYA 2HLFD 2PW2B 2XJKA 4H8WH 1P1ZB 4ICXA 4KC3B 4OLXL 5EIIG 1CS6A 2IAAC 3MA7A 3OL2A 4PI2A 3IRCA 1ZEAL 4WI0A 4X7CC 4FZ8H 2VXQH 1S9XA 5E03A 3WJLC 3RX7A 1X7QA 1O7SA 1ZHKB 2OMWB 2WLMA 3HNSL 3MRDB 1VFOA 1NMCB 3NGBB 3PNRB 1U58B 4JB9L 4O5LH 4E5XA 3RDTC 5KVEH 1GTNA 5DD1H 1MCFA 3R8BB 5CGYC 4GFXA 3F7VB 3WFZA 1HSBB 5IJDC 3ZU8A 1ZLSH 3M6DA 4B41A 4Z78A 2EDXA 2Y07L 2GJ6A 3FSOA 1IGTA 3L5WB 3NIDB 3WUZA 1XZ0B 2YLHA 3FQ4A 4NFCA 3B34A 4N0YL 4P2RD 3QGVA 1U33A 4N0UE 5FA4A 1M9SA 4ZMWA 3P4MA 3G6DH 4MAUH 3DWTA 3QDGA 2PNDA 5BVJB 1LE5A 2IOMA 1YJDL 4L48A 3R18A 4Y1TA 3UTQB 4TTGA 3C60C 1PVHA 5JHBA 4PQXA 3FO2A 3W9EB 3ZDYF 4Z7NE 1LK2B 4BZYA 4WNQA 1LQBC 1A6UL 2X28A 2BVOA 1PD0A 3IN2A 1G1YA 5F9DC 3WIFB 5B21A 1ZT7A 4QRBA 2ZYRA 3P9MB 1T2QH 5E70A 5CXPA 5AZEL 1A8ZA 3T4AC 4LASH 1UXMA 1QSFD 4KJQC 2JCCA 2XA8L 3POHA 4R26L 2OXHB 3H2QA 2LLNA 1KLUA 3HNVL 2CKBB 3R1GL 1U8JA 3IU3B 3BKML 1TXKA 1AG0A 1WCQA 3LKRA 1MW1A 6FABH 3ULUF 1MCOH 2WWNA 1OALA 4TQHA 1I1AC 3Q8CA 2Q8BL 3Q48A 5K39A 4GOSA 3MACH 4EN3B 2UWEE 3MLRH 4W9DC 5I6KA 4G3YL 4JCMA 2C1PA 3ARTA 1NWPA 4GH7B 3D52A 1FAIL 5I0YA 2JKJA 4PJCA 2F53A 4PJHE 2WKOA 4YHYB 1HXYA 3N06B 3BLPX 3OAUH 1UA6L 1W2KT 5ADPH 3OZ9L 1UJ3A 3AT9A 3FRPG 3IDNB 2HUEA 5DA0B 4XNYL 3QI9B 1OE1A 3GMQB 3LIUA 4U1IB 5HGDA 3VQLA 2DBLL 3PWPE 1HH9B 3FU0A 4LZKA 3WFHA 2KBGA 3NJHA 5FKPA 1SJEA 3RX8A 2F7QA 1EFXA 1QFWI 2YN5A 3Q2NA 4MNQE 4W9IC 5IWLA 3MRLB 1I8LA 2DWDB 2F1EA 2YAOA 4HEPA 5H37G 4J8RA 1S7RA 4ZDHB 3RVUD 4YFDB 3T0EE 4OZIB 1C16A 4A2FA 4KZDH 1J1XH 3CIQA 4IBLT 2XWJA 4GG6B 5HVWA 5KUKA 5EV7A 4OW6A 5TPWL 3LB6C 3PY9A 2YA0A 3ETTA 5AYTA 1T4KA 2CHDA 2NPLX 5KVGE 2HAZA 4MCZA 2DTML 2JK5B 3LXCA 3ZHLA 1JGLH 4MQ7A 1JBJA 3GZOA 2H32H 1IC5L 1JRHH 1BQLH 2DS4A 1D5RA 2X2UA 3JTTA 4Y9EA 1CF1A 2AJYL 2GBVA 1QTYT 4MZ3A 4R4BA 4XAKD 5C0EB 2E9JA 3ZKMC 5ILTH 3SO5A 2BM3A 3UGEA 1M1XB 3A4EA 4M62H 4APQB 4Z9KB 3AT0A 3WNIA 3TM6A 3STLB 2EABA 4C83A 5CIPH 3TCTA 4NRZB 3FS9A 4CVZB 1CB4A 1CTOA 4ZAKD 5DHMC 4TS6A 3W1ZA 1GZHC 3SOBH 4UUJB 3RHWF 3ZXAC 3VFGH 1EHLL 3JV6A 5D2LA 3KH4A 1EEZA 3DIVA 2FIKB 2IAMD 4F80A 2PYEE 3CFTA 4BDVB 1UKQA 4ES9A 3BGFC 5L2KE 1PZBA 1K4CB 3B1UA 4XN9A 5KS9F 1URIA 4Z6AT 3TF4A 3JTSB 4U05A 3TVMB 2QBWA 1OF2B 3MBEB 5J9PA 1F18A 2I24N 3O8XA 3L16A 1EHAA 1T80A 3UZQB 5LBSL 2G5UA 4U7MA 2C4FT 1GW0A 4X98B 3LSOB 3PNWA 4PCTA 5F3HB 1KTLB 3DSFH 2YAEA 3P40A 3DJRA 4EJ1C 2ZWNA 4JKKA 5EBLA 1WZMA 4K9EL 2OJZH 5D1QB 1RK7A 4JFPB 1O7DC 3ARRA 1RURL 1KC5H 3HG3A 4QWWD 4B53A 3IVKA 3DROB 1N6QH 1I3RA 4NERA 4I9WD 4QRPD 3DARA 3OPZL 2GFBB 2WNGA 3UACA 3ZYJA 1OLLA 4DT2A 1KIUB 1DSFH 1CVSC 5FYKE 3EJPA 3BFOA 4Y16D 2O5ZL 5TFSL 4WV1A 4A2HA 4GW1B 4KGJA 2DIEA 1GGIH 2P24A 1G6RL 4NZRH 3EYUL 4MCNA 1HEZA 1GYVA 2ALWA 1U92A 4Z0XB 3KPNA 5IROC 4OLUH 1SN2A 4TTDD 2CBPA 1WFTA 5CFAA 3QO0A 2HTKD 5K9KB 4JN2B 3A6CL 1CBVL 1J8RA 2YPVA 3GBNL 4PY8I 4NCDA 2ZXEB 2LU5A 3ZE1F 1H3WM 4XH2B 3VI3B 5E08H 3KPLB 4G71B 3ME0B 5GZOC 4PH8A 4YHKH 5D2NB 4AV5A 2HFTA 4OM1L 3OKLA 4JFDE 4FQXD 1P4BH 2P44B 4P23B 2N7AA 3VO0A 3ARUA 2K78A 3ILPB 3O45B 3OD3A 1P5VB 3OKNA 5J13B 4X4XA 3V55A 4RAUB 3EJUA 3VFWA 3IDJA 4PJ5A 5HYJD 1QYGH 5CR8A 5GPRA 3DX7A 5ABZA 1DZBA 2UVEA 3Q8AA 1KEML 1PQZB 4HXAL 1ZA6B 3VXMA 2X4SA 4AYEC 1J18A 5JO5B 1G1OA 3PV6A 3VD0A 3VWKD 3O3EB 4WFGE 2DB8A 3TL5A 1RP8A 5DZ9A 3VFVA 5HI4D 2I07A 1BXXA 4Y5XA 2K8QA 4P3CL 1I4FB 1JCKA 5F96H 5KVFH 3N1GC 5IEHA 3NTCL 4Z77A 5KVDH 3BDXA 3UTPD 1NLBH 3NP4A 2APWA 2WINA 2WUCL 3LKQB 2FEDD 4G6AC 3CZUB 4Y1AE 5E0FA 2ITCB 1UACH 5DT1L 5B8CB 3BT2H 3VXOA 1C5BL 4PWEA 4G7VL 3M1CA 1E6JL 1RZQA 2Y69B 4LVOC 4QKXB 3VJ6B 1RIUL 5E2UH 1KV7A 4NZTH 3WDHA 3IGUA 3IJ9A 1S7VA 2GG1A 1MWAL 3CLEH 3T0BA 3WTXA 4DN3H 1Q1JH 4XCNA 3ZIYA 5E0QA 4HUXA 4IIZA 5GRVK 1B4LA 4K8RD 1GMEA 1GS8A 3JWNH 3U6XA 2FT8A 5FO2A 1NDMA 5IMOB 1ZCRA 3LQZB 2LV4A 4NO5A 1G6RB 3SIKA 5F44A 5J6SA 3D0VB 5E4OA 1OT4A 5LLIC 1AS6A 3ZE2B 1MZZA 1G7LA 1G0XA 1G9HA 3BE1L 3LEXA 1TQVA 1NAMH 4ABWA 3ULVE 1J1OH 4XMVA 4F92B 4L3EE 4P06A 3BUDA 5I76B 1J8HE 2CDFB 2UX7A 3PXLA 5G4OA 2GK0B 3EKCA 3MXWH 1UA3A 4HLZG 4I9XA 3FCSA 4CU8A 4R5XA 4ZMYA 1NKRA 