3UP6A

Crystal structure of a putative cell adhesion protein (bacova_04078) from bacteroides ovatus atcc 8483 at 2.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
324
structure length
322
Chain Sequence
TRAQLSIDLVNNVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BACOVA_04078
publication title Crystal structure of a hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483] (ZP_02067074.1, SP17169A, JCSG 417104) from Bacteroides ovatus ATCC 8483 at 2.80 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
total genus 73
structure length 322
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A01
2.60.40.3380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A02
4JRFA 4JG5A 3UP6A 4GPVA 3R4RA 5DHMC 4RDBA
chains in the Genus database with same CATH superfamily
5EHFA 1FYTE 4JFDA 1E3ZA 2BHUA 25C8L 2HLAB 1AMXA 3B7RL 3BLBA 5I6OA 2OMBA 4PJIB 4ELKB 5L4MA 2P52A 5JIKA 1RK7A 1PKOA 2X0WA 4B9YA 5C08A 3EBGA 3FN3A 3HZ3A 4OD3H 4OZGB 1GAFL 2PUQT 2WK2A 3O6FB 2EECA 3MN8A 5CINL 2FR4A 3MRQA 3FFCB 1T2QL 4XRCB 4NZFA 4QRTA 3QUZA 4KAQH 4YBLB 2F54D 2EDDA 4IW4C 4JFED 3D39D 5ACZB 3OSKA 1LK2B 1YPZB 3KVQA 1P7QB 3QSKB 1UZ8B 3N06B 4ZAKA 2VGLM 4M00A 1D2OA 5DO2D 4PWEA 4WTZA 4J3OC 4HGWB 2R4SH 3WAKA 3GI9L 3K1DA 3LH8A 3PRZA 3RWEA 1PY4A 5CO1A 5HYEA 3BYYA 5JMOC 4I0CC 4MBRA 1X9QA 2ZAGA 4QRUA 4OF5A 2DWSA 2X4UB 4HCFA 4YMPA 5SX4I 4G6JL 3FRPB 3HBQA 3EYFB 3ULSB 4W1TA 5IQNA 3ARGC 1CD9B 4JMXA 2VCOA 5CJXA 4DKTA 3MYJA 2ZJSL 3KCPA 3HLAB 4S1SH 3UYOD 1TNNA 2R29L 2G60H 4Q6YA 5FO9A 3RTQA 1ZANL 3VH8A 2XPYA 2YQ2A 4GRMB 3RY5A 3N44B 1NC4B 3EO9L 2BNRA 4DK3A 3IJ7A 1GW0A 1MLCA 4LB8A 4AYDC 2XN2A 3DJSA 3JTBA 2Z92A 1EJOL 4P5KB 4B0MB 1AR2A 1OQXA 1A3ZA 1KXHA 1RUPL 3DX4A 5IVZA 3T6WA 1EVTC 4PG2A 2OMVA 3TGXA 2V2XB 3W11D 3ZHKA 4A7UA 5FPIA 3ZVVA 1T1ZB 3CU7A 3PP3H 1XTLA 3RA7H 2Y1VA 2IBGA 4NQED 4CNIA 2WLYA 5IK3A 4NCDA 1U8QB 3PQYE 1SEQL 3ZTEA 1QFOA 3SGDH 1ZKAA 2O5YH 1R5VA 1IFHH 3MRNB 5E5LA 4OLYH 4OSUL 4PJHA 1MCWM 3HBZA 3MA9L 5TE6H 5LO7A 1YEJL 4GKNA 3GB7A 5CEZH 5GS2H 2FEDD 1QBLL 4G8AC 3DXAB 4XCFL 5FO7A 3FDWA 2X3AA 4U05A 5SWZB 2Q20A 1S3RA 2QT6A 1CTMA 3LS5H 4JG0L 4LDLB 5L2KE 5ISZE 4ZNEE 4UB0L 1G7QA 1O7SA 5B1BB 3DDGA 4U6VL 1H8NA 5GGTH 4F2MB 3NAAH 2ZWSA 1QAWA 4ETQA 2H3XC 4WFHE 5DMYA 1UYWH 3IF1B 2Q0ZX 4GAYB 1AAJA 3S48A 1XZWA 1ES0A 4QHUA 5G2NA 4EZJA 3NQKA 4JFDD 4YX2L 1FAIH 4YGVA 3VFPB 3LS4L 4TQHA 4HV8A 3BSGA 5KOVC 4LSQH 5SWQB 3C75A 3IETA 4K7PL 2AK4D 4KZDL 1TTCA 5H8DA 1RZPA 2HFTA 5EU4B 3FF8A 4PD4J 2GFBB 2Y6SC 5C0EA 3IDIA 1CQKA 4X4YA 4B9ZA 3PWPA 4DKFL 4OLUH 1FE8H 1Q9OA 3H9ZA 3QUZD 2V8MA 4WDIB 4EUPG 1BBDL 5E9DB 1SJEA 3TYFA 4L8SA 2QPFA 1QI5A 4NKOB 1K3IA 1XB8A 3IMUA 1X7QB 4JM2B 1FVCA 1BFVH 4X5RA 2VSMB 5CIPA 4APQB 1BQ5A 2L7QA 1GSMA 4BFRA 3F5WB 4HZLA 2KDGA 2VO5A 4J6RH 3F00A 2BS8A 3BPNC 3BISA 2AXWA 1OAUL 3RU8L 4RZCB 4ORGB 1QTPA 4JREC 2FO4B 5C0JB 2UX6A 3QQ3A 2PPCA 4ZS6D 5EF0A 1LILA 5C07B 5K9OB 2PXYC 3NGBB 3GBML 4JHWL 2YWYA 5ERWB 3E8UH 5IF0B 4L18A 4NFBA 4OGYL 1RUQL 4L2YA 3RTQD 1JHKL 4G42B 2EXTA 2XXCB 4PPTA 5DCCA 1JIBA 2BNRD 1ZEAH 4MNQE 3T3MF 1HCFX 4LCCA 3SKOA 1AZZC 1NIBA 4N0FA 4NO5B 4W68A 1XXFC 1BECA 4LCIL 4YC2C 4FXKC 4WY7H 1CXEA 2BIIA 3KYKL 2XVLA 3LKNA 1S9XA 3QEUA 4JO8A 3ROLB 5C09B 1N0LB 5HSFA 2OP4H 1OAKH 1GC1L 4RFOH 5F7WC 4QGTA 3H2WA 2VMDA 4J12A 4L2LA 4M1CC 3KL3A 5IVNA 3Q8CA 4F8OA 1FFOA 3L54A 3WFCL 2CMRL 4OVUA 4YXHH 1MH5A 4GFXA 4XP5H 2VR8A 4M1GH 3LNDA 5C0GB 2GT9A 4WAFA 5T1DH 4EPSA 3HG0A 3BZ5A 5DMGC 1U3HB 2IH8A 3AMKA 1SJHB 4HXBL 4U1IA 1TZ8A 3A23A 1DSWA 3DVIA 3VVWA 3MRKB 2JCCB 4NXKA 4WEEA 3DX8A 4KQ0A 4P46A 2YD1A 3DGCR 5SX5H 4GKZB 5IQ7H 4M29A 4BSVA 3EXJA 2NNAB 2YXMA 2FWUA 4B9FA 4WI5A 4E9LA 4HIHA 3U7YH 1BZ7B 5FGBA 5FUOH 4FG6C 2FJFA 1U8IB 3SKJL 1YEFL 3R4DA 1PCSA 4NGHL 1TO5A 4GKSB 5IKCA 4ZPVA 5IB5B 3S96B 1W8EA 2XA8H 4UT6A 3PGCA 3CPUA 2R2BA 4MNHA 5CXPA 1G7HA 3H42L 4NT6A 3CN1A 4XNAA 3B3BA 2FLMA 4MXWL 5FO8B 2QQLH 4N8VB 4PU2A 4TL4A 1Q9KA 3G5ZA 2LV4A 4X9HA 2H0EA 3IMSA 4U3HA 3PWPD 4XZUA 1HZHH 1RH8A 1IIIA 3RFRA 1JD9A 3FAXA 2ETWA 2VZ3A 2VLKA 3NFSH 1DP0A 1TEYA 3DV6B 2MSPA 1T04B 1KTDA 3OLEA 4Z77B 1JTPA 1C9SA 1S2EA 1ADWA 5DFVC 1NL0L 1EUTA 4DP5X 4F80A 4UV4L 4K7FA 4NJ9H 3VG0H 3LB6C 4KNUA 1KFAH 4HKZB 4ZMWA 5DJDA 3O2DA 4NX0A 4WEUD 1LP9B 2HMIC 2OL3A 2I9TA 2AXJA 1JGDA 3E1F1 4A6YH 1NM4A 2IQ9H 3KW8A 1AC6A 3OTTA 4DGIL 1NLBL 3N43B 4HH9B 4QO1B 5FC9A 1U2CA 3D87B 4CL7A 1HSAB 3W39A 2VJ8A 1PKQA 3NJLA 3KYOB 3T3PB 4WJ5A 5JUEL 1ZGLA 3W37A 4AEIH 4H25A 3MBWB 1QP1A 4OZFG 1VACA 4L4TE 1KCSL 3BIBX 1N3NB 2X28A 4XNXH 2I27N 4L29B 4LL4A 4OZIA 1JN6B 1N64L 1Z66A 5DRNA 4MKMA 1DQDL 2NNCA 3EBIA 4P4KC 1ILSA 4PJ7E 4FFVD 5K39A 2IH1A 35C8L 4X7DC 2VMFA 2JJSC 1KNOB 3DTDA 3OQ3B 3NIDF 3KWUA 4R96B 3MRJA 2F53A 4E41A 2VDLB 2P80A 3IFNH 1LO5A 3SDXB 5C0IB 5ABDE 1P84J 3SDCC 4LCVA 5KYXB 3ARGB 4MRBA 2HKFH 4GUPA 4Y19A 2N7SA 1A6ZA 1QVOB 4GMSH 4V11A 4X2UA 1FIEA 1BMWA 2J71A 1NUFA 4TLTA 5F9JB 5ECGA 1CXHA 4BKLA 1DJYA 5AAPA 3MLSL 1IJ9A 3LOWA 1EEZB 4JFVA 4X7EC 3EFOA 4XN9A 2MOVA 3WJLA 5F96L 2IH3A 3Q5YA 3ILQD 3QJFA 3CFEA 1KY6A 4S0HA 1DUYA 3KPLA 1KBGL 4XHQA 1JHTB 5T5NG 3B9DA 1A2YA 1QQDA 5LAXA 