3UP6A

Crystal structure of a putative cell adhesion protein (bacova_04078) from bacteroides ovatus atcc 8483 at 2.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
324
structure length
322
Chain Sequence
TRAQLSIDLVNNVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BACOVA_04078
publication title Crystal structure of a hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483] (ZP_02067074.1, SP17169A, JCSG 417104) from Bacteroides ovatus ATCC 8483 at 2.80 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
total genus 73
structure length 322
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A01
2.60.40.3380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A02
3R4RA 4JRFA 4RDBA 5DHMC 4GPVA 4JG5A 3UP6A
chains in the Genus database with same CATH superfamily
2DMCA 4UM9A 5GQBA 3VXMA 2H4EA 1MWAB 5JXED 5HDQL 5I18L 4P2YA 4PP1D 4YSTA 4PGJA 2CPUA 3BSZH 4PJHA 4GSXA 4Y1AB 4W9KC 1PBYA 5D1XB 2DAVA 2XN9D 4BRVA 1TYEB 2JB5L 5J12C 2Y2TA 1BZOA 3VG0L 1YN6A 1QFUL 4W9ZA 5DJ2A 4AEHL 3MR9A 1EDYA 3TBWB 3T04D 5GIRA 1FFOA 1G5AA 2AI0H 1CXEA 3HC4L 4N28A 4XN2A 3SKJH 2V8MA 1KTBA 3EYSL 3MSPA 3PFUA 2G3MA 5GZND 3NJKA 2YKLH 2G2PA 2MCMA 1IIKA 4KHTL 5J6GB 5FFGA 3RB5A 1M6OB 5MEOB 2QKSA 4YNYB 4YFEA 5D7LE 1H8NA 3QXAB 4G6ML 4EJ1C 3GNML 3RFZC 3GRWH 2VW4A 1PZBA 3KEHA 5JMRA 2QPSA 2CO3A 5GS0C 4N6QA 5EO9B 2DPKA 2ENQA 4P2OA 3MNZA 2MCG1 1P2CA 1QW8A 4ZMAT 3P4NB 2A9CA 1F6AB 3K4ZA 3SBQA 3PUCA 2I9TA 4MMYB 5EOQH 4F2ME 4JG9A 2A2QT 3V0VB 2A6KA 3QPQC 4HC1L 1Z2KA 5GS1C 3EBHA 2NQCA 5F88A 3WEBA 5LNDA 4ZMWA 3C2AH 3K72A 5TDPA 3I6LD 4O2EA 4Q6IA 2H8PB 1CICB 4MZIA 1GYAA 3JWDL 5HGHB 1T5XA 3PWVB 4P4KB 3KLDA 4JREC 3ZRFC 4IBWA 2ODIA 4WWKB 2ERJB 3NFPA 4UU9A 1BLNB 4E9YA 2QPUA 2WXHA 4U0RB 1OAKL 5I8OH 2C4FT 1OD9A 1WFIA 1YNLL 2QSCH 3B1TA 3F05A 5KVGE 3U2JA 1A7PH 2YRZA 3WLBA 4M62L 3FO2A 3QIBD 4QRBA 3I75B 4F7KA 2C8NA 2HUEA 3MZTA 3QA3B 2NY0C 2X7LB 3MXVH 4MDJB 5GJSL 5IFHL 4QT5A 2AEQH 1FH5L 4ODUB 1RAMA 4I5BB 3RIAK 2N3JA 1MAJA 1JYVA 1FYHB 43C9B 2EC9T 3CZLA 5DFWH 3HBPA 2YPVA 4EZKA 1P7QA 1TQWA 2O6PA 3PP3H 3O3AA 3C60D 3VGDA 5A2IH 5TPWH 3TU6A 5I1HL 5AVSB 1I3RB 1Z3RA 4JO3H 5JUEH 4M6NH 3IAGC 1BZ9B 2M8XA 5D7LB 1ILSA 3VMNA 4YBLB 4YSQA 1ZLUH 2WQVA 4AZ8A 4J4PC 3QHZH 3QUKA 1OTUD 1M7UA 9CGTA 3CN1A 2EYSB 5E8EB 4RFEA 4ELDA 1OLLA 1ZEAL 1R24A 4PRHD 2EE2A 3FUKA 2KZ1B 4O4YH 3BUTA 4L3CB 5HVFB 2UZXB 5BRZD 3VD0A 1HZHH 1ASQA 2B1AL 2PYED 2APTA 4F2MB 4PJ6A 3UYOD 4Y7MA 3P4OA 4OW6A 1N64L 4B95C 4PJFF 4LXFA 5CCGE 4TKWA 5MI0B 4IDJH 1QPXA 3LTVA 2DQFB 4Z0BH 5FWRA 3V0DA 2XXMB 4LF3B 1MFBL 3HBQA 4QXTA 1FNSH 5HYQB 3OJDB 1RZ8B 1WS8A 5DZNA 4LKCB 4ANWA 3ULUD 4PW4A 4L48A 5DEZA 3UDWC 4L18A 5CFAA 1FV1A 2VRQA 2YPVH 4HEPG 4LLVA 1CL7L 1AQMA 3H0TB 1H8OA 5FB8A 1O5DT 2X4PA 2YA0A 4LP8A 4Q9RL 5D7JB 2F53E 3DPBA 4AQEB 4F20A 4PD4K 2ZKWA 3GB7A 5AOLA 5E70A 1YLBB 3SE9L 3NUKA 2I26N 2AFNA 4Z7NF 5IB3B 1YMHA 2GIMA 4QRFA 4UYPA 5L2KD 5EA0H 5DJAA 2ETWA 5I76B 4K2UH 5C0EA 1C1EH 2HKFH 5KTEH 1OOAA 4GRLC 2X0UA 2XWDA 1XGQA 2MOGA 4NS0A 1BLIA 1KGWA 3HAEH 2ZOOA 5PAZA 2A74A 3UG3A 5I8KH 2C34A 5DA0B 5C3IA 4G8EB 4XMVA 1JTOA 3L4WA 3MFGB 2J1XA 2LLGA 4XRCB 3UBXI 3CX5K 3OGCB 3VE0B 3EYFB 5DCCA 4RNRB 4YQXL 1NM9A 3CFNA 2PNDA 3OKMA 3JYBA 4HS6B 1G9NL 4MJIE 4XWGH 3EZ8A 1I7RA 3NACH 4KDTA 1ADQL 1BVLA 4F93B 3EOYG 3IE4A 3CZEA 3QXDA 5H2BB 1WBXA 2ZP0T 1PNCA 4JM2F 1X9RA 3B2VL 2WZPA 4K7PL 3U0TA 1JUFB 4P5TA 5GS2H 5ALCL 1U8MA 1WCBA 1T04B 2PWEA 1A6UH 1D2PA 1QLFA 3DGGA 2FIKB 4G6AD 4YHLH 5IB2B 5E6IA 1F45A 1KFAL 2RFXB 4CVWA 2NY1B 5IM7B 3GIVA 1AD9B 3TVMC 1G7LB 4MX7A 1R3IH 1DVZA 1YCSA 4WNJA 4L05A 5DWUH 5I6OA 3RWGB 2D2CC 5E08L 3L3GB 1RZJH 5EG6C 3ZYOA 3MI6A 4YDLC 3HA0A 3JWOL 3B5GA 1P5UC 2WQ8A 4IU3B 3W39A 2X6CA 1OW0C 2O5ZL 4M7KH 4R7DA 1KYOK 2FZ3A 2FD6L 2F53B 5DEJA 3WKYA 5IQ9B 5EN3A 2WB7A 2HWZH 5HJ3A 3TN0C 3TXAA 1G7MA 2HH0L 3D0AA 3SHSA 2DQDH 2NW2A 5LWYL 3V95A 1BOGB 1J0YA 3S5LB 2AQ2A 2I07A 4MHHG 1QA9A 2DZEA 4GXUM 4H1LB 4AW4A 2VLME 4N2FA 2B4CL 3J8F7 3KXFA 5MEND 5IVOA 2PCFA 2GB2A 2V2XA 3MUGA 4MCYA 2ZOKA 3FW6A 2D4FA 4QRSB 1EEQA 4PV1C 4YHPA 4FL4C 4HIEA 2CLZB 3F5WB 1IM9D 3IS1X 4IBLT 1AY1L 1FFNB 4OZ4A 4NRYB 3FULA 1NFDF 4XR8C 3BN9C 3CPLB 1K3ZA 3DGDA 4EXPX 3QCTH 2Z35A 1OKEA 3ZRCC 2X6MA 4P5MA 1TENA 3IFOA 2CE6A 3QUZB 4AMKH 3BEVA 2YD4A 4H13C 3ARZA 4MJIB 3RX9A 2ZUXA 3VI3E 3EOTH 1TEYA 1QSEA 1ZA3B 5DI8A 1Q9KB 2W65A 2OMUB 4F7CB 2A73B 4U1KA 1IB5A 3V0GA 2BNRE 5EIIG 1SUJA 5D4QA 1XF1A 5MEQA 1W72L 2CQVA 4CW1B 5C0AD 2E9GA 4JY5L 1T7WA 4YIQA 4PJBA 2A99A 1LNUB 1WFJA 2OX5B 4KC3B 2R4RL 4L1DA 4OZGB 4AJVA 2CPCA 5ERWB 2RQ8A 4Z7IA 4H8HA 3FC8A 5B1AB 1CK0L 1IAOA 2VDKB 2FJFB 4R4ND 4Y19D 3VFSB 5FO7A 1KACB 1P4IL 3QW9A 2DOCA 1KIPB 4HS3A 4RAHA 1T1ZB 5E94A 4AYGA 1YYLL 1EZSA 3QQ3A 4XP5H 3SGKA 1NC4A 4PB0H 3ZE1E 2W94A 2GTWA 3OKYA 4GRWH 1Q1PA 1H9DA 4R2GB 2W1NA 1U4FA 3WKNA 1VFBA 5ADPH 1W8NA 1BPVA 2DM7A 1C8PA 4MQXC 2AQRA 1V05A 4MZ2A 4J28A 4L23A 5T3ZH 5DQ9B 3TT1L 4QRQA 1OO2A 4N68A 4LLUB 5K9JL 4LAQH 3VFVA 4R8WL 2IPTL 2MIZA 3CC5B 3GJFB 1OAUH 3QDGA 1DQTA 2BDNH 1K4DB 2CM6A 3BRFA 4WI9A 2Q5BA 2F19H 3DVGB 4OGXH 4AIZA 2WBJB 1G6RB 1A1MB 1TSHA 4PGCB 5IESH 4M48H 