1FIGH 4XNZB 2JVUA 1Q0YH 3KGSA 1KGYE 1LD9B 3HZ3A 4FC3E 4N9GB 1KN2H 4IRZA 4ZMOA 4LCCB 4JPWH 2CK0L 5I9QC 1F90H 1SUHA 5MEND 4PUBH 3TBCA 3TGXA 1BLNA 1IT9H 1EBPA 2B9BA 5A6LA 1JV2A 1D5ZB 1AC6A 4PRDA 4X5WB 4X6CF 3E9UA 2CGRH 5E8OB 2X6VA 1BM3L 4ES8A 2E59A 2WLKA 4HFWB 3V52L 4HQQH 1P5UC 1QZNA 5DMIH 1FIEA 4FYSA 4I2XE 3UAFA 1ICTA 5IQ7L 4JHWH 2OSXA 4TSAL 3O4LB 2WVUA 1ZHLA 4DP2X 4OZGE 2DQEH 2F74B 4NNPL 4MKMA 2VCOA 4DVBA 2ZJSL 2Q0ZX 4NWTL 4QHNB 3S8WA 2EVFA 4P07A 4WKZB 2OJ1A 1BQSA 2W60A 3UC2A 4ZS6D 3WFCL 3WTVA 2FSEB 4LHUA 4L4VB 3B9KC 2Y5TB 1NC2D 1RZJC 2R39A 4WGWB 1PZSA 2XQYA 1EZUA 3MV7B 2SEBB 4PRIB 1L0XA 1WDAA 1NSNH 4JQIH 3GI9L 4OZFA 3NIFB 2FWUA 3FOMB 5F7NC 4BXVA 1OCOB 3NN8B 1ZTXH 1MREH 3T0DA 3PWNA 2N0MA 4ZPVB 3VXUA 4XVJH 5BZDB 2VQ1A 5EU7E 5EOQL 4RRPG 2EO9A 4FG6C 5SX4H 1MWAB 1UQSB 1RXLA 1DE4B 5F3BA 1BP3B 1S7SB 1LEKB 4PB0H 4KOBA 1TJHL 5AAWC 2LVEA 3VXQB 5DUJA 3WN6A 3DV6B 1K8IB 3GMRA 4ZMQA 1RK0B 1C5CL 2CLVA 5IUCA 4NUQA 4PJAE 1BFOA 5T5NF 2GJ6D 4IMKC 4U1SA 1OPGL 5CEYA 2DQDL 4E9QA 1HIML 1M7DB 3OLEA 5D7LA 3V8CA 2HWZH 4LFHG 2E3VA 2R1YA 2WVSA 2X9ZA 1MRFH 2XCMC 1X6NA 5L4JA 4UV4H 1I82A 2NXZD 5DJAB 5T3ZH 2LT9A 1DVFC 3HRZB 4XHQA 1Q94B 2EEDA 2AXHA 4WW1B 5D9SB 1JI2A 4HJSA 1SMDA 1VACB 4E9LA 3US9A 2D3NA 1USQA 2ZG2A 3L3HA 3QDGD 3MLTA 2DOCA 3SKNA 1MVYA 1Z5HA 4LIQE 2BSRA 5F7EH 3T04D 4LSUL 4ISVB 4LCVA 3KPPB 3G5XB 1DSWA 4L8SB 1T89C 1LK3L 2PXYC 2BIQA 4MDIA 3D9AL 3ZJAA 3BQVA 4F9PA 2F7OA 4XXWC 5IY5B 5KTEL 1XIWC 5CM1A 1LQSR 3T2LA 5HJGA 4PJGF 1YEGL 2Q86B 3A4AA 5MEQB 1UATA 3R06B 3Q05A 5TGBB 1YQVH 3KXFD 3KLHC 2OZ4L 3FCGA 3CQQA 3VD1A 4XP4H 1A14H 2Z7WA 2Z92A 1ES0A 5L8LB 2Z1PA 3ZTEA 3QISA 3DMMA 1BQ5A 3HI1A 2ZOOA 3MNWA 1NEZG 2F53D 4M00A 1XAUA 1ZGLP 2CD0A 1JPEA 4DZBA 4NKMB 3DPBB 4NKQB 4YZFE 1F8TH 1GR7A 1ML0A 1PLCA 3GJFB 4MD4A 4NENB 1Y18B 4NHUB 1AIZA 1BAFL 1ZMYA 4AL8H 4N5EC 5ESVA 3G5ZA 4PWIA 3AROA 3RQ3A 1J5IA 1AD0B 1PZDA 2EDTA 1RUML 2I5YL 3FJTA 4ZOAA 4CMMB 1J5HA 3HUJB 1J8KA 1RJZB 5D8JL 2Y4SA 4P2RE 4Y7OC 3TASA 2J57A 3ZSTA 4BSWB 4R2GB 1J10A 4U33A 1EFXD 1LEGB 3IT8D 4FFZL 1FL6A 4ORZC 5AKSA 5BXFA 3U7YH 1MFVA 4X8CA 3BWAA 2XTLA 32C2A 3KE0A 4HD9A 1P7KA 2NY6D 3BUQA 3GXFA 4MJIA 4F7PA 2GTWB 1KGUA 2B14A 1RJLA 3TJEH 3GMMB 4Q0XH 1I8IA 3QYMA 2H2PC 3GMOB 3II2A 1Y6NR 3PJLA 4XMTA 3DRTA 4NO3B 2ROYA 5DZAA 1XH0A 3ECVA 3EZJB 4HJJL 5E4IA 4ECNA 2X4PA 3MCLL 1IBBA 4HU8A 3SGKA 1YPZF 1SJVA 4Z0BH 3BXNB 3N43F 2H0EA 5DCCA 3RYMA 2AVFA 3VCLB 43C9B 4EI5C 1WBXA 3BUPA 4LSPL 2EUVA 4GBXB 2J2ZB 3TIDB 4ORGA 2OMUB 5DC4B 2QVIA 3FZUD 3PFQA 5HHQA 5E9AA 4OLWH 5I15L 4RSVA 2GT9B 4G9DB 4ZXBB 1TSRA 2TRHA 2FWSA 3ZN6A 5AALA 3SE9H 2HKAA 2XWEA 2YD6A 4RLDA 4YDLB 5I26A 4P4RB 1PG7H 2H9GB 3N1FC 4P2YA 3MRBB 4X0NA 1UG9A 5CWSB 2XX0A 1MFEL 1ZLWH 5GIRA 2DYPB 3OMZA 4XC3H 4OKVB 4DESA 2FL5A 1D6VL 3X1GA 1JUFB 3ZL4L 3O8XD 5CO1A 2QELA 1KB5A 3QRLA 5BUAA 2ROXA 3NESA 4FF9A 3RKDC 1TKWB 5E6IC 4MCYB 4LOFA 2OR9L 3CC5A 2VABB 2CU9A 4LPYA 3IM1A 2P8PA 5F7WC 4PHZA 1AI1L 5BS0A 3L3OC 1O75A 5DJZA 1N67A 3T2NH 4X99B 5KSBF 3I75A 1IAII 4FLOA 3SCMB 3BH4A 2EIEA 3T4YB 4LLDA 1XR9B 4FX5A 3L9RB 3WY2A 1S9YA 4R90L 2ZX8A 5GRUH 2PCFB 3HI6H 4WEMB 1OE3A 1X5JA 1NGWB 4AGQA 4OM0H 4N90E 2VT0A 2WWOA 5GISL 3OG6B 3Q8FA 1VFAA 3IMBA 5TE4L 3MGTA 2Y6TE 4UT7H 4BSVB 3G9AB 1UHVA 1Z9OA 2XIBA 4M6OH 2AGJH 4XAKE 2AEOA 2J7LA 3I6GB 2R9HD 3DI3B 1ODAA 4EMZA 3KVDD 5C7ZA 3OXRB 2YGNA 1BVNT 1LO5A 1P6AB 3N1PC 4FQCH 1YN7A 1T1YB 2WGXA 2Z35A 3NFPA 3QZWG 3ABZA 3GMPB 4XN1A 5EIIA 2NY7H 3BUIA 4OD1H 3V4PH 5JW5B 1Y0LA 2VLKA 1SXAA 1ITBB 4G5AA 3I02B 3TWCH 4PS4H 1L4IA 4PJ7F 3L81A 3O0RL 5IQ9A 3CLFH 4ZJ9A 1U8KA 3LRLA 5FUCC 5D4JA 4U1HB 1TU2A 2XZCL 1E3ZA 3KBPA 2WNXA 4JM0A 3A6BH 4PJ5D 5ABAA 1W72L 1GAFL 3UC0H 1U8PA 5JIIA 2DQJL 4JVUA 3NCYS 3GXTA 3BIKB 4JK0D 1V7MH 3VXMD 1LO2H 4QXUH 1FYTE 1AVAA 4Y2OA 3H4FA 1YRKA 1OE2A 3GJEB 3Q9QA 3Q6GH 3WKQA 3SDDC 1Z32X 2VL5A 4HSQA 4M5YL 1RZKL 2Y24A 1TZAA 3BKCH 1F45A 1QNZH 1KTCA 3IFPA 3MRRA 4OJAA 3DGCR 4Z7UB 4U6VH 5AVYB 4CVXA 3EFOA 2XIDA 4YPGA 5LQBH 5D7IB 3RP1A 2AXFB 2CQVA 3EGXA 1JI1A 4KGLA 4YFEA 3H42H 3JXAA 3FFDA 