4A2MA 4XAWL 2A9AA 4F3FB 3A21A 4KVCL 3H7BA 5D7SH 5DEGA 2GJ6A 5EUOA 1J1OH 4NQDB 1F4HA 4KK8D 5DVNA 1X44A 1RY7B 2GC7C 3MV8A 5GRJH 2Y5QA 5FAAA 4Z7UB 3WIHL 3DX2A 5D72L 4ISVB 5D7LE 5AOLA 4OIIH 2VTFA 3V4PA 1AHKA 3L9EA 1NFKA 2UUDK 1WZMA 4JFTA 2EYSB 2IWEA 4WV1A 2VR3A 5E08H 4J27A 5IZ7A 2HVJA 3JV6A 5C1MB 3TF7C 4HA1A 2W9EH 5ALCL 1EEYA 2OXHA 3QEQD 3DX6B 2VLKD 3GTTA 4U6HB 3V4VH 5HGAA 2I5YH 1FNFA 4HT1L 5IQ9A 2F19L 4A39A 5LUMA 5MENE 1ID5I 2F6AA 2QVTA 2YRLA 2ZCKL 1ADQH 2H6OA 3QISA 4I3RH 4NENB 3ZN6A 4HVBA 1EK3A 4HDIA 4XMPH 3FH8A 2DICA 1G9MC 1EAPA 1ODAA 3B43A 1BM3L 4AVJA 1A6WL 2AV1A 2W0PA 3CSYB 4HJ0D 4P2QA 3FW6A 4AT6A 1OB1B 4Z8FL 1NMAL 3HMXL 3ZT7A 4Y1AA 4EN2A 3UEZA 1NCAL 3CBRA 4ZMQA 4UQ2B 4Y16C 5FW6A 1DE4B 4JFQA 2DMGA 3JWOC 5AG9A 1RZFH 1Z7JA 2IAMA 3P1VA 4PRIB 4Q8BA 3WE6B 1VFAB 4UM9A 5HI3D 1MCNA 1SDDA 2P24B 2PP9A 2R0ZH 5DQJA 1P6AB 3FSAA 2CLZB 3X1NA 3DV4A 5MP6L 3UTZB 3GBDA 5AZEH 3VFNB 3VRJB 3BLKA 3QNXA 4LCWE 4OCYL 3UTSB 5GGUB 1D6EA 1IAKA 5TDNB 4BCXA 1A8ZA 1ZPUA 1MDTA 3HB3D 3II1A 3INUH 3WI9A 2HAZA 2Y69B 3GKWH 2QADD 2YK1H 2XWJB 3S97C 4IRSB 2WD0A 4JFPB 4QY8B 2Y1YA 1W72A 2OJ1A 3QK0A 4J3TA 2F53D 4GMTL 4F20A 5IBUB 1BVNT 2OZ4H 2G75A 2P80D 2PTUA 3BPNB 3HE6C 5C9KA 4P3DB 1RZIB 3MCKB 4JREB 4KROD 4HAKA 3VJ6B 2ZSWA 3QFJB 4MVBC 4N90D 5EO0A 2PXYB 3ZKQD 4Y19D 3CMOH 1MWAL 5JQHC 2G2PA 2N7AA 1N8ZA 2CJTA 5CEYB 4ZMXA 2M83A 1S3KH 3TT1H 5EN3A 3UJIH 1ZK5A 4P49A 3CXDL 1HI6B 1WAAE 5AYQA 1HDMB 3S34H 5CZVH 5F7YC 1X6LA 2A4CA 3T4YB 2L04A 4G43A 4YC2B 5HDQH 2D0HA 1A14H 4FXKB 1RL1A 3FHAA 3OLDA 1ASOA 4FQ1H 3DVGB 4X5WA 43C9B 2X3CA 1VGEL 2XXFA 4HG4K 3IAQA 3KLHD 4GRLC 2E47A 3L3IB 3QW9A 1L9OA 1OGTA 2GJ6D 3ETBJ 5MERB 4BFBD 1UKTA 3UTPE 1M2OA 4PJCB 3TYGL 5EIIA 1MHHB 1FBIL 4I2XB 5CHNB 3ES6B 3GDBA 4PB0H 3MACL 4IOFD 5D1QD 5FYKL 2J3SA 4YQXL 4HUNB 1WQVT 4XPHH 3AABA 5GRWA 5DJ8A 5C0ND 2VDLL 1I4FB 2WJ5A 5CGMA 1O9WA 2AEPH 4TQEL 5IFHL 2HTLD 3ZE0F 2XIIA 1KELH 2RACA 1RZGB 1RAMA 2YPLA 1G84A 1FL5A 3O0RH 1MIMH 4HEME 1R5IB 5DZAA 2J55A 3IU4L 4P9ML 2JSFA 1ORSA 4LP5A 3TONA 4DQOH 3V0WH 4DGYH 4N20A 4QCIB 2RR3A 1DBKH 2VR9A 4LNRA 4FL4B 1NEZB 3U2IA 4PJFE 2EAEA 4R84A 2Y07L 5IJBC 1NMBL 2VN7A 1NM9A 5AZUA 2WVVB 4P2QD 4XPFH 3CG8A 3G6JB 3GHPA 1J0ZA 2WWMD 1UXMA 3FXIC 4AITA 3T3ME 4HC1H 1OKEA 4P59H 4HMEA 2FBJH 2X6CA 2KLTA 3H9SA 3RNQA 3VFVA 1W91A 1A1MA 1EGJA 3ZE2E 2BSSA 3DRQB 3E2HC 3QQDA 2D7MA 5PAZA 1X6NA 3D2TA 3O3BB 2EO7A 2IAMD 3QO0B 4UT9L 5F0PB 3RWGA 2VDKH 3KPTA 4M6NH 4IHBA 5C9JB 3QHTC 1F2XK 1M1XB 3LPPA 4OLXH 4J3BA 5E23A 4NQCB 3TO4C 5I2IA 3DURB 4ESKA 1R24B 3UP1A 5GZOA 2XFGB 3ZZ1A 2EO1A 4D9LH 5BZDA 1AHMA 1HH9A 4PRPE 3PHOB 3QNZA 1TQSA 4W9CC 2DQDH 2WBJC 4NHUA 4UUJA 3I6SA 1CLYH 2QJDA 3ZUCA 3WN5C 3VXUB 3EJPA 3FQ2A 3OZKA 3L81A 3LX9A 4E5XA 1T7XA 3ATFA 3B5GA 5CJBA 3N42B 4PJEA 2A6DB 2VC2B 2FNBA 3MO1B 1B4RA 3HG5A 2XXMB 5CR1A 1I1CA 4CMMA 5FECB 3L3JB 1A02N 4NRXA 2EUZA 4ORZC 3WY1A 4G8IB 3S3JA 5F3BB 2ZYIA 2GCYA 3MI6A 3QB7C 4Y9FA 3WY3A 3C8DA 5AVWB 2PCPB 1HCVA 5D2NE 5ETUB 3ROOA 1X7TA 2A9CA 1AXSB 3GNMH 2VM4A 2XRAL 2HLFC 4FS0A 3GK8L 4ZTPL 2RD0A 3JV4A 1CDIA 2XFXA 3QXVA 4LE8A 1L3WA 1QYGL 3FFDB 4TVPL 5KVGH 1IQWH 3RVXC 3A6CH 2VDRH 1U8NB 3E1ZA 1GS7A 4YHOH 1TJIH 5C7XH 3C12A 4ZUWA 4UOW1 2R8SH 5DJXB 4X6FA 4P48A 4RX4D 1UZ6F 4M61A 5ESAB 4CMHC 3MV7A 4LHUB 2BW5A 4BELD 3Q7JA 3RNKA 2BC4A 2ZWYA 3TN0C 1NMCC 1JWUB 2DQEL 2UXGA 4H8QA 1AY1L 2YD0A 3LNHA 1KB9J 3DOHA 3D25A 1LVEA 4UTCA 3ZR6A 2CWRA 4YFEA 1VPOH 5F7HA 3QIBA 4K5PA 2IPKB 3IXTB 3U9PH 3U0TA 3UBXI 4E9SA 1W0VA 2GTWB 1WZAA 3OMNB 3VW3H 4YDVA 4YAQB 3O2VH 2PYEB 2FT7A 3KL0A 2CDEB 3STLA 1XFPA 2J20A 2NY1D 3NOIA 3S4SB 4RRPG 1H8LA 1EBAA 3UZVA 1A7QL 3HNVL 1QMUA 2QHRH 1R3JB 2GJZB 1QHOA 1UM4H 2BVPA 3X13B 4CGTA 5D7IA 1MCWW 1DJIA 3BD3A 5BW7A 1ZCRA 3WFZA 3MX0A 2NCEA 1OL0A 2LR4A 3NIDE 5DJ0B 1NBCA 3EJSA 1WIUA 1JXDA 4K23H 4RMBA 5GZOD 1CK0L 4EF3A 1AMYA 5I73C 2AABH 1R17A 2HG0A 2PW2B 3K80A 3B6SB 2Z1PA 4NKQB 2DIJA 4FYRA 4NC2B 3CC5A 5DRZB 4B96A 1NAMB 3AT0A 5MHSD 1RK1B 4QJ5B 1J5OL 1DQLL 1ERNA 1HQRB 4FG0A 3D50A 3M1OA 1QRKA 3OAYH 4CILA 1ACZA 4F7CA 1PLBA 2ZUVA 2H2PD 4BE5A 4JFOA 5H4ZA 4X99B 2A6IA 3HBPA 2CK2A 1SBSL 4CSPA 3QPQC 3OB0H 3V6FA 2P44B 4Y16B 5H2BB 3O41A 2R23A 3FRPG 3L95B 1A3QA 3UPCA 1W15A 1F4XL 1BQSA 4PVNA 5FXCH 5JIDA 1KLFB 3ZKXC 5JHDE 2EVIA 1OXYA 4XXDB 2K9UA 3DSNA 4TSBH 5GRUL 4ODWB 2ZXEB 3MLWH 4O2EB 4RWYH 1CLZL 1FO0H 3DKHA 4ONHA 1ZVHA 4KO6A 3CLFH 4HS6A 2EUVA 2YXWA 4MMZC 3VXMA 2GAZB 5FHBH 3QRFM 3QJSB 3WD5H 2F15A 4EDXA 4FTVD 2D4FA 4YL4A 3FH7A 1FV1B 3MLRH 4D9QE 3P4MA 3PGDB 4BK4A 4PJAE 4KKAC 5D71L 1X5IA 3LQAH 3HE6B 1IM3B 3NIFE 4I89A 3TXAA 3TOPA 1P2CA 3PJSB 4ODTL 2K4AA 3ECQA 5C70A 3F7QA 5JIMA 2V5YA 5EOCH 3T0VA 4CN4A 3PWLB 5CCHE 1VENA 3MV7D 2HRHA 3TURA 4NLHA 1A22B 3NQIA 3C9NB 2VC2L 1DQQB 2PWEA 1HYSC 2FX7L 1KZQA 2I9LA 1UJ3C 3DO3A 4X4ZA 3U0WL 5HD8C 2H6PB 1AKJA 4ZSOB 5E2TL 4R7VA 2WM0A 5AW1B 3WMSA 2VZOA 4AQAA 1XGUB 1WYJA 3C6LA 1EIBA 4FI6A 5IUSA 3CFBA 3B7UX 1JERA 3IMTA 2D7TL 3QIUA 4JFFE 4DW2L 1X3DA 3RI5K 4WRLA 5KSUA 2F8XC 2O72A 1E8WA 1LEIB 3I9IA 4GRLB 1MCHA 2IBZX 5EZJA 4I4WB 1WC7A 1F56A 3S3DB 3AM8A 4A66A 2YSTA 4XXWA 5D70L 3LAFA 5JOEA 3FQRA 4V2BA 3RL1B 