3UP6A

Crystal structure of a putative cell adhesion protein (bacova_04078) from bacteroides ovatus atcc 8483 at 2.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
324
structure length
322
Chain Sequence
TRAQLSIDLVNNVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483] (ZP_02067074.1, SP17169A, JCSG 417104) from Bacteroides ovatus ATCC 8483 at 2.80 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
molecule keywords hypothetical protein BACOVA_04078
total genus 73
structure length 322
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A01
2.60.40.3380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A02
5DHMC 4RDBA 4JRFA 4GPVA 3UP6A 3R4RA 4JG5A
chains in the Genus database with same CATH superfamily
5LBSL 3US0A 3R0MA 4UNVA 2R0KL 4ODHL 1ZOXA 1MJ8L 2LAGB 4CN1A 3H9SB 2MCPH 3CFUA 1FL6B 2JXMA 2VQTA 4P46C 4U1KA 1T20A 3APMA 5EEXA 3EJTA 4IDLA 3T71A 3U1SL 3NZ8B 4F9PA 3KJ4C 1KB5L 4UIMA 1JFQL 2YPVL 3O4OB 4G6KH 3D2UB 4L1TA 3K46A 3LOWA 3O45A 4ZFGL 3S8GB 2DQMA 5JHDD 3GBDA 4QRBA 1UD4A 4V33A 5DRWA 1IQDA 3MCLL 4A2MA 1JERA 4BSWA 2OTPA 1CVRA 5T5FA 4GP8B 2H1XA 5HHXL 2VM9A 3O2WH 4CVWA 2HVBA 4WHDA 5DJYB 3TASA 2QLYA 4KHTL 5KW9H 1E4JA 3MJ8A 5BZZA 4I18B 1QMUA 4X7DC 2IOIA 1ZLWH 4AI7A 2VXVH 5ICYA 2ITDA 3F5WA 5FO2A 4G80A 3IFLH 4G6AC 2R1XB 2BVEA 3VFUB 2V17L 2AMUA 3RTQD 4K3HA 4HUVA 2B5IB 4PRID 3DOSB 2WBJB 4DGWC 3O2VL 2CHWA 5E8DH 1T4WA 4KKLD 2WKOA 4QTHA 1UH4A 3H6AA 1UT9A 2PTTB 1EZVY 1LGVA 1Y1DA 2YZ8A 4PGBA 3KH3A 2OFQA 3NP3A 1MFBL 2H1PL 2OTWA 1YEFL 2BNQA 2IDFA 4L8CB 3V0GA 5I8KH 4JN1L 1OAUH 1A8ZA 3ZTJH 1WTLA 4AUYA 1LILA 1RSFA 3Q8CA 1GOGA 1C1EL 4LNVA 5DRWB 3TBSA 4Q56A 5BMFL 3H54A 1V7MH 3SDAD 1NTDA 2XN1A 3IDYB 1BJMA 1BQRA 1PZDA 4XAWH 4NS0A 4F7CA 1FNLA 4P9HC 1MLBB 1T3FA 2NNAB 4KUZL 2DKSA 1RZ8A 3BD3A 4MA8H 1NFDE 1G43A 5H35B 3F6JA 5E6YA 3LZFL 2O26U 3U79A 3UZQB 2X4OB 3EGSA 2BVQB 4JPKL 3S35L 4QTHB 1Q94B 4Y4HA 4XCYA 2WBJA 4PJFB 1FQ9C 4AW7A 2JLLA 4LVNC 3ZQXA 2PO6B 2K6YA 5EZIH 4LBAA 3AG2B 1E5AA 4B27A 1SXZA 4MS8C 1V3MA 4KRLB 5H94A 5LG6A 2PR4L 4ORGB 4YGVB 3ZTNL 1YEFH 2MKWA 1WGOA 1YMHB 3X13B 4JJHA 4FE9A 1DBAL 3RDTA 2VMDA 5LQBL 4HGWB 3A6BL 1NC4A 3AAZA 3ESOA 3OAWA 2EIJB 1ODAA 3CIAA 5IW1B 2EXTA 4OIFA 1NGXB 4OY9A 2NYYD 5HPOA 5DHEA 5DHDA 4DCQA 4PJ5D 4EBQH 3S34H 4Y5YB 5HYJA 1H8LA 5D72H 1TMQA 1QHQA 2OM5A 1TTFA 1RLBA 2DEYX 1SOQA 2XPGB 1DVQA 4U1MA 1T21B 3V4PH 4EJ1C 1ONQB 3VCLB 5KJRL 2AJXL 2VR9A 4R7DA 4PJCB 4U3SA 4B9FA 5E6IB 1Z6JT 3N43B 3DMMA 3GJFA 5DRNA 4N85A 3T3MF 3BDXA 3ABMB 3E0GA 5B7EA 4FCAA 4WV1C 5AVYB 4ADIA 4OCXH 4FXGC 4PRIB 4NOFA 3EH1A 3KPSD 3OL2A 3CBJB 4PJ9C 3X3FL 5IBTL 3C8HA 3EFDH 4UI2A 4UTBL 4N8VB 1FZJB 2HJFA 3REWB 1OD7A 5GIRB 1P2CA 3L5WB 1MWAB 3DKHA 3II1A 2DH3A 4I8DA 2ZOKB 4PR5A 4JW3A 4RVBA 3X1EA 3SKMB 2WXIA 4LPUA 4R4ND 2VXQL 2XQYA 1OPGL 4ZMWA 4ZTPL 2E9BA 5KVGL 4ZTOL 3OJ2C 5SV4A 4NO0A 3B9EA 4F5CA 3GI8L 3HE6A 5JHDB 1OK0A 3JUYA 1JWUB 2ENSA 2CXKA 4ZSOB 5BS0D 4DIXA 1X7QB 2PF6A 4Q9BA 4XMLH 3CN0A 3QHTC 2QHLA 3V79C 3P69A 1UD3A 3DPBB 1JPTH 2J2ZB 4GMTH 3GJFB 1KULA 1LYQA 1UKSA 4HBCL 2CRZA 3SCMD 3OHXA 4XAKD 4JY6B 2Q7YB 3ZXAC 5F0JB 4A67A 1CDIA 5SWSB 4E41B 2R4SL 3ILDA 3GMNB 1A7PH 4LHUD 2VWEC 4R97C 4YL4A 1XF3A 2MKLC 5I17B 5I30H 3CFQA 1KN4H 1IC7L 1MRCL 5D1QB 5HVFB 2YUVA 3GI9L 5DZNA 3L3OB 2BM3A 