4TSBH 5A2FA 1I1YB 4CC1A 1JJUA 3M7OA 4K7PH 3ZHDA 4ENED 4ZMAT 3UTZA 1JOIA 1MWOA 2X2IA 2HSIA 3BKJL 3O6ML 5J3HC 2BVUA 4FXGB 3TH2T 4AQZA 2XQYK 4G2AA 2R29L 4LDOB 1W0WA 3N85H 4OZ4B 2W59A 4YDVA 5AAMC 7CGTA 1MLCA 1JNHA 3LKSA 2H26B 5IKCA 4CN1A 1DCLA 1HH6B 1J05A 1PTZA 1QI4A 2H3XC 3PJSB 4OZHA 1OB1A 3QPXH 4XRCB 3D09A 4LLAA 4FHBD 1LE9B 1OTUC 4X9FA 4H1LB 1BJMA 4YS4A 4WEBL 1IB5A 5IW3A 2WC7A 5KSAC 1ZXKA 2QVFB 3GUTA 4HULB 1S7QB 2DQCH 4F7TA 4H1LG 1E4WL 4KVNH 1IEAB 3QJRB 3LCYA 3BSHA 1DVSA 5HYJE 1E42A 3CVHA 3TEUA 1EXHA 4YX2H 2FWOA 3P11L 1F1GA 4MX7A 3FRPA 4QRSB 3F6LA 4Z7OB 4KJYA 1AHWA 1DN0B 4XO5A 1A4JA 1BZ7A 1KB3A 4G7YL 4PGCB 5BMFL 3WS6A 4G59C 4C59B 3IKCA 5ESQB 1XGYL 1IKFL 1EK3A 1OGSA 2I9LB 4X5XB 3QIBB 2AEPL 4D0CB 5TQ2H 4HGKC 3FB7A 4UI2A 2E7BA 4YWGL 1E28B 3MLZH 3NK4A 4IKIA 2R2EA 2JJSA 2WVVB 4HCRL 5IK3B 1W72B 5H37A 1KJVA 2A83A 5JXAH 2OPCA 1FNHA 2E47A 4U49A 1ID5I 2NXYC 1MIML 3CVCA 3ZE0F 2V8MA 2XV0A 1HDMB 3CU7A 3ZMEA 4IHBA 5CINL 4OJCA 2ITFA 4GRWH 4PJXB 1NBZB 1CD1B 4LHUD 3WXVH 3WUWG 2WK2A 4LOUC 4AVIA 5BVPH 3OKOB 4OKDA 2KT6A 5H4ZA 3LRKA 1U8MB 4TRPL 4FQIL 5D70L 4HJEA 3IS1X 3SPHA 3UERA 1J86A 4L3FA 5HI5C 2AMUA 5KN5A 4KHXL 4S1SL 4BFKA 1KJ2L 2XNAB 3GTTA 2BC4A 1OAYH 1EPFA 3VXUD 3MROB 1TVHA 1XGTA 2MIZA 1A5FH 5JPMA 1J8SA 2Q3XA 4RWYL 3VGDA 4CBPA 4G7RB 3C5SB 3VQMA 2BSSA 2FDBP 4TVSa 2N56A 4XBEL 5CUSL 1TMQA 3QCVL 4U3XA 1XVSA 2OMTA 2FX7L 3S3CB 2AZAA 1HNFA 4JO2L 4I18A 2XRAL 3FMGL 3FH7A 2X40A 1EGJH 2QADC 4QF1B 1HJBC 2WXRA 1BVKB 2PCPB 5D7LD 5F9WC 2FLBT 4WWOA 4JANB 3WXWH 3EOYG 1E5UI 3NPSB 4BCYA 1CD9B 3O6LH 1A0QH 3MA9L 3IGLA 3QCTL 3TA3C 4F7MB 2CRMA 3T3PB 5I16B 3VG9B 3IMRA 5EU3B 4K94L 4KJWC 1QUNA 2FZ3B 4ZS7L 2APVA 2GJJA 2VH5H 1D3CA 4OF6A 3W0WA 1D5IH 2BSTA 5C97A 2H7WA 1N5AA 3QWOB 4HDIB 1JGDB 2KLRA 3WD5H 4IOSA 4TLTA 3RX9A 2DMGA 2YFNA 2ESVB 2UZYA 3GB7A 2XT1B 1CCZA 3U36B 2UYLA 2W9DH 1FDLL 5BO1L 1NIAA 4KFMA 3E2HB 1D7FA 5CZXD 3IDYC 3KDMB 4HPYH 1QWUA 5CP7A 5JHDA 5SV4A 4XN4A 1OK0A 3A4DA 3KWTA 3SDAA 5I73C 1FP5A 1FV1A 4Y4HC 3AAZB 5TE6H 3ZE1B 1O9ZA 1GGUA 1DLFH 1EAPA 3TV3L 3US0A 1G84A 4I0PC 3UFIA 3ALPA 3GRBA 1UVQB 1B2YA 5HPMB 1T5KA 1ZSDB 3DMMD 3U0WH 3EOAA 4NQEA 1MHCB 3G5VA 1V7NH 4UDUB 2EVJA 4P5KB 5EIQA 1W8EA 4JFEB 4YIQA 5T1LB 1VPOH 3HW7A 3TH4T 1GZPA 2ZOLA 5TH2A 4M5ZH 2DQ6A 4G5ZL 2GJ6E 1NOFA 4KI5D 3K8MA 4XTRC 1GGCH 1ONQB 2BHZA 2ICWA 4RFNC 3UJJH 3UPCA 3VRIB 4HUUA 4KDTC 2EYRA 4JG1H 5EEWA 4ZUWA 3O9WB 2VXUH 4PJ9B 4OIIH 1MRDL 3SYAA 4UQ2B 5DS2A 2XPYA 4JFSA 3CMOL 1ZJBA 4OFVA 4J27A 2GTZB 1A4AA 3P77B 4MJID 5GGTA 3ZKXC 5CF3A 5DQJB 1FFTB 2H2SD 4LHJB 5EU6B 5B39G 3P54A 4WI6A 5E1AB 3OMAB 4AYFA 4NZ8A 5IB3A 4QHUB 1U2CA 1DCEA 2AJXH 4LSRL 3BPOC 2V5SA 1SY6H 3O6FC 5IB4A 5IB5A 3VTTA 3H55A 3HLKA 1X9QA 3TJHD 3UTSB 2FJFA 4FQJH 1MQ8A 1ZS8A 3D18A 4N9OB 1INDH 1PJWA 1IC7H 2ZCHL 4WY7L 5B1JC 5IHZA 5C0NC 3KPSA 1L6PA 5D1ZB 2BHFA 2OL3L 1HS6A 2CNZA 4GAJL 3WAKA 2BOCA 4KTYA 1ZRUA 1NBCA 3KXFE 2YN3A 5KVFE 3U30B 2HRGA 3UYOD 1TENA 1AO7B 2FIRT 4NHCH 4J3SA 2MCAA 3PABA 1GZQA 1BJ1H 3NZHL 4MDRA 4OLXH 4X6BB 1DDTA 3GHPA 3RL2B 1KCLA 3LS4L 4L1SA 5FK9B 3I6LD 3O41A 1R24A 4FNQA 3L2NA 1NGXA 3DX4A 3LN9A 2P7TB 2WBWB 1JPGA 4NPYB 4Z7WE 5HYSB 3T0WA 1CXKA 3DV4B 3L45A 3X3FL 3HNSH 3RFZC 3DYOA 1BG1A 1M1SA 3LTVA 5LDSA 2VC2L 1ACCA 4JB9H 1DVUA 4FQHA 3AS1A 3D85B 5HYSG 3JWNE 3DJSA 4F7CB 5CLWA 1U95A 1B0WA 4TNWF 5C09E 3RWGB 2X6CA 5BS0D 3L3IA 1MJJB 4PWKA 2B5IB 2ODHA 2Y07H 4EIGB 1EEYA 3PE9A 2ERJB 3NT0A 4BUQA 4N0YH 1M42A 3AC0A 1PG7W 5A3IC 3EUDA 2H1LM 5HYQA 1KLGA 2ZYIA 5AYUL 1J88A 4FTVB 4ZX4A 4UTAL 3OC8A 5KYWB 2WQ8A 2HG5B 1JVKA 4WUKL 2DLTA 2QSCL 3U79A 1EMTL 5JNYB 2Q6WA 2VQUA 3JWOC 4NIKB 1T66D 1YJDH 1D6EA 2BIHA 3QWNA 5C07B 1MHHA 1NPJA 2WAHA 1EUTA 3BP7A 2BNUB 3PGDA 1A6UH 3VXNA 2BHYA 1D5MB 1D9KB 1HHGB 2ZIDA 5SWQA 4P57A 1E40A 1T1ZB 3ROOA 3DX0A 5AZEH 3AREC 5D7SL 5IR1B 2XKNB 4R26H 1OLZA 2DLIA 4I5BB 4GO9A 2W0FB 3HE7A 3K6FA 1AAJA 3HNVH 1OWRM 3R1GH 3BKMH 4DP4X 5HVHC 3I6KB 4KTDL 4J3WA 3BZ5A 3O11A 4OTXL 4XCEB 3G3LA 2VLKD 3ZDXB 1A6ZB 3PIQA 4NQXA 2Q8BH 3RWCB 4RRPA 3M17A 4M43L 4QRUA 4EUPG 2WO4A 4XC1L 