4MD4A 4KJYA 4YJZL 1RIHH 3WL9B 3VWJA 1PSKL 3HEIB 2X2JA 2ADIB 2BVTA 3HG1A 3ZJAA 32C2B 2AAAA 3EDEA 3LKQA 4UIMB 4ANKA 4YXKH 2DOCA 1NBZB 1HNGA 3M17A 5C0AB 3HZYA 2X05A 4P2OC 1G6VK 3HI6H 3QAZC 3LMJL 4NI3A 4WHTA 4OBRA 4F37F 1YN7B 2HJLA 5T3ZE 1WBYA 4XOAA 4UQ3A 1JMXA 1FGVH 3PFQA 3D85B 1QEWB 3DWTA 3GJEB 2Z4QB 5EBGA 4ALAH 1NCWL 4ZFGL 3RDTC 5KS9A 1RLBA 3BCDA 4OGAD 4IKKA 2B0SH 3AS2A 3GSQB 4M5ZH 1KTCA 3E2HB 3O9WC 4KDVA 4HIXH 1XH3B 3NJMA 2HT2D 1JPFA 4RGNE 4H5SB 2IG2L 5I75B 5A2FA 1FFPB 4Z7VA 5D1XA 4KK6C 3VDAA 4C4UA 4CN6A 2HX9A 1P1ZB 4OQTL 4WUKH 4JY4A 2PMZA 3RGVC 4FOMA 2R7EA 5HHXH 2NY2C 4HJ1A 5FA4B 2YUXA 4YHPA 2QTVA 3MJ9A 3TO4B 5JMRA 1BEYL 5C71A 3VXSD 4V1DE 1HL9A 3ARFA 2V3EA 1ZLWK 4JANB 1S9VA 4CKVX 2WBJB 4QYOB 3DMMC 4WW2F 3ASNB 4YUEH 1LE9B 2FO8A 3DHPA 3DVNA 3W57A 4LIQH 5D5MF 3UCRA 3WN5B 1SOQA 1K72A 1F3JB 5CBEA 2IPTH 4JDTL 3ZE0E 4M62H 4HLEA 5AKVA 4N3TA 1OF2B 4OF6A 3M6DA 2WAQA 4AJYV 5CUSL 5F3HB 3MU3A 1NAML 3AAZA 4RH4A 5CGYC 3WJJA 3LRSA 5BVPH 1G9ML 4P3CH 3O45B 4JFYA 3LXBA 4BV1A 4K3GA 1SJMA 1KTJA 2DMCA 5E5RB 4JE0A 5GGRA 1R9FA 5AVUB 3D12B 5D2LB 1WD8A 1MCOH 1IL1B 3JWOL 3OMAB 3ZUNC 4I88A 2HJKA 4GG8B 4Z95H 2VQ1A 3C6LD 3UZQB 2W9DH 4UAOC 4OR1A 3BP4B 2IANA 1S7SA 3ASOB 1X4ZA 2CCVA 4K9EH 5KBLA 1A4JB 1V7ML 4TOYL 3TBTB 3RY6A 3L4XA 3FQWA 3NCFB 3QYMA 1JPTH 1F42A 3QUGA 1AIFB 5JPNA 3HCVA 4ATTA 4PP1C 4F7MA 3UOAB 1C5DB 4GKLA 2ZWLT 4ENZA 4F37K 4MJIA 1OAYH 3KAAA 4XMKH 4AVIA 4NO2A 4LZKA 3NYKA 4HS8L 1WIPA 4XN1A 2ZCHH 2WNXA 3VO0A 4S10A 3T09A 4NNXA 4WSJA 1FYTA 1AQKH 4IMKA 4LLVA 3VWJD 2HT3C 4G9FB 4CMHB 3DOSB 2A77L 1ML0A 4N8VG 3TN0B 1NMCB 3QQ4A 1BGXL 4TRPH 4YHKH 2VZTA 4GLRH 4WKZB 3VXNB 2PYFB 2TSBA 3LQMA 1K6QH 1RV6X 3BLPX 5DHVA 3RAJL 3L9RA 4MCZB 3QWOB 5DDHA 2WO3B 2XYBA 3DO7A 2HYMA 4F57H 3V4UL 5EZLA 5E6SB 4JHUA 1I3RA 2K0RA 4OFQA 3PIQB 4G5ZH 1A4KB 2Y2YA 5SWSA 1NCBH 5B39A 2WN3A 1FLRL 3MKKA 4MJ4A 4R8WH 1SEBA 1UA7A 1KCRL 2IV8A 3QYCA 3V6ZB 2E7LA 1QRNE 1BMGA 1DQJA 1C5CL 5LCVL 2WLNA 4YPJA 2VZSA 2PPFA 2R2EA 4JKNA 3GMMB 1MVFA 1T66D 1Q72H 3F6IA 2ITFA 4H88L 2KI6A 4JQIL 2X6BA 4OM0H 4HWNA 1P5VB 1GGCH 1IGJB 3DTXA 2G0LA 1CFNB 1MJ7L 4U1JA 1WFTA 4KBPA 4MB3A 5L4JA 5DWPA 4ZXBB 3MRCA 1LWJA 1XX9C 2HKAA 3WEXB 1GIGH 2NY3C 3IDNB 3S5YA 5I73B 3LEVL 1T22B 3TWCL 3K8KA 3MLTA 1CGSH 1KC5H 2NZIA 1IILE 2YEZB 1MUJB 2VM3A 3DYOA 4QF1A 3FTVA 3V8CA 2GJJA 5D8JL 1UWXH 4C4BA 4PS4L 2R56H 1UZ6E 3BQUA 4J3OG 1AGFA 5ABZA 3I6KA 2WYIA 5IEHA 1KBPA 3QG6B 1U41A 5HHQA 1MNNA 1F8TL 5KSBE 1PNDA 2C1OA 3FZUD 2V5TA 3FSWA 4LFHG 2CR6A 4DP4X 3GMOB 3VB8A 1GS6X 3MRHB 4A38A 4B97A 3J8F7 3ECUA 3PQYA 3NESA 4KKLC 3U0PB 1LQSR 4I5BA 4XOBA 3CPLA 2VL4A 2PCXA 3ZKXB 5LHDA 4HUCA 4LK4A 1BM7A 5I1JL 5L8KB 4XP9L 1L9QA 3BGMB 3ZDYF 1KIRA 3BEVB 2E9JA 3P0VL 4PWHA 3ENEA 2YQ3A 4NUPA 4YDMA 5E0FA 5ELIA 3H3BC 3DX3A 5FV2A 5GS0D 4P2AA 4XVJH 3L17A 3IJEA 4ENEC 3ARWA 2UZIL 2G9HB 1BOGA 3L2NA 1WFUA 4LSPH 5DUBA 2IAND 2DMHA 4MMZB 1UA3A 3HFFA 4OJFH 1F18A 5ISZA 3BGFC 4FJZA 3I6LD 3ZT5A 4ZNEA 2BWDA 4QXVA 1P5UC 4LLYB 4WU5B 5EIVA 1C7SA 1XT5A 1S7WA 3TNMB 2XWTB 5I1DA 3G5VA 1GZQA 2VQ4A 3P4NB 5T5FH 3IVKB 4XMWA 3WXVH 2WLIB 5TDOB 1MAMH 4NUJB 1T89C 1PX4A 4KFMA 4X5QA 4BZ2L 1GGIL 2BZDA 3ZDZB 4GEJA 1BLNB 4ZTEA 2E6JA 1FYTD 1TJHL 4MLSA 3BRGC 3Q6GL 3E3QC 1QO3B 5FLUA 5BQDA 5EBWA 3NSDA 1LO3H 3PJNA 5CP7A 3DK0A 5JYLA 4R4ND 1U95B 2N59A 5T33H 1UJ3B 4JAMA 3STZB 2V7NA 4GEIA 1KUMA 2FUQA 1MFAH 2ZSVA 2IDUA 2OJEB 3APFA 4PREB 2XZAH 4OD3L 1KYUA 3W9DA 2X1XR 3CN2A 1F4YH 3QZLA 4ZK8A 4F1SA 2BJMH 4U33A 4KAQL 4N28A 5FO2A 1S7XA 1N6QH 4G71B 1VRSA 5GS1A 1YQ2A 4Y7OC 5JQ6H 1Z32X 4C54A 1MREH 5BO1H 2R4SL 1FDLH 5KZCB 3O3AB 4LSSH 4DT2A 4WFFE 2CO1A 4PJ9A 3F64A 1CGWA 4HIJB 3LV3B 1GS8A 3BKMH 3HZVB 4NNPH 5DC4B 4Q56A 3TLRA 4YDLC 1RFDH 2XNAA 3BRFA 4Q89A 4BYHA 5KUMA 5AOZA 1FGNH 5E2UH 3O4LE 1JGIA 4JN1H 4B3VA 3ZRFC 4P2OB 4OI7A 2Z3FA 1SLWA 3BH9A 2GUOB 3A4FA 4XP1H 1J88A 1C8PA 3QAZB 5DO2C 2IXQB 1D5ZB 4X6BB 3ALPA 4W9HC 4S1SL 2EE0A 3SKNB 3PV6B 4X0NA 5AUMA 3ARDA 2G60L 2IEPA 1YA5A 3BQUD 1AGCB 2G3NA 5EFIB 1VAHA 3VRIB 4BZ1A 4DCQB 5JOFA 3MNWB 5BS0B 4F8NA 2Z8SA 1E9QB 3G9VA 5AD0A 1F2QA 4M9OA 3RDTB 2H8PB 5IBUG 2BSRB 2WINB 3B2PA 1CDBA 2W0FA 2BS71 1KGYE 4NRZB 3O9WB 3PQYD 5I71B 3N04A 3RA7L 4MYWB 3ZK0A 2JKRM 4QPEA 3WKQA 1FC2D 1M6UA 2B08A 4MCMA 4J1UB 1TTRA 4CAGA 2O5YL 5DYOA 3RGVB 2FLBT 2D03L 1MHCA 1QA9B 2NY2B 3B9AA 1IFHL 4OAWA 1NFDF 2J8OA 2WLJA 4LPWA 4OLYL 5DR5H 5TE6L 3MXWH 4N0YH 2GPZA 1GPOH 3W5MA 1QASA 3DMMB 4PYHA 3W11C 2HSIA 4Z7QF 4I48A 3ZO0A 5CEZL 5L2KD 5ISZD 2EYTA 4IEFA 1PQZA 4N2DA 2ENPA 3LS5L 5F3FA 5LBGA 1UD4A 4ZUTB 3CH1A 3FJTA 3FT1A 4HOZA 4WFHD 3GIVB 3I3BA 3BVUA 5H37H 1Y0LB 3PV7A 4A6YB 3CVHH 1NJ9A 2LAAA 3H3KA 5GGTL 3EYOA 5F1SA 1ZLVH 3EO1A 3BDBA 4PGJA 1OEZW 1UYWL 2OSXA 3ZKMD 1U3ZA 4AGQA 3IKCA 5CF3A 4QHMA 1WITA 2FEDC 1FZKA 2IO5A 2EC9U 3OZ9H 4I0PD 4TTDD 4FFYA 2B77A 1FAIL 3DI3B 4GI9A 3DX9B 5IG7B 1AQHA 2MMXA 1K5NA 4LSQL 2KERA 1M56B 4QAMB 1I8IA 1IC1A 2DI7A 4U7MA 3TH2T 4TYUA 4UAOB 3I2CH 4HJUA 2R2CA 2N56A 4NBYB 3VD4A 5D1ZA 4Y9EA 2HFFA 2WGNB 4TN9A 1Q9LA 3GKZA 1EFXB 2AI0H 2ARJQ 1U8OB 4OFDA 5EC1B 4OLUL 3II3A 1FE8L 3QZWA 1GJIA 5GIRA 4MA8H 3K74B 3RVWD 1UM6H 4N0CD 