2VDML 3FCSA 2V17H 1JFQH 1SY6L 1UJ3A 5ID1B 3FONB 5CSBA 1X9LA 2E7BA 1M2VA 1J8KA 4IJ3C 3SZ6A 2HPOA 4MS8C 4PG9A 3HG0A 5DRZB 4PY8I 5ICYA 2X9WA 3MLTB 4OV6F 4RDQG 3VI3B 4QHNA 3T0EC 2B14A 1TO5A 3ATAA 1TITA 2YOAA 2PWFA 3VWJA 5DT1L 3HAEG 3GBDA 2BNRB 2F58L 3KE0A 3P3YA 3D85A 4NO2A 3GSQA 1E2ZA 3QQDB 3EYUH 1EO8H 3QNFA 4YFDB 3U6XS 1YY8B 1J0ZA 4TNEA 3DMMD 2B59A 4NRXB 3CZFA 3ZL2A 1F3RB 2AJUH 4HCFA 4X98A 4NPYB 4YAQA 2XQYK 3WSQH 3CZUB 1Z5HA 4KJYB 2FJHB 2R0LL 2QGDA 4Q9QL 1BCIA 4X9IA 1F58L 2OSWA 3V0JA 3ZE1B 1TJHL 3Q9PA 3UJJL 3GPEA 4MXQC 2J55A 3B8YA 5C70A 2AJ3B 2VUOA 5D72L 2BFGA 2J1WA 2UXVA 1Z9OA 2OA9A 4PIBA 3LRSA 4YSUA 1A4KA 5GRJH 4FP8L 4XC3L 2ZE0A 1CG9A 4H0LC 3ZOAA 1HKLH 4KXDA 1ZHKA 3QEGL 4LCUA 4ZUWA 4LLWB 1REIA 4BK5A 4MS6A 1OLZA 3MRQB 4WEBH 2OK0L 4XNUL 2UV3A 3VM7A 3FU8A 4XNBA 4LOUD 3U9UA 3X14A 3VXQA 5K9QG 3KYOB 1RP9A 2WO3B 3D2UA 3QT2A 4CUCA 5EORH 3LD8B 2BZCA 1EO5A 2JFCA 3RBGA 1ZHLA 2K6ZA 5E1QA 3IMBA 4JGNA 2ZUWA 2NX5D 3R19A 2DJSA 1FBIH 1MW3A 1U3HD 2WQSA 4XPFH 4CKQA 1BAFL 1MSPA 1ZRUA 3MJ9A 4D0CB 3PDGA 4JCWA 1A7NH 4GKSA 3V5KB 3UJTH 3VXRD 4UTBA 3S9DB 2OI9B 1ZXKA 4PFEA 2Y6SC 3CFCL 3FTWA 3BPOC 1JGEB 4GBXD 2WIIA 3C8KB 4UQ3A 2GJZB 3DYOA 1JAEA 1XH1A 1MJ7L 1KJ2A 1HH6B 4P3CH 2KUTA 5FYKU 4KZCA 4MMXB 3RKPA 4JG1L 4GUQA 3QORD 3ISWA 1DO5A 2X4TA 3TNMA 5FO2A 1ANUA 1I7UB 1PD1A 4PTUB 1IBHA 2MTAA 4AEIH 1A3QA 4KU1A 3AY4A 1GRWA 4LCVA 2JB6A 5JDJA 3WDJA 1S7WB 4Y2DA 2E8ZA 1AR1B 3FQXB 2FQFA 3OAYK 3PCYA 4WSGA 3O4LA 3P54A 4J3SA 1FG9C 1UZGA 3W3BA 1DSYA 1DO6A 1CBVL 2ZKMX 4U33A 3K6FA 3QPXL 4KXCA 3SDAB 2D03H 1TNMA 4QTIH 4TUOB 3MJ9H 1MEXL 2CAKA 1WUNT 3C5SA 1I8MB 3VH8B 3HNSH 1L0QA 4UTBH 4ZW6A 5ICXA 2YEQA 2C9RA 4I2XE 1SVCP 4P46C 2WTRB 3UTQB 5CJ8A 4GMSH 3PF2A 1T21B 1WC7A 4F1SA 4YN3A 5DHXB 2YQGA 3RWDB 4N5EC 4HX1A 5BOPA 1KJ2H 2PO6C 3V4PL 3NJIA 2XA3A 3BUQA 3PIQB 4W1TA 4LSSH 3OKNB 1LMIA 3U4BH 4BBWA 3BWUC 4JCMA 3GBNH 4IJTA 3N40F 3MNWA 4UB0H 3CHRA 4PJAA 1BXAA 1RUQL 5F9JB 4G71B 1Q0EA 1IAIL 2AC0A 3UAFA 4WTZA 5D5MA 5HHME 4JY6A 1WICA 5C0RH 4I88A 1Q94A 3LKPA 4GG6E 3CIAA 2Z31C 4HG4J 3FT1A 3FFCE 3ISYA 4MJHA 5I66A 2E7LA 2YK1H 4JFED 4ZMTA 1Y6KR 4TNWK 1N10A 2ZSWB 3S6CA 1W6WA 4NO5A 2EEAA 4HQQL 1TQVA 3T4AA 4HBQA 5AZ2H 1TJIH 4IU2A 1TZGH 1MLBA 3NPSC 4J3UA 1QZNA 2EDEA 1QO3B 3L4XA 2D7TH 4XOEA 4AV5A 1N6QL 2HJKB 3IJ8A 3EW3B 4O02H 1DSWA 5B3NA 1UWXH 2VR8A 4HETA 3LQAL 3VXTA 3ILPA 2JCCE 3BPCA 3ARBB 5FGSA 1A2YB 5TDNB 1HI6A 4ZPVB 4IMKA 1EMTH 2Y07L 2DD8L 3WMSA 4IBVA 2AXWA 4X9YA 2XV0A 1FVDA 2DQ6A 4UILH 2E0PA 3QRGL 3T3PE 4NPJA 4JX0A 3BQUC 4FADA 1VB9A 2X4RB 1HE8A 4QJ5B 3NZUA 4I2XB 1K5WA 1D5IL 2AXGA 1E6JH 2FGWL 3EJSA 4GH7B 4ESKA 1EZUA 3FUFA 5JXAL 2XN1A 5GSRA 1U9KA 1E28B 3RNQB 4HOMA 5AENA 2AKRA 4P0DA 2QZ5A 3NVQA 4ODVL 4ONHB 2O6DA 3QIBA 4ALAC 4DGYL 1HEJC 2JIXD 2DMHA 3IDGA 4KQ3H 1YY9C 3PP4L 5DHVB 3MJ7B 5HHMB 2Z1KA 3SKMA 3S34L 5AAPA 3QP3A 2CKBL 3ULSA 4ODHH 1WGVA 5BVPH 4GG6B 4W6WB 3DXAD 3FFCB 5IKCB 1ZGLP 1BJMA 5C0FB 3RJDA 4V2BA 3GSVA 3WTUA 3VMPA 3TWCL 2WYHA 3MO1B 3N41B 4OD1H 4XTRC 4L4TE 1E8WA 2CO7B 3ZHDA 1KOAA 5T33L 1U8HA 5HD8D 1MQKL 5EU6B 2GW5A 4JHWH 4TYUA 2H2PD 2R15A 3DIVA 4JZJC 4GUCA 4RISL 3Q1EA 3ULVC 2B15A 3EJUA 1V7NL 1AH1A 5DGRA 4R6UA 2JCCB 4GW1B 1C5DB 3RX5A 3RUGA 1INQA 2Q6WB 3PJLA 4PRHA 3KYKL 4GAFB 5AZEL 5CZKA 2XPYA 4QXGH 3KPRE 4H4NA 5LN4A 2CJUL 1JK9A 1W72B 2PYEA 3UAJC 2EDWA 3T3PB 4KKAD 2QQKH 3BWSA 4ZYKA 1X5IA 1TU2A 1NGPH 4U2ZA 1IGTA 1SLXA 2FUQA 5F6HJ 4L1LA 3C6SB 5GS3A 4HHAA 1ZVNA 1VGKB 2WZAA 3VFRB 5L8LB 2GK0A 4GXFA 3S5LG 1N0LB 5L4IA 3IRZA 5F1NB 4H1LG 1YUKB 2Y3NA 1FRGH 2M1KA 5AW2B 3TL5A 2EIEA 4PRNA 1IILE 4OIFA 1QSZA 1PCSA 2HTLC 3GMQA 5JIQA 2R4SL 3Q1SH 4GEIA 1LK2A 4QTHA 4B0MM 4NAJA 1RMFL 1YEFH 3TNNB 4N1CA 1NCWH 4M6MH 1A14H 2XC8A 3CSYB 1WLHA 1U8CB 2HFFA 3C9NA 3ZDXE 1JHTA 4U1SA 3WO4C 2UXGA 1PPIA 5FYLL 3V6FA 5D9SA 4N0CC 3WY4A 1LE5A 5CCJA 5FIEA 1FN4A 4TLTA 4ZTOH 3ERXA 4LRIA 4ATTA 1RIUL 1IAKB 4Y4FB 3FBKA 4NZRL 5L7XH 4KXZH 2V3EA 4ZUTB 4Z78A 1EEZA 2CUMA 3SCMB 2HVKA 4L4TB 1CFBA 2VDMB 1TXKA 4XMPL 1ORSB 2HLAB 1O6TA 4HISA 3S35L 3WIIH 4IRSA 5GS0L 1FAKT 5BRPA 4MJ5A 4JM2D 3D6GA 3B2XA 2FNBA 5CUSH 4QHKI 4IMLA 1RD6A 3MLZL 4JZNB 4LPVA 4NCC1 4OF7A 4CVZB 1IBZA 3IMRA 4ZX4A 3NCWA 1FLRH 1LEKB 1NCBL 4A2HA 4EI5B 1RPUA 1JGDB 4HWZA 3KPOB 2LLNA 4DTGL 3GRBA 3ULUH 4OM1H 4UQ2B 4Q9BA 3VYOA 4UDTB 4CMHB 4WK2B 3LN4B 3OXRB 4HU8A 3KPRB 1P7BA 1HHIA 4JPWL 1PF3A 2AQNA 2PPAA 4OJYA 7CGTA 1TMCB 3FOMB 3LN5A 1TPXC 4R90H 2OJEA 3HMXA 4AYBA 1ZDSA 2NR6D 1T4KB 1MHEB 2NNCA 1J5HA 3BH8B 3WU1A 4PHZA 5DMJB 4JB9H 3WIAA 4M93C 3GLEA 4QPEA 2D9CA 2F08A 4JDZA 4PWIA 1E4XH 4X4MA 1AQKL 1IC7H 4L2YA 1E3XA 1N12A 3KPQB 4P4RA 3FQNB 2VO8A 3PQYE 4UTAA 2A0LD 3TPUB 5FYKH 1I85C 4WKXA 1TYJA 2KKQA 4RBPK 2DWDB 4LSRH 3ZDXB 2DQGL 3KPNB 2FJSA 3DROB 3G08B 3EOBA 4MYWB 1NEPA 4NNXA 5JDSB 4O2FB 3O41A 5I1CL 1J1PH 3MRPB 4JKKA 5MENA 1A66A 1DFBH 4BSJA 4K23H 1BBJB 4DK3A 2OJ1A 1PZ2A 1ZCRA 1M6UA 3VFOA 4BV1A 1ZTMA 4EUPB 1IM9A 4JLRB 3BVNB 1ETB1 1QSFD 3IDNB 4B9GA 3FUNA 3HMXH 5IMMA 2F74A 2UWEE 3DJSA 5I16A 2WN3A 4N8VB 4JFUA 5L6YH 4MMZA 4IGBD 5KBMA 12E8L 2BY1A 4NZTH 2XXFA 1TQBC 2OZ4L 3K5RA 4ADJA 3UG5A 3VFNA 1KEMH 1SBBA 4H25A 2VAAA 