4G3YH 5F6IB 3P73A 1UH2A 1NMAL 5JXEC 1AGBB 2OL3B 1FAIH 1VRSA 1ZLDA 3HB3C 1FNGB 4NSKB 4DPAX 5LG6A 1FFPA 1T2JA 2GIYA 4JQXA 1UA6H 2V7NB 4OY9A 3OZ9H 4B6ZA 4BFIB 4OGZA 4ZOEA 4L1TA 4JY6A 1JS4A 5SWZB 3VGAC 2BP0B 4XNYH 4FTDA 1AJ7L 3DVNB 4J3OG 4NP4L 4V11A 1IAKB 1ZTXE 2DBLH 3IJYA 4K71B 4LDCA 5E9DA 5DD6A 4ZOBA 2V3EA 3V5DB 1F4WL 1HHKA 3QR2A 2J8HA 3HMXA 4PJEF 4WWPA 4M1CD 1QLFB 3PL6A 4Z3TA 2VXSL 5T5NG 4EVNB 3HN8A 2ATKA 3NSFA 2IBGA 3FB5A 2K9UA 4M6AA 3LNDA 2VC2B 4ODXA 1A02N 1QHOA 3GSVA 4Q97A 3FTGA 1N2RB 1OP3K 3BEWB 4MDJB 2Y2TA 5HGGS 1G7PA 2FH6A 5TPWH 2DEYX 2AAAA 2HKHL 3PJNA 3KM2A 2WCPA 1PAZA 1KPUA 1P9MA 4LEEA 5F7BA 3RILA 4Q6IC 2DTMH 4IHOA 3MRHB 3QZBA 2FJHB 2HLFC 2AJYH 1F00I 2BIMA 2DV6A 4AYBA 1SPDA 1DJYA 5EZIL 3V0IA 4JM2B 2WLJA 4NN5B 4XNUL 3BPNC 4JE0A 1TQUA 1HQRB 3LKNA 4HUWB 4UINL 4I77L 2IC2A 4GFTB 1I7TB 2X4QA 4E68A 4S1DD 1MLBB 1A3QA 3TPKA 1S7TA 1M6OB 4HS6A 2MCG1 4WO0A 1QD0A 1EHLH 2K9FB 1ID2A 3D39A 3ABGA 2D0FA 4HHGA 2FE0A 1NEZA 5CN2A 4JZNA 1KF9B 4PJ5E 1CL7H 4Z7VB 5SWSA 3BAIA 1N59A 2FNWA 1P84J 3VXME 3O3AA 1GOFA 2E0PA 3ATBA 4YHLL 3QORA 4MZ2A 4P04A 5LBSH 5JOPD 3GXPA 1H5BA 1F3JB 4YC2C 4QOKA 5ANHA 4JVWA 1HNYA 1NGPH 3GBEA 3U7WL 1KJMA 4XB8A 4PVLA 3MRMA 2X6UA 1KCWA 1P4UA 4K9EH 1DSYA 3DK0A 5DF0A 1NCGA 1RURH 3JUZA 4N1EA 2QR0B 4UQ3A 4PRHB 1YEHL 3F2LA 5K69A 4H0GA 2FRGP 3OPZH 1DJSA 3LXAA 1LLAA 1WZLA 3B7TA 5EUOF 2O5ZH 5TFSH 5ICXA 5EF0A 1DDHA 3ZDZB 4BH7B 4MMXC 1G6RH 5E99L 2UZXB 3EYUH 4JQVC 4HLZH 3V0FA 2Q10A 1G1CA 1KIPB 4IBYA 2CUIA 4F9LA 4I48A 2JB5L 3T4AB 3QUKB 2HLAA 4M3HA 1PNDA 4S0TD 3NJFA 1NFDF 2DIBA 4PMFA 1QRNE 3A6CH 3DYMA 4ADJA 1CBVH 2ZOWA 1XWVA 3GBNH 1YMME 4KI1A 4HK3J 2Q87A 4ELMA 3KYNA 3DK2A 3TIEA 2VITB 2X6BA 4K7PY 4LCIL 3RWHB 4F58L 2WQUA 2OTUA 1OAXL 3GXUB 3FTZA 4EZJA 1I1AB 4OM1H 4X0KA 2D7PA 2X7LA 5JQ6L 1FFNA 5CMAB 1MI5A 3W2DL 2CHXA 3FUDA 3ULAB 3RVVD 3FQRB 2WWKO 2EKSA 3H9SB 5H94B 1MNNA 1CDBA 3HZVB 1QBML 3QXDA 3ISYA 1NH6A 4WGKA 1C12B 1N18A 4DFIA 3Q7JA 1VEOA 3K2UL 1QQDB 1KEMH 4HXAH 2FX8L 3RVUC 4J23A 1CT8B 1J5CA 4F20A 4MQTB 4PBWD 5HHNA 5LO7A 4AQAB 3CFCL 5DFVD 3AZUA 2DQHL 1IFHL 3UGXA 4Z7QE 1WD9A 4UIKL 4LLYB 3WN5C 4P3CH 2NX5B 4V1DA 2H5UA 3IFOB 3DIFB 3FQTB 3ZT5A 3NTCH 1S7UB 3IGFA 4HSCX 3W0WD 1WC7A 3QJOA 2WUCH 2VLMD 1QMUA 2KHAA 3EZ8A 1YDPA 2IBZY 3F6JA 4G43A 4HIPA 3WFEL 1PLAA 4NUJB 5J11C 5DT1H 4U3HA 4IOSD 3CSYB 2MPAL 2DMBA 4DGVL 1M7IB 1C5BH 1TZHA 2MTAA 4G7VH 1E6JH 5F88B 4LKXB 1CURA 1OCCB 4GKZA 1RIUH 4FYQA 1HWGB 3BSZA 4ZAKC 1HHHB 4R4FL 2Z1KA 3HFML 5DQDL 3D2UB 1KOAA 4PWFA 5JHDD 4LCUB 2ETWA 3MRJB 4P4KB 3WEXA 3SDAD 2IAMC 1RPKA 1EJOL 3S2AA 1A4CA 2W95A 4U6YB 2V33A 2XTJE 4XNMA 1XSIA 2W94A 1Q38A 2YLKA 3VXUE 4MS6A 1MY7A 1S7XB 4G8FA 1BFVL 2D0GA 3DVGB 3QZWA 4WSKA 1KYFA 5E6UB 4ZZKA 2FECL 1TQBC 1LTXA 4JFUA 5DJCA 3BE1H 3IXTA 4DGWC 2R23B 4FDWA 4NQED 5DURB 5F1SA 4OFKA 3WL9A 2AK4B 3LZFL 2V6HA 5D1XB 3BGFB 3GZPA 1R5IB 4AQEA 2EC9U 3NQKA 2BVPA 4P5TA 2RD0A 1XMWA 3VTAA 4QRTB 4Y19E 1J9CT 1XAKA 4UZSA 1JZGA 3FQNA 1NCOA 4AUYA 1XCTB 1MJUL 2YC1B 1SYVB 4P05A 5IF0A 3GDCA 2O61B 4QWWC 4L8CA 4C4UA 2CK0H 4BA0A 1Z0MA 3ZL2A 3U83A 4UOW0 3VW3L 3IYLW 1MOEA 4WI2A 1I7UB 4LLWA 4A6YA 4Y16C 3QDJA 4WJ5B 2Z0UA 5E5UB 1A7PL 5FM8A 4PJBF 2WOYA 4B7IA 5LBGA 1BM3H 4NQDE 1KZQA 3V52H 3C8HA 1JDDA 3QEUA 5C0CE 5B38G 4IU3A 4ZNCD 1G0DA 4KK9D 5IQ7H 3MBWA 2JIXB 5INCA 4TSAH 2OP4L 4MJ2A 2AF2A 4JFVA 1O5DT 1MFCL 2HTKC 3FFCB 2QGCA 2QFPA 5ETUB 4ZFQA 4NNPH 2VLJA 2VR6A 2ZJSH 3OB0H 4NWTH 2XZZA 4TLSA 2LE9A 3V95A 5KG9B 2YAPA 3WFCH 4B7LA 3W3BA 3F7PC 3QNZB 2NY2B 4LVNC 3KPSD 1NQBA 4EKXA 1CI3M 5I75C 1ZVSB 4FQXC 1TJGL 1NLDL 1IFRA 3GI9H 1WWWX 4PJ6A 2PWHA 3GJFH 4OFIA 5I1IL 4G6FD 4FQQA 4MWFB 4JNXA 4D0DA 1KEGH 4OUUA 4DHLA 1O6SB 3D0AA 3IK2A 1ZLUH 1PLGL 3GRWL 4V2BA 3TO4A 2CCWA 5EOQH 3TBYB 2DMKA 4KAQL 2MHAA 3HZYA 2D8KA 2AQSA 5IVXF 3D25B 3VWKC 1ORQB 5CEZL 4GKSB 3K4DA 3DA0A 3B37A 1TJHH 5LG1A 3UP6A 4JZJA 5M7QA 5HI4C 3FDWA 3HCVB 4KI5E 4MD0B 4U6HA 1PBYA 3AQXA 3ZQWA 2HRPL 1JXDA 3WHE0 1J5OL 1C5CH 4ODBD 1TO5A 4JFOB 3M1BA 1I8MA 1OP4A 1OPGH 3EADA 2DQDH 3T77A 1HIMH 4LSQL 5A6MA 2CXKA 