1L6XA 2A5UA 4XB8A 4LRNH 2IDFA 1UCBH 2Z8RA 3L3DA 4ZX6A 1WP6A 4L9LA 4RQQA 2J21A 4PJ9D 1KJVA 3FBKA 5E4EB 1KB5H 5D5ME 1T3FB 3AADB 2XN9A 3OKOB 5DK0A 3SZ6A 4P5MA 2IQAA 3BUBA 3U6RA 4DETA 4MB5A 1BIIA 2VITA 2NPLX 5C97A 3UX9B 4HG4J 4X5PA 2XG4A 3L7EB 4Z0BH 2WMPB 2ICWI 2GIXA 4L4TA 3VFSB 5IQOA 5BV7L 5I1LA 4MNQD 4LMQI 1A6TA 3OKEB 3CHRA 1R3LB 1NPNA 3ARDD 3UYRH 1BQUA 1H15B 3D8MA 4FNPA 1ZEAL 1BG1A 3LD8C 3VFOB 4PJ7A 4X5XB 1PGRB 2VDQB 3SCMC 5KYUB 1IX2A 2E7CA 4WY7L 3PLYA 1QACA 2BCKA 4ZS6C 5I6MA 1UENA 5CJXC 1EH9A 2D9CA 1CICA 3FSZA 4MX7A 1SBBA 1OAKL 2OP4L 5DLMH 4Q14A 4PRDB 4AYFB 5DS2A 4RFOL 3W2DH 3LIZH 2VRKA 1JK8A 5J6HB 2GK0B 2V6HA 4QD2E 1NQBA 4YXHL 3ZXAC 4F2FA 4PCSA 2NY3B 4QKXB 1IE4A 4M1GL 1J8HB 3V4VB 5T1DL 2FTAA 2ZQKA 2ZUQC 2AXGA 3BUDA 2OV0A 4H0IA 4M5YH 5DWUH 5GSVA 1JJUA 2VT0A 4HJTA 3DPDA 4M8QB 2DQMA 3MREA 3MUGA 4GW4A 6FABH 4I9XA 2ZOLB 1OHQA 2EP6A 4AGLA 5G5DA 1TCMA 3Q2NA 3QEGH 2F5BH 3GLAA 3GC3A 5IQ7L 4FXTA 1QPPA 1VCAA 3RIFK 4JRYB 2IDQA 4YO0A 1XGPA 2YN5A 5IGXH 1QSFB 3AU0A 5FUOL 3IBOA 3LKRB 4G72B 4CRPA 2V2TB 3DUUB 4LHUG 3SJVB 3VI3B 2GHWB 3FYIB 2XA8L 4J4PA 4KDTC 3B37A 2LLNA 5I30H 2OTWA 3K6IA 1RZ7H 3KJ6H 3MGTA 3ZHLA 5AVTB 1R34A 4PWGA 5EOTA 2ZZUT 1HC1A 2QQLL 3FU0A 3CFCH 3FT4A 4MJ2A 1YC7A 5B1JA 3BGFB 2JJWA 1P5UB 5HGGS 1HZHL 2ESVB 4MCYB 5MENA 4Y5YC 3IGKA 2LT9A 5EBMB 3LN5A 1K4CB 2I26N 1J86A 3HUJA 1WA2X 3NA9L 3NFSL 5IESH 1ZVYA 4JQVA 4LHQB 2WW8A 1BREA 1WCQA 3LQAC 3NN8A 4N6QA 4B50A 5TQ0H 1HCYA 1JF6A 2XG5B 4X6CA 4DUVA 1WBZB 4LBEA 4NJ9L 4P5TD 4M3HA 1JZ4A 3VG0L 5CLTA 5M94B 1B2YA 3GMRA 1KFAL 1H8OA 2JTYA 4X6DE 1KXVA 3HNTH 3RUGF 4XX1G 2GW5A 4ZUSB 1R0AH 2BERA 2IQ9L 5AW3B 4NQSA 2NZ9D 3FQ1A 5BJTA 5C0FB 3QARA 1T4WA 4DTGH 5CS7A 4MA7H 2E46A 1QX1A 5DQDH 4L4TD 5EZOL 5HHMB 3H4FA 1UURA 4HHAB 2XBDA 4K3EL 4AEIL 2WGXA 3KPNA 4JKPH 4DH2A 5I76A 1DN0B 2WQUA 5HGBA 2A73B 4XNXL 3QVAA 2W0KA 4U1HA 4DERA 1U3NA 3GJFH 3HHMA 4IDJH 5E8OB 3ZYJA 4XMLH 4MRCA 4KH2A 3QG7H 3RZCA 4YK4C 4F9LC 4C57C 1V7NH 3OR6B 4PV1C 3EOYG 2CBTA 1CICD 2YD2A 4K3HA 5I16B 3QCTL 4IGBA 2HA1A 2JKXA 3GZOA 3GXFA 3QUXA 4YDLB 4Z7WA 1DDHB 2A0LD 1UB6A 2YEQA 2F54B 4LCCC 1UXLA 3D39B 4JFEB 4CU7A 2AJUL 1I7RA 4AE0A 5IVXF 4NHCL 4U49A 4PRAB 1HXKA 4P23A 1Q94A 2VDOH 2F2HA 5IHLB 1CLVA 1SYVB 1WAAA 2YSSA 1JFQH 4GMSL 2P45B 3N1FC 1UA6H 4K73A 1CFQB 1CFTA 4FFVC 1Q0EA 1HHGA 3BUIA 2G4EA 3DO4A 5C6WH 2SODB 1H6UA 3X11A 1F0LA 2FBRA 1AP2B 3K4ZA 1JOIA 4XCNB 4KXDA 2WZPA 1M05A 1IEAB 1OTUD 2XJKA 3ILDA 2OX5B 3KPPB 1IBBA 2YRBA 1W6LA 2YXVA 4UNVA 1JGEA 2HG5A 1BBJB 5C8JA 5D7SL 4ES8A 1UOKA 1J1OL 1CL7I 1R3IH 4WGWB 3VRLE 1IKNC 1PD6A 1L6ZA 2VDQL 2IDSA 4OLVH 5D7LD 5GRJL 3SD5A 4EDWH 2VDKB 4ABUA 1JWMB 4J4PD 2GSMB 5MEOA 4NDMB 5AZ2H 3FB7B 2PF6A 3RFZC 4OIIL 3ILQC 5JW5B 3TFBA 2GI7A 4Z3HA 4YEFA 1U8HA 3RQ3A 5E08L 5FF6B 1YUHA 4HWBA 4QTHB 5TF1H 3BZDA 1RUAH 4NQEB 5MEND 1OCWH 4A7VA 4YIQA 4GG6B 3V4VL 3CFQA 3FL7A 4PJFA 2I5YL 3JWDH 3G5XB 4KTDH 4K07A 1Z9PA 1WHPA 4JVUA 4XR8C 1JNLH 2XKNB 1ADQL 4I3RL 4Q6IC 4Y4FA 2UZXB 4XMPL 2QMJA 4PV9B 3BE1H 1LEGA 3QEHA 4KQ3H 5LJYH 3ULVL 2C3GA 1AHWA 1TTAA 2DEXX 3L45A 2BHFA 4HGKC 3CDZA 5I8KH 1WE5A 4HKXA 3V5HA 4R5XA 5EO1A 4PM1A 3U25A 1RZFL 1CTOA 1K4DB 1ZVSA 3FQYA 4XWGH 4NN7B 3A0OA 3F7RA 4ZG1A 2VUYA 4LCWD 2FECL 1C12A 5IV2A 4JPVH 2R0ZL 5DD0H 3T0EA 4AZUA 1DFXA 1YEEH 1CYWA 2C9RA 1X9RA 3K6NA 4K9EC 2KS0A 4M6MH 2YD3A 4PV8B 5DRWB 3S5ZA 2WOYA 4HJ0C 2HRPH 2V3DA 4AYSA 2ADGB 1AC0A 3SGEH 1OPGH 2W59A 3N85H 4MD0B 1BQHA 1KDIA 2AEWA 2BP8A 1NFDE 2VDRB 2DL9A 4HOXA 3RZCD 2AK4B 2NYZA 3ZYZA 2QDVA 5FA3A 3V5DA 4GUOA 3GKWL 4GKOA 2L8AA 2CAKA 2V5MA 4K2UL 6CGTA 1PJWA 2QV4A 3SEPA 1QTYT 2VSCA 1AGBA 5IJKC 3X1FA 5HI3C 3T2NH 2QKIC 2FR4B 2ORBH 2OZ4L 2YXFA 2VE6A 4IGBD 3QUXD 4L48A 1LO0H 5D7HA 5KBKA 4QRTB 4CU8A 2HX7A 3OB8A 1FL6A 2Z91B 3TM6A 1YG9A 4IMLA 4U0RC 3RDJA 4GIPD 3CMOL 3HB3C 5F9WC 3D2UA 4G1MB 3S35X 3B8SA 1S3KL 1A3RL 2EH7H 3BESR 5G4NA 3UJIL 3VGGA 1CT8B 1EUUA 1VFBA 2QADC 4BQ6A 2CO6A 3QJRB 5D2NA 3LEYL 5DMJB 1FI8C 3CFKA 3S36X 4QGYA 4LSVH 4LASH 4R97C 1TENA 5CZVL 3A67H 1TQBC 3LD8B 1HJCA 4KGLA 4PS8A 3FHEA 1FP5A 4XP6L 1FZJA 3VFMB 4LLWA 3SCMB 3T6ZA 4DUWA 5HDQL 2DMBA 3QJUB 4KROC 1A14L 2R69H 1EAQA 3UTPD 2ITDB 1KCWA 5JDSA 4GSXA 5ENWB 4PJBE 2ZE0A 3VD0A 3L1OH 1T21B 3UBFA 2NR6A 3VH8B 1P1VA 1FG2B 1TVBA 4N5ED 3U4BL 2IALB 1KGXA 3ZTJG 4AEHH 5HYSB 4PB0L 3HJEA 4B9PA 1UH3A 2X4OB 4WFGE 2OMZB 4CADA 5LGJB 5KYYB 2ZUQB 2OMVB 4FLQA 3OX8B 2AEPL 3KXFB 4LAQH 4HU8A 3KLHC 5FLVA 2JFCA 1O0VA 2EIBA 4IOSA 1MIML 1E43A 1I8KB 4YPGA 4ZODA 3SE3A 4Q6KA 4DQOL 1PLGH 1ETB1 4UQAA 5D7JA 3V0WL 1GJWA 4DGYL 3QCUH 4P9HH 3VXOA 4ATWA 1DBKL 4IOFC 1ETJA 5D1QC 4RDQF 2WO2B 3CJJA 4KXZH 4AM0Q 5AFAA 4EVNA 5C0NC 4PW4A 2I7SA 1ONQA 1WA1X 2QPDB 2C3XA 3GB7B 1XL4A 4XPFL 4PMFA 3LZLA 5KVFE 4WI2A 3CQQA 4HC1L 3PDOA 4P59L 2FBJL 4ZFOB 1OCOB 4UQEA 4ONGL 3HN5A 2F1BA 4NZ8A 1FO0B 2Y7OA 3QPXH 4J8QA 3P9LB 3SQBB 3MUJA 3BH8B 4M6NL 4KHXH 4GQRA 3MRLA 3TV3H 1JXKA 4NPJA 4ZX5A 4KRNA 2PPDA 4Y5YB 2I07B 4OLXL 4DGWC 3TJEH 3ULVE 5ALBH 4D9LL 4UTAL 2WN2A 2NW3A 1I3GH 1MVUA 2DQDL 3IETB 2JLLA 1BYOA 3Q01A 2DWDB 4AQZA 1CLYL 1JDAA 3ASWA 4M7LH 2IAMC 4F7TA 2FRGP 2IVFC 2NQDA 3R18A 1QSEE 5TE4H 2XTLA 