4A04A 5DWUL 3T9WA 3D50A 3CN3A 3P2DA 3NJNA 2Z31D 3T1FA 3G3LA 2YUXA 1Z1WA 1CQKA 1LO4L 2AQNA 1CD9B 4OIIL 4PJ7B 5F0MB 3N1GC 2YQGA 3V7MA 3CZNA 1GYCA 2C1PB 2QLVB 1N67A 2FATL 2ZXCA 3OKEB 2XU9A 5IB4A 2V8MA 1NCBH 2IWEA 2KLTA 2CDEA 4OGQC 1X5MA 3ASNB 2CKNA 5AOLA 1PAMA 5EU6A 4JGNA 1UA6H 1SBBA 4R5VA 3C9NA 3HR5B 5KBMA 3JWDL 2WOBA 1QQDA 2NTSP 4D0BA 3QYMA 3CXHJ 2CUIA 5M94B 4UM9B 3NRQA 4BK4A 4LEBA 2OMVA 3C6LC 3PV6A 4EKJA 2IALA 5F7AA 5DXWA 3WEBA 4GB9A 2CO7B 2LTQB 2X42A 2VSKB 3NYKA 4E9QA 1I8MB 4GRLA 4JPKH 4JFPB 5E1GA 3TA3B 2ZP8A 1E4HA 1Q1JL 4MA3A 4Z76A 1JNNH 1JGEA 5F7UA 1OSEA 4FULA 5CLWA 4WTZA 3VXOB 4X9YA 2GK0A 2EEFA 4NZTH 3PPSA 3QHZH 1I1CA 2VDLH 4QYOB 1J11A 3S96A 4IJTA 4YAQA 4XNXH 3PL6A 4UDUA 2WLIB 4Q9RL 1NIEA 4HK3J 4FFYH 3IKCB 4HF5H 3T08A 2DQTL 1JGDB 1L0QA 3EGXB 3ILPB 2B0SL 1WFMA 3F00A 3WN5A 2JVUA 3SDCB 2FX9H 4Y4FC 2J56A 3U7AA 2X87A 3HUJA 4O4YH 3LRSA 1A1NA 1RJZB 4RZCB 4HUUB 2JCCB 4QF1B 5TE6L 1S2EA 2IPUK 3ETBF 1QR1A 1KCKA 2ORBH 3H0TA 5ICYB 2XIDA 2BIQA 4L1BA 3BLPX 3OZLA 5EF0A 2EC9T 4LSSH 5I76A 2X70B 3U9WA 5FV1L 2MOGA 3AM8C 5LO7A 3CN1A 5E6ZA 4KTGA 2WQUA 3FL7A 5DU7A 5AB2A 4AKPA 4Z76B 4ZW3A 1TZIA 2OQJA 3ARGC 5J1SC 2F2HA 2VXSL 2LLNA 1TTCA 4X4ME 3X3FH 1N7MH 4L2LA 4WUUE 5C9JA 1I31A 5F88B 1SJMA 4LSQL 3CZGA 4P2CG 3N43F 5E5LA 1QG3A 2PR4H 4UINH 5IHHA 3DGGA 1RK7A 5DLLA 5HI4C 4KK8C 4E9TA 1SHWA 1KLFA 2NY2D 3N5AA 2BDNL 3QO0B 4NC2B 4U1IB 3P3SA 3QDJE 5FKAB 4AGMA 2NNRA 5D5MF 2VDPL 5F44A 2CE6A 1L3WA 4CC0A 3HA0A 5D55A 1FC2D 2AXFA 3DX0A 4XNXL 1QFPA 3GZQA 3QUKA 4LE8A 5DJ8A 5EBWA 3QJFA 5HGAA 2BSCA 4KJWC 4YHNA 4HD9A 4ENEC 4QXTA 4G9DB 2OK0H 1GS6X 1ZSDB 1N0XH 4RNRA 2D9CA 1NIDA 3FTXA 3CK0H 2CIKA 4LSUH 2XX1A 2ARJA 5K1JA 4EZMA 4XMZA 3DJ9A 1GHFH 3IDXH 4U0RC 3G6DL 4Z7VB 5IVNA 3PY9A 5D7JD 3NCFB 5HGDA 1R24B 2GTWA 5B3SB 3B9KD 3U6XS 3QNYB 4RZKA 3TF4A 2O93L 1U4EA 2X28A 2A99A 2AGJL 4JHAL 3AAZB 4GUQA 4YO0A 2BY3A 5C6PB 2DQHL 1KCWA 4FX5A 2GCYA 5F9OL 3MNZB 3NJKA 1J1PH 1LO5A 3QUXB 1QFUL 3THMH 1ILUA 1NGYB 1V5JA 3ZKMD 5KN5A 3BE1L 2NY5C 3TXAA 3OZ9H 2FBOJ 1N64L 5IWLA 1JPGB 3BP7A 2VXUH 1LP9A 4YSCA 1U8NB 1U6AL 4J2QA 4PJIE 2P28B 1SEBB 1S7RA 4JN1H 4M03A 5CFAA 3GRWA 3WJLA 2CKBL 1DQIA 2ARJB 1SF3A 3V5KB 5MERA 1JWSB 1OHQA 2O5ZH 3BP6B 2WP3T 5IMMB 1F3JB 4NC0B 1RQ5A 2YPKA 3JWNG 4GS7B 4KGJA 4UIKL 4PRHB 2FH8A 3TZVB 3U25A 1IMHC 3QIWC 4BEIA 5TK4A 1QSFD 2VSMB 4TLKA 1E4WL 2XRAH 4XB7A 5IB3A 3DO4A 2R1YA 3KPQA 4GEIA 5I2IA 3TVMB 4DKFL 4HWNA 1I9JL 4YR6B 2Z31B 2BNUA 5AG8A 4IRSA 3DX7B 2ZUQB 4KNUA 1JD7A 1MCKA 3FQTB 1FL5A 5D7IE 2VXVL 5K69A 1P4BH 4WIQA 1CC3A 3RIFK 2R15A 2X3BA 3M7OA 3H42H 2X4NB 2V8LA 2X4OA 1MCJA 1A9BB 1GOFA 3H9SD 5EPMA 3QEUB 4FQJL 1LMIA 5J13B 1Q9KA 2QKSA 1SXSA 2FX9L 1QBML 5DHVA 1P5UB 1YRKA 1S5IH 2F58H 1HJBC 3BP6A 5BOJA 5IMMA 2ICES 1CE6B 4J4PA 3KLDA 1DSFH 3JYCA 4J3TA 4K94L 3KLLA 4Y2DD 2FX7L 1YYML 5AD0B 3EYSL 2VDQB 3VXNA 1A6AB 1ZS2A 3IPBA 4MA1B 3BUIA 1JRHL 4QDGA 2L3BA 5A6LA 2EP6A 4IOSD 4I1PA 4IIQA 5LGHL 3DVGB 1INQA 2WPGA 4BKTC 1KCUL 1G7HB 2PXYC 5IHUL 2UYLA 2K8MA 4IHBA 4ZZKA 2CRYA 2DKUA 1JNNL 5EHFA 5SWQA 2FUTA 1LVEA 4WV1A 3BPLB 1QRND 2D7TH 3S4SG 3O2DA 4ZXBC 1S9KC 5D1ZC 1YMMD 4M7LL 1XZ0B 5IBLC 1ZHLA 5CUSH 1K3ZA 4TNWK 5CHNA 5CILL 4PJCA 4AYID 4Y2OB 4JPIB 3I6SA 3EZJB 1UENA 1ZLVK 4K7PY 2CLVB 3EDDA 5ESVA 2Z4TA 6FABH 2VZTA 4GO6B 