3QPQD 3H6JA 4MJIE 5J6HB 1RZJL 4DO6A 4AJVA 1WICA 3OC5A 2HP4A 4A7VA 4QR7A 3Q6FA 4CC4A 3RG1C 3DTDA 3PREA 4HMDA 4W1TA 5ICZA 3H9ZA 2PYFB 4JY5H 3TBBA 4GG8B 2Z34A 2H3KA 4LSUH 2NW3A 5HGHB 4N2AA 2HKFL 3LZLA 4YSCA 2QKSA 3ORJA 3NCYP 1TVBA 1LK3H 2GJZB 3VI4B 4LVOB 5JYMA 3D9AH 4N6QA 4JGUA 5JW4N 3WUWA 2Q3AA 3KL3A 4JRXE 4ZTOL 2KI6A 2M1KA 5KTEH 1N26A 3NRFA 1WAPA 3D48R 4TM9A 4PSPA 3GIZL 4ZFFB 4HP5A 1YEGH 4M9OA 3HE7D 4DPCX 2IDSA 2DMHA 4MASA 2YAMA 4X8JA 3DO7B 2OZ4H 1EZVY 5E94A 3FB8B 1KCKA 3QEQA 3C2AH 4W9GC 4PLNC 4GRWE 3MR9B 1EQWA 5CEXB 1BF5A 4XNXL 2R0KL 3HC2A 1CXHA 3O3UN 2AS5M 4JRLA 3MLUL 3VWJA 2E74C 3KLQA 1N8ZB 4D9LH 5J12C 1KT2B 3FCTB 4XP1L 4WNJA 1VADB 3F00A 2BCKA 2XJLA 1BAFH 4XGZB 1BGXL 5I9QB 1KXTA 2X0UA 5E9DD 2XXFA 3ETSA 3BP4B 2I5YH 2YBRA 1CGTA 5KS9A 5D8JH 1TEFA 4LFHD 3SDCB 3MU3A 4ZTPL 3PL6D 4FFZH 1BOGB 5AD0B 5GGRA 3FOLB 1R4XA 5GSVA 1KYOJ 4XXCA 4OCYL 5IHUL 3GWJA 1A7RL 2DWYA 4KRPD 4EDWH 4PRBA 3MNZA 2XPZA 5B3JE 2NQCA 4YEEA 1X4ZA 2A9BA 2IFFL 1MAML 4N20A 3NG5A 2X44D 1E8XA 1NKGA 4BZ1L 1CFTA 1LL1A 2BNQE 3K72A 4IRSB 4LB8A 1DVXA 1FBIL 4HJJH 3OPUA 1X5GA 2TAAA 3V2AR 3MUHL 3MCLH 1CF8L 1SNRA 4ZMZA 1J87A 1QFHA 1HHIB 2Y7QA 3KW7A 3V6FA 1C5DA 1HOCA 5K1JA 4ZMVA 4LSPH 3D3VB 5HDQL 3FQUB 4M4PA 2A6DA 5IFJB 5DUPL 3QNYB 1DLHA 1CG9B 2NY4D 4HOXA 5I15H 2PTTA 2RFXB 2DLEA 4BGDA 4ZPTA 5A7EA 1M56B 1A1OB 3D39D 3FUFA 1KGXA 3LD8C 1XEUA 1V05A 4GKLA 4OIFA 4B96A 1KTDB 1T0OA 2C7UB 1V54B 2EH7L 3SGEI 5FPIA 2MQ0A 3OHMB 3B7SA 1F1DA 2QL1A 5SWSD 4CN4A 1MFEH 4FKKA 3EYOB 1CVRA 1UXWB 3VH8G 4BV1A 4KXZH 1D6VH 3ZL4H 3QORD 1ZXQA 2QPEB 2Y5EA 2NXZC 1T0PB 1N0XL 3GSNB 4LPXA 4J2QA 4OB5L 3EJYD 3GPEA 3HC0B 4QOKD 2OR9H 4JY4A 4OGAD 1B0RB 2FT7A 1AI1H 4JFFB 4TMPA 4NO0B 2F8IA 4JFTA 2J6EA 5INDA 1MUJA 3S34L 4PB9L 2C5DC 1IGIL 1SJMA 2C3VA 3Q01A 1BG9A 4R90H 1WF5A 1RJYA 3Q5YA 4R6UA 4K23L 2Z9TA 1ZVHA 3BC9A 5B39A 2CJ3A 5GISH 1KTKE 3QJZA 1G7QB 3T3MF 1VZGA 2CPUA 3BWUC 3P2DA 4H1LH 2IH9A 4ZT1A 3FTSA 5TE4H 1M3IA 5F7DB 3S96B 4KVCL 3TBVB 3ZDWA 5FO9A 2AMGA 4AIXA 1M71B 3CD4A 1Q9WB 2APBA 1YAIA 1YUHA 3QFJA 4NI6A 3DJZA 4E41E 1UD5A 4HS3A 5L4IA 3ZX1A 1KBVA 5D72L 4BINA 2WLYA 5EC2B 3IJSB 3KWXA 1UJ3C 1RI8A 2F68X 2ZUSA 4NO2A 4L8BB 5D7JA 5E00B 5AOJA 1KYUA 1MI5D 5AVSB 1M2VA 5HSFA 1BD2B 3MC0A 1EZVX 4NI3A 2VE6B 1WWCA 1RK1A 3C6LA 3M1OA 3O0RH 3V9FA 3VFUA 1ETA1 1PCXA 2XZCH 4PP2A 4QTIL 3BESR 3MCKB 4W70A 5EB9A 4DEPB 1X5YA 3BLKA 1SBBA 1W72H 1GAFH 2R8SL 5JOPE 2DQJH 3JYBA 4A7SA 4WI9A 1CYWA 3AB0C 1MJ7L 3SQBB 1R3KA 1KWGA 1P4IL 2DI9A 2MPVA 2NY6C 1BECA 1YEFL 2OMBA 2APXA 3AMKA 1AMYA 2ILLA 3IRZA 4Q4EA 2C3HA 3VSTA 1MIEL 3MFFA 1SOXA 4M5YH 2VWEE 5M94B 1RZKH 3VFTB 3KD4A 4V1DD 1VGKB 5F7MC 4ZNEA 1ASQA 4PJFF 4A7UA 5MEPA 4YSUA 5CGMA 5IB2A 2CR0A 4O02A 3EDJA 4X6CA 4IS6B 4AVJA 3P30L 3U2SA 4GG6E 3EJJX 3HR6A 2G60L 1BQHB 4HIIB 4NKDA 3RWEB 3BKJH 2EDLA 2OMXB 3O6MH 4LCYB 2EYSB 4N85A 5DFTA 5FYKU 1JMZA 4LLUB 4YSAA 4WSJA 1KGCE 2X4OA 2MOGA 2R29H 1L0PA 2C4FU 2NSXA 2VZ1A 5FYJL 1HN1A 1KYDA 1XTMA 3NCWA 3K8LA 3O2DA 2P26A 2OI9C 3TYFA 5F71A 1TOXA 2FEEL 1G7MB 1BXUA 4HIXL 5E8PB 3MTRA 2GITB 3O8XC 4Q14A 4WEBH 4X2UA 3NYKA 3X13A 3G6AB 4AW4A 3ETBF 4F93B 3F5WB 1VKXB 4X4MA 6PAZA 1WCBB 1C8QA 1GVIA 2NZ1A 2G4GA 4EUPA 2JCWA 4P46A 1DBAL 1E4WH 4P5TD 3KGRA 1KBGL 5HHOA 1A9VA 5F6HI 2OX5B 4UU9B 5HHPA 5I5IA 2ICEA 4YDJB 5B3NA 8FABA 1QWNA 2WUBH 3P11H 3ESMA 4M7JL 2HJLA 2HVKA 4FLQA 4OF3A 5IP4A 3KPRA 3DX6A 4QRQA 3BJ91 5BMFH 5EEZA 4JHUA 4JFYB 1XGYH 1IKFH 5FGCB 1INQA 1SEBB 3QDJD 3MREB 2AEPH 3NSXA 4KMQA 1IGJB 5DEFA 5BZWA 4BFBD 4JRYA 4H88L 3D05A 3CFMA 5EO0A 1EAQA 4YWGH 2ZUTA 4DO4A 4HCRH 4IK7A 5ICYA 3FU3A 5ALCL 4N25A 1GKEA 4XOEA 5L8JB 4KY2A 2FD6L 2R9HC 3SE4A 3QXAB 3H6AA 1MIMH 3L54A 4DP7X 2VLJD 5CINH 2YAFA 3SJVA 1PF3A 2A77L 3MJ6A 4OLEA 1DQKA 4BXSV 4APXB 4ICWA 2CO6B 4YEFA 1F13A 3H0TB 3MNDA 4Q74A 2YPLA 5I19L 5LAXB 4TRPH 3FHQA 5D70H 3P4LA 4FQIH 4XNQB 3CFUA 4HBCL 1DQQA 3IU4L 4HFUL 5KBPA 1E4HA 1ZSHA 1B4RA 2VERN 3CCHA 5I1LA 4R97C 4KHXH 4S1SH 1RERA 2ZSVB 1KJ2H 5B22A 3F7YA 5ESAB 1UT2A 3EH5B 4PGJA 1J0HA 4P2OC 4X6DA 3TO4D 4BKTC 4PJGA 3VI3E 4NQEE 