1ZLUH 3VCLB 4LSTH 1Y6NR 3IDIB 3MROB 3HR5B 3R0MA 4AV5A 3KWVA 4Y1SA 3TBVA 4BFJA 2PCFA 2OSYA 3PWPB 2BP0B 1G7IB 1O6VA 1VEPA 3CFDA 1WT5A 3MNMA 3V4LA 3EJTA 3AY4A 1KYAA 5JHDA 2C3HA 4Y2DA 3NPZB 1F02I 3CD4A 3QDGE 2OYLA 3T04D 3DIDA 2ISDA 5LQBH 5I1AB 4ZFFA 2A9NH 3UMTA 4AK1A 5FUCC 2X1OA 4UT7H 4LPCA 4OLZH 4ZW8A 5KW9H 2RQEA 4HX1A 1FVEA 2O6PA 4ZMVA 3K6OA 4FULA 5J4MA 2R59A 5J7CC 5J11C 4MB4A 3ZTDC 2X4PB 4A7SA 3GNML 5AWNH 3QQ3B 4G7SB 2DYPA 2ZOUA 3MRDA 4PJAA 4XO4A 1JG9A 4P4RA 4KK5D 3QDMA 5FYLE 1TJGH 3X12A 3SKMB 2FGZA 3G6AB 5KVGL 1IQWL 2VLJE 1E5CA 2X4QB 2EE9A 1FNGB 1J9SA 1ZA3A 2C9UA 3GIZH 4PP2B 5JA9A 1ZGLP 1M71B 1TJIL 4YHOL 5F7LB 5C7XL 5EG6C 5DRXB 5F6HJ 3S5LA 4EUPH 1B6DA 4XN8A 2R8SL 4N0FB 4MMYB 3UJJH 1M7XA 1JWSB 1GZPB 4FNUA 2JNZA 3V0AC 3QA3B 2V2WB 8CGTA 1QI3A 2X7LA 2NXYD 3BMVA 1Y6MR 4ERSH 2QV2A 1T2JA 1WJ3A 3OXRB 4IOSD 4YGAB 3UC0H 4JFFA 1E50A 4XO5A 2Y7QA 3FTUA 4L3EE 3RUGE 4D2NA 2ALWA 1P4BH 5D7JD 2ALAA 1KLUA 1QLEH 1UC6A 2PTTB 1S5HB 3MLYH 4JPQA 4YSCA 3PHQB 3RP1A 3VSQA 2JKIS 5CZRA 1ASQA 2GT9B 3GSNA 4M5SA 3G6DH 1XB6A 4NIKB 2FNWA 4NSKB 2IBZY 3V9EA 1RSFA 4RIRA 5E95B 4JB9H 5B8CA 4KZCA 2Y2TA 3BDYH 3GXUB 3VW3L 1RERA 3NT0A 5I1KH 3O2VL 1JGVL 3DX8B 5HDBF 1WF5A 1L9TA 1D5IH 2CK0L 3R8BB 1ED3B 3AREA 4QNPF 2VKXA 3RFZB 3KPRA 3B2VH 5KN5B 2QHRL 3OAZH 5J5EA 4GH7B 4WI0A 2EEAA 3PYCA 2XTSA 4RGMC 1UM4L 3CZFB 4UNUA 4WWID 4ZPTB 1DCEA 1TXKA 4YE0A 2WOBA 2CKBA 2N7BA 5E6IA 3IJSA 1U8LB 2FJFB 3WO3B 1EVUA 4J3XA 4LCUA 3GUTB 3QXDA 3JTSA 4IIQA 2FD6H 4K23L 4QIRA 5AAMC 1IM9D 3ZE1B 3GRWA 4HYTB 2AABL 2EIKB 2NY1C 1GW6A 4P2YA 1T20B 1J18A 2KL6A 4Q6IB 1L9SA 5IVXE 2XSKA 3CVBA 4UM8A 1O7DC 2BY0A 4WUUE 4D7BA 4F33B 3ALWA 4XO9A 1SOXA 2H7WA 4M4RA 5F7NC 4NUQA 5I18H 1FFNB 1SN0A 1J9TA 4XZUB 3SGKA 1B0WA 2ADYA 2GTQA 1AACA 2J6EA 1PU0A 3QEQB 4NZJA 5F89A 1AYOA 2A6KB 5KG9B 5JHDD 5ID1A 5GZOC 4G70B 3NJGA 4X8CA 4M93C 2XWRA 4K7FB 5ITFA 5TK2A 4YOKA 2JKLA 2D31B 4G6AC 2XDHA 1S7QA 4ZFOL 2WXNA 4WKXA 3MLWL 3V6BR 4RWYL 2H2PC 2QMKA 4JJHA 2OL3B 1FO0L 1X5MA 4ADIA 1JGDB 4TUOA 3D0VB 3KNBA 3HAEA 2EABA 3CLFL 3FSVA 5F21B 5KAQG 4DPCX 4D9QD 3WJMB 5FHBL 3UIYA 3WD5L 5HDLA 4D7PA 4URKA 3REWA 2VXQA 1SM3H 1MJJA 1G7LB 3ABZA 3MLRL 4WJ5B 4QRSA 2DH3A 1BJ1H 2QKIB 4H25B 3LQAL 1VACB 2WQWA 1AG0A 1HQ4A 3UTTE 4LVHC 4BUQA 2VSKB 4U0RB 5EOCL 3VXTA 1K8IA 3HB3B 5F9WB 5MEQB 1EJ6A 4DESA 5FIEA 4PB9H 4Y2OB 5CSZB 3BI9X 1MAJA 2QADB 3WE1A 3SPIA 2PABA 3NFNA 5LDSA 3HMWH 4JFFD 4R97B 3CLEH 1AJ7H 4PWKA 3AWFA 5T1KA 1TQBB 4ODUA 4JQXA 2NSXA 4Z3EA 4IBLT 5FEBA 5DJ6A 1I7TB 4KROB 4L5FE 3QGVA 4UQ9A 4JDEB 3FUEA 1KJMA 1N67A 3WUWA 1UADC 4UANA 3T8XB 3ABLB 4A04A 3BSZA 4OZFH 4PIBA 3WSQH 2FH6A 2E8YA 2Q2LA 3D4GA 3GSVA 3T9WA 1QLRA 2FATL 3ZTNH 1AZUA 3ARED 2EYRB 2RALA 4HFWB 4M56A 2X2HA 1RP9A 1HHKA 3CFEB 3IU3B 4PI2A 3ZBMA 5JLZB 3KPLB 1RIHL 4N22A 5AB2A 1X5GA 3U6XS 3RB7A 2AC0A 4BE6A 1EHKB 5E6ID 3H7BB 2OW7A 1F1DA 2B4CC 2GJ6B 3V0EA 5FYJU 4YXKL 1A64A 3V7AG 4XBGB 2DWTA 3BC9A 4QUOA 2ED6A 4NQXB 1NDTA 3HI6L 2WKOA 5T3ZD 5D1QB 5IFJB 3VQLA 3RJOA 2FJGA 1FGVL 1DVUA 1QRNA 1VIWA 4PJIE 4W9IC 1AO7A 4XBPA 3OKMB 5B3JE 4UINL 1YJDH 3FFOA 3MBEA 2HKHH 2OXHB 1M7UA 5DUPH 4RGND 2B0SL 4ZUVA 4FMFA 1HL8A 1X5ZA 3MJ7A 2EE2A 1A9BB 3DLQR 3FFCE 4KI5C 4LLMA 4PJHF 4AH2A 3HOGA 4OQ1A 4HIEB 2YZ8A 2KQMA 3MZGB 3GHEH 4TLUA 4G82A 2X4TA 5HHPB 3FB8A 1KTLB 1U92B 1EAPB 1ZOXA 1G1KA 1F41A 1NWPA 3BVTA 4QYAA 4V1DD 2WBWB 4WUKL 4B6ZA 4AT6B 5HHXL 4GAFB 7FABH 5DK2B 1BVKB 3OJ2C 1HHIA 4OGAC 1XSOA 5CCKH 1WS8A 1ZA6A 5I0VA 4YUEL 1T1XA 3SO3C 4JFQB 1NFIB 3OSVA 2CJUH 4JLRB 5C0BB 5ICZA 2HT2C 2CKNA 3C6SB 4LIQL 4OKDA 2G5BB 2E76C 5KSBA 3BKCH 2YMTA 1SDDB 2ZYHA 2IPTL 2OR7A 1E3XA 1ECYA 4M62L 2B1AH 2IOMA 5DJZB 2VQUA 5AW0B 3I75B 5E2VH 4JJ5B 2GJRA 5DS8B 4XBEH 1SHXA 2DS4A 3MLPA 2BVYA 1NGPH 4X9FA 5IB3A 4KKNA 4Q0XH 2OYMA 4MZRA 4O2FB 1MCOL 4YHLH 4PUBL 2UXVA 4E9QA 2ADFH 3NABH 2WWKT 3RBSA 2QQNH 2KQNA 4UILH 5T1KD 3QH3A 4Z95L 5IR1A 5J11B 1AH1A 4F15B 4OGXH 3ABMB 3PG2A 2DQUL 3MYZA 4EOWH 2EEBA 4WWKD 3H54A 2ZSWB 4K9EL 1T5WB 4PJGB 5JOPE 1XF2B 5EO0B 4J6IA 4A1RA 3ILEA 4Z23A 2OL3L 5DTFA 2Y5TA 1JPTL 3HR6A 3T8VA 2EH8L 5DZ9A 3U2SB 1T4KB 1I9JH 1A4CA 5INCB 3R7RA 1OAYL 4JX0A 4IBQA 4XMKL 1FVDB 4KO9A 5A16B 5JQIB 3EYUH 2ZCHL 3V0VA 2VKWA 2BK8A 2P8LB 1PYWA 3C6LC 3NA4A 3P30L 4UU9B 5GSRB 5SWZE 3U9UB 1HILB 5HJ3B 3L4TA 1ZT4A 2LFGA 5I1HH 3UJTH 3S3CB 1K9TA 3WIAA 1CURA 2NNXA 1KJ3H 3BIKB 1CI3M 4Q7DA 3ETSA 2PWFA 2K4WA 3B2DC 3D4CA 3IBEA 1YNLH 3JV5A 4TRPL 2R51A 4S2SB 3S9DB 5EIIB 5TE7H 4HJGB 1K6QL 1NGWA 4IKJA 2YBRA 3IK2A 2JQMA 3HC3H 5JHLA 3OPUA 4KJQC 3KBPA 5I0ZA 3L5WA 4QHKI 4F57L 1UH2A 3IDGB 3PABB 4MXVE 1KF9B 3X1BA 1OP4A 3AQYA 3RY4A 4G5ZL 3B3IB 3RIAK 1QRND 3WKML 4K8RD 1NCBL 3AWGA 5IROC 3KVPA 4LDCA 3MBED 4R6UA 4R8WL 2XVGA 3T65A 5IBLD 5MEPA 2DKUA 4R3SB 4E9WA 1Q72L 1Q9WA 4LNRB 4RGMB 1XH0A 1ET7A 5HHNA 1D6VL 1DBBH 3ARUA 4OM0L 4EQ3A 1GGCL 2EXYD 3L16A 4JDVA 25C8H 4KV5F 4PIRF 2WXQA 4QT5A 1U9KA 3T71A 2L7EA 3H8NA 1QTSA 1X5HA 3LN4B 1GIGL 3FUDA 4J3SA 5EBLA 1HAUA 1INQB 2O61A 1PZAA 2NXZD 2NY1B 1CGSL 1KC5L 1TUPA 4R5TA 1SHWA 3U1QA 3JWDC 3NDYE 5DMIH 1OCRB 4C8XA 4L1TA 1KB3A 2R56L 3QHZH 1T66C 1GYUA 3CVHB 5K1VA 1X4XA 4GSUA 5BXFA 