2EKSB 1UQSA 2VQTA 1B3JA 1G5GA 2AK1H 2XQBL 2PW1B 4PH8A 3E80A 5CAYB 2ZOLB 3FQRB 3T1FA 1IGCL 3TBVB 1ZTXE 2IH1A 4XNXL 4KZDL 1MAMH 2R69A 4UZSA 1TQTA 4NQDE 3F62A 4C8XA 4MCMA 2XPGA 1ZS8B 1SEQL 3AMKA 2VLLA 2ZIDA 4XCCL 1VGEL 2ZKHL 2BNUB 3RDTA 4UNUA 1TQSA 2A6DB 1SJEA 3NZHH 2RIKA 1A7QH 2JELL 2HX8A 4WU7A 3NZ8A 3E2HB 3DX8B 3GINA 3TJEL 1M4KA 1QYGH 4Y19A 4M5ZH 3Q9QA 5AOZA 5D96B 3RNKA 2XG4B 4ICWA 1JN6B 1HH9A 2DTSA 4XNDA 5DGQA 2OSYA 1X5HA 4PBXA 5CZVL 2KI6A 3PQYB 4XCFH 1OXYA 4JM4L 3CSTA 4H2AA 4DW2L 4EO5A 1AQDA 2OCCB 3R1GL 4G1EA 4PJGE 4UMSA 2K7PA 5IW6B 1MPAL 1GGCL 2B5IB 2XIBA 3NABL 5FK9B 2V5RA 4U1IA 4BFFA 3L9EA 3B2UD 1XF5A 4TF4A 1U58B 3G5ZB 4KTYA 3EYVA 3V4UL 4HUNB 5BZDA 3G6DH 5EU4A 4UV7L 1AI1H 3FCTA 3VYNA 1V8HA 1GGIH 1OP3H 3HZVA 1TTAA 3VNYA 4H8VA 3O11B 5JHMA 1HYSD 3V4PB 4YE4H 4RZKA 4XXWC 5D1XD 3T0VA 3IGUA 5DHYA 1U8JA 1B0WA 1VADB 3KJ4C 4BH8B 2UWEB 1ZVSB 3SYCA 3ABLB 2HYMA 2X4OA 1S9YA 1ZHNA 3H8NA 5TDOA 1E4WL 4M5SA 2ARJB 5CJOH 2Y36L 4HK3N 5F9WB 2Z6FA 4YPGB 3VFWB 3G6JF 3FRPA 4G8IB 5DYFA 4RGOH 2VXTL 5AW7B 1D5ZA 3H56A 4PHXA 5F0LB 3NSXA 4QOKA 2AJSH 4NQDB 4WIQA 4UM8A 4WJKB 2DQCL 2NXYC 2ED9A 2CO6A 1S3KL 1UADC 4HJ1A 4NDMA 4XVUD 3CJJA 3SZKC 4I0PB 2DIEA 4I9WD 3RWEB 5D7KE 1EGJA 3D69A 4Z18A 4EXKA 4GUPA 4ANUA 1HHHB 1MRCL 3DMMA 3MJ8A 3RY6C 1SEBA 1MCCA 3GXUB 1XH2A 3ZHLA 4E5XG 2EQDA 2WXLA 1UZ8A 3FQ1A 1HU8A 3HC3H 3HJ0A 5C09E 3OPZL 1U8KB 5GGVL 5JOEA 3ARUA 4U7SA 2C1OA 2G30A 2OQJA 3O6KH 3WS3B 2G3ZA 2QHRL 2G9HB 1HESA 1CICD 3U9PH 3T8VA 4PJGB 4MA3B 1WUZA 2XTJC 4FRWA 2Q2EB 4LCCC 1WK0A 4P4KD 1AGCB 4FNTA 4WWKD 5J9PA 3PL6B 1T7YA 1UTDA 3STZA 3WJLC 3L3KA 3S96A 1VFAA 3I2CH 4D9LL 3N43B 1FLTX 2ZONA 4PGBB 4WGWB 3UMTA 5TQ0H 2R7EB 1J0IA 1CYWA 2W0LA 5IOPA 4HZLA 3DRTB 5T8IA 2IWEA 4FLHA 1MDAA 4NT6B 1AOHA 1I1AA 2XT1B 1J7VR 3MPCA 3KGUA 3MRHB 2OMWB 3FH7A 3SGJA 3U1SH 4XPAL 2NX5A 3C87A 2Y2YA 4MAYB 3E6HA 1U3HA 1FNEA 3OWEA 3BKYH 1A6AB 3AC0A 4DQOH 2HFEA 2WHVA 2YGQA 5GRYA 1KLGB 2Z0UA 3AADB 5GSVB 4ELMF 3QEQE 1B2WH 5JIMA 1MDTA 4QUOA 3VXRA 3DOHA 2NUTA 2CKBB 3GTTA 5FYLE 1FDLL 4PW3A 3HE6B 1AS7A 2G2RA 3K81A 3EO0A 3MRRA 3NFSH 4GBXA 2OSLB 4KI5C 5FWQA 5AVWB 3D5OF 4E9SA 5AB9A 4YO0A 3TM6A 5I1AB 2CRMA 1CDBA 1QFWM 1H3UA 3ARTA 3QORA 4X7SH 4OUUA 3LKOB 3OJ2C 3CFKB 5DLMH 2R0KL 3QHFH 3S48A 1BGXH 25C8H 1S7SA 2BW5A 1F90L 2OXGA 3DIDA 4KK5C 4IRZA 5CCKL 2VGLM 4U7MA 4OGYH 4XPBL 5DDHB 5EPMA 3VXOA 5JQ6L 2BC4B 4P04A 5I30H 5AD0B 1KSRA 3O2VL 2R56H 3DUUB 4HHGA 2VDPL 3SGEH 5IB4B 1FA4A 2CHWA 2ITEA 2ADJA 3QK0A 4J3OF 4QY8B 1AGEB 4FG4A 1U4EA 2QEJA 2VMCA 1PD6A 3ARDD 3QJOA 5KSUA 3ZYZA 4Y9FA 2YD8A 3GMNB 1ETZB 4WW1B 3REVA 3SKNB 2OCFD 4UWQB 3KG5A 2NYYD 4PJ9B 1RULH 3EHBC 3K46A 5GRXG 3B9KC 1WWAX 1J12A 1QRNB 5GGUB 3EYQD 5MP6H 3MODH 1SDDA 1IBDA 2EVHA 2WV3A 2H9GA 4Z95H 1UH2A 4DN4L 1QACA 1FC2D 3FXIC 1SM3L 1YEKH 3LQZA 4E0RB 1CURA 2CUAA 3GHPA 3H3PL 6FABH 3EJTA 3L5IA 3AROA 3L1FA 2ZUSA 1ACYH 3BO8A 4XMUA 1HSAB 1BHGA 4Y5XC 3JYCA 1FZOA 1PX8A 5I8CA 4Z7UE 1XR9B 5CP7B 1OB1A 1L3NA 2PP7A 5JW3H 4WSKA 5I17B 2CDEA 1NL0H 3BHBB 3IDMB 3OKKA 1LP9E 4YK4C 4D9QE 4U6XB 1OTSC 5J12B 2AEOA 3X12A 2X6VA 4ZD3L 2HX9A 1RIHH 4IRZH 4Z5RB 4MLSA 3QEQB 1QUNA 3MGOB 1CFNA 2P8PA 4X6DE 3E38A 5KWYC 2VMJA 4LQFL 2DH3A 1Z6JT 5I1EL 1JZ5A 2QVMA 2Z4QB 1KCVH 3HR5A 3KJ6H 1DVUA 4HEMA 4JFEA 3HVDA 2O6CA 4GMTL 3RFZB 3CZGA 3OSKA 5KYWA 2OCJA 3MRLB 2VE6A 3GSUA 4DCQB 1WZMA 3OHXB 1T20B 3PV6B 1JZ4A 3CCHA 3GSXB 3MRMA 4HAFA 4RMTA 3FB8A 4D0DA 5I71C 4J12A 1R5IA 4G80B 3L3OA 1A1NA 1LMKA 3OC5A 4LVEA 2BP0A 4HUCA 4XMKH 3NTCL 4RMVA 1F86A 2XWBA 4OCYH 1YEIL 5JO5B 2AK4E 1AGFA 2NY1D 4NKMA 5GS1B 4HIQA 2DV6A 4FFVD 4KTDL 1CLOH 1MREL 1Y1DA 2HRGA 1MY7A 4PM1A 2YBRB 4A7TA 1DLFH 1BP3B 4MQ7A 2GUOA 4NIKB 3VDCA 3JV5A 1ES0B 1TVBB 5A2KH 3QNXA 5GGSA 3DLQR 4G6KL 4QRTA 3HMWH 2W60B 3ETBJ 3BESR 3QDME 3SKUD 1FC1A 1KGCE 1CXKA 5H37G 3Q5TA 3CV5A 1MWOA 4IW4C 2GC7C 2F53D 4LVNC 4OD2B 1AZVA 5HYSB 1K5NA 5F3BB 3CFMA 1N8ZB 3UTPE 1I31A 2NY0B 1JWUA 3GUTA 2YUWA 4OCRL 4KZEL 3HI1A 2PYFB 4FQQA 3BP7A 2IALB 5LLIC 1TUPA 1LP9B 3P1VA 3D1MC 5IJKC 2E6QA 1OTTD 2XLLA 4QF1B 4HXAL 3X11A 1NGZB 2X2HA 5B38A 1XEUA 1DVFC 4K94L 4NC1C 2FATH 5T5FH 2VDLH 3C5JA 4F9PC 3KPMB 5I8EA 1NCIA 2D0HA 3OKEA 2I85A 4X6DB 4A7GA 1NAKH 1ZD6A 2BNQE 2YRPA 4FXGC 4AM0A 3EIFA 1HQRB 2WD0A 4PRBB 4WJG3 1ZPLA 4DWHA 4KKPA 1FG2B 5JPNA 1DQIA 3QUZD 1IFHL 3RTLA 4MJID 4W9HC 2XFXB 3ZTDC 4OCXH 5ABDE 2V9RA 5B3SB 2V7HA 3VJ6B 1Q9LA 4JQIL 2A6JA 4FG2A 2GVYA 3ZK0A 2OAAA 3M1BB 1JZDC 2R0ZH 1MQ8A 5EBMB 1GYWA 4WCYH 3EFFB 2H1PH 4IIQA 3RA7H 4WV1C 3N44B 1AQHA 2B8OT 2YPKA 1CIDA 4PJFA 3V6ZA 3NIDF 2AK4B 2UUDH 2VL5B 1U93B 5HHVL 4QKTA 1X6NA 1WYJA 4G8GD 2ICEA 2W88A 2ARWA 3FJTA 1GZPA 3SDCD 1Z9PA 2CRIA 3UROR 4C57C 3EDFA 3LMJH 4NUJA 3OF6A 2PW2B 3RURA 2X4NA 1IBFA 1NPJA 4W81A 3QDMB 2XKNA 3F6LA 2X12A 5CILH 1DBBH 4OAWB 3QPKA 3OHMB 5E2JA 1F4XL 3GEFA 4NNPL 2JJTC 1HHKA 5D6CA 2IJ0C 3H2QA 3IMSA 1DFXA 5DMGC 1RXLA 4FEMA 4YLQT 2XYCA 3G6AB 3K8KA 3DTXA 4JRYA 2VLMD 4L2LA 2OMXB 3MLVL 1YECL 2R1WB 1WQVT 2QPEB 3FS9A 2VZSA 1OE2A 3CZNA 4RX4D 4ZMQA 2FO1A 3ZYIA 3UPRB 4KH2A 1RPKA 1Q1JL 1X4YA 5EOTA 2WBJD 4EUPG 2VUKA 1A7BA 1LTXA 1NLDL 2X9YA 3KM2A 5AVYB 3DOSB 