1KCSL 5EULV 3BHBB 4HH9A 4WIQA 5HXMA 4PG2A 3G6JF 3PHQA 1AGFA 4RWYH 5D2NE 4N2KA 4OGQC 3RHWK 2Q76A 1G7HB 3ULUD 3PP4L 1OGTA 4JDZA 4NOFA 1LP9F 2BLFA 5E4EC 5DWPA 1U8LA 3H1ZA 4XBEH 5CUSH 3QCVH 4E0RB 2FX7H 4HA1A 2DQUL 2DDQL 5KVGL 4Y5XC 2WSPA 3DIDA 4JO2H 3W82A 2XRAH 1RLBA 3FMGH 5HGAB 3VA2C 1DBJL 2F7PA 5J57B 2D4DA 1LJMA 1OAKL 4RMBA 1JZ3A 5DMGD 2FB4L 2VMDA 1NBQA 3MV11 1XHHA 3RDTA 1PU0A 4N6RA 3DHPA 1K4DA 4FXKA 2B0SL 2FO4A 5CHNA 4ANXA 3MA9H 3QCTH 4WUUB 4M7ZB 2X70A 4XCYA 4Z7NB 3L1GA 4K94H 3KBHE 4ZS7H 5HJ3B 4G9FD 2AJUL 3R0MA 4F7EA 4Z3GA 4WZ9A 4OCWL 1FL5B 1CJYA 3OKKB 5C0GB 1SMOA 4MAYA 3HEIB 3RUGF 2XYBA 4LF3B 3IGAB 3WELA 4LBEB 4NN7C 3KPSE 4YHOL 3QP3A 4QHPA 4YSPA 3GSXB 3VGGA 3MN8A 1DUYA 2OLDA 1RL1A 4IDJL 1QWHA 1BZQK 4KNQA 1T5XB 3VX0A 3LQAC 1C08B 1MW2A 1U3YA 2K3HA 1S3KL 2C9RA 2NTSP 5E8NA 4JREB 5AOZA 2DWEA 2Y23A 1YPZA 3MRIA 3LX9A 1P7QA 5HDBF 4WK2B 1SJHA 4NYLA 4N0FA 3TV3H 2ZICA 3WJMB 3QEQD 3HVNA 1QTPA 3WHXA 4KO7A 4CVUA 3ZO9A 5KSAB 3VDCA 1TMCB 4TUOB 3H2PA 5FDWB 3ZE2E 3VRLE 3NSYA 1IJNA 5DMYA 3VWJD 3PWUB 4AZUA 1CICD 1QA9B 3EUUA 3BO8B 3IFNL 3VX1A 4HWZA 1CFMA 4PU2A 1AR1C 4NXSA 4HKJA 1U91B 2EXYD 2MCPL 3B2MA 4G5ZH 4G8EB 2GKIA 4YDKL 1E27A 5FV1L 3ESOA 3NZ8A 3MJ9A 4OCLC 4OIBA 1QO3B 4Q9BA 1QBBA 1MPAL 3BP6B 2NQDA 3A22A 2IXQA 3ROLA 4AXWB 1KSRA 1MRDH 5EFIB 1Z3RA 4JMNA 1LO4H 3CMOH 3TYGL 3QG7L 3SDXF 2BIPA 1M2OA 3PPEA 2GHWB 4KVPA 1E6OL 3QH3B 4QRRB 3D30A 2FR4A 2C34A 4IBZA 5KSBA 1NDGB 2NXYB 3EH4B 4JE4B 3UROR 3OX8A 4YSEA 1JV5A 4I3RL 1L9MA 1PZ5A 3O4LE 4WDIB 2VLRA 4LSRH 4M61B 2CO7B 3AW5A 1L9RA 4MD5A 1NZRA 3B2XA 2W0KA 2A6IA 1UCBL 4U1LB 2ZCHH 4PREB 4WY7H 1U8HA 4N2CA 1N6VA 1XF5B 2WLIA 3LKPB 2OL3H 4GAJH 4J3OH 3HPLB 2A9AA 1WT5C 4W6WB 4JUSA 2JKRM 4HSAC 5IMKA 2WIIA 1CBJA 3QFGA 3MV7E 4F37K 4PRIE 1LO3L 2K4AA 2PYEB 4DN4L 1Z9SB 2F9BT 5L2KB 5LVEA 3L3DB 3X1NA 3NIFE 3X14A 1AZRA 5I8KL 3LPWA 3NZHH 3H85A 3KGTA 1R34A 3HAEG 3LS4H 3N42F 5JQIB 1U3HA 2KZ1B 4S10A 3KPQB 7PCYA 1DBML 3PUUA 4L29B 1HL4A 3QUXB 2CUHA 1JZHA 3KYMA 2YXVA 2BO0A 3HPJA 5IJCC 1GC1C 3X3FH 1HZLA 4UDTA 3PWLA 2CIKA 2K70A 4Y4KA 1S46A 1HOEA 2RB8A 3UCQA 4PJ7A 5E9DE 4D3CL 1I1FA 4IOFD 1JYVA 3WLBA 1D5BA 2NR6A 1GRWA 3OJ2C 4PJDF 3T1FB 3ZGHA 3MX0B 5ACLA 4XX1G 1T04A 4ALAC 1FZOA 1ZHKA 4W4OC 3DHUA 3QEHA 2WCSA 5KAQF 1U58A 4N1CA 5J6GA 3EJSA 1LMIA 2L7JA 2Z65C 2BH0A 2DIJA 5AYUH 1CLYL 1SHXA 4FI6A 3UTTA 3DPDA 5B38A 2XY1A 4XZUB 3U4EA 4UTAH 1WJ3A 3RTQB 2DIAA 4GO6B 2QSCH 4WUKH 1EMTH 3V10A 2OSLB 1ADQA 3Q3GA 4RQQB 4MYWB 2WTRA 2VRKA 4Z3HA 3N0AA 3IDMA 4RZCB 4J4PA 3MHZA 3MRKA 4FGMA 2A9MH 3MV9A 3LQMA 3QFJD 4BYHA 1OW0A 1R0AL 3DMMC 5DJDB 1SYSB 5D7SH 3S37X 3WAJA 1GJIA 5BOJA 1M7UA 2VMJA 2WHVA 3VGBA 4JFDB 3U48A 5IROA 2VDPL 5BRZB 1QVOB 3UPRB 4DSYA 1LK2A 2QPSA 4I0PB 2PTUA 4U3SB 4RGND 4KTDH 4OTXH 3KLAB 3LPPA 2DQGL 5D7JD 5I74C 1MCJA 1PX8A 4XP5L 4EZLA 1DBKL 2A7BA 3EDEA 5SWSE 4ADIA 3C6LD 4M43H 1OSPL 2YRPA 4XC1H 5I0ZA 4DZ8A 3NH7L 1NMAH 1IZJA 1ET8A 5GZOA 4YBLB 2OSWA 4AZ8A 3WO4C 1UFGA 3TBSB 2CKBA 5DR5L 1W9XA 3CXFA 5DDHB 1KG0A 3BN9D 3QDMA 4PRNA 3TURA 1AJ7H 1WHOA 3BH9B 4HGWA 3LRGA 4NP4H 4RFNB 1Z66A 4XCCL 4EN3A 4F15B 3ZQ9A 5IW1A 1GXEA 1F4WH 3HG1A 2XSKA 1X7TA 3HUJE 2VOTA 3T0XA 3BZEB 1CDJA 3KHOA 4G11A 4MMZB 4Y1AB 2VXSH 3CX2A 1AS8A 2E8ZA 2FH8A 4X7DC 1RZIA 1UT1A 3ZKXB 2VZTA 3SGKC 4N3UA 4U1IA 4ODTL 1RVFL 2W65B 2JCCF 3WJJA 1OT1A 2HKHH 4GI6A 1U8OA 1GYCA 3BPOB 5LGYA 5G55A 1JZEA 1KXVA 2XOTA 1DTUA 1E9PA 3W5NA 1G5GA 3NK3A 4M5TA 2PF6A 2PMZA 1MCHA 4AENA 3FU9A 1OD9A 4JHBA 3S3DB 4XNUH 2OSYA 43CAA 2WY3B 4YSTA 1WAAA 4I77H 4PJCF 4M93C 4ODUA 3I2CL 1I75A 4L3EB 5GGVY 5CCGE 2IQAB 3DOSA 1J8HB 1TZIA 4C4KT 1WPCA 4K7FB 4I1PA 2WXJA 4S1QL 5F7LB 3SKMB 1F5WA 3ABLB 3G04B 3MGOA 4PHXA 5IHWA 3KJ6L 4P46D 4U1KA 1CYGA 1QBLL 4JEGB 3VFOB 5HHOD 3L2LA 4LIQL 1YUKB 3X11B 2XX1A 2ARJB 4IRJB 3H56A 1IM3B 4WWKA 3WNPA 2AERT 2VDPB 5HDWA 2ITDA 5LAPA 1OIOA 2EE3A 4YHLH 3KPRD 3N44F 5EO9A 4FQ1L 4DK3A 3IDIB 5JPNA 1F11B 1FNLA 3U7WH 1T66C 3FTUA 4GIAA 3UBXG 4JRYD 1A6TB 5LCVL 2WLHA 4OZGB 3H8NA 4OD3L 4FZEL 1PZUB 2F0CA 3ISWA 1AD9B 1YEHH 4AC4A 4P8QA 1UWXK 