2OULB 3PFQA 5EDXA 2ZUYA 1MFAL 1EJOL 3GNMH 4GSUA 1RU9L 1H5BA 5EU4B 4KDTA 5DWPA 5C7XL 4ANKA 5EBLA 5I1DA 5J6HB 2WUBH 1P9MA 3BZ4A 4FQXD 4M5YL 4UNTA 4DOHE 5L4FA 1IGJA 1JYNA 1U8QB 1I8MA 3VXSA 1MNUL 2CBQA 1A6ZB 1OE2A 5DUML 1HKLH 5I1JL 4ZUVA 5E9DA 4WI0B 1DUYB 1CICA 2VR5A 1N10A 2PTUA 3W39A 4WF7A 4KZ0A 4PSRA 1L6XA 4NO0B 4OF0A 5HHOD 5EO9A 2I69A 4XNUH 2QJDA 4G7VH 4QNPE 2A0LC 3B56A 1RZ7H 5IZ7A 4GUPB 1CGSL 3DHPA 3LQZA 4WEMB 2KZWA 2VDKB 1UZ8A 5FUCE 3CG8A 2R69A 4Z7VE 4UQ2A 4BZ1L 3SGEH 3HZVB 3N2JA 5K9JL 4GW5B 5KTEL 2WD0A 5KEZA 4EN3A 2AEQL 2C9XA 3TFKC 3O3UN 2LE9A 1UQSB 3BZ4B 4U6TA 5LXGH 1CFVH 5EU4A 3BZEA 4PUBH 4NWUL 3SDCC 4JY4B 1QD0A 4I0PB 3A24A 2PCPA 3EYFB 3TJEH 1PU0A 3U4EA 3KH4A 1CFQA 4N20A 3KYOA 5DZPA 2WVVB 2PO6D 2QSCL 3ZU8A 2PP9A 5ICUA 3D7PA 3T0AA 4V1DB 3BESR 4JFFB 4JQXA 4PY7A 2Y3NA 4H0GA 1W0YT 3CC5A 5GSRA 4G8GE 5CWSB 3MRJB 4WNSA 3DOSA 4PP2A 4JRLA 2DLGA 3SYCA 3WAJA 3RFZB 4OZIF 1ACYL 4X6CF 4HMEA 1B0GB 3GTNA 2ADJB 5JO5A 3BSZH 1UCTA 1TVDA 4OFQA 1CGVA 2H47C 3X12B 1KTDB 1MH5B 1K4DB 2D03L 5T1JA 4GO9A 1KJ2H 2FR4A 1G7MB 3MV9A 2C3GA 4UU9A 4LNRB 1MI5A 5B3JE 1G5AA 2Y25A 1OY3B 1THAA 2IPTH 3GXDA 4XP9L 5EIIA 1JAEA 5KYXA 2AXWA 2ZCKH 4R6UA 4Y19A 4U6YB 3VFWA 2AKRB 2I27N 4WO4B 3PFUA 2H9GB 3GMOA 2H6OA 4PJFE 1GW6A 3E2HB 4JPSA 3QQ9D 2ERJB 3QUMB 1VPOL 3NA9H 3D1MC 1CLYH 5I6OA 2AV1B 4KX7A 3H56A 1BVOA 2C9QA 1CFVL 1AZNA 2AV7B 4IMLA 4Q89A 3NIGF 5CP3H 1DFBL 1DQJA 3PWVB 1UWXK 2B3IA 1ZHBA 4BHUA 2DQIH 2JKIS 2YD4A 5DUPH 5DRZA 5BQDA 2EO7A 3UEQA 5FECB 5ID0B 1M71B 4KKBC 1XB6A 1HWWA 5L8KB 1DCLA 4FYRA 5IVZB 4AQ8A 4L3EA 1HXMB 4WNJA 3X11A 3QULB 1FCGA 1BAWA 1QWUA 2ZXGA 4ANWA 4JZJA 1JCVA 3K2UL 4RETB 3SCMC 1OE3A 3O4LE 2A9AA 4XN9A 2L7QA 2QDWA 3WFHA 5JIPA 5HVHC 3RI5F 1IGCH 3MNVB 4HIJB 3RFRA 4RISL 5EU3B 3CFMA 4QEGA 2I9TA 1OF2B 2NT0A 4NENB 4AMKH 2F61A 3OF6A 4TLUA 1HL4A 4AVHA 1JPST 3QNFA 1D5MB 2O61A 4P99A 4Z3GA 4CC4A 5DFVD 3O6FD 1RERA 4XH2B 4PRHE 3GXUB 1CS6A 3ARBC 5D9SB 2BVOB 3KDMA 3N55A 1CFTB 1UB5A 5D71L 1GPOL 4NZUH 1JUFA 5FF6B 4AT6A 4PJ7E 3CX5J 1IC5L 4OM0H 2NX5D 4TUJB 1DBJH 2A83B 5BZWA 4DO5A 4ZPVA 4M4PA 3RVUD 4YLBA 4C55A 3LRLA 2ADFH 2I5YH 5EB9A 1JFHA 3R1GH 1M71A 2A3TA 4U33A 3ZHFA 1L9PA 4XGZA 3VVVA 4CVZA 1U2HA 1G6RA 4IW4C 3LB6C 1M2OA 3T2NL 3D18B 2C1OB 3GHBH 4OBSA 1BA9A 1JZ6A 2EDOA 5AW9B 3TBTA 1T1ZA 4X6CE 5G4NA 3S0PA 3RWDB 4HZAA 1INDH 1SOXA 4XP4L 4PGZA 4KKCC 3EGDA 3B7SA 4PV8A 3NIDF 5HHXH 2N4IA 4PFEA 1D5ZB 1KGJA 2V2XB 2V6HA 5IR1B 2EADA 1T0MA 2F54D 4PJEF 1G7LB 3GD1C 2PWDA 2DEXX 3AXLB 1XH0A 4DPBX 2BSTB 4Q9RH 1COBA 1BD2B 3TIEB 1MFVA 3SBQA 4PRBB 1MCCA 5FA3B 5I8CB 2V9QA 4HHWA 1HHKB 4NZDA 2H6PB 3QQDB 5L2KB 4XGZB 4ZMLA 1HXYB 3T6QC 5FIEA 1BQUA 3QHFL 4V2CB 4JM4H 3EJYC 5I19H 1KTCA 5GXBB 1GYVA 1IGFL 3F6LA 5C0EB 3HC0A 1MXDA 1MREH 3GDBA 4TNWF 4MD4B 4A39A 1B2WL 3WXWH 1A4BA 3A67H 4PJGA 2OQJB 3RB5A 1ES0B 3GO1L 3JV5A 4UT9L 5FGSA 3ISRA 3HE7B 2R27A 4N9GA 3E8VA 1ZE3C 2WY3B 4PWJA 5DQDH 3SKOA 3VRIB 3JV4A 4BZ1H 1LQBC 1YG9A 1OHZA 4NO5B 4R0LB 1IGYA 1TETL 2NOYA 2I60L 3PQYD 3VRLF 1H19A 3P0GB 2GG1A 4NEHB 1UJTA 1PZUB 4PGCB 3APCA 3HC4L 5TE4H 2BZDA 2YSTA 3K72A 2ZUSA 4G7SB 2BP8A 3C2SA 3UXFA 1OAQH 1WBXB 4QRRA 3WLWD 1LM8V 1DUZB 4PRBA 5FA3A 3LNEA 1ZEAL 3EBHA 3UYOD 1FV1A 5JIDA 1A3QA 3WHXB 2EVHA 4WCYL 2NDFA 5IB1A 5KVDL 1Z5LA 2Z7ZA 4ZMPA 1NCCL 5AVXB 