4KO5A 5LKNA 1OAZH 1G7PA 4GRLB 4N8VG 2YD1A 4C55A 4F5CA 2BNQB 3OMAB 4WI6A 2J43A 2XY1A 4JHUA 4PGEB 1YUHB 5EWIH 1KXQA 3WDHA 3QIUC 1P4BL 2IH8A 4N85A 1WEJL 1F97A 4ENEC 3A3YB 1OCWL 2F54E 1GYUA 2NY5H 2V6HA 3MNMA 4P59H 4UINH 2HG5B 3BWAA 5HHPA 3DTUB 4ANVA 1H8SA 5HYJE 3BQVA 4UYQA 5LB1A 4XMTA 1HEZA 1V3KA 3V4VL 1T80A 1PAMA 3ZTEA 1CF1A 2FQGA 2BNRD 4JM2A 1HDMB 4BZ2L 3Q2NA 4LLYB 3KDMB 4UBDC 4Q6YA 4WK0B 4X99B 3P2TA 1ODUA 3AS2A 4AVHA 1DBML 2X40A 4JZOA 3RWIA 1FE8L 1NMCC 1RJLA 2ICCA 4NC0B 5K1JA 2EJ1A 3VRLE 1VHPA 2X89D 1PY4A 2Y7QB 1NGQL 4K73A 4N0UE 1NAMH 1JZ6A 3DBXB 4BKSC 4JN1H 3K8MA 1IT9H 3KPLB 3TVMB 5KSBF 1VACB 5E2VH 2Y69B 4DO4A 4AENB 2HX7A 4PS7A 2NR6A 3CSGA 4FQ2L 3F7VA 4YDLB 4KMQA 1PZCA 4JO2H 4X42A 2YFOA 3DSFH 4PN6A 4XMWA 3FAXA 2VXVH 1LO2L 2CK0H 2ADIB 4U3CA 1UEYA 2HZHA 5D2NC 4ALAL 3F84A 4AQ8A 1NKOA 4CSSA 3ZKMC 1RUKH 4TVPL 5CBAB 5DJYB 4O2CA 4HLEA 1MN4A 1JRHI 3C5ZC 2Y72A 2Y06L 2VM3A 5I6LA 1XTLA 1HQ4B 2LFEA 1EDQA 5SWSA 1JFHA 1M1XB 1UB6A 4FL4B 2ID5A 4BQ9A 1T2XA 3U0WH 3QVAA 3N43F 1NFDA 1EWHA 1CD9B 1VSCA 3CFDB 3SDYL 1J1XH 2FX9H 5IJVB 1IM3B 4JJ5B 3D9AH 3CN0A 4G42B 3RU8H 2N56A 3AAZA 2F54B 2PCPB 3FQTB 3REWB 4A2MA 3N55A 4KAQL 4KQ4H 1Z5YD 1ACZA 1KTKE 3ULVL 4XC1L 1SF3A 5K33A 5HYJB 5IG7A 5TQ2H 3JV0A 4PJIE 2B3IA 3T0EE 4AH2B 3F7KA 5AQ0A 1KCRL 2AVGA 3N9GL 5IB1A 3BX7C 3HRPA 1H8LA 4IGBA 2CBMA 1RP8A 2ZG3A 1NCDH 1ET5A 3F7YB 1LM8V 1HKFA 3GLAA 2A38A 5D1ZI 1AP2B 4G3YL 4G7VH 3V52H 3DI3B 2HJLA 2Z8SA 1H0DB 4XP6H 1JNHB 4NJ9H 3TCLA 4N0UB 1AR1D 4ETQA 1P4UA 1O5PA 3H6AA 4CJ0A 4NWUH 3RVWC 2WNXA 3STLA 5KYYB 2BSBA 5B39G 2MFNA 4M7JL 5HHQA 4F8NA 4EN2A 5IVZB 1A7OH 2PTUA 4DN3L 1EDHA 4RAVB 3DIFB 2XHNA 4HK0A 4PGDA 3WY1A 3VD4A 2OTWB 1HN1A 3LH8A 2C1PA 4I85A 3CH1A 3SDAD 4DP9X 4OI7A 5DRWA 2EC9U 2D3JA 5I0WA 4XBGB 1H3GA 3NZSA 3MX0A 1RZGB 4PWFA 2VDPB 4KTGA 3A6OA 3ZE2E 2I9LB 2CLRA 2GT9A 2YAQA 4OCMC 4D0BB 1J0HA 1KBGL 1R5VA 3UP6A 5FXCH 2NTFA 5IBTH 2ZX8A 3FQUA 5K39B 4A2EA 1I4FA 3VXSA 1W0VA 1CLYH 1FSKC 1H3WM 3D50A 1WV7T 1W0WA 1EEUA 1BJ8A 2XZCL 3EOAB 2IDTA 1MVUB 4YX2H 3DARA 2HUHA 4DEPC 3T65A 2IGFH 3N1PC 1F41A 3GI9L 2ZXGA 3CZSA 3P3SA 2VO5A 4AXWB 2MQCA 5LHDA 1KIQA 1MWAA 3S3PA 4ZO8A 4IJ3B 1J8HE 4ODBD 3H4FA 3QI9A 2WZ5A 4R4BB 4RWHA 5DTFB 1PZ3A 4FQHA 2ZPKH 4WUUE 1IC4H 3SDXE 2P5WE 5D1XA 1CZ8L 5IR1B 1YC8A 4PJIB 3T0EB 2ZYHA 4LL9A 3H9ZA 5LBGA 3TBWA 1EJOL 5FAAA 2VYRE 1ZE3C 2NYZA 4NUMA 4UOW1 4M5YL 3GSNL 3SE8L 4K7PX 3TA3C 3PHQA 4WI2A 1BREA 2ZOUA 2EH7H 4NXKA 1QBLL 3UZVB 5I6XC 1QR1A 4Q7DA 1M6OA 5MEOA 3STBA 1T89C 1KJMB 5GJTH 1KJ3L 3FPYA 4Y4HB 2LVCA 3FSOA 3ASNB 3I6KA 2YPLE 4R5XA 2VLKE 5CN2A 2EDBA 5FW8A 1J86A 1THAA 3CBRA 5F96L 3ARBD 1QTSA 1SXCA 3P4NA 2AXJA 2ZCLL 2CXGA 3CQPA 5TK4A 3WFEL 1IC5L 4MMYA 3IFPB 3LZFL 1E27B 3O81A 1IUZA 3ZE2B 1AOZA 4ANXA 4M4PA 4DP0X 4OF0A 1PLBA 4R97C 3O9WC 3AWGA 2ZXEB 1UD3A 5I1LB 4IYKA 2JJWA 1DUYB 5EIVA 5HGHA 1QBML 2VMFA 3CDZB 1YC7A 2V33A 3ARFC 4P4KA 2EVJA 1LO4H 3X3GH 4WWKA 4G8FB 4OM0H 4XPGL 3GK8L 1ZMYA 4OFPA 3TWYA 4W93A 1BLNA 2ISDA 1S9XB 3V5HA 2OMVB 3GM0A 2UYLB 1KTCA 3L3DB 3VWKC 4FA8A 4YXLL 3SEPA 5D4JA 3QZOA 3I75A 4F91B 4NAQA 3HZ3A 3QA3A 3Q13A 4MDJA 1EAPA 1GOGA 3BIKB 1J8HB 1CE1L 1DL7H 1MJUL 1HXMA 2ZZUT 2P28B 4X5LA 4WUUB 4Z7UF 5F3FA 5HHMD 5LCVA 5BV7C 1W2KT 4I5BA 2P5WB 3KWUA 3IDXL 1U0QA 3JWNH 4MASA 4BCYA 1MJJB 4M7LT 5FGRA 3FFCD 2FUTA 4PRDB 4DP4X 3WXVL 3P30L 3WHXB 3BPOB 3OD3A 43C9A 4I3RH 4PREB 2EIJB 5IHZA 3MFFB 2UZIL 3ECVA 3MLXL 2B0SH 4OFVA 4NIYE 3PP3K 4KUCF 4L29B 2FR4B 5H94B 1I3RA 4ODSL 1BZ9A 1KTLB 4BK8A 4RSVA 4L0PB 1FCGA 5EU5B 2RD0A 2XVKA 4LDOB 2NNXA 4URTB 4PBDA 1I8LA 4FZ8H 1BQUA 1T83C 2K6WA 2PMZA 2YPLB 3HHMA 5E8EA 4J6IA 2VLKB 2IIJA 3NCBB 3R8BB 4KJWC 4XMLH 4K5OA 1Z3GH 5E6SB 4KX9A 3MOAL 3BRGC 1BQHA 4ZFOL 5E8NA 4L3CA 3R8QA 4QHMB 2UZXA 2PKDA 5EOCL 2IANE 2O6FA 4F2MA 1ZLSL 2YQBA 3N44F 3WNKA 4X5XB 1UASA 4FFYH 5AKTA 1L0XA 5CHNA 1CD0A 4N6RA 4FDWA 5LCVH 1JTTA 1PX3A 1FFRA 4ZMOA 1T22B 2PTTA 1Q72L 2WUCL 3ARDA 5IFAH 5JPMB 3FT4B 4X4XB 3FH5A 4IBSA 5DMIH 3N6YA 4LPCA 1RZ8A 4L1BA 4ORGB 3Q48A 4ZNEE 2XYBA 1GJUA 1DANT 4P46B 4M61B 3NJGA 5TE7H 3HFMH 1AHWA 1T5WB 1LE9A 3BIBX 2PO6B 3IN2A 1H15B 4JR9L 3V8OA 1B90A 2ATKB 4NPKA 5SV3A 2VDRL 4OB5L 2NZ1A 3KLHC 5D6DC 3TGXA 2EYTB 2X4UB 4YDIH 3VW3L 4L8SA 3LKNB 3W38A 3ESOA 4FQLL 2P26A 2WWKT 2ZICA 5I5JA 1YAZA 3PWUB 5JIKA 5DJDB 3BXNB 5CJQL 3RB7A 4YEFA 4DP1X 4HUXA 2R83A 4Y4FD 5LXGH 1EEYB 5EUOF 2RQEA 1HILB 5I76A 1OT2A 2FB4L 2BHZA 4I7ZC 2VQUA 2K70A 3BE1L 3SCMD 4G7YL 1CS6A 1CU4H 5C8JB 1VFMA 2VOTA 1KPUB 1KPVA 4GIAA 4U0QB 3T09A 4GAGL 4A38A 1S6NA 4GQ9L 3JT2A 1GZHA 3IFLH 1XGYH 2VW6A 4QRAA 1NC2B 2KHAA 3BKJL 5ALBH 5FW7A 5JORB 4JPVL 4K3EL 4LL4A 4LQ1A 2JKLA 3OGCA 3VE0A 2BOBB 4MSWA 3SDDC 5CFHA 1MW0A 4HS6A 3PFQA 3WKMH 4EI5D 2EDOA 3PE9A 3ULVE 2EH8L 4MD4B 4LPYA 4R84A 3QG6A 3V4VB 1KENL 3T08A 2QQQA 5H2BA 4F3FB 5E99H 4RRPG 3KPRD 3ZQXA 3L7FA 5KVGH 2J72A 1Q8MA 2YAOA 8FABB 1CDHA 3DX3A 1NSNH 4OZHF 4PJXF 4PWGA 1UT1A 3ME0B 1RCYA 4YXHL 1W15A 3BQUB 2RFXA 2RACA 3ZL4L 5IM7A 1ZANL 3TZVC 1F4HA 5IUSA 5EZLB 3I50H 4UDUB 3RWGA 3QR0A 1JGUH 4CVUA 1N2RB 3WIHL 2AGJH 3SE3A 1TETH 2QL1A 3UJIH 4HFUH 3DETD 3TYFA 1DP0A 3SQBB 5HJGA 4PJ5E 4W9GC 