4MKTA 4BRJA 2ZZUT 4OU3A 3U6RA 2HFFB 4LRIA 3UOAB 2UZPA 5HBBA 1WA1X 4G1EA 4BQCA 3M88A 2Y1YA 3QJSB 1BFTA 4GQQA 3SJVD 5AOKA 1T0NA 3LY6A 3SGDH 4X9YA 5FOJA 2PPCA 4P9HC 5E99H 2J8UB 5D1QA 5T1MA 3VQ2C 2YPLD 4YHIA 5I8EB 4MAZA 4ELKA 1W16A 2XWBA 2JB5H 4HWNA 3HG5A 1F0LA 3AREB 5D2LF 4ZQKB 3P3RA 2CLRA 3DI2B 1RPUA 4B5EA 5FM5O 4OQTA 3K8KA 5MERA 4RSYA 2O1AA 3B9KA 5LJYH 5BZZA 1AKJB 5T3XD 4F58H 5HVHB 3VNYA 1JNNL 1OAXH 2G2RB 4S11A 1BQKA 2IBBA 4TQPA 2NTFB 5KSVB 5JQ6H 2P47B 3CUPB 2KYIA 4LCWB 4U1GC 4XMZA 4D7PA 4NJAL 4UBDD 3W2DH 3VU2A 3UYPB 2XG4B 3DJTA 4L4TE 3VH8A 1F2QA 4DP5X 3KEDA 5B7MA 2NMSA 1QBMH 3BVXA 2JLPA 2AXGB 4MXQC 1IKOP 3IMSA 3TCXA 3K2UH 2EIBA 2FX8H 4QTHA 3QDJE 5DJ2B 2DRUA 3ZZSA 3RDTD 5AAWA 5GGRY 4X83A 3SN6N 1LXMA 2D0HA 5FYLD 4M48L 5FCUL 5C0IB 3CFCH 1JFHA 1IFHH 1NGQL 5DVMA 4NN6C 3BPCB 5EPMB 4UIKH 2V2TB 2E7LA 4JGNA 4Z7UE 4JGJA 1MCDA 4HXBL 4P2QA 2R0ZL 3AY4A 4U1MA 4FLSA 5D7IE 4MAYD 1E4XL 3WFEH 4MA7L 4DGVH 1BHGA 1XL6A 2MPAH 4Q6IB 4OV5B 3MJ8B 1H3TA 1TTFA 4EOWL 5KYUA 4UM8B 4S1DC 4PRPB 2X09A 3ESPA 2VLLA 3C60D 5DRNA 4R4FH 1UH4A 5E1GA 3HFMH 1XGQA 5DQDH 3D51A 1S8DB 1FVEB 3QIWA 3MV8A 2PXYA 5FECA 1A6AA 1WUNT 1EJOH 5T5FA 3NFNB 1P7QD 2IGTA 2X2HA 4J3UA 4Y5VA 4H25A 3GMLB 4XXWA 1HT6A 1XIWA 4KJQD 1BFVH 3T6XA 4GAYA 4IKLA 1G1KA 2YZ1A 4AQ1A 5C0FB 2MH4A 3DSNA 4GW4B 4FJ6A 3LZFH 1KIRB 5KYYB 2ZG3A 3T8XA 2VISB 5I6XB 4IBQA 3M07A 1DQVA 1O5PA 2WZPA 4P2RB 5AEAA 2L7QA 3F12B 4N2EA 3ARGA 1MJUH 3L9BA 2JJSC 1MCEA 5FA3B 5FUZL 3ELAT 5F7HA 3I84A 2JWYA 5C0AA 3NZUA 3VW3H 4YC2B 4Z7OE 2CM6A 2P45B 3CFBA 5CBAA 4R0LA 3OLIA 4U1NB 4PGBB 4TQIA 4L8DB 1X5ZA 1A7PH 1DANT 1LEIA 2NUPA 4FFYA 3CTTA 3TNMA 2ZQKA 2WP3T 4KKBD 3HN5A 3F8UB 4G9FE 1COBA 1UZGA 3SEPA 1IL1B 1UOWA 3RPKA 1E5ZA 2OP4H 1A22B 3LN4A 5I1JL 3B2UD 2DLGA 4XN8A 1QSFB 1MFCH 3FT1A 3IF1B 3AXLA 2VLRD 3W57A 5BQ7B 5LXGL 5EF3A 1ACZA 1D5ZA 1BZ9B 2KLSA 4HX1A 4X9GA 3BLBA 1PDKB 1G9NC 2NNRA 5E8OA 3WMPA 3HN3A 3KPMB 4W9HC 4WHYH 1RZFL 4RNRA 4RGOL 4N87A 5JPMC 1Q72L 2VW4A 1ZGLA 4PBDA 4XVUC 3NZSA 1TJGH 1WIPA 1N7ML 1NLDH 1U4FA 2O5XL 4GXUM 4LAJH 3SY0B 2YMOA 1SDDA 5B1CA 1H3VA 4UMSA 5IMMA 1HSAB 3RVVC 5I1IH 1A4KB 1N6UA 4WKZA 3ZKMD 2E6JA 3WEAA 3DUSA 2YR3A 4LE8A 4I18C 2AANA 4EI5A 2AP2A 1U3HD 1PLGH 1JGUL 3GRWH 5EWIL 1MDTA 2QHLA 4KAQH 3MMEA 1KBPA 4K3HA 5CGBA 1OSEA 3CGTA 1QFWL 4ADGA 1AZNA 3BD5A 3WE6B 1VFBA 2ZUUA 3L5XL 5CEZH 1SDAB 2Z91A 1K85A 4Y4KD 3L7EA 4RESB 3FRUB 2P5WA 2NR6D 4ZUVA 2HRPH 5JIPA 3IJEA 2ZAIA 1HZHL 2HFGL 1N64L 5HJDA 3X12A 1JPTL 4L2YA 1KDJA 5DS8B 3VDAA 2IDQA 1MWAA 1UQSA 4TYUA 4N2NA 1RV6X 3APFA 4LSQH 1S7SA 3CH8A 3FC8A 4PLOB 5E6IA 3S5LA 1RZJH 1S5HA 2E9BA 3DV6A 3UTTD 1FVDA 1AZVA 2CAKA 2G30A 3QJQB 3GD1C 2BMKB 3L3OA 1H0DA 4O2CA 4PJEA 3T3PE 3X17A 3U46B 3V6OA 3AACA 1XCQB 1SEQL 2HKFH 2KZBA 4ZUTB 1PZCA 2LW3A 1DQJA 1SHMA 3FQWB 4J4PD 1JHLL 2XVBA 4RA3A 3C09B 1AQKL 5EIVA 2PP7A 3K71A 4YXKL 3L4UA 5HY9B 3MV9D 4ZAKB 4AQOA 1IIIA 2J55A 4ZTOH 4IBTA 5I6PA 3VGHA 5BO0D 3EYQD 1NBVL 1XF3B 2GC4C 2J43A 3SYPA 4KQ3L 3GIZH 3U9WA 5IROD 2O6FA 1IM9A 2IAMB 4U0QB 3PGCA 4F1ZA 1SVZA 1G43A 5A1AA 4OIAA 3B9VA 4KK8D 3U1SL 5TK4A 4R9HA 5GRZA 2E9IA 2ICES 5E7BA 3VXTA 3ZE1E 2JI1A 1CFNB 2ZP9A 4U7SA 4CSSA 1KZYA 4X80L 4O2EB 3QG6B 4LXFA 4OI9A 5GZOD 2Q86A 4XNXH 2R0KH 2ZNWA 1T7VA 3MLUH 2XFXB 1R6VA 5CILL 5DVKA 3QDMD 4LDEB 3BFWA 4EIBA 4JFEE 4YSSA 3QWRA 4KXCA 5LWYL 1MDAA 1OHZA 4EN3D 1BGXH 3T2PA 2Z3FA 2ZP0T 4O51A 1JWMB 1XH2A 5CJXA 3AVEA 4ACPA 2EYTB 3HG1D 4QRPB 4KK9C 4K8RL 4QHLA 2ZOTA 4UOZA 1ZJAA 4AT6B 1CE6B 3OKEB 3QUYC 4Y16B 2XV6B 4GQ9L 4WTQA 5DEGB 4ZTPH 2YS4A 3V0JA 4OI8A 1HHJB 4KQ4L 3ZHNA 2XV2A 3FO1A 3UBFA 3FONA 1UXSB 3I50L 3M86A 4OCYH 5IHUH 2VSMB 3GT6A 3QSKB 1A7RH 2AJZA 2F58L 4OLVL 2ZKHL 3ZZLA 4JHAH 5C71A 5AW5B 3B7RL 1FFOA 1RJZA 2IFFH 1MAMH 3NCFB 4BSWA 5EU6E 4BZ1H 3G08A 4RMRA 3O3DB 1LEGA 2E75C 5EEYA 1DEEA 5K59E 3WS3A 1FBIH 4G6AD 1JDAA 4LEOB 5ILTL 3SYOA 3E7JA 4A2GA 5EUOA 3WI9A 4LVNB 4GYBA 1CF8H 2CO1A 3IWUA 1PKOA 5I75B 5IIEB 3Q2LA 2GAZA 4FQXB 3H9YA 5FV2A 5HDOA 5HDQH 4JRFA 4Y89A 5DJ0B 3CHPA 5I1AA 3TO2B 3W11D 2D7MA 5DUPH 5BW7A 4UOW1 