3IEAA 3R06B 5C09D 3OC8A 1A25A 4AG4H 2IAMC 4DTGL 1AQHA 3TJHD 3EYQD 2F74B 2XZAL 1Q9LA 1HE7A 5DHXB 5ECJE 1MCOH 4QWWC 2QFPA 1FVEB 2L04A 3FO2A 1QKZH 5CMAB 1OTSD 4MJIA 3IVKB 1XR9B 25C8L 4OTXL 4TSAH 1RPQA 2DICA 2KDYA 2IADA 3PWUA 1R3LB 3WIHH 1L6ZA 3HB3D 4KOBA 4NFDA 3K6IA 3QJSB 3CVHL 4AEHH 4F58H 3G9AB 4S10A 2CHNA 3FT2B 3TVMD 4BD4A 5I18L 1HDMA 4J23A 1U8LB 3TO4A 3WFDL 3VA2C 3C60A 4ERSH 2VERN 4HX1A 2C9PA 2K78A 5GGUB 3GSRB 4AMKL 3RL2A 4QHKI 2VC2B 3DXAE 3ZL1A 1DZ0A 3ZDXE 1SY6L 3QO1B 4ZO9A 4FADA 5I1KL 2D4FA 4GO8A 2DQEH 2NY4C 4ZUWB 4DK3A 2BHYA 5D1XE 4C59B 5I1GL 2V37A 2EVIA 3FUIA 5CJ8A 3BP7B 4P23A 1RJYA 3STBA 1NPUA 1OGAA 3HN3A 4U1NA 3UJIL 1RV6X 3K4AA 1IAIH 1I7RB 5AB1A 4YEFA 2XWCA 3OC5A 1F56A 1Q0EA 1S9XB 3DV6A 3TCLB 1MHEA 1ZK9A 4IBZA 3QDME 8FABB 4A55A 5D2LA 4YXKL 4WWKB 1U95B 4PAZA 4XPBL 3QDJD 5FYKE 2P3YA 3OG4B 1MUJB 3FUHA 2YQBA 5J6HA 5CGYC 3KXFA 1XTMA 3IKKA 2YEVB 2JJTA 3FHEA 4UYQA 1JK8B 2PPCA 3B83A 2DBLH 3MACH 4ATTA 3QO1A 2DI8A 2B8OT 2DWEB 3INOA 3QEGH 3CZUB 3WIIL 2A73A 1LWJA 5HTSA 3GPSA 1CDGA 4X0KB 2B5IC 3WFCL 1CU4L 2JCWA 4JPWL 1T7ZA 5SWSE 4HIHA 2FWOA 2JKLA 5FKPA 4NAJA 1LL1A 2YR3A 4ELKB 1S9XA 1ASPA 4GQQA 2GTZB 4NWTH 3C2AH 3VXRB 1QUPA 1BYNA 2CAKA 4WLCA 3TBVB 4RGND 4ZMAT 2OCJA 4FHJA 3WD5H 2EACA 3FN0H 1JF6A 1ACXA 1TLKA 3EJZD 5FYJH 2BFVL 4Y5XA 2WUCH 4PEEA 5B7MA 3LXBA 4ZMXA 4N8VA 5ICZA 2AJ3A 4P3WA 2R29L 4PU2A 1KB5H 3HMXA 4MB4A 4XO4A 3DPBA 1CXKA 2J5WA 4MJ2A 1SJEB 2PW1A 3ATFA 1KGYE 4KO5A 4OF7A 2Y7MA 3D48R 5FYKU 1ANUA 1EUUA 4MS8D 4X0KA 3WE6A 1DBAH 2NY3D 5LNGA 5BVPL 4ELMB 5CM1A 4F7PA 4MDJA 2OR8A 1CT8A 3BCFA 3QARA 3RJOA 3L9BA 2HJLA 1G9MH 3EAKA 2GUOA 3ZN6A 1DDHA 1TU2B 1MVUB 5FAAA 3KJ6L 1DFBH 4AV5A 2EILB 4FLHA 4HAGA 3AGVA 3G6DH 4P2RE 1QTSA 2F1AA 4ZUUA 3QWQB 1K5NA 1XDTT 5JHMA 5C0GB 5DUBA 4ZXBD 1MJUL 2AK4A 2FYYA 3ULVE 4XMPH 4IBVA 2XVKA 3B5TA 5JHLH 1NIAA 4YHKH 3V4VH 4TSBL 2NY6D 1ZMYA 3BMWA 3GBNH 4MAYC 4S1RL 3TN0D 1DVFA 5EZOH 3B4NA 3VXSB 2JELL 3VMNA 5IJKA 1TJIH 3LH2H 1PAZA 4O58H 3H9HB 2IH1A 5AOKA 2IMMA 3BLKA 3FQRB 4TTDC 4ATWA 4PRAB 3T0WA 1KCVL 1WFTA 4UTBH 4CDHA 1DVUA 3RGVB 4LKCA 5FM5O 4LCWA 4OI8A 4NHUA 4V1DD 4PJDB 3JQOB 1WIPA 5FCSH 1EEZB 1FLTX 3BIKB 4PJDF 4PJ9D 1XCWA 4HIIA 4F3FA 4RDBA 2JTYA 3WNPA 4E42B 1G5GA 4H8WC 3S97C 3SQBB 4FZ8L 2CALA 4LOUD 3AVEA 5CGMA 3QDJB 4JVUA 2DQJH 1U8MB 1A0QL 1TOXA 3Q5TA 2G60H 2WCGA 2AK4B 4JFWA 4KPHL 1CL7L 2OW6A 1XGTA 4FFZH 4GKNA 2OMUB 1VSCA 2DWXA 2AFNA 2ZNXA 1T6WA 2J55A 1LEKB 1OAJA 4Q0XH 3LPOA 3ZRCC 1YC8A 2HMID 4A2HA 1E4XL 1D7BA 3SZ6A 2XWJB 1I3VA 4K07A 1RIHL 1VZIA 2F8OA 35C8L 4N2HA 1SOKA 1SM3H 3GSNH 3MNVA 3NPZB 3UAJC 1W72L 3CZFB 1MVFA 1LO0L 4IBQA 1RHHA 2GSGB 3BPCB 3VI4A 3JVFC 3K80A 4QXUL 4JFDB 3DRQB 5F1SA 3SKOB 1NA8A 5EU5A 1MFCL 1NL0L 5AOMA 5EOCL 3SDCD 5FYLH 1R47A 3BLBA 5J9PA 3LKRA 4OF6A 3J7HA 3C87A 2DW5A 1MCSA 1XCTA 4XPHL 5CEXA 4O58L 3IDJA 3DHMA 5E5MA 4ABQA 5J4MA 3RKDC 2UVFA 2A5UA 4B7LA 4BFKA 1OAKL 1UM6H 5F7MC 1CQYA 2N3JA 3U36B 1PD1A 4EDWL 2OZ4H 4RAVA 2VJ0A 4MNGA 1H3PL 3SBPA 1A1NB 1PLAA 4FGMA 4P2YA 3QFJB 1NCAL 3CDZB 4FABL 5JW4M 1BWMA 3L17A 2BIMA 2EICA 4J3BA 5KVEL 3WKNA 3KM2A 4Y19B 1ZIBA 5DO2D 3VFWB 4ACPA 5IHBA 2NXZC 5DDHB 5JMOC 3BPCA 3VI4B 4CMMB 3GSUB 1J1OH 1KBKA 3FT4B 1G9HA 3F7VA 5FUOH 3UTZB 4I2XE 4FFWC 3U83A 3IMVA 4NCDA 2VDNH 4BFNA 5DJDA 4NRYA 5EO0A 5ETUA 