5IQ9A 3EGSA 3N0AA 4TULH 3A6BH 1CVRA 4EOWL 3L5XL 4FF9A 1NCCL 3VFGH 4WTWA 3AACA 2E47A 2HJFA 5E9DE 5F6IB 2YAPA 1BOGA 3X2QB 1WG3A 3VI4F 4PRPE 5JIIA 3NMEA 3S37H 2ZCKL 2K6YA 3HG4A 4QRSA 2ZXQA 4WO0A 3ZX1A 4QAWA 1EFXA 4UIMB 3HS0C 4MD0B 3U7YH 4OLVH 3I85A 1J1OL 3MRKB 3BFOA 3IPFA 1FFNA 1PSKH 3NCJH 2B20A 2WYIA 4NRYA 3V6OC 2ZP8A 1YNKL 4Y88A 3CPLA 2V9QA 3JWNG 1N70A 4HJTA 1JPTL 5HHNB 2MEJB 2LW3A 1T2JA 3WN5C 4HULB 2IPUG 2EIDA 2QV2A 2XBDA 1QKZH 2MOVA 5LDSA 3OLGA 3QUZA 1OF2B 1R3KB 4EBQH 2QGBA 4ONOA 4MJIA 1JS4A 4JZJB 3CQQA 4L8CB 1VF5C 1ZA3A 3RWHB 1WWWX 1Q9KA 5FM4A 1WAPA 2LU3A 1X5XA 1VIWA 2DBLH 2EVGA 2JJSC 4OBRA 2H2SD 2BRRL 2WLYA 1N18A 4OLYL 3LRKA 3UG4A 2FEEI 1E5CA 3HLAA 4G6JL 2Q8BL 3CXDL 2F7IA 5J6HB 2AZAA 3B5HA 4DGWC 2VM4A 1QLEL 2ESVE 2OX5A 3TIDB 1NH6A 1J8RA 5ERWA 4Z7WF 3DECA 4G8GA 2FJFA 3P11L 3NK3A 1G9HA 1KIPA 3CMOL 1T1ZA 4IKNA 3R4DA 4LU5L 1QBAA 3SDCA 1AFVH 5E9NA 1ZLEA 2VXQL 1NDGB 3PQYD 3RGVA 1ND0B 3QZMA 4M56A 4NX0A 2MCPH 3L81A 4L5FE 1L9PA 4EZMA 2ZG2A 3DX2A 4PJ5B 1NIAA 4NFDA 4ERSH 2YMXL 5DQ9A 4MA8L 4F37K 4LLUA 5B1JA 4NZJA 5JW4R 2DQTH 5E9DB 1A3LL 5HXMA 3VNZA 1AMXA 3EADA 1KMGA 1KTRL 1UVQA 4LGRB 2AJXL 4I13B 4PRPB 3GJFA 4KRMB 1K4DA 4XAWH 2BIHA 6PAZA 3HI6H 1OWWA 3NDZE 5B3JF 1UG9A 3DVGA 4LGPB 2WBJA 1G6RA 1P1ZA 4QO1B 4FG6D 1TJGL 1A1MA 4PGCA 1DLHA 5ITFA 1AIFA 3QIWC 2EEBA 4OLXH 3LOWA 2X2IA 3UPCA 1KELL 3FONA 2ZCZA 2IBZX 2GYSA 4YGVB 4R7NA 4R7VA 1KNOB 3EGXA 3MXWH 1PZDA 4OCSL 3EXJA 3CVHH 3F12B 3RX7A 1IGMH 3NCMA 5DRZA 5GZOC 3MLTA 4IHOB 1JWMB 4XP4L 3VI3A 5DJXB 1IQDA 4PI2A 4B60A 4PJDF 2JKSA 3MV8E 4O51B 4TV3A 1XB8A 2BNRA 4XI5C 4NQDD 4HJIA 1JHKH 5E2TH 3BUYB 3QQDA 1DQKA 3GSNB 1VESA 4XOAA 1NTDA 1WAEA 2ESVB 3VSUA 1S78C 3BWZA 4LK4A 4PBVC 3HZKB 4GUOA 4NPYA 4P06A 4JFVA 5T1JA 2NRDA 5DEFA 2BSSB 4OLZL 4M93B 2FJHA 3WHE0 1C08B 3EJZD 3ECWA 5DUJA 4PWHA 1ODAA 1MFCH 1IL1A 3CXHJ 1G6RH 3BKMH 3JQOB 3EO1B 2YLKA 4KK6C 3D07A 1EV2E 2GJRA 3ES6B 2VISA 3LIZL 1MRDL 1CFTA 3B2PA 2ZAIA 2N59A 1IX2A 1UFUA 4Y1SA 3PL6D 3UO1H 5IMLB 4PUBH 1AO7E 1FORL 4XCNB 5DD1H 2K8QA 1V5JA 4LLWA 3JZ7A 3K0YA 3MBEC 1C8QA 1TF4A 3EO9L 2H6PB 2NY7L 4IK6A 3O2DL 4HIXH 5FKAB 3QS2A 1J5OH 3QUYC 2MHAB 4LASL 4NKIL 3LHPH 1ZA6B 2NZIA 2ZF8A 2B16A 1MCDA 5E4AA 4CBZA 1GMEA 4WI0B 4NQXB 1L7TH 5KVMC 1K6QH 4MAYD 1SBSH 3SGDH 5D2LE 4LBEB 3C6LB 1RUML 1HL5A 4V2CB 5DF0A 1A47A 4D0CA 3RKDD 4U3XA 3F7RA 2EXWC 5M95B 4F7EB 3FO9B 2JKRM 4XNQA 1JZHA 2R2HB 3SDXF 1TQBB 3K71B 3CHXA 2VR5A 3PABB 3HE6D 3MV8B 1QNZL 1JGEA 4L0YA 1H6UA 1CF8L 3C8KA 2GJZA 5ECGA 4D8PB 1IIIA 1HH6A 2Z7ZA 1HNFA 4MMXA 4Z3GA 5KJ7E 5AYUL 2DLIA 4MJ4A 4AE1A 1KEGL 5D7KD 1I7UA 4LKXA 3CK0H 4HJGA 4A66A 1VKXB 1X7QB 3SQRA 4XB3A 5DUBA 4PTUA 2AJVH 5B4MC 4OCWH 3E8UH 1BQ5A 5DEGB 1WD9A 3WS6A 5C09D 2AANA 5DD0L 1OP5H 1IAIM 1S7WA 2X70B 1Y6MR 2P49B 1S4IA 1DQDL 2BS71 2AQ1A 2OP4H 5MEPB 4JPKH 4ZFOB 2XBZA 1JZGA 3PPEA 2A9NH 3TBSA 1W91A 3BFQG 2CA4A 3R0MA 4PJ9D 1IJ9A 2X4QB 1SXNA 4F7MB 3AW5A 2E46A 4QHUA 4NJAH 3APMA 2D3NA 1FAIL 1AO7B 1DJGA 3I9PA 4GINA 8CGTA 3RL1B 2OMBA 3KD4A 1LO3L 2L0DA 3WLWC 3SN6N 4Z3HA 1XIWD 1I8MA 2Z0BA 3VH8A 2R8SL 2WSKA 3S97C 5K1NA 4XN5A 3EDJA 3K2UL 1CTOA 1EHLL 2WTRA 2N7BA 5AYTA 3UTQA 1EZLA 2CUHA 2AXFB 3WDIA 1VZGA 1ZJAA 3PDOA 2GFBA 1T21A 2IPKB 4OLUH 4N2CA 3LKSB 1LDPL 4W9JC 3MUHL 4JE0A 1LHZA 3PIQA 5DMKB 1BIHA 5D2LB 3OKNA 3V7MA 1CPUA 4WHTB 3MDJA 3KJ4B 5IIEA 3L2MA 4NCDA 4NN7C 5CCHE 2VDRB 3QEQD 3TV3H 1W0YT 5E1AB 1DBKL 5FYLD 4DP2X 3H4HA 4PJCF 3UC0H 5IVXE 1AKPA 4BD4A 1NBVL 5TE4H 3T4YB 2UVFA 3QUGA 4LEXL 4QEGA 4Y5YA 5CWSB 2ZSWA 5AALA 5EF1A 4KI5E 4GSUA 4WY7L 4LRNL 3KH4A 2NXYB 5SV4A 2IV8A 2WIMA 5GS0D 4O58L 4DFIA 5IQNA 1Q0XH 2CDGA 5AW5B 2LT9A 3HBZA 2HJKA 3FT2B 4GAYB 2PLTA 4YBHA 1EH9A 3ABGA 2JKWA 3UBXG 1OM3L 2FAUA 1UWXK 1IVTA 3QPQD 3EBGA 1LO0L 4LCWE 3ARBA 1HSBB 5TDNA 2HT3C 5K69A 4OV5B 3F65A 3S4SG 4XN7A 4GRMA 4M1DL 2VXUL 3K0WA 4JQXA 3KPPA 2XTJB 4LCCB 4N2OA 1XV8A 1H3XA 3WELA 2EDJA 1T1WA 4YHYC 4K3HA 4N2MA 2X4RA 1NCAL 3OMNB 5E6YA 3SE9H 5I6MA 2AJZB 2E9BA 5TK2A 2BW4A 2AV7B 4OKVA 1ZDQA 3MC0A 5CEYB 4EDWL 2BVQA 2QSVA 2NY0D 1GKOA 2J2ZB 1E28A 4X0NA 5EEXA 2E3VA 3D18B 3M8OH 5K93A 4S0SD 4PLKD 4U6YA 3UTZB 4EIBA 3TF7C 2R0WH 2J8UE 2ZX5A 1A3RH 1R3HA 1GSMA 5CSGA 1KCSL 1S5HA 1NGXA 4ONHA 4D9QD 2GJPA 3KVQA 1X7TA 4B9PA 4IKLA 3HZMB 2R23A 4ZPTB 1ORQA 3B3IB 1UHVA 2VDNH 5LDUA 1BD2E 3B7UX 1CGWA 1XH3B 3MJ7A 4YSRA 5I1JL 5CU5A 4KUCD 4CADB 1JGVH 3BPNC 5IVXB 4GG6A 1U3NA 4BDVA 4F9LC 5IKCA 2X0VA 4NQCA 5JHDB 5C0FA 3QUHA 3DVNB 2VZ1A 4B9ZA 1GS7A 1K9TA 4I18B 4M4RB 4QTFA 4JDTL 3QYCA 3MO1A 2CLVB 1K85A 1CGYA 4X6CB 3NIGE 4GT0A 3GDBA 4LPWA 4YZWA 5JIPA 1B9ZA 1UCBL 5KS9E 3JV6B 5C2UB 2CZNA 1S7QB 4G1MA 4L0ZA 1BZQK 4BA8A 1RZJC 1DTUA 1ILUA 2MSPA 3FOLA 4P5RA 1PZSA 3V0WH 5CINL 4DEUA 2AK4D 2JCCA 3KM1A 4GW1A 5C2BL 1C5DA 1KGUA 4LCWB 3RI5K 3D2TA 3J7HA 3MBWA 1VRSA 2Q6WA 4HSQA 1A9VA 1RZFH 2A74C 3EZJB 4BIKA 5J13C 4MRBA 4L37B 4ZUUB 3VXPB 3F00A 1IZKA 1IGYB 2IQ9H 4PIRF 2PETA 1OAYL 2K7QA 2ZXWB 1CGTA 3EHBB 1F4WH 3B9KB 1DR9A 3BT2L 2EIMB 3QDMD 1KGCD 1QLEB 1UZ6E 2W0PA 2F8XC 2V5YA 4JKPH 4BQCA 3OPUA 3C6SA 4M03A 1UUNA 5LQBH 4L1TA 1VGKA 2EVFA 1KDIA 1N0LA 3OKOB 4P5TC 2FYVA 3U48A 3UTPD 4RDBA 