4CC0A 3EO0B 1CC3A 1S9WA 1IGML 1BXAA 4FYRA 5IM7A 3WTUA 1NFDA 1AO7E 2DI7A 5HYJB 2UWEF 3CN1A 2CGYA 3DVIA 5AVXB 1MF2L 5IESL 1E9QA 3EH3B 1T3FB 2EH7H 3IJHB 5CD3B 1VEMA 4PJHF 3BH8B 4IEFA 4CJ0A 4WWKD 3D4ZA 4FNPA 3PAZA 1DVZA 2GT9A 2WLZA 3R4DA 3KLDA 1YZZA 5EZJA 5TDNA 3SGJA 2NY3D 1N0XH 3FO0L 4OB5H 3CQPA 4ZI8A 5AKTA 3ASOB 5CCKL 1UUNA 3GS0A 5DC0A 3LRSB 3C6EA 2IH3A 1LNUA 2XBZA 3LNHA 4ZMPA 3QJXA 3DX9B 4F8QA 2G3ZA 2YQGA 4PVMA 4AI7A 2GBUA 3CC1A 1QI3A 3FQXB 3FO9A 1XB6A 3P9LB 3S34H 5I17A 2ED7A 4X6CE 4PB9H 1IGIH 2V2XA 4BA8A 1TKWA 4PV8B 4K23H 4MCYA 3BGMA 4X6EA 3BMVA 4FTVE 4QGTA 2CO4A 3QA3A 3S5ZA 3HE7C 3V5HA 4WFED 3VFNA 3SCMA 4KVCH 1GS7A 1XR9A 2ED6A 3EFDL 2R1WA 5AQ0A 2GPZA 2FYYA 4DKAA 2FT6A 4KZEL 1BYNA 4PG9B 2ZWZA 4GNKB 1IBHA 3B9KD 3HLAA 5ACZA 1VJSA 1J11A 3EW3B 4ONHB 3WHE1 5F1NB 1OEZW 3MGAA 3L95B 5D72H 5IEKB 5ICUA 4RMUA 4IU2B 3IJ8A 3MSPA 5TE7L 4JZOB 3V6ZB 2BVQB 4HC1A 1HL9A 4FLHA 5FCSH 4WW2B 1OWWA 3RX5A 3QZMA 4TPRL 2MEJB 4FHJA 4LHQB 1MCCA 5MENB 3D08A 1UZ8B 4GSDL 3OXRA 3GHEL 3V0VA 4RMSA 4LPUA 2ENJA 2AV7A 4QTIH 4L37B 4FG6D 2WXOA 1H15B 3PL6C 5J4MA 4LLVB 1HINL 5J12B 4M1GL 5E6SB 5HHXL 1R5VA 2R8SH 5C9KA 3FL7A 4QXWA 1MJ7H 3RVXD 1P4IH 3KH3A 4OQ1A 4Q4IA 4KRPC 5LUMA 4XPBL 1YEFH 2K45A 4TNWK 4UTCA 1Q9OA 4JRYE 4E9TA 4O4YL 1QFWM 3K2KA 3FKUS 2L04A 1MIEH 3DDFA 3CDZB 3RWDB 2HX8A 3UEZA 4HLJA 4QMEA 4XAWL 5K1NA 1IKNA 5TD4A 2NNAB 3QPKA 4QTFA 5K9OB 3P0YL 1A65A 4J28A 4EQ3A 4KDWA 4B50A 4P2QD 1NC2B 1F41A 2WP3O 4PY7A 3AM8A 1VCBC 4NXKA 1XH3B 5KAQG 4W81A 4IBUA 1CGSL 3P30H 4UQ9A 1MH5B 5AW1B 4IK6A 3TA3A 5JDSA 2L7EA 4WHCA 2G60H 4IW4C 1XCWA 2V7HB 4AH2B 1RZ8B 2HVJA 4MNHA 5DEJA 3VFRA 4A37A 5DHVA 2P9RA 1XO8A 2OMYA 2HRHA 2NY4C 3L1FA 4KRLB 1AE6L 3K91A 1IEBB 3MA7B 5AFAA 1JIBA 5L6YL 3QIWD 2P52A 4WI0B 3MV8D 2PXYD 3CN3A 4JPKL 5FYJH 4P3WA 3V0AC 4F2MA 5IBTL 1N10A 1S9XB 1X7QB 4HIHA 4PTUA 5T3XE 1XIWD 4PJGE 1EDQA 2HT4D 5L8KB 4FXGA 4HIXH 1J7VR 3AT8A 4E5XB 5ID0A 4Y9FA 2NY0C 3QORC 2BS71 1ETZA 5I0WA 4MA1B 1BQUA 4ZG1A 3KLHD 1H5BC 4Y4HA 1LDPL 4HJTA 1UUSA 2V5RA 3EJYC 2CA4A 4NPJA 4Z78B 3MUUA 2GJ6B 4E5XG 1DBAH 2AQNA 4ANUA 3PJSA 2M2DA 4OGAC 1KBGH 2WZPD 4B9JA 4KX7A 3T09A 2Z7ZA 2H6UA 5I5RA 3ARGD 1H6EA 4UQBA 2NXZB 1K8DA 3LZQA 4M7JH 2H8PA 2V3FA 3GLEA 5FA4B 1W8OA 1WBYB 3P4MB 5C0AD 3VMNA 5IVXA 3RWJA 4EIUA 4GIPD 1RHHA 5FYLE 2ENPA 1HI6A 3NCJL 3QDGB 4TLKA 1LE5B 1IEAA 2QVKA 1I3GL 4QT5A 4R7LA 4GUOA 3CN0A 5TK2A 3FO2B 4FMVA 4WNQB 4H88H 4JHWL 1JYXA 3EDFA 2EDFA 2BVOB 5CLZA 1YEEL 3BGAA 3NUKA 3MLWL 1ZT7B 5ALCH 4PGCA 4Z23A 1G4RA 4JFHD 4PRHE 2FD6H 5I2IA 2OULB 4JBSA 5ESQA 4AEEA 5CZVL 1JZ8A 1TZOA 3B7YA 4ZFGL 4EBQL 1DVQA 1F4HA 1WBZA 4P3DA 1KLUB 5JHAA 4ZW8A 2A77H 1CDGA 3L8QA 2EC8A 1U8JB 3KXFB 3AG1B 3LKRB 2P46B 3PP3H 1FVCB 5IK3A 1MELA 4JDVA 5I19H 1NCTA 5K9QI 4YNYA 1PY0A 1UWEL 5K39B 1HILA 4ZX6A 3LV3A 3WNNA 3OGOE 4PI0A 4HBCH 3O6FA 3VXRA 3IU4H 2C1PB 4HFUH 5T1KB 1MREL 1ZK5A 1EO5A 5GJTL 2OQJB 4PJCB 2F53B 1NCWL 2B1AL 3P1VA 4PJXA 3B5TA 1HXYB 4Z7WB 1XD0A 4EI5D 2V0AA 1JZDC 1UJ3B 4MSWA 3ZUNC 4J2XA 4FADA 1OQXA 4M8RA 5IT2L 1KCSH 1NUGA 3QULA 4G7SB 3ULVF 1NGZA 1ET5A 1BVZA 1S4IA 5DI8A 2IWGA 4I85A 1VZIA 3PP4H 5DTFB 1U6AL 2GSMB 4N86A 3SHSA 4AYMC 3WFHB 2OCFD 4MJ4A 5FKPB 1SJEB 1KLFA 1EFXB 4GQRA 3HG0A 2P5WD 2XNAA 2DQUH 2LFEA 2DDQH 3J2PA 3HE6A 3H9SE 3F05A 4J8RB 1S7RB 1DBJH 3AB0B 1FFRA 1F1AA 3QNXA 2WYHA 2X4TA 3RFZA 2NY6B 1OAKH 3VAEA 2IGFL 2YPVL 2FB4H 2F5AL 2COVD 2OW7A 3H9HA 4FMFA 5F9JA 4CUCA 4UF7C 2V5MA 4JFQA 4Z3IA 2B0SH 5E6ID 4XBPA 5AZ2H 4MQ7B 1J0KA 2DLHA 1T0MA 3RU8L 5KSBE 5EN3A 3JTTB 3NRPA 3V0GA 4YJZL 5B7EA 2GVYA 3N1QC 1RFDL 2BVTA 4R4BB 1YEDA 2NX5E 2VLRE 3HAEH 1MN4A 2AJUH 4PYHA 4OCWH 1Y6KR 2O5NA 3MCG1 4MJ6A 1N4XL 2AJSL 1OSYA 4C58B 2PPEA 4C83B 5D7HA 5B4MD 2OTWA 1Z1WA 2BP5M 4YHOH 2G4EA 4DPRA 3S36X 4IDJH 1E5AA 2YJLA 3JV6B 1QLEL 5AW0B 1IM9D 1EEZB 3WIHH 4KO9A 4KZCA 4OCXL 5CZKA 3JT2A 1S3KH 2OI9B 4U0RC 2X4RA 2HN7A 4HDIA 3QWOA 4P5TC 4U2YA 5I8OL 2XVKA 5D71L 1JGDA 1SFDA 5FGRA 2HG0A 2QMJA 3O8XB 3MYJA 3IWVA 2V5YA 2HCZX 3ZKQD 2BSEA 4BUGA 5AENA 2C3WA 3PNWB 4JLRA 2XC8A 2ARJQ 2AK4E 5M95B 2UZIL