3DBSA 4X83A 1MFEH 4QHLA 4XI5D 3H9SE 3QUHA 3HKFA 3IAGC 4LSPH 3X11B 3E8UH 4AZUA 2ERJC 1U93A 4WWNA 5AALA 3CDZA 4TNVF 4Y4HD 1J0KA 1RJYB 1ITCA 1AZUA 1DVZA 2VMCA 3PGFH 5F6IC 1WG3A 4KK6C 3TBSB 4AL8H 2WIIA 4WK0B 4BE6A 4HG4J 3FUDA 4ODUA 3SY0B 5INCB 4DP7X 1I9IL 4U3HA 2C26A 3A5VA 2HH0H 1QVOB 3G6JE 3F7KA 3AU0A 4UQ3A 4OKDA 3ZBMA 4K7PH 3QZLA 5GJTL 3BW9A 4R90L 4G7YL 1FNGA 5EORL 4Z0XB 1RUAH 4X98B 4F7TB 1EQWA 4Y9EA 1KIRB 2BP3A 3KPNA 1YDPA 5DRXB 3ARGD 4H1LH 2GC7C 4KDVA 4PHXA 2HT2C 3KGTA 4A2FA 3C08H 2HLEB 2YD9A 1E6OL 1FBIL 2CNYA 4U7KA 5MP6H 1UGNA 5JPNC 2P7TA 3LHAA 1JRHI 4TRPL 2Q86A 1GMIA 1DJWA 5AW1B 3ZX1A 1JPGA 3EUDA 5FB8A 8PAZA 2FWOB 3SKNB 4PBWD 1OSPH 1SDAB 2IDQA 1QEWB 5I1CL 1NGZA 3F62A 4RFEA 2NXZB 2F53E 3EZ8A 5KS9E 3RWJB 3QCTL 1Z5HA 3IJ9A 2H8PA 4MCMA 1HINL 4XZUB 4JM2C 4MJ5B 4L9LA 1A6PA 1WZLA 3WN5C 3QRFM 3D4CA 4O2FB 3SGDI 2X4TA 4GMSH 4AM0Q 5IFJA 4XI5C 2YPLB 4AX3A 3D0VB 5CZRA 2IH9A 1J8HB 2NR6C 3MJ9H 1J5CA 3B2VL 3PL6C 3FQYA 5CJQH 5TQ0H 3ZSTA 1T0NB 1GC1L 2TAAA 3QWOB 2ICWI 1PZ5B 5KSAC 4ZD3H 4F5CE 2ATAA 3ELAT 3VSQA 1E4KA 1PNDA 5GGQL 1SJHA 3B9KC 4O9HL 1KIUB 4NO0D 5HHOB 3PDOB 3S36X 2O5YL 3LZPA 1QEWA 5TE6H 2AZUA 4FKHA 3AABA 3LS5H 1DQQA 2A9NL 1UM4H 2WXNA 3DX2A 1CLZH 1A6WH 2DD8H 3VXQA 2ZX8A 5DUBB 5JQHC 1TEYA 1HT6A 4HS8H 4HEME 3MRRB 3VFOB 1WIUA 4PS4H 5D7KE 3GFUA 1PKOA 4NN5B 4DSYA 1ZEAH 4M29A 5BVPH 2NY7L 2C9UA 1OM3H 4X5PA 2Z31C 4CJ1A 4MWFA 5E9NA 4JG0H 5D70L 3IU3A 3HE7C 5D93B 1I3UA 5MENA 4UIMB 4GG6F 1AD9A 1DLFH 3UTQB 1WPCA 3WBDA 4JL1A 2YRZA 3HTLX 4JN2A 1OTTD 2AQTA 4HJSA 1OAUL 2XDHA 4NNYA 4OF8A 4AIEA 4JFQA 4Y7OC 3WD5L 1QHOA 3PAUA 4Y9BA 2FQGA 1TENA 4D0DB 2GUYA 1Z9NA 1BM3H 4X9FA 3TFBA 1M05B 2VZOA 3ZPDA 1D3CA 4U6HA 3BWAA 4PJHE 5F3HA 1NDGB 1J5IA 4C83A 1QO3B 25C8H 4K8RC 4OFYA 3DX6A 4HOMA 4ZD3L 5ADOH 5JPNA 3FSAA 1WAAA 4G6AD 4DF9A 4F7MA 2JK5A 4EIZC 4G80B 2EH7H 4BSJA 1I8KB 1IU1A 1AYOA 1HEHC 1Y18B 3OLEA 2P5WE 1CURA 1KGUA 1FGVH 1U8QA 2K45A 3GTTA 1NLDH 5IOKA 2W60A 3W11C 5I1LB 4JANA 4KRPC 4X7CC 5CEYA 4I4WA 4W9HC 5C0FB 2QHRL 5DVLA 1YEEH 4TQEH 4PRPD 2DTML 3KWWB 4LOVA 4OQTH 3U1PA 1SYSA 4Z7UE 4MS6A 1U33A 5F7EL 5GJTH 4M6NH 4LMQE 3O8XC 3NFPA 2WBWB 1KXQE 3KPOA 4MD4A 3V6FB 2Y22A 1K4CA 5LCVL 4EIBA 3OKKB 4Z7WE 5C07E 3WGVB 4YUEH 4JKWA 1EK3A 1D6EA 4BKSC 4N90D 3HZVA 5J6SA 1AR1C 3EHBB 1X5JA 1WZKA 2CLRB 1LDPL 1PZAA 2G4EA 5DK0A 2ZSWB 3G5ZB 1XF2A 3IMRA 3COOA 4NZRH 2WVVA 4GS7C 1ZHNA 2NUPA 4QXUH 1O5PA 2LLGA 1MZYA 4L8DB 4UT6H 3UYPA 2AXJA 5BUAA 3KCPA 3N85L 2EDJA 1IIIA 2D31A 3RWCA 1DQLL 4JRXA 1B0GA 3QJVB 3NCYP 4RQQB 1IVTA 4QO1A 1K8DB 1UVQB 2XVLA 3CFCH 3M45A 5TH2A 3GSUA 1IFRA 4LDCA 3CD4A 4DK5A 4TPRL 4DAGH 4U3XA 3X17A 4ORGA 4ZT1A 5I1HL 3TN0B 2DQJL 3WIHL 4G3YH 4HQQH 4JPVL 1KELL 3SB3A 4XMTA 3N91A 4OFDA 1JZDC 3RYMA 3VWJB 1Y0LB 3QDJA 3WY2A 4XNUL 5F7YC 2XA3A 2IQ9H 2VC2H 2CRMA 2ZAHA 3TYFB 1GGUA 2ZICA 3DMMC 2ZAIA 1J0IA 3X12A 1XZWA 3UAFA 3E80A 4G5ZL 3FU6A 1TF4A 1W91A 2ZOLB 3KCPB 1HCVA 2DJ4A 1JHLL 1OGAD 2ROXA 4P9HL 4ODBD 2YLHA 4O51A 4XPGL 3WJLC 4JFXA 4U1LA 2J6EH 1K8DA 1UVQA 4CSPA 1TYRA 3FPYA 5DLML 4JB9H 3MRGB 1FE8L 4Z9KB 2X12A 1QI3A 1PCSA 5EZPA 1W0WA 1KTJA 4YSSA 1FNEA 3M8OH 5DJ2B 1B0IA 4K5NA 1E8XA 4IK7A 4LCIL 5TDOB 4BFRA 5EH1A 4DAGL 1JPTL 4HD5A 5ALCL 4A2DA 2PP7A 3FTZA 3WJMB 5CEZH 5HSFA 5C7ZA 1K5NB 3ML9A 1N3NB 2CO6A 2NY3C 