4PTTA 3MV9E 5CEZL 3L2LA 4FS0A 4KHXH 1AXTL 2Z34A 2J8UB 5E6IC 1AY1H 1JVLA 4BEIA 3O6FC 2OYLA 1BOYA 2H0EA 4YK4B 1FWXA 4MXWL 2F61A 2CU9A 4EVNA 2DLTA 3ULAB 1KC5H 1U8CA 4NC1E 5DSCB 2CIIB 3RVTC 2K4AA 4GRLD 2BNQD 3OAWA 5IBUG 5E2WL 5FO9B 4NRZA 4J3OH 1WTLA 3GKWH 3U4EB 1IAKA 4Y4FA 3PREA 3E6FB 1M71A 3JT0A 1DVXA 1OAQL 4ZUTA 4UT6H 2NPLX 1GSKA 3QBTB 3NIGB 5BUGA 2HLAA 5DRNB 3UYRL 5JOPE 4CRPA 4K71B 5KS9B 4BHUI 5T3XL 2Y5EA 3L1EA 1YEGL 5D93C 4JZNA 4CVZA 2L7QA 5I71B 2P8MB 3MLYL 4BKTC 1Y07A 1T4WA 3BSGA 1T2QL 2DQUH 2GI0A 4AJWA 3QDAA 4GSDH 2DJ4A 4TNVF 3KPOA 4HDIB 2K8MA 1EAQA 4MA7H 3PNWB 5KBLA 5C08B 2LE9A 3TT3L 2P7TB 4DP8X 3U9WA 4D3CH 1U2YA 2FJGB 3OXRA 3WEXB 3TVMD 4HIIB 4NZDA 4U6HB 2QVTA 1XWVA 3GHEH 4RMSA 4LGSB 3FOMA 4FKHA 4I3SH 1KYAA 1S7TB 1WIPA 1T4KA 4XO3A 1URLA 2HSIA 2WO2B 4NWTL 4OCLC 3KW8A 4F24A 5KBDA 3AQZA 2NDFA 1OGAB 1U8PA 3GBML 2JI3A 5AVQB 4Z76B 3H42L 3N85L 2DWEB 4LVNB 4QJ3B 4GY4A 1OT4A 3KPQA 1IVLA 3FQNA 5J11C 3MV9B 4LHUB 1TSRA 1E7VA 2KMWA 2P42B 2X41A 1Q9WA 2OR8A 5BV7L 2E9WA 1E3ZA 2NCMA 3WNNA 4MQTB 5KG9B 3JUZA 3TPUA 2ZUYA 2JLLA 3B2MA 4F15C 3T8MA 2HB0A 4MJ6A 3EH2A 5KANI 4GQRA 3LZPA 4JE4B 1DVFB 2G60L 3ASOB 3BAXA 3KPNA 4N0FB 3DROA 3G08A 3SGKC 1BQLL 5BQ7B 4B9FA 5L8JB 4X83A 1E4KA 1IM3D 3BN9D 1A1OB 3FTVA 2HTKC 4FXGB 4JDEA 3WNIA 3AITA 1BBJA 5CP3A 3TIEA 5D8JH 2F54D 3MRJB 2CCVA 1LK3H 2F58H 4U1JB 1F1DA 3A4DA 3ZBMA 5HYJD 3SPCA 4JLRA 4LSVL 4JFXB 3BVNA 3IDNA 4O5LH 5HI3C 5FF6A 2NY3B 1KZYA 5LBSL 5JYLA 2QPDB 4OUOA 2B2XH 2X42A 3W11C 4Y0GA 2EDXA 4WAFA 5A7BA 3QEUA 3VQ2C 4I4WB 4KMTH 2RB8A 4WV1B 4DGVH 3WE6B 2PW1A 3FQRA 1R47A 1UJ3C 5L0QC 5T5NF 4NKDB 2XPZA 4YBQC 4B27A 1I9IH 1ZS8A 4AKQA 4FLOA 4ZT1A 4KY1H 4H0HB 5AOMA 5FLUA 2DKMA 4X8JB 2DDQL 4PCYA 3MJWA 4Y4KD 1I9RL 5CGBA 3KHOA 3VWJC 4U31A 4MQXD 3UBHA 3VTMA 1Z5LA 2XXGA 5ADOH 2XG4A 1JN6A 1N59B 5CP3H 4RSYA 4M5TA 2IOIA 5D2NE 1HC1A 3LNIA 4GXUN 3SPVA 5IREA 1LWRA 3PQYA 4HCRL 4ZUSB 1DQLL 2GSIA 1HOCB 3BYTA 4N2IA 3T6WA 5T1MA 2L8AA 3FZUC 4UANA 2DH2A 2X1XR 5IK3B 4DT2A 1IEAA 2MRYA 3ZT5A 4ZOCA 5IY5B 3QAZC 1F8TH 1RKRA 4YXKL 3TH4T 4M1GH 3HG5A 3G5ZA 2XQYG 5C7XL 3MTXA 3MYJB 2WTPA 4AV4A 1JPGB 1NCHA 2FECL 1BFOB 2JKTM 5HYFA 3S37X 4V1DA 5IT2H 4ZX3A 3CFTA 4KKLD 1SUHA 1X5JA 1DBJL 4H5SB 2BJMH 3QIUB 1XL4A 1CFSB 1WE5A 2UZYB 3O11A 4WGVB 1OP3K 2DQEH 4HZ1A 3V4PA 1MI5E 3RHWK 4RFNC 3UZQB 4HWBL 3T0ED 4BH8A 1G7HB 2UWEA 3KS0J 4BK5C 3HG1E 1CTNA 3PJNA 5FGBC 2J25A 3WUZA 1PEZA 4OTXH 4P8QA 1UD5A 3MN8A 3ZMNA 4J3OG 5EULV 3LKRB 3THML 1X5FA 3BLBA 4YPGA 5EZOH 3VFWA 4GFXA 3QFJE 4OD3L 2WQAA 4AUUA 1JJUA 1BAWA 1E6OL 3DVIA 2V2WB 4HWUA 1NMCB 4NQVB 5CBEB 3QO1A 4KOCA 5F1IB 4MCZB 4Y4HD 4CVXB 5EU3B 1E0OB 3KR3H 3U6RA 5DC9B 5KSBA 3OKDA 3VFTA 2VDOH 2P46B 2WGNB 3UAAA 1JXKA 1OF0A 4X6BB 3G5XB 1A6TA 2WAHA 5E1GA 1JNLH 3IMWA 3RWEA 3MLUL 1HHHA 3OR6B 2PPFA 3LXBA 2OL3A 1F4AA 4MXQD 2NUPB 2V5SA 5AVRB 1WAAE 1XZWA 3FPXA 1UM4H 1U8KA 2R39A 2YMTA 3ZGHA 1E5ZA 1JF6A 3TV8A 1JV2B 4Q74A 2HFGH 5A1AA 4AM0Q 5D2NB 4S1DC 1KYDA 4GEJA 3WS3A 5I15H 2OJZH 4N20A 3AUVA 2G9HA 2R51A 5E7FA 3UACA 5K9OA 2FGZA 4PJGA 4PV9B 3IU3B 3INUH 3T0WA 3C5ZB 2AW2A 4HT1H 5KAQF 3AY4C 3DJTA 4FHJA 2BOLA 4Y2DC 3V7AE 2OBGA 4EIUA 3FU9A 1KPRB 1N5AA 5ILTH 2N4IA 5JQIB 4FE9A 4WW2F 4BFOA 1GZQA 5I1IH 4U2YA 4MNQE 3SO5A 2XACC 2R7EA 1GHFL 2C3XA 2BSTA 4N25A 1J8HD 3QEHB 1IGFL 1ZTXH 9PCYA 4ZAKB 2AJYL 3DBSA 4WUUD 2EUVA 3OB0H 2P5WD 1QQDB 5CEZE 1MI5B 4J3VA 4JFQB 5GGTL 5BMFL 3T6VA 1LQSR 2R2CA 3HG1B 1BPLB 4MAYA 1AZUA 4QYOB 5JW5B 4NM4L 3BVWA 4RWYH 2OL3H 3L4ZA 2IQAA 1NBQA 1RPQA 3JZYA 5DVLA 3MCYA 3BN3B 3O3EA 3MLSL 3U4KA 2P5EE 3QFJB 4HAKA 1CYXA 3OZLA 4K0OA 1TCRB 2RA1A 4PLJD 1MFEH 4FQJH 1CQKA 3Q7JA 2OSLA 3RGHA 4P3DB 5I1AA 4H8WL 4ZO6A 1CGXA 3HN5A 3Q3GB 4TRPL 1RJZB 1MFDH 3DX1A 2YPLD 4JG0H 4P9HC 4LNRB 3E3QC 2VLKD 1ACCA 3FQWB 4JFFA 7FABL 3LKOA 1MCQA 4GAJL 5T3XE 2DTMH 5I1GH 3O3UN 2DQHL 1LEGB 5DDHA 1QLRA 5C09A 4E9TA 2CBQA 1KIRB 2BC4A 2E7LC 1J0JA 5AD0A 3DUUA 3ECQA 3QZPA 5C6TL 5IB4A 1L9TA 2LV4A 2I24N 2JQAA 3CFUA 1N9PA 1OE3A 1AGEA 1UACL 2DMBA 1GY1A 4QY8A 4KKRA 5GGSY 1NCNA 3IXAA 3T4AC 4AKOA 4AGQA 3GMNA 1ETZA 2D7MA 4WW1A 4PJ9A 3BVXA 3A6CL 4P46D 1WHOA 4P9ML 2PUQT 5GGUA 4BWUA 5KUKA 4MYPA 3K6SB 5FO8B 4N5ED 2PO6D 2ED7A 1S5IL 4HS8H 1XIWA 4K3JH 5JW4Q 3MV11 4F7TA 1NMBH 1UA6L 4ZI8A 4N0YH 4DEPB 2P44B 3HIZA 3HNTH 4I89A 4NP4L 3QQ4A 4KPHH 5C0GA 5CIPB 3MKGA 1CWVA 1OSPL 1DBAH 1INDL 4C54A 4TLKA 3TFKC 3D51A 1XR9A 4GJTB 5CP7A 4QDGA 2D8KA 3FL7A 3QYNA 1LD9B 5I17A 4QRPB 5EH1A 5A16A 1T0MB 1QABA 1TYRA 4P2QE 1FGNH 4QXUH 1Q0YH 2VLJE 4AUYA 5FECB 2WLLB 5E8PA 2VT0A 3LS4L 3M1CA 3SOBL 4Z5RA 3OQRA 3BEWA 3IGAB 3EG9B 1NGYB 4TL4A 1NFIB 1KCUL 3WY2A 5CR1A 1IU1A 2P5EB 3TA3B 1BQSA 1J05A 2VJ0A 1V7NH 1NC2D 3GO1H 3M07A 4H20H 3ZQWA 4B9KC 2Z4QA 1XGTB 3BSHA 3QH3B 5I6XB 1LO5B 1TZIB 2NSXA 2BXZA 1Q4NX 2APFA 2I5YH 2C26A 2N7SA 2XNAB 3L1OH 4GB9A 4Y1TA 4M7LL 2R9HD 1Z0NA 2CJUH 3QULB 3KZ8A 3MRLA 4DCQA 4ISVB 3HB3D 1PTZA 2WCGA 3OHXA 3TBTB 2MOQA 4W6YB 3GSXA 3MGTB 3K80A 2ENJA 2IAND 1MCPL 1M3JA 1M05A 3WNLA 3MROA 3C6EA 5EBWA 4ZS7H 1SMDA 3AY2A 1MNUH 1R75A 4G5ZH 1A4JB 3BSZL 3BQUD 5JO5A 5GS1A 4EQ3A 4R97B 3H3KA 4EIZC 2YBRA 3O9WB 3APNA 1GCFA 