1VESA 3MJ8B 2W5PA 3WS3B 2AK1H 5CJQH 1U6AH 2F61A 3BGAA 3CFJB 5HGHA 1T03H 4FG4A 2CDFA 1HXMB 2P7TA 3CBKB 3GI9H 5TGBA 1XB3A 4FD0A 4PY8J 1BJMA 5AOJA 1HH9B 2NQ3A 3UH8A 4NAJA 5CMAA 4JPWH 4M93B 1JCVA 2CNZA 5A3ID 4ADJA 4BFIA 3GI8L 5DU7A 1ZWIA 2VXVL 4A2GA 2E9IA 3BN3B 4NO3B 2Q76A 5KSVA 3SDAA 3D18B 3APMA 1B4JH 1PFOA 3NFPA 2BIOA 3QWQB 4QHLA 5HDBE 1A5FH 3ARZA 3FZUC 4LSPL 2WLZA 5F1IB 4QNPE 3OHXC 3WELA 2XZQH 2GQHA 1SN5A 2R29H 4UTBA 3WHXA 2JJTA 1NPUA 4OJFL 4JZJC 2A7BA 4LF3B 3APNA 5FW8A 4CMMB 4MA1C 3QFGA 5I6XC 2G3ZA 3CZSA 1CFMA 1LWRA 3T2LA 2J1ZA 2AQSA 1CDCA 4KDWA 2Z7UA 4KJPD 1NGZA 2GCYB 2YPVH 1KB5B 3HVDA 5T5FL 5F7UA 2QLVB 4MAZA 3WXVL 3WNOA 1MAML 4TNGA 5GS0C 3NCXA 3V5KB 4UDTA 3ROOB 1QNIA 1PZCA 3CDGB 4QXUH 4NWUH 1RP8A 1C5BH 3F7VA 4FFZA 5EUKA 3GTNA 1J05A 1URIA 4FTVB 1E28B 1LO3L 2J8UA 3QJHB 4N8PA 1S7RA 4GBXD 4XNBA 5T33L 2ILLA 1G7JB 2A6JA 3S35H 4OZIF 1I85A 1QR1B 4NCC1 4NM8H 2G2NA 2YMOA 3MA9H 1SY6A 1MFAL 4HK3N 4DK5A 4U1MA 5FKPB 3WS6A 4KX8A 3CNKA 2DIBA 1DVYA 1OAQH 1TTBA 4P2RE 3GS4A 3S36H 2MIZA 2XZAL 5BQ7B 2N0KA 1N2RA 1KV3A 4HUMB 2Q86A 1F4YL 3GXIA 2BJML 1A4BA 2XY1A 4LPYA 3ALXA 4RAVA 1N6QL 1O5PA 4ELMF 4R4NC 1BWMA 1MFUA 3KDPB 1VERA 5JQ6L 5D4IA 1IVLA 4WFFD 1GSKA 4LVEA 3POHA 5BO1L 1BYNA 2X89D 4F1ZA 1FDLL 5I23A 4LSSL 2R0WH 2K6WA 4MQSB 4QRPE 4BH8B 5EF1A 3O4LD 3QO1B 3BKML 4JG1L 3IKKA 3PJLA 4NNPL 3LS4H 3IJYA 3GMLA 2AJ3A 1RFDL 2OULB 3KMDA 4KZDH 1W0VB 3SO5A 5E2UL 4BCZA 4YDVB 4J23A 4JN1L 4IBVA 5EPMA 3IXAA 4QOKA 1E67A 4XP1L 3SE4C 3PNWA 5I5JA 3PY9A 2BZ7A 4P9HC 4EEEA 2EDQA 2QZQA 1P53A 5EUOF 5KBNC 1UKSA 5C08E 3EXLA 1CL7H 3UERA 4WTXA 5AW7B 5EH1A 3LRLA 2OSLB 3TA3D 3E6HA 4UZSA 4W9ZA 1F6FB 4J8RA 2B9AA 1OQOA 2EQDA 4U1SA 2OMYA 2AJYH 1RZQA 4HPYL 5A2BA 3T6VA 3BQUC 5EU3B 4ZJ9A 3FT3B 3ESUF 5JPMC 4WI9A 2P26A 2LABA 3LPWA 3MXVL 4GAJH 3SDAD 4F7CB 3HZKB 4K5MA 2KUTA 3ZL4H 5FYKE 5ESVB 3GBMH 5T1MB 2A6IB 4PJDA 5LXGH 5DR5L 5E8NB 2DYRB 3MXWL 4N0YL 1GPOL 5GGSA 1ZHBA 3SO3B 1JHKH 3SDDA 3HS0C 2FIKB 3G08A 3FCTA 3VU1A 2GBTA 1UUNA 4D8PA 4FQJH 3LEXA 4LLUA 1BP3B 3K72B 2UXTA 4JMNA 3VH8G 2EUXA 1RJZB 1QR4A 3CVHL 3GSRB 3SY0B 3VXSB 1XF1A 5HYSG 5E5MA 5L2JB 4J39A 1IQDA 1XGTA 4U3XA 2VABB 3MSPA 4Y5XA 2XT1B 5A43C 1JVKA 4GSRA 3OKKA 3OZ9L 2JLPA 4AMWA 4MQXD 3MZTA 3DIVA 3FTWA 4L8CA 2NUTB 4Z76B 1TIUA 3U36B 1SUHA 1OANA 5EEXA 4U1LB 3I2CL 1KJ2A 3OWRA 3GJFB 5FWRA 2MQCA 1SF5A 4PJHE 4Z7UE 5CJ5A 1F1AA 3JUZA 3L3HA 1G7MB 3EGXB 1GCYA 1A1OA 3FO9B 4P05A 3S2AA 3T8MA 4CVXB 3PAUA 3ZKMC 2AI0L 3D3VA 1FLTX 4RSYA 2X1QA 2LQRA 4MA8L 1UM6L 4FNTA 2NW2B 2DLEA 2WB7A 4I0PC 4L1HA 4TTDC 4CA4A 5AAWA 4LRNL 4OLEA 4JPSA 3NJKA 1GYWA 5T8IA 1UCBL 4NKMB 3US0A 3T2QA 5FWQA 3BZFA 4NM4H 3C6LB 5IB2A 4X6DA 3ARBB 4EN3D 4DIXA 4FQCL 4ZO7A 3ME0A 4JCMA 4X4XA 1Y7VA 1XF4A 1KB5L 2VDOB 2ZKHH 3CFMA 4N86A 5I8OH 2BP3A 5EN2B 1O6TA 2WHVA 4NCC2 3TO2A 1D5XB 4UV7L 3RVWC 1MCSA 2IADA 4N0CC 5CWSA 4R4BA 1JBJA 1EDYA 4YHIA 2DPKA 4MXWH 3UBXB 2UY6A 3LXUX 4OD2A 4Z0BL 1IT9L 3FKUS 2ZOKA 4LEOA 4KJYB 1D7DA 1QPXA 3Q2CA 2ZUSA 3DRTA 3UYRL 1UACH 5DHYB 4HWZA 1VGKA 1RPKA 5GHWH 4WTWA 5ADOL 1FPTH 1S78C 4YLCA 3OVUB 3MNVA 3BOVA 3M17B 2EZ0D 3O4OC 1XGQA 1NDGA 4UOW0 5DLLA 1YMHA 4NN6C 4PAZA 2VR4A 2ZWNA 1JCKA 2BVEA 4KXBA 3ARDC 4LKXA 3W2DL 3LIZL 5EDSA 3EADA 1A66A 2FSEA 3LHAA 4TXVB 3CVDA 1LO2H 3K0YA 4OCLC 1Z1WA 4LCYA 3S3SA 3HRPA 4MDIB 4PR5A 3H9YA 3LXCA 5JUEH 4U6TA 1WHOA 5DWUL 4N9GA 4ES9A 4M5YL 2B4CL 4CJ0A 4ZMZA 3WMPA 6FABL 3WFHB 3VFRB 3VQ2C 4TNWF 1ET8A 3QEGL 3MUZ1 3ZMEA 4HW6A 2E6PA 1KIUB 5IVOA 1EHXA 3LSOB 3VYPA 1U2YA 5IMOB 1WRFA 3VA6A 5D4JA 1TTUA 4YHPB 5IGXL 1VEOA 2KLRA 2APBA 4UOJA 4HFUH 4HBCH 3G04A 3NZ8B 4KNTA 4X8JA 4K3DH 3SOBH 1KY7A 4GI8A 4OUUB 2Z35A 2C9SA 3RX5A 3VTMA 5I30L 1RZ7L 2VJXA 2CUMA 2XETA 1YCSA 3HC2A 3KJ6L 3QIWA 4JZNB 3JUYA 3AAZB 1XR8B 1BOYA 3KPQB 2P5WE 3OHXB 3RWCB 3CFCL 4GP8B 2ZXAA 3GEFA 3ILPA 4IRJC 4JZJB 3L3KB 5I6XB 1N12A 1O6SB 5IIEA 4G83A 1KG0B 3TVMD 5CD3A 3NP3A 1TU2A 5IESL 4PJEF 2WJ7A 3VI4F 1DQKA 1QSZA 1JK9B 3PWVB 4XAWH 4LSUH 5B4MD 5TQ0L 2R83A 1RIVH 4RISH 1MG2C 3NJHA 3SE9H 2IANB 4HAFA 2MQ0A 3TBWA 4OJDH 4ZUUB 3RWDA 2ERJC 1OAJA 1S9KC 3QZNA 3ULUF 2AFNA 4GXVH 2AF2A 3QUYA 1REIA 1BWWA 4LSDA 2B59B 2F8VA 2UWEE 4DTGL 4JRXA 3NCWA 4MA7L 2BPBA 2WXFA 1TCRB 3IPFA 5DQDL 4F9PC 3SGDI 4QKTA 1E42A 2FHCA 4P5TC 1FYTB 4CC4C 4JKPL 5C3IA 1W80A 4LLVB 3T4AC 2CLRB 2YGOA 5KWYC 1KCKA 1QHQA 1CXKA 2F19H 3DJZA 4K71C 2MPVA 4U7KA 4IDJL 4RNRA 5AOMA 2E4FA 2EIEA 2W94A 2Y4SA 2ZCKH 4TNWK 4XMLL 1IKFL 4Y8DC 3DJTA 5LLIC 2RAMA 1LYQA 1V7NL 1E9PA 3H7LA 2B5IC 5DJAA 3GMNB 3KS0H 1NMAH 2VLLA 3HMXH 4I18C 4R83A 3EBHA 4W93A 1PFCA 1CFSA 5D9SB 1NCAH 4K4KA 4BQCA 4YHNB 4WGKA 1UWGH 2LU4A 4IIZA 3IWUA 4FXGA 2MHAA 4GT0A 3PE9A 1OGAB 5E1IA 1H3XA 2RMNA 3KYNA 4M8VA 3D5OF 3L3GB 2VDOL 5BPPA 1W6WA 1UA6L 1WUZA 3WFBH 4QHNA 2XU9A 4FKKA 1AOHA 1PKQE 3BSZH 3SBPA 3QWRA 4P57B 2DWXA 3WTWA 3OF6A 3FCSA 2XTJC 4MSWB 4F5CA 4QWWD 4QXGH 3Q3GB 1D5RA 2DB8A 2H3NB 2A0LC 4AQEB 2BNUA 3C60D 4OZIE 5EORL 1I1AA 4PJBA 5K9KB 4W4OC 3U4KA 2ZXCA 4IBZA 3GBEA 3MLTB 3W9EA 3VXRA 4JO1H 1J5CA 4JCLA 2BIPA 1N26A 1T0PB 5D7IF 4RMTA 4HCIA 4YSUA 2GB2A 2YAFA 4OLVL 5JPMB 4X7TA 2JVUA 2WQSA 5EF2A 4AYEC 4E0RB 3CXHK 4XTRD 4E41E 5DD5H 1AD0A 2WPGA 5AZ2L 2DMKA 1IBGH 1MWAH 4ELME 1YEIH 3QIWD 4H2AA 1S9WB 2ADJB 4O02A 5DHDA 1OTUC 5ESQA 1IGMH 2CIKB 3NRQA 3MRIB 3BP7A 3EG9B 3CXDH 4KRPD 4I5BB 5TF1L 5F7DA 3IAPA 3HS0B 1RUAL 4K8RH 1S9YA 2W07A 3KPOB 1HEZB 2OMTA 2BSED 2EDBA 3G5YA 5HVFB 1CD0A 1EAOA 5DVOA 4PQXA 3RWIA 3JWDL 3MNZB 1EV2E 2X2IA 4KTDL 1B0RA 3EUUA 3PCYA 1JNLL 1Z2KA 2CO4A 4IOIA 4HHWA 1BOGB 1UH4A 2P4AB 1I7UA 2Q3AA 4MDJA 3BE1L 2XBZA 4KQ3L 2FZ3B 2X9WA 5L2KB 5ISZB 1E65A 1ZLEA 3KPMB 2XPGA 4LOUD 3MACH 3MQIA 3MV8E 2BM3A 3QUYD 4QXTB 5I8KL 2NYKA 1S7WB 5TPWH 1U91A 2VAAB 4WNSA 3M1BA 5F7KC 3KG5A 4KQ4H 2BOCB 2V8LA 4XWGL 4TQEH 5H94B 1DYZA 1E9OA 4JPVL 5DD0L 5CCJA 1BYPA 4H1LA 1NFAA 4M6ML 2XQYG 1AD9B 1CIUA 4TNVF 4OFKA 2HRPL 1TQCC 5CP7B 3FQTA 4I0PB 4EJ1C 1OPGL 5DFTA 2EC9T 3TBSA 3N85L 5HVHC 4I13B 2D73A 1QSEA 2Y9RT 1THCA 1M9SA 5I24A 5JW3H 1JTTA 4EUPB 2QSTA 2BRQA 4ZOAA 1TVHA 3AS0A 2NTFA 4KRLB 2OA9A 3T2NL 4M4PA 3B34A 2X12A 3W9DB 5GS0L 1LO0L 3B2UC 5CLXA 1JZ5A 1G6RH 4Y1AE 2YAMA 3FTZA 2XVKA 4X6EA 2BWIA 1COBA 3EZJB 1Z9LA 1C16A 5DO8A 4AGPA 2OR9H 4HUXA 2C5DC 1QLEB 1LNUB 2EH7L 3VDBA 2MKWA 3DUSA 3IRCA 1ASPA 3VE0A 2H1PH 3OF6D 4NYLB 4LSVL 4LASL 2FE0A 4E2OA 1WD9A 3A67L 4IGBC 3WLBB 3QUXC 2J7LA 3LPOA 1I1FB 3UCQA 3PF2A 5F9AC 3RWJA 1BVLA 2R69L 3ZZQA 1I1AD 1RSYA 2ATKB 3NIGF 3O4OB 5I66A 4HKBA 4A2FA 1IEHA 5F97E 4NN6B 1CLOH 4CSTA 2ARJB 5EEZA 2G30A 2BZCA 3DGGB 4MNQB 5D93C 2R1XA 3ARDB 3BZ4A 3L1OL 2CPUA 1NOAA 2QEJA 1GKOA 3EH5B 3BD4A 4WFGD 1QLFB 4AEHL 1QOKA 2A99A 4HCRH 2VXTH 1FZOA 1EDQA 1MHPL 1MJUH 3B4NA 1FNHA 3KPSB 2J1YA 4NFDA 3L7FA 4D0DA 1GOFA 2AQ1A 1NWOA 2HRGA 2RBLA 5GQBA 4L3EA 4LAQL 3MRPA 5CD5D 4WF7A 3D0LB 4NO0D 2AJSH 3AFLA 4MMXA 4EI6B 2I25N 12E8H 4DUXA 1FJ1B 5KS9F 6TAAA 3KYAA 3QCUL 4P9HL 3BVXA 1UXWA 1HESA 3CK0H 1IBYA 5DHXB 5KJ7E 4HMDA 2ED7A 3PWJA 4NB7A 1T1WA 1BZ9B 5CEXB 1YNTB 5A2LH 2Y6TE 1P6FA 4Z7VF 1HKLH 3E9TA 2EIJB 2PO6A 1FN4A 2OCFD 2WXLA 1FZMA 2JB6A 1URLA 4R0LC 3SDYH 5KYWB 3TIDA 1WSST 4Z0XA 1A7OH 3FO2B 3UPRB 4HU2A 4F8LA 4HP5A 5DFWH 4AENA 5EIIG 4MJ5A 2AMGA 4XCEB 4APXB 1AVAA 3P3UA 1CS6A 3UZEC 1Z0NA 3QR2A 3I6GB 4KHXL 3EO1B 4IRJB 4Z78A 1M6OB 2XV0A 5IJCC 3ULVD 1N10A 2XBTA 3VSUA 1S7TB 1L9PA 1AY1H 2WQRA 1BIHA 1DQVA 1RI8A 3Q2WA 2YPLE 5C0CE 4U1NA 1NCIA 5FOJA 2ZOWA 3TJEL 1UXSB 4ZDHA 1I8LA 2ZOTA 1F90H 1MKFA 2V0AA 2VLRA 3I84A 5ALBL 5DQ9B 3X3GH 4EI5A 1QSED 5J3HD 1I3GL 3VYNA 5JHMA 3F12A 3CSFA 5HYQB 5AB1A 4M7LL 5TE4L 5ICUA 4LSTL 2ERJB 3WNIA 3MRBB 2APFA 2FVNA 2XIDA 3AG4B 3OM3B 3IGUA 4BHUI 2BVQA 1N5YL 3QDGD 3QZWB 3EIFA 5GIRB 4PGCA 4J2QA 4F2EA 1Z5LA 4U1KA 1B88A 3GGWB 5CLYA 3US9A 4K94H 3H9SE 4AEFA 1C08B 3FNKA 4GOSA 1U8KB 4MA3B 1M7IA 4HUWB 4QRRA 1XSIA 5IB1A 5LQBL 1J1PH 1H0DB 2ATPB 3L3DB 2A9NL 1BZOA 3BN9D 1MFEH 4P5TB 1G0YR 3Q9PA 1P9MA 4JDZB 4NQVA 3T4AB 4UT7L 4OLZL 4FHJA 3P9MA 5H37G 5JO5A 1A7BA 2NT0A 4O4YH 1CK0H 1ZY9A 5A6IA 1D7BA 1PEWA 4K71B 1U8PA 3OJDA 1ZHLA 2NT1A 4G6KH 4MFHA 4OZFB 2FEJA 5TQ2H 3TX4A 5FYLD 2KDYA 1BFSA 3LY6A 2J5WA 1EJFA 4YR6B 2H4EA 2NMSA 2VLJD 2YJLA 3MNDA 5I74C 3HI1A 2ZCLH 2B5IB 4L4TB 3MR9B 1TJGL 3ZYIA 1IBHA 4GNKB 4I18B 2Z7ZA 5ICXA 2AANA 3NJIA 3RURA 1TFHA 4AZ8A 1SBSH 2VUKA 5TH2B 4FG2A 4GQ9L 3P9WB 4S1DC 3EJZC 3MRMA 4PJEE 3VI4E 3UJJL 1KPVB 4WU7B 4ZMOA 3VD9A 3OD3A 4PRHA 2WAHA 1RJLB 1RJYA 1YMMB 3FBQA 4C56B 4L3ED 1AI1H 1Z5YD 3TEZA 4KK5C 1FHNA 4EXKA 1DBMH 3UC0L 4ECNA 2XTJB 1S8DA 5HPOA 3ULUE 5BRZA 5TTRA 1NCUA 1P4BL 2E56A 1QLEL 1T7ZA 5CZXC 4PTUA 2FECI 2Z8VC 3MLYL 4DN3H 3WIFB 1AZBA 5D2LE 2J6WA 4YE4H 1NOFA 4AQ8C 2BOBB 2W60B 2DQ6A 2EJ1A 2QVKA 2NXYC 3MPCA 4GP5B 2PO6D 4GW4B 3MMEA 1M2VA 5DSCB 2Z93A 5I1KL 1CBVH 5AYTA 3ZHDA 4OGZA 1FUNA 3W0WB 3BPCA 5HY9A 1D5IL 2W1NA 1HFUA 5D7JC 3QBTB 3SPJA 4YO0B 2CHWA 5HHOA 4GINA 4ADGA 3B2VL 3U48A 1SYSA 3FTGA 4YZFF 4BZ1L 1Z9NA 5EOQH 2ICEA 1II4E 3B1UA 3RJDA 1EO7A 1Z3RA 2W80C 4XZ4A 5FK9A 1OW0C 2ROYA 3P2DA 1CBJA 5D7LB 3OXSB 2DY2A 4HUVB 1HXYB 2FD6L 2CHNA 3HW7A 5HPMA 4RRPA 2HLAA 1CDYA 1KGUA 3L4ZA 3MFFB 4WUUD 2EXWD 2X9XA 4XPGH 2ZX8A 4PJIA 3FO0H 4AKPA 4ELKA 1HYRC 1KEMH 2QSQA 1MRCL 1OB0A 3EHBD 3O6FA 2AKRA 3CDFA 5I18L 5FB8B 5LKNA 3FFCA 4H4NA 4XRCA 5A7EA 3R0NA 1PZ5B 2H32H 2YS4A 1F3DJ 1PMYA 3QHFH 5ACZA 1GXEA 4XHJD 1LK2A 3IE9A 1YPZA 3ML8A 5T1LD 1KIPB 1P7QA 3I9PA 3NN8B 1WEJH 1UZ8A 3VXPB 2QDWA 2EDJA 2AHIA 3RVVD 4HGWA 5D7IE 3GMRB 5I0WA 5DD1H 5I28A 1EO8L 2VOTA 1TQCB 4U3SB 5HI4C 1OIOA 4KX9A 1ITCA 1MQ8A 2XWXA 5HVHB 1EMTH 2X4UA 1TQUA 4NQSB 2F7PA 2EINB 3EYFA 3ULSA 3K6DA 1YAIA 2NTSP 4H8HA 1SM3L 5AVYB 1EHLH 1IFRA 4LCWB 3HLAA 4ZFGH 3UTTD 2O6EA 2ICWB 5I76B 5IHZB 1DSYA 4WEBH 5HGBB 4GRMA 4P07A 1NC4A 2BO0A 3LNIA 4P5KA 4C59B 3P3SA 2ITCB 4LRIC 4MQ7B 2V2XA 2ZICA 2W95A 4PB9L 1T1ZA 1NC2D 1YY9D 3D08A 4N9OB 2DQJH 3D06A 2A38A 1AQ8A 3F6JA 1I3UA 2FX8H 1PZSA 1U8QA 1BEYH 2FHBA 3HMWL 3IJ9A 3CLEL 1AJ7L 5CJOH 2DJMA 5DUMH 3WHE1 3MRNA 4FQXA 3TP4A 1JYVA 2H1XA 3HE7D 3M7OA 5TF0A 4K3JL 2E0PA 3NCJH 4GSDH 1XEUA 3VXME 4F7EB 2YSSB 1VLXA 1T83A 4H8PA 2E3VA 3IDYC 3HPLB 5D93B 1E4KA 1XD1A 3DXAA 3WSQL 5SWZA 2V9TA 1XSKA 2LU7A 2BFVL 2BRRH 4XNUH 1G9MH 4BWUA 3ZTNL 5I8CB 3Q9QA 4RAUB 3B8YA 4UDUA 4G9DB 1B0GB 5AYUH 1G87A 2UY7B 2Q7YB 4JS7A 4L3AA 4F2MA 