The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
73
|
sequence length |
324
|
structure length |
322
|
Chain Sequence |
TRAQLSIDLVNNVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of a hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483] (ZP_02067074.1, SP17169A, JCSG 417104) from Bacteroides ovatus ATCC 8483 at 2.80 A resolution
rcsb |
molecule keywords |
hypothetical protein BACOVA_04078
|
source organism |
Bacteroides ovatus
|
molecule tags |
Cell adhesion
|
total genus |
73
|
structure length |
322
|
sequence length |
324
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-11-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06321 | P_gingi_FimA | Major fimbrial subunit protein (FimA) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like |