1TQCC 2Z3FA 2AQPA 5F70A 5KVDE 4GG8B 3VCLB 3ARFB 2IAAC 2AI0L 3SKJL 3UADA 2W60A 4CN1A 1UZ6F 4Z7QB 3ETBF 3GMRA 1JDDA 2YKLL 5KYUB 2RTTA 4WHYG 4QGTA 4ODWA 2WLIB 3VWKB 3FN0H 1R33A 5CD3B 4OD2A 4ONGH 3BZEB 5HY9A 5HYSA 4HWEH 4CGTA 4Q8BA 1N8ZA 3GRWL 4Z7OF 4Z7UA 5H35B 1YY9D 4Z3IA 2XX1A 4GP4B 2NDGA 4MKMA 1BW8A 2PYFA 4KNUA 5BV7B 2IALA 2OULB 3PHOB 5BJTA 4P2QB 1O9VA 2VLJB 4JGMA 1JG9A 1U6AH 1WT5A 2W9DH 3PXHA 5EOQL 1EUUA 3MLZH 5F9DC 4YDKH 4X6DA 4XTRD 4ZQKA 3ULUC 3FYEB 4FJZA 2KZWA 1I1FB 5DFVC 3BPLB 5IP4A 1UXSA 1HQRA 3C2AL 5I0VA 5KBKA 1Y18B 4JCLA 1FG2A 1XCQA 3U36B 1IGJB 1D6VH 1BM7A 5HPOA 5JIDA 1GKEA 1BZDA 4OT1H 2XFXA 4AX3A 3ULVD 1N6VA 4ZXBC 5FYJH 2QLVB 3B9AA 3BISA 1UT9A 3VJ6A 4B50A 5EEYA 3VB8A 1WF5A 4AGLA 1QHQA 4JFYA 5H4ZA 3M1BA 1GOHA 2QSCL 2WAQA 3HHSB 1A7PL 1NMAH 5EBMA 2UZPA 5HDBF 4XN8A 2D3LA 3EFFA 2OZ4A 4X6EB 3UAJD 3MXVL 2FHBA 4JHAH 2AEQL 2AK4A 2VL5A 3WYRA 1U93A 2VSDA 1JGLH 4YDVB 1TFHA 2UUDK 2ZWYA 5F7DA 1U3ZA 3GXNA 1T1YA 5I1KH 4IRSC 5D5MF 2FL5A 5BUPA 2VM9A 2NT0A 4JS7A 4ACPA 4W4NA 3KNBB 4NI3A 2QBWA 2PW2A 4ELKA 5JZ7D 3HC0B 4NZUH 3QDMA 2QSTA 3K4DA 1QI3A 3QR1A 1HNYA 5TPWL 2HTLD 5F2FA 4PJ5D 3D7PA 4TXVB 4JO3L 3I9GH 3A22A 1YEEH 4M6NL 5JUEL 4B5EA 3FTXA 4AK1A 5E9DD 2ITFA 1CDGA 2DQJH 3GMOB 3QHZL 5DJ0B 4YMPA 2DI7A 2EDTA 4PRPD 1EHNA 4L8DB 4WUKH 4LLMB 2Y6TE 1MHPH 3F85A 4QAMB 5JOFA 5EUOA 4O4YL 4XNMB 4MWFA 1HZHL 3MMEB 2YRBA 3DOSA 4TS6A 1ZT4A 5F72S 4GRLA 3MRFA 2BNQA 2X9XA 4FQIH 4IDJL 4FZEH 4NZ8A 4Z0BL 3V6OE 4ZFFB 4E41A 1KB5A 1JXFA 1CT8B 3IWVA 1KLFA 3ESNA 3GSWB 1T0NA 1FNSL 3FO1B 3FSVA 4XVSH 2WKLA 2EO1A 2HG5A 4KOBA 4HKBB 3SDDB 3WAJA 1UD8A 1XF3B 2YPVL 5C0BA 2CBTA 4R7XA 4G9FE 4LLYA 1I1RA 2XN0A 2GITA 5DC4B 2RAMA 3HPJB 3KWVA 4JN2B 3MRDA 4U1GC 3GF8A 4N3UA 4OZHA 3MA9H 3QJSB 1SOQA 1XB3A 2ESVD 5E00B 4FQPA 5CMAB 4BQBA 2Y7QA 1IQWH 1KF9B 2R1XA 3KPLA 1VACA 1SFDA 3TZVB 1BZEA 2JV6A 2WJ5A 5EA0L 5DHEA 1NINA 1KG0A 4K2UL 4MMZC 5D7IF 4AENA 1C1EL 4F8TA 2HKFL 5KTEL 3EJPA 1D9KD 1FZMB 5IJCC 3PNRB 1XF2B 4W9IC 4HKZB 5F1KC 5I8KL 1E5BA 3P4MB 1OW0A 4X80H 3RTQB 1SN0A 4L9LC 1AG6A 5D55A 2CK2A 1MRFH 1WZKA 4JM0A 3OSVA 1KB5H 2EDRA 2LAAA 5CR8A 2DBJA 2NNAA 2DYPA 3GT6A 4FI7A 5CBAA 1Z1WA 4XWGL 5SX5H 5DJYA 3NACL 3ZHFA 3RDTC 1D6EA 4D2NA 4S1RH 4RGNC 1ZE3H 4Q14A 1HQ4A 1PMYA 3CDGA 2CHXA 4R4NC 4DETA 3FTZA 3RUGF 1A6UL 1M1XA 1SDAB 5JHAA 1IFRA 3HS0B 2W07A 2ZX7A 1GCYA 3FB6B 4YHLL 5DJCB 1I8AA 3CFDA 4HW6A 3D06A 3C6LD 4NQTA 3FT3B 5IJVA 5LG6A 1R3IL 3WN5B 4AC4A 4BCXA 5E23A 2F54A 4IBZA 2PCPA 2HRPH 3FQTA 1UKQA 3KYNB 5DWUL 3REWA 1F6FB 1WD8A 1RZJL 2HT4C 2VR4A 2O5YH 2YJQA 4ANKA 5HYJA 3MV8D 3HG3A 3KBFA 4GP8B 5IW1B 2ZWNA 4D7PA 4OLWH 2C3HA 3RDJA 3HE7D 1H6FA 4DVRH 2ZOWA 4L9DA 4G9FB 4HXBH 4M7KL 2COQA 2EICA 4K7FB 3F7YA 3M7OA 2C5DC 4KUZH 2HWZL 3UTTE 3VU1A 1B0RB 4ZK8A 4YWGH 3RVVD 1ZVHA 2ZQKA 2DQDL 4WHCA 4HD5A 1JNHA 2QKIA 4N0UA 4AIXA 4S0TD 1I9JH 2IMMA 4QIRA 1X5ZA 3MLPA 5KYYA 3GRGA 2G0KA 1JXGA 4YVUA 5EBLA 3JTSB 1FJ1B 1ID2A 3DIFA 4NSKA 5F0PB 5DWPA 2AQTA 1WHPA 3QCTL 4Y4KA 3V4LA 3ZDYE 4XBGA 1AO7D 1RZGA 2BS9A 4Q56A 3IJHB 2X4SB 1A6WH 3WGVB 4AMKL 5K9KB 3HI5H 1JNNH 4X9BA 2VJ8A 3KLQA 3SE4C 1F2QA 4AQ1A 3EOTL 4F2FA 2WXRA 5K39A 3GBEA 1BVKB 1U95B 3ZTNH 1Y6NR 3WUWA 1IE5A 1ZPUA 3EOAA 1MVUA 1OGPA 3BDYH 2YEZB 1WFTA 4JVPA 1RZIA 4OCNC 2ADGB 4UV4H 4MHHI 1S7UA 1II4E 2FH6A 4AXWA 3QIWB 4UMGA 4B0MB 1P6FA 2AHIA 3I02A 1MUJA 1KUMA 3LXCA 1SN5A 3LNDA 2H6UA 1SLWA 2AQQA 4R4BA 5DTFA 4PG2A 5LG1A 1IO4C 3K3QA 1D5XA 2BH0A 5HBBA 4WO4D 5HHXL 4XP5L 1DZBA 4PB0L 4U6TA 4A6YA 5IR1A 4RA3A 1J0KA 4PJIA 3V0HA 4QRUB 4AK2A 4B7LA 4Z3EA 3T0EA 2QMJA 4BUHA 4LNVA 3ML9A 5ADPL 4AITA 3WOVA 1A6PA 3WD5H 4FNUA 3UGUA 3UTTB 1DANU 5T3ZL 2NXYD 1OY3B 1ZLDA 2Z9TA 3VXME 1MKFA 3AG1B 2J6EA 4LAQL 3UZVA 1E67A 3WJMA 1I1AC 3IAQA 1J18A 2L3BA 2ZJSH 2EYRB 1UM5H 4OJFH 4TLUA 1KJMA 3ARXA 4HPYH 1OAUL 4UQ9A 5D7EA 2BDNL 4Y4HA 2R2EB 4UAOC 1U3HC 3VFUB 3NOIA 3G5WA 1IEBB 2F19L 4XO5A 4MFHA 3BZ5A 4FQ1H 4OGXL 4GKLA 5IESL 2YXFA 4O9HH 1CO1A 2V17L 1JFQL 4GKOA 4FTDA 4DJMA 3MRNB 3UZEA 2RHEA 3IFPA 3ZDYB 5FKPA 4GBXC 4HKJA 1E27A 2V5MA 5CLYA 5EC1B 3VXUA 2BSDA 1U8QA 4ZOEA 2XU9A 4RGMB 1EXGA 3QORC 3L9BA 4NFBA 5I1LA 4MTMA 3W5MA 3S0PA 3MBEB 1DUYA 3P9MA 3OAUH 4A37A 4A6YH 1W8EA 2YUXA 5D1ZA 3TBYB 1S7RA 1SOSA 1F56A 3EYUL 4G43B 2UYLA 4HA1A 4TUKH 3L3DA 4TUUA 3RWJB 1EO8L 2OV0A 3UTSE 1JRHH 1ULVA 2I25N 2J6EH 3LEXB 3RL2B 3ZL1A 2WINB 4XHJC 2AJUL 1QOKA 4UNVA 3MYZA 1J8HA 2FSEB 3WSQL 5J06A 2IADB 1SFHA 2G4EA 3H9HB 4GO8A 4WUUA 1P1VA 3CLEH 2A83B 1YSOA 2P5WA 3SDXA 3SKOB 1MJJA 5KUMA 3PWLA 5B7EA 4NQEE 1YEHH 1NEZG 3WHXA 3MTRA 4AVKA 1JZ3A 2CHZA 2O5XH 1RSYA 3QFGA 2FEDC 5IJDC 3MFFA 4KI5D 1ECZA 7TAAA 4UM9B 3VXMB 2IXQA 2N01B 4FHBD 2AP2A 1HKLL 1JVOA 3EJJX 2GBAA 4HJ0D 3ZGIA 3PGDB 5H94A 3GIZH 5K59F 4W68A 2JJUA 1KTLA 4WEBL 1IE4A 5L88L 2RALA 2Q8AH 3AT9A 4HJJH 5EU5A 3MQIA 4GKNA 2A9DA 1LQBC 3S2AA 1QI5A 3BP6A 2GG1A 2XZAH 5EORL 4BFIB 4JQIA 3MR9B 4LCWD 1JK8A 4X7DC 2K4WA 3AQXA 5FW6A 2CWRA 4A63A 1FBIL 2RR3A 4XPFL 4X5XA 2QTVA 2XY2A 1J48A 2WLKA 3EHBD 3II2A 3B9KD 2BVTA 1SPDA 1A7NL 3L17A 3UJTL 2MNJB 1DUZA 2XICA 1ZT7A 1N3NB 1T22A 1KDJA 3ABMB 1ITBB 3FT4A 4OF3A 5JPMA 4NO3A 2DLEA 4R4FH 3MNZB 