1LLAA 5J1SC 2ZIDA 4L1DA 4XNZC 3TJHD 2D4DA 3SBWC 5INDB 3IF1A 3C08H 2ZX9A 1XSJA 2K3TA 4J3VA 5B8CC 4Y4KC 2DI8A 3JWNE 2LU3A 2C8NA 2XY2A 4FNLH 3B5HA 4JM4H 1MEXL 5SWQA 1LHZA 2E27H 5J9PB 1IO4C 3WIIH 5EU4A 4HOWA 2XWCA 4YVNA 2XYCA 3DBXB 2HCZX 1R5WA 2GFBA 1AQDB 1XCTB 5JXEA 1M1SA 3O6FD 1R46A 4R0LB 3FFCD 3LVTA 1M53A 4LLAA 2CCWA 4HS8H 4WDIA 2HKHL 4UBDD 3RLSA 4NKOA 3VNZA 1KXQE 2DBJA 4PJFB 1P7QD 1E5YA 3RL2A 3GXTA 1X7QA 4JM2A 1GH7A 3NIGE 2A77H 3GHEL 3DDFA 4W6XB 3UO1H 4URTB 3RPKA 4BD4A 4N6RB 2GY5A 3BQVA 1QI4A 5F88B 4APQA 4WJG3 3CAFA 3HG1E 3T3MB 2EVHA 5F93C 3DUHA 3FCUB 3QDAA 7FABL 3SGKC 4HALA 4ORGA 2PR4H 3CDZB 3QWNA 5I8EB 3T08A 4RGNC 5C0JA 3V4UH 5C07A 1QBBA 5K9OA 1ZVSB 2CJUL 2QVFB 2YQBA 4L4VE 5ERWA 2GSGA 5FM5M 3FRUB 1XH2A 1R3KA 4L1BA 3KD4A 3FOLB 5F9DC 4G42A 4PJ8C 4PRPB 2B1AL 5L8LB 1NC4D 3WUZA 3WNLA 3LZNA 5BVJB 3PNRB 5KS9E 5GXBB 3KYMB 5E2VL 3BZEB 1NCDH 1PAZA 4IS6B 4XBEL 2Q8BH 1SHMA 1BF5A 1INEH 3CN3A 4I9WE 1SLVA 3WIHA 1NGPL 5FA3B 2JF1A 4Q0XL 5CM1A 3ROLA 4H8VA 2DW5A 4FA7B 4Z7VE 5D1XE 5C09A 4YHLL 3FN0H 3LH9A 2ZG2A 2QQNL 3B9EA 5JOPD 4O2CB 3GDCA 2DYSB 3N1MC 4OGXL 4EOWL 4FQXD 1CFBA 1CF1A 1JUFA 2VZVA 5ECJE 2J73A 1FL6B 4PS4H 5C0GA 5I74B 3O8XA 3E6FB 2NY0D 4AW7A 4ZQKA 3NTCH 3WNKA 1U3HA 1SJHA 5L4FA 4PTTB 1IE5A 1JI2A 1T0OA 1SVZA 2JCCA 3MRKA 5SWZD 4G7YH 3A24A 4GKZA 2MFNA 1SN2A 2L7JA 3FS9A 5J6GB 4ZO8A 4JQXC 2HJFB 1T0NB 3M88A 5B1CA 4D0BB 4WWKC 5I1HL 1N8OE 4MB1A 3UJTL 4XP9H 5FGCE 1KJ3L 3ARQA 3P0VH 5IOPB 2ED8A 3JYCA 4AIZA 4XBMA 1YNLL 2EEFA 4GKSA 4JG5A 2NUPB 3V0HA 5TE7L 2UZIH 2UYLB 4PJ7F 5IB5A 2CO7A 4RVBA 3D07A 1QG3A 5HVGB 3HC3L 2DKSA 2N1KA 5DJ2B 3WYRA 5LAPA 2HZHA 1MWOA 5GZNA 3C5ZC 5FO8A 3LRGA 3FTXA 4N8VA 4NPYB 3UDWC 2NXYB 3FU9A 5JXED 5TDPB 2KHAA 2V5SA 3MLZH 4XNQB 1FH5H 4MJIE 4BFGA 5D7JB 3DV6A 4QRPA 1HHHA 3GXPA 5G4MA 5AEAA 1ICTA 4Z77A 2Q2EB 4JM2D 2M1KA 3CGTA 4WW1B 1DHKA 1DBBL 2YD8A 3F8UB 2P5EE 1XF3B 2J44A 3U1PA 1BMZA 4HKZA 3UO8B 4RBPK 1DBJH 1LP9A 3O3EB 2O5XL 2JKSA 3MRGB 4K8RC 4PJ5B 4G8EB 5F1KC 4CSSA 1XXDC 2EC8A 5TK4A 2W8CA 2OTUB 3MBEC 4FXLA 1OP5H 2GEEA 3ZTJH 1WS7A 3MV9B 2GVYA 4KX7A 4HH9A 4QO1A 2E4TA 5DMIL 1OD7A 4V2CB 3QFDB 5D4HA 3QHZL 1JZJA 4WO4C 3NIDB 1BD2E 3KYOA 1C1EH 2K6YA 5ID0B 2WLLB 1R3HA 4Y1TA 1XO8A 2AK1L 3MBWA 4N85A 4K9JA 2V17H 5CJQL 1NOLA 1U6AL 3BPLC 1N3NA 5SWSE 1T03L 3LVEA 5IY5B 1SXZA 4L29A 4U7SA 2IMNA 4I87A 4K55A 2APVA 1IM9B 1JN6A 1GJUA 1ZS8B 1BLIA 3LKOB 4HISA 4U6XB 5B39G 4R2GD 2NXZC 7PCYA 2P8PB 4JPWL 4NKIH 1J12A 2WQXA 3VSTA 1U58B 2Z7YA 2VISB 3AQXA 1ETZB 1KNOA 2X1WL 4R96A 1B4JL 2CR3A 3HUJF 2X40A 3TBVB 3QUMA 3BJLA 1DJSA 3SDXA 5C0IA 1A5FL 2F7QA 3POCA 4OD1L 1XAKA 4OCXH 4P06A 5JHDB 2XZQL 4X6CF 3ARGA 5KYXA 3O8XD 4OIBA 4Y88A 4YZFE 1QVOA 1E6JL 2VXUH 4N0UE 4OI8A 1I9RH 5A3IC 3QJQB 3MJWA 3NCYS 3KLSA 5F9JA 3WBDA 2Z9TA 3ZDXF 2DQIH 4KY2A 3CQFA 4MLIA 4AMXA 3MDJA 2YPVL 3B2MA 4HX1B 1FVEB 1J9QA 1RCYA 1UD6A 3T6XA 1TKWB 3M8OH 3W38A 4TLKA 4NZTH 3H6AA 4QXUL 4NWUL 1C5BL 3FB6B 2X88A 3TL5A 3H56A 4F3FA 2TRYA 2D03H 4NQQA 1FNEB 4DZ8B 2VL5B 4NQDA 4UT9A 4JR9L 2EKSA 3S35L 1BEXA 1W0YT 4KJPC 4NM8L 4XWOC 4Z7UA 4P2RD 2DLTA 4RGOH 2BX5A 3DPBB 4ISVA 3JVGC 5F7BA 3SJVE 1JYWA 1OAQL 1RMFL 3S36L 3AJ7A 3T1FB 5KJRH 1ZHNB 4OFVA 1DJGA 1H3WM 1V54B 4TVSa 2EYSA 4B41A 2B14A 3IDYB 2YC1A 2X6AA 5IW6B 1O5DT 4GBXC 4Z7WF 3LKPB 1KTKE 2C9XA 2ZKYA 4QRPD 4U0QB 3SOTA 2QSVA 1WAAF 1J5DA 4TQ8A 5ILTL 5AVXB 2R0WL 3Q1EA 1Y1UA 1RUKL 2FEEL 4NENA 3C8HA 5T3XE 3QRBA 4AXWB 4XNZB 2CHXA 4NFCA 1E5BA 1W0WB 4RIRB 5B8CB 5EU5B 3CSYA 1HS6A 1OB1A 4Y4KB 2DAVA 4MD5B 4Y5VB 2AXFB 1URZA 5FYLH 4XH2B 2XIBA 1KT2B 3DA0A 4CBZA 4UQ2A 5C08D 1KGJA 1FORH 4OF8A 3N2JA 1DE4A 1JV2B 1BZQK 2VR6A 4PRIA 5JORB 3LRMA 2M8XA 1BAFL 1A6VH 3CXHJ 1YEHH 1CL7L 2PETA 1VFAA 2WKGA 2P24A 1WWWX 3F7PC 3OR7B 3IJSB 2CLZA 4X5LA 1WK0A 2ZYSA 5IOKA 5HHME 4ZAKD 3UTZA 5KBDA 3VFNA 1TLMA 2KKQA 3Q48A 4IK7A 3JTSB 3UTSA 1JV5B 1BPLB 1KN2L 4YSDA 5F9OH 5GGUA 1UEMA 3DX1A 3OZLA 4XE0A 2D3VA 5TDNA 1KPUB 1PAMA 4Z5RA 1RHHA 5J1AB 2FYYB 2AJYL 3HHRB 1KZYA 4J3OD 3PDDA 3H1ZA 4JFWA 5FYKD 2XWJA 4IRSA 2VWEE 4JFPA 4OTXH 4QY8A 2CSPA 4GAJL 5FM8A 3FPXA 5IJDC 4PHZA 2VW7A 2ZUTA 4PY7B 2DQTH 3ZL4L 5FS5A 4PJFF 2J2ZB 4JHVA 4TQPA 3TA3C 5LXGL 2J72A 4P3DA 1RZIA 4XO3A 3BO8B 1I31A 4RGNB 4PVMA 1U21A 1BX2B 3ARGD 3QFJA 2PXYA 3V0JA 4GLRI 5CEYA 3DX7B 3VFTB 1JNHA 1ODUA 5A2AA 5AW4B 3ZE2F 4IJTA 4IQHA 2B7DT 4WCYL 4FQJL 1S7QB 1HI6A 2HH0H 2ZD0A 1NIFA 4PJ8B 4V1DB 1HDMA 4M1DH 2MOGA 4K5OA 1AKPA 1YEDB 4H0LC 3KHOA 1Q1PA 3KNBB 5HTSA 3CE1A 1UCTA 4FXKA 4ZW7A 4ZZFA 1SMAA 3F01A 43C9A 4K94C 3QXAB 3BRDA 4J5VA 3ZE0B 1SOSA 4FJYA 3CHOA 4G11A 4KY1L 3A6BH 5MERA 2AQPA 4PJCA 4G8FB 1F4AA 2P5WA 1MHHA 4I2XA 5CHNA 4IBWA 1DN2A 4TSCH 2F0CA 3KWWB 2Y1AA 1BW8A 3FOMB 1IU1A 1MCRA 1WVZA 4LOVA 5LGYA 3IMBA 5L7XH 3VXTB 1FNSH 1R4XA 1I4FA 5IP4A 2C7UB 2AEIT 3L4WA 2CXGA 3CHQA 1RZGA 1LEKB 3IWVA 4MQXC 4WHDA 2OAAA 3D69A 1HCZA 1R5IA 5T1KB 1I85C 3KZ8A 4NM4L 2WP3O 4LPUA 4QCIA 4WWKB 3GQFA 4K15A 1NEZA 2VIRB 2ZKHL 4XCYB 4Y9BA 5I8OL 3QAQA 5IT2H 3FYEB 3K6SB 1DJXA 3BP6B 2UWEA 2FDBP 2CHDA 4JRFA 5JR1H 5GGQH 5DMKB 3G6JA 3P02A 4TL5A 4WW2C 1X5LA 1Z9OA 4OM1H 4GFTB 3ZDWA 4FRWA 3DRQA 4MZ2A 5F44A 5EU6E