5HJBA 3HS0C 3KPNB 1ML0A 4OI7A 3LDBC 1NCAH 5DEFB 1JGIA 2IAND 4FRWA 4DO6A 4OD2A 4NM4H 2XJLA 2O6EA 5M7QA 4YE4H 2OYKA 1MPAL 1HZHH 4CW1A 2WJ5A 4Y5VC 1UH2A 4L9DA 5HI5C 4HHGA 3HJEA 5CINL 4J8QA 4LMQI 1LMKA 2HFFB 5I28A 4GUOA 1YEIL 3PWNA 1VHPA 1OSZB 3ULUE 3EJQA 1K9TA 4NENA 3VXRE 4K94H 4TNEA 5A2IH 3HMXH 4YXHL 3SQOL 3FQUA 1NL0H 5CAYB 2PLTA 3MNZA 4YDJB 3CC1A 5FYLL 1U0QA 4NQDA 3S5LA 1OV8A 3JV6B 1BZ9A 3FSZA 1FN4A 4H13C 1F5WA 4NCC2 5DJDB 1BZ7A 4WO4D 1UH3A 2ID5A 3QDAA 4BFJA 4P2QE 1FL6A 3ZHNA 1NCNA 3OKLB 2Z92B 3VGDA 3QCUL 1GC1C 4LCCB 5I1JH 5IQ9A 1TJMA 1EFXD 2IV9A 2VW7A 1M4KA 2CU9A 2E74C 4WHYG 4XAKE 3AADB 5DMGC 5EO1B 2JLPA 3EJRA 4N1EA 1L9RA 2UZXA 3FQWA 2DBLL 4KPHH 5IB2A 5KSAB 3NIGE 3LSOB 1M7IB 3MCKA 1KLUB 2F7QA 3K0WA 1P6WA 4OM1H 4XN7A 1R3HA 1UJ3C 5F1IA 4WGWB 4JZOA 2DIEA 4UIKH 4QLWA 1J1OL 5DEGB 2DWSA 4C4UA 3W9DA 4GBXC 2ZPKH 5D2NC 5DZVA 3N1MC 1OM9A 4HIEB 4MD0A 4HOXA 2J1WA 1FN4B 1PEZA 4UZUA 4KZDH 2HFTA 3GLDA 3MUY1 5ANMB 2AITA 3VQ2C 4ZX6A 2EXYD 4NAQA 5IW6B 2CQVA 1JGLH 4UBDC 1SLWA 3MBWB 2IQAB 4JQXC 3IU3B 4KK9D 4OKVB 3WHE1 3OMNB 3IXAA 1W8OA 2IDTA 3O9WB 2CHXA 4Q9QH 3HRZC 1J9SA 5DHVB 4PRPA 1IKFL 4Y5XC 5T1LA 4R5XA 5H37A 4W6XB 2OP4L 2F08A 4OUUB 3DX8B 4U1HB 3VB8A 2Y0SA 3GHEH 4DUVA 4D8PA 3VGBA 1M7IA 4N8CH 4X7TA 1IV8A 1Z9OA 3NSJA 2DL2A 4E36A 5IVXA 4NJAH 3ARDC 4RMVA 1BLNA 2YAMA 3DVNB 2V5SA 3OKOB 4A6YA 2NR6A 3O11B 5KG9B 1UKTA 2BOLA 3B3IA 1EEZA 3BIKA 3ZLQC 2A77H 5KAQG 1RJZA 3BVTA 4MVBC 2DWYA 3JV4B 5HVGB 5IF0A 1LO3L 2ADIB 3QNXB 4PWFA 4LCYA 1DZBA 3O6KH 3S6CA 1QAWA 2QQNL 4XNZC 5DS8B 5J57B 1SLVA 2OK0L 5C0IA 3DSNB 3LKQB 2XQYK 4MJIB 1EDQA 3GEFA 3MV01 3P2BA 4J3XA 4PWIA 4NQVB 3V0FA 1QPPA 1XL4A 5AKSA 1MCDA 1EXUB 1YSOA 3MNDA 3Q8FA 3C6SB 5C0BA 4Z3TA 1P0SE 4YSUA 3DX8A 4U1HA 2R0WL 3FNKA 3LXUX 4M6OL 3NEOA 5FWQA 3TV3H 4DP5X 4PBVC 1AO7E 4F57H 1F4AA 1VADA 3K6SA 1UACL 4A6YB 2EKSB 4JLRB 3VWJD 2G5BB 3ISYA 2N7AA 2VO5A 5A7EA 1EIBA 1KELH 3AG3B 1ZT4A 4M02A 3MR9A 1DUYA 2WYIA 4GKZA 3HBZA 3UP6A 5HD8C 5L2KD 3MRHA 3RDTC 3NIFF 5J9PB 5L0QB 4OZGA 2H45A 4ZS7L 3U6RA 1K5WA 4JO1H 3ABKB 2K3HA 3NCCB 4AQ1A 4ZS6D 1I9JH 4NQCE 3L1GA 1IFHL 1JZEA 3K8MA 1NAML 2XPGA 4EZLA 4M6ML 5CXPA 2GBAA 4IU3B 5GS1A 3P2TA 4HJGB 1NCDL 4M8QA 3K74B 3C6SA 1UT1A 3NTCL 2P5EB 1MFNA 3S5LG 5HYEA 3QEQD 5AW8B 1MF2H 2UXFA 1W72A 2UZIL 3W57A 1EJFA 4NZRL 5G4MA 1TIUA 4FYTA 3F58L 3DROA 2ILLA 5K9JH 4HCRL 5DYFA 2WWMC 3Q1SH 2HT2D 4LCIH 4G6JL 2G5BA 2OMBA 1CTNA 4OCLC 5FHBL 2XN9E 3N42F 4GG8B 2J57A 4HJ0C 1WWAX 4GJTB 1GSMA 4C47A 3MNMA 4XOEA 2BY0A 1MCOL 3SGEI 4QOKE 3QRGH 1JNLH 2KC0A 4QRTA 4FL4B 1PEWA 1INDL 2NY7H 4TMPA 3EGSB 3H42L 1MPAH 3L1EA 1JZJA 4HH8A 5EO0B 5FKPB 2R0LH 1C1EH 1OTSC 4U0RB 2UX7A 2Y69B 3QQ4A 2PO6A 5D1ZA 5FM5M 32C2B 4JANB 2VDQL 4PJFA 1XEDA 1HCZA 5EZLA 1IAOA 5C0ND 2WXHA 1NC2D 2IQ9L 2VC2L 3LS5L 2A73B 1LNUB 3HB3C 4KFMA 3O6MH 4HPYH 5TDOA 4P3DB 7FABH 2HLFC 5I1DB 3TVMC 1NCBL 3QBTB 3V9FA 1TQTA 3BKYH 3T04D 2VUKA 3WO3B 1FYTD 4NRZB 4ZSOE 3LYRA 2G2PA 4H1LG 4B96A 2BNUB 4G9FD 1SUJA 1P6AB 4NKDA 2R9HC 3WY4A 5EZIL 4E5XG 4QI3A 5J1AA 2VN5A 4WFGE 3NDZE 1FIEA 4Z95L 3AWEA 3DJRA 4LDOB 1E8ZA 2ZIDA 2VISA 2NY3B 2IXQA 4MWFB 4L8BB 3FQ1A 1V10A 5E6IA 1CPUA 3LZQA 3ULUF 4YHIA 1IBDA 3BWSA 3GLZA 3NJLA 2OMWB 2WBJC 3IJYA 4KQ3H 2I26N 1WH0A 2D3JA 4JHWL 2JMRA 2APVA 1FLRH 2Z7YA 3AS3A 3FB5B 1GZPA 