3NSJA 2E27H 1P2CB 2PXYB 2KC0A 3L3OC 3FTGA 1INEH 1YEJH 4P46A 4XPTH 4P3CL 1DN2A 1RFDH 5KYXA 1AZRA 4CSPA 2ENYA 2VAJA 3TO4A 3X17A 4CL7A 5DD6B 5TE6H 2PO6A 3GXTA 3RP1A 1H15A 3UTSB 2K1MA 5B8CC 5EIIB 3N42F 5F88B 5L2JB 3MNVB 2YAEA 4AEIL 5K9QI 4FNSA 4MJ2A 1OTSD 2R59A 3D4CA 1QFWI 2NY2C 1B4JH 1BD2D 3MBXH 4K8RH 4OLEA 1EA9C 4UQDA 1K8DB 4NN7B 3LKNA 4HV8A 2F0CA 4NHUA 5EZIH 3TYGH 1DE4A 5ACMA 4JRLA 4HUWA 3PWUA 3ARGB 1OARH 3PJSA 5DJDA 4ZTPL 2NXZB 5IEHB 1ZAGA 3BXNA 3DTDA 1FPTH 5C0IB 1EEYA 1YRKA 4G6FD 1E5AA 4DKDC 1FZKA 2RCSH 3WLBB 3P77B 1R9FA 2LOEA 4J8RA 1PY9A 3UBGA 2D03L 1LEIB 1TTFA 4J6RH 2CCWA 4QTIL 4IIZA 3MJ9L 5JORA 4ZO9A 1NC2A 1U8LB 1L6ZA 4QT5B 5CKAA 4ZZKA 3HNSL 4UTBL 3I74A 1BEYH 1CDYA 5E4EC 4PCTA 2ZF9A 3PDDA 4YR6A 5HHOE 4EIGB 3AGVA 3NIFE 5GRZA 2PWGA 4GMSL 1V27A 1ZJBA 1UWGH 3QARA 3H1ZA 4N26A 4BZYA 4PYGA 2EIZB 4MD4A 1KJ2L 3BAIA 3S7GA 3D87B 3JVFC 3V4VA 3CXFA 3VAEA 1P7QB 1QPPA 2EDYA 4M8RA 2IANA 1QP1A 3O3AB 4LSSL 4Y1AE 2CM5A 2JJVA 3U4BL 4XCEA 1PAZA 1TCMA 5C0DA 8FABA 2IAMA 3NCXA 4XBPB 1M9SA 3GBNL 5JPNC 4J2XA 4UB0L 3UPAA 3ME0A 1FGVH 5JTWA 5SX4I 1V3LA 3UL4A 3QUKB 5C0RL 2WZ0A 2GIYA 4GNKB 5CSZB 1J11A 1I8IA 2XVBA 5EZLA 3K91A 3UYPA 2YK1L 1D5BB 2KDGA 3ZKQD 2ADFH 5F7WC 1N2RA 3O2WH 3MV9D 4LHUD 3TJHC 1DJHA 2WLMA 4IIQC 5BZWA 5AZ2L 1TJIL 3AXLB 1TZGL 2WXQA 4XNYH 3SQOH 3HAEB 1F3JA 4Z7VF 3SQBA 3L54A 3QB7C 2V4LA 2D7TL 2ICEC 3WMPA 3QC6X 4APQA 2NY5C 1CLVA 1DVFD 3AGWA 3ALXA 4O02L 3LS5H 4QXTB 4PU2A 1HIMH 2FQDA 5EIQA 3CFIC 1ED3B 4KKAC 5B1BB 1ZHBB 2ZOTA 3ZKND 3BPNB 4JGJA 1FI8C 3VU2A 4UIMA 1EMTL 4JUTA 4MD0A 1KXTA 5AOIA 5FB8B 1CXIA 4UILL 3MRKA 1LXMA 3OBAA 4LVHB 5JOPD 1G7IB 4E9QA 3IBOA 5HHNA 2NY3D 1OOWA 3IDIB 1F4YH 1ZT1B 1XCXA 3UFIA 1E6JL 1SVBA 2PR9A 1KGYE 1OF2A 1SXZA 1R3KA 2E59A 2QQNH 4YFLI 3W0WE 5HHOB 1YMHB 2W95A 3NIFB 4JZJA 4YDZA 4L8CA 4XBMA 3OMIB 3KHQA 3OXSB 4JL1A 3M7FB 4OF8A 1YJDH 5C0EB 3GSOA 3L3IA 1LVEA 2A1WH 4X6FB 3LNGA 3QFDB 1HINH 1BIIB 1FUNA 2JKJA 4FQCH 1AZCA 2A74B 5J13B 2XQ0A 3U30C 5IQLA 1FVEA 2AERT 5B22A 5T3ZE 4KQ3L 4OZFH 3GM8A 1PKQE 3PAVA 4LFHD 1JYWA 3KWWB 3TIDA 1KN4H 1WFNA 3ZMEA 3OKMB 3HS8A 4GP5B 4ODHL 5IHUH 5BVPL 4AYDC 3DX7B 1BVLB 1JZ7A 4JM2C 3BAJA 5CF3A 3QXDB 3I9AA 2RBLA 4Y9GA 1F3DJ 2A4CA 1C5BH 4P5TB 1NDGA 4XH2B 5HGBB 1U8MB 1WCBB 4LOVA 4GI9A 4OD1L 1MFMA 3D0VB 5ESAA 1U21A 4X7CC 1QLFB 1OV8A 4PJ5A 2XKSA 3X1GA 3WFHB 2HCZX 5E6IB 1FZJB 2ZSVB 4JHWL 2XWTA 3GIVB 3O6FB 1MH5A 4MX7B 3BLPX 4PR5B 3LH2H 4XP9H 4MZ3A 4JY4A 4LHJB 5E8OA 4PRPA 2PF6A 5TGBB 3EKCA 4DO6A 1RURH 2ORBL 5IHHA 3W5NA 1WA0X 2GQHA 3QIUD 4QXGL 3A67H 3W39B 1QFHA 1C12B 3CDFA 5LJYH 1R19A 3CBJB 4QO1A 5LXVA 5MHSE 4ENED 3U7WH 2G5RA 3LNEA 4R7DB 4XX1E 2NW3A 3TEZA 2AAAA 2QQKL 4EE2A 3COOA 5HJ3B 4B3VA 3FTUA 4YGVA 1NGPL 1KNOA 2WQRA 3S3BB 2LGNA 3F12A 2Z1PA 2A0LC 2FX7H 5D93B 3W0WB 3U46B 2OPCA 3RX8A 4IHOA 5DJXA 1DVSA 4YSOA 3GI8H 1FRGL 1O9WA 4GRWB 1CFQA 1QAWA 4F92B 1Z9NA 4KVNH 4TNFA 1UD4A 1RVFH 3PWPA 4N8UA 3Q1SL 4OJEH 1JYXA 3DO7B 1VPOH 3BUYA 2HLFC 3NRFA 1X9UA 1YEFL 1M7DA 2Z35B 3GSNA 3MRBA 3UCRA 1PKQB 1NCWL 4C58B 4M6ML 4P5MB 1A14L 3SPIA 3IFOB 2BM3A 2ESVA 4DEWA 3BEVB 4NERA 3QCVH 3Q2CA 2BIOA 4ZTOL 1OK8A 4A7GF 1JMZA 2YARA 3GJFK 2WYTA 4J8QA 5L7XL 4IGBC 3L4CA 1OB0A 1XO8A 5MEQB 1D9KA 3ZKMD 1R3JA 5J11B 5FM5M 2O93L 2TSBA 3WV0A 5I0YA 2DKSA 3RZCB 3WIIL 2BPBA 5F44A 3C5ZD 4YIQB 4LL1A 5BNXD 3NCYS 3ZDYF 4PJBB 5IMLA 5CUSL 1HEHC 1IRAY 1X4XA 4MDRA 2OR9H 4XCNA 3ZIMA 1IAOB 4F15B 3FO0H 2QSQA 1FLRL 2GKIA 4BE6A 1N19A 1ONQA 1VFUA 5BW7A 3ULUL 4OM1L 1NC4B 1HFUA 2GTWB 3ZYJA 1FL6B 2NQDA 5F1SA 2MHAA 4FCHA 1ZA6A 4FI8A 4ZAKD 3HS9A 5DFTA 1XZ0B 3FRUB 2UY6A 1MI5D 3EFDH 1D3CA 4R90L 1IZJA 2DS4A 2J21A 5BVJA 3HG1D 4ZUVB 5C97A 1L0PA 3C6LA 1I75A 4PEEA 3PG2A 5FFOA 4JB9L 3VFVB 3ZZLA 3FHEA 1E4XL 5HVWA 5I2IA 2TRHA 3FO9A 4F7EA 1IC7L 1YMME 3N1QC 3QFJD 1WIOA 2W59A 3B2UC 1MLCA 2GY5A 3MV8A 4XPHH 3QJFA 2VMDA 3E0GA 3HE7A 1ZIAA 4FYRA 3FCSB 3VD7A 4L5FH 1UJ3B 5FYKL 5L0QB 5EF2A 4YEEA 3WAKA 3RVWD 4KFMA 1ZSDA 3QI9C 1RHHA 4L3EE 3T8XB 1VKXA 1X7QA 4LSRL 1OSYA 2Q7YB 4Y2OB 4GYBA 2J8HA 5KVFE 4ONFH 1ZLVH 5ICYB 5DEGA 3US1A 1J1PL 4QHNB 4R83A 4KDVA 1DFBL 4PVMA 2J71A 3B9EA 1U33A 4K23L 5T1DH 1OP5K 3VWJB 3IDJB 4C56A 4CBPA 3ESUF 4EKXA 1KCLA 4EN3A 4NO2B 4OZFG 1UWEH 4U7KA 4R26H 4ZFOA 15C8H 2YZ8A 2CH8A 3HMXL 1WP6A 3GJEA 2MTPA 4LHQB 4LT7A 3UEQA 3BCDA 3PUUA 2P3YA 3UTOA 3WTSA 1T0OA 1AO7A 1GPOH 2F8OA 3CZFB 4A1RA 4DF9A 5L6YL 3RL1A 4NZTL 4KTEH 4YAQB 3JWNC 3QAZB 1KEML 4MNQD 2AK1L 2X3BA 4V11A 4N3TA 3MLWH 2J5WA 1MAML 1CLZH 2IPKA 3VD3A 2D7NA 3LZNA 4OZGE 5LGHH 4TQPA 5DHMC 5DO8A 1A0QH 4OFQA 5J6SA 3BKCH 5CEZD 1AYOA 2DEYX 1A7RH 3NZHL 3DUSA 5DMKA 2V5TA 3T3MF 1A7QL 4ZUWB 4RFNB 1ZHKB 5D2LA 4XB7A 4WHTA 1YA5A 2IOOA 2CG9X 2F18A 4NQQA 4IEFB 4I77H 4PMEA 1C7SA 1QYGL 4M5ZL 4YZFE 4P4KC 3U9UB 3X14B 1YMMB 2P5ED 2VQ1A 3D2UB 3TA3D 2ERJC 4N24A 4WO4A 2NCEA 2M26A 4PYHA 4UUJA 1I8UA 4XCFL 4JL2A 2Z91A 3T2OA 5CWSA 2VABA 1V3MA 1ZXQA 2DKUA 4JHBA 4JFDA 3MCG1 4ZMPA 4L4VE 5CLTA 2DJMA 3VTAA 4L3EB 1RK0B 3E3QE 5T3XD 4BFEA 3O4OC 3WTXA 1HCFX 4OIBA 3G6DL 2Q1EA 3AB0C 3FT2A 4QR7A 1Q72H 2C9SA 1AI1L 3WN6A 4XXCA 4GAYA 1UM6H 3QNZA 4E42B 4DP6X 2P45B 3B7TA 1GGIL 3GLZA