4HS3B 4EXKA 3GUTA 5EZLB 4Y2DC 4PJBE 1RVFH 4N2MA 4P5KA 4GRLD 1UCBH 3H53A 1N2RB 4L8SC 3L5WA 4KFZC 1IKOP 5DQDL 3LKOB 4FN0A 3GXTA 4N2OA 3Q06A 5EUKA 2CO7A 1OGTA 3KAAA 2FK9A 2BP0B 1ICTA 4HPOH 3S88H 1NFDF 2R0KH 1ORQA 3MLSL 1LQSR 4O02L 2FYYB 5FA4B 1P4IL 2AQSA 5B4MC 3HE6B 7CGTA 3KWXA 3ARTA 1T7VA 5EO1A 5IBLD 3SE9H 4UT6L 3T3ME 3HC3H 3JWOC 3NACL 4P2QD 4JFZH 3IXTB 3D33A 5CWSA 3TJPA 5F7WC 4PJEE 2SEBB 1YMMA 5E51A 1BMZA 1VFAA 4HS6B 2VR6A 3I9GH 2XZZA 1DQVA 1RZJC 1T0NA 1BAGA 2WUCL 1JXFA 3WIFB 4MXQC 4Y5VB 2J8HA 2HAZA 2XWRA 3VD2A 4PJ7F 1WC7B 3EJSA 5D71H 3Q2VA 2ROYA 1V7NL 1UM5H 3AWFA 3DIDA 3T0BA 5I75C 5KBLA 5FO9A 1TEGA 2VQUA 3BSZL 3TA4D 1TG8A 1NOFA 2GQHA 2XC8A 2VLJB 1TVHB 3WOVA 2AJYL 2A0LD 3V0AC 3CJJA 3RUGE 3QCVL 4RDQG 1U3HB 3UJJL 3IGFA 3SCMA 5BVJB 3F6IA 4ONHB 2VUYA 3FKUS 3UO1H 4FQLL 4KXAA 2XHNA 5BQ7B 1QRNB 5EUOB 2YOCA 1TQBB 2B1HL 2F54B 3FONA 2LOEA 4H1LB 5BS0A 5I1KH 1CI5A 2D31B 4N2FA 3K2KA 2V5MA 3ZUCA 1QSFB 2BRQA 3OPZH 5I1HH 2YAPA 3CSYB 1I4FA 1XGRA 3PHAA 4K9JA 3KPRB 3D5OF 1USQA 3WUWA 1BM3L 2OXHB 1WS7A 2V9TA 3HR5A 2K6ZA 1ZSHA 5F7FA 3DXAD 4AOFA 2EUWA 3CMOL 3D85B 4R97B 2BIPA 4CAGA 2OP4H 2WMPB 3C6EA 1T7YA 3SE8L 1X5ZA 1Y0LA 2CPCA 5IHWA 1ASOA 2R69H 3H2WA 3QUMH 1T0PB 1BG1A 4J3OF 2YN5A 1NEZB 5A2CA 2DMHA 1R5IA 3V0HA 3BZ5A 5EU7E 2D0FA 4YLCA 3RHWF 2EYSB 4BH7A 3HHRB 2YRLA 3I3EA 2Z8SA 4NUQA 3TIDB 2WLIA 3CE1A 5DGRA 4OGZA 3FN0L 1CFTA 2WXLA 3H7BA 3GSQA 4WI4A 3BAWA 1CIUA 3TTYA 3VI3E 4MAZA 2DWDB 4QOKB 3NAAL 4CADA 1U8CA 5CNHA 4DKAA 3QEQB 1E0OB 3QUZD 4OCSH 3TT3L 4DVRH 4X5RA 1KCLA 2NY0C 4YDLB 1OARH 2BVTA 3T0EE 3LRSB 4RZCA 3C12A 3BRDA 2JI3A 3D85A 4YHOL 2UVEA 3ZMRA 3V6FA 1TXKA 1E9OA 1EHNA 4X9BA 4Y2DB 2APBA 3IJHB 2N1KA 4JGJA 4M1DH 1AZBA 1PMYA 2VDMB 3RY5A 4KTEH 4XN2A 3CHOA 2F15A 2CBTA 5ETUB 3TOPA 5KSBE 5L8JB 2JNZA 2CBMA 2P5EE 2GABA 2P24A 3NZ8A 3SQRA 4DN3L 3AGWA 5E8EA 4W6YB 3QP3A 3EG9A 1LWRA 5E6ID 5IGXL 1BIHA 4RGNE 1CR9L 1EMTH 1TT6A 4HUKB 2NTFB 2CUAA 1EEQA 4RMTA 4CN4A 2XKNA 3KS0H 5I30L 3MN8A 4TVPD 3I74A 3VFNA 1FRGL 3SKJL 1OSZA 1YPZE 2VDML 4WK2B 4HSQA 1QUNB 2X53A 3VXTA 5LHDA 4LCUA 1G7PA 2VXSH 5CGYD 1DCEA 1GTNA 3KM1A 3MRCA 4FXGA 2FAUA 1S3RA 5E0FA 1OAXH 1N9PA 3NH7H 5IROC 3VFUA 4OLZH 1FYTB 2HRHA 3VCLA 4DP0X 1PBYA 1O6SA 3ARBB 3IFPB 5C09E 5AVZB 3ML8A 5E94B 2DLHA 3LEYL 3AXHA 1GGIH 4EI5D 4Y4KD 4PRIA 4X6BB 4Z3EA 1SFHA 1BPLB 2X6AA 3CMGA 2YA1A 5DGQA 3U0PA 1Z0NA 2NY0D 1ZVHA 4S0SD 4RFNC 4XMXA 1JZ5A 5IHZB 4Z7IA 4EQ2A 4QXVA 4D9QE 5L7XL 2EABA 4UYPA 3K5RA 4CKQA 1F86A 2VSCA 3I9IA 3OHXC 3S48A 1P5UC 43CAA 4XVTH 4N2NA 2M1KA 2F53D 2X2IA 5I9QB 1L7TL 3DX9A 4N86A 3HS0A 2YPLA 3HUJF 4OZ4A 1Q9LB 2J1XA 1XZ0A 4G42A 4OFKA 4AJVA 4MB3A 4GPVA 3VD3A 3GGWA 1F1GA 1KYUA 4P23D 1OP9A 5GZNA 2A74A 1QPKA 2VIRB 4CGUB 4XHJC 5T33H 1OLLA 3QW9A 1R5WA 5KBDA 3L3GB 4GQZA 3MCLH 1F3JA 1MFBH 2EE2A 5I73C 1UKQA 2XZCL 4UILL 3ZE1E 1C5DA 4BFIB 2I60H 1DQKA 2FHBA 4JREC 3EDEA 3F65A 4BH8A 2JQMA 3IETB 3WTUA 1T0OA 4ZFOB 3WFEH 4AUJA 1USZA 2QFRA 2DM4A 5E4EB 1E5UI 4UT9H 4ALAL 4P4KA 3BDYH 2VXQA 3DX7A 2GT9A 1T1XA 3ZDYB 2EDMA 2G75B 5LAPA 4YR6A 1Z9MA 3FQNA 3FN9A 3Q8EA 1MHCB 1FVDA 4YIQA 1R3JB 3HEIB 2UY7B 4Y1AA 1CDYA 2GJJA 5IV2A 2BSRB 5KVGH 3MGOB 3GZPA 35C8H 1RIHH 3WS6C 1YJDC 1A9BA 1R1CA 3VTAA 1JZGA 1ACCA 3LZFH 4B7IA 3PRZA 3VXPB 5B1JA 2MCAA 2PMZA 4OZ4B 5J3HD 4OGXH 5CR1A 4KKPA 5C0BD 3TPKA 2XXMB 4GUPA 2AEPH 2NW3B 3IF1B 3I84A 1Q4NX 4MMXC 2G3NA 4DKFH 4NPKA 1IJNA 1GAFH 1AQMA 2ZTBA 2ZXAA 5A6IA 3VX1A 2OTWB 1QZNA 5CN3A 4JRYE 3RWEA 1YEIH 1PX3A 2WJ7A 1QRKA 3L1FA 1E7VA 1KEML 1P2CB 2EKSA 3NCJH 3Q13A 1PNCA 4AZ8A 1GJIA 4LARH 3O6LL 5C2BH 4FLSA 1YNTA 2EE3A 3VG0H 2FD6H 2D0GA 5H2BB 3TZVD 2H0EA 1ASQA 3I9AA 1YNLL 2Z64C 1U8OA 4PJ5A 3KWWA 5HYJD 1BOYA 4EBQL 1MFEL 4QIRA 4JM0A 2Q2LA 1AFVL 1A7NH 5DK2A 4RGOL 1L3NA 1DANT 5JDSB 1I85A 2IBZX 1MIEL 2HJKA 4JO4L 3NT0A 4Y2OA 4I0CC 3CN2A 3WFEL 1ZLUK 3MROA 5BNXD 4R4BA 2CLVA 3BKCH 4Z78B 1U8KB 4NUPA 2DQHH 3SDCA 3CLEL 2JIXB 4R3SA 2FBJL 5C08E 5BZDA 2PP8A 2EEBA 1FORH 3FUEA 1QSEB 1H6EA 4OCSL 5DLMH 5GGRA 4DVRL 2NX5B 1PW3A 4B97A 4HU2A 3ZUNC 4FFTA 3ZDYF 1P6FA 5ILTL 3UBXI 3AU1A 2VAAA 3ZYIA 1XVSA 2FZ3A 1YNTB 2WWKO 4F37K 3RFZC 2XBZA 3FQ2A 1AQDB 4N8VG 3F12A 5E4EC 3ORJA 5KVEE 2J5LC 4MCYA 2BY1A 1S46A 5J06A 5JDSA 2WYHA 5DZOA 2VJXA 4MXWL 2X6UA 2VITA 4XXCA 3LRHA 4WQOA 3SDAA 3NCXA 1LLAA 5IJVA 2P9RA 1F2QA 3ATDA 5D7JB 2FDBP 1OO2A 5D1ZB 3NA4A 4R4BB 2GJRA 4HHAB 4W93A 1BIIA 5DJ0B 1AY1H 4I13B 1S8DB 2BSEA 3KJ6H 4U2ZA 2CIIA 1QSEE 5D1QD 1NGPH 2IBGA 1FORL 2X4UB 3RGVC 3IMWA 5F89A 4Y5YC 4HT1L 4JY4A 3EYOB 4I1NB 1M2VA 2I32A 4JFOA 3GSOA 2ZKWA 3G08B 1ADQA 2HT4C 4R8WL 3U2SA 2EUVA 4YZFF 1CTMA 3AS2A 2HWZH 4UOW1 3IAPA 4UF7C 2VR4A 4K4KA 3ZW3A 3ZE2F 2AK4D 1R5VA 4V1DE 4X99B 3SGDH 4PY7B 3SODB 2TSBA 4OZFH 1IEHA 4NM8L 1L7IH 1FSKB 4ODVL 3BIBX 4MZRA 1AGFA 1J9CT 2VITB 2W94A 4QHNB 3OJDA 4OCWL 4DGVL 5JPMC 2A1WH 2HRLA 3SHSA 3KLHD 2MOQA 2CO6B 5HBBA 1TLMA 3GIZH 1QNIA 3MRGA 2ODIA 3HZYA 3GB7A 1G7MA 3EJZC 3MV9B 4UWQB 2CUHA 1U41A 3B8YA 5FHBH 3SBWC 4ZMQA 4Y5XB 2CGYA 4NBZB 2ARWA 3B1TA 1YQVL 1EX0A 3OSVA 4ZFFA 4N2DA 1BM7A 2YD1A 1S7TA 3QEGL 2GIXA 4PJ8C 3CZFA 3O0RL 5FUCC 4LLDA 1WITA 2JFCA 4ODHH 5FHAH 2N0KA 5HYJB 3Q2WA 5ITFB 3RJQB 1P7KB 5DD0L 3QDGA 2ZX9A 3MJGX 3R4RA 5E2VH 4O02H 2OI9C 1NGPL 4LK4A 2C9SA 4R2GB 4YSDA 2XY1A 1AXTH 3RNQA 3ZDYE 4XB3A 1ZY9A 4EOWH 3BAEH 5D1QC 2FT6A 3GS0A 2W81C 2AK1H 3KR3H 1A6TA 2WP3O 3DMMD 3QAZB 4JDZB 2NXYD 1HSBA 4KO6A 2BSED 4QCIA 4IRJC 2ZXEB 3TN0C 2Q76A 1CXEA 5D70H 1PSKL 2B4CL 5F1NA 3M17B 2FUQA 3IJHA 5KBPA 2PPDA 1EDYA 2GJ6E 4MXQD 1JGEB 2LU5A 3HC0B 4NN7B 3DSFL 1QFWM 2E76C 5AKRA 5KSAD 4TLSA 2XBTA 3GF8A 5F9JB 3QXWA 2CIKB 3W0WE 1U6AH 3DBXB 2DQDL 1LTXA 3ZE1F 2GY5A 1INEL 4DQOL 5I75B 3CVIL 2XA8H 3FS9A 5LB1A 5JW3H 1BQSA 4ONFH 3NSDA 3HC4H 4PTUB 5TE4L 1A6AA 3K4ZA 4D94A 1AHMA 1AHWC 2Q8BH 4Z7AA 1XH1A 2BVOA 4OLEA 1DTUA 5FW6A 1IL1A 3QJTB 2WN3A 3FCUB 1ZTXE 3M1BA 1KGCE 4K5MA 1NEZG 3VMOA 1ZTMA 4IIQC 4OTXH 5DURD 4JY6A 4OJFL 2AK1L 3KR3L 3MGAA 4GLRI 2VRAA 1PCXA 3RJDA 3DYOA 5C9KA 3HE6C 3IDNB 4ZMZA 1QOKA 3GK8H 4WW2C 4WKZB 1ZVNA 4MMYB 1YAIA 3NCBB 2EEAA 3VMPA 2AEIT 2JKNA 1N68A 3IGUA 5F1NB 5CHNB 5TGBA 4WSJA 1O6SB 2PABA 3FQXA 2X4PB 3DRTB 4JFFE 4POUB 4MDIB 2EVFA 2GBUA 3PIQA 3QUML 2WINA 2ZP0T 1HHIA 4OT1L 4HKBA 2HRGA 4A1RA 4M5SA 3TP4A 2FX7H 4UDTB 3GTVA 3TZVA 3EOBA 3OXRB 1B9KA 1YYMH 3G04B 5F1OB 3RRQA 1YEWA 4Z7QF 4UZGA 3UJIH 1U9KA 2WBXA 3IDJB 1IQDB 3VO0A 4B0MB 1N5AB 4BZ1A 2ATKA 3FCSB 2DWTA 4MD5A 1OCCB 3R8QA 3LVTA 4IOFD 2FWUA 5GGUA 4S1DD 3QXTA 1H6FA 3EXJA 1M53A 4Z7OE 5ENWB 1AAJA 1MCBA 4S1QL 1ZA3A 4J3WA 1OP3K 2JCCF 3GIVB 5EN2A 1ZGLP 4TOYH 2YKLL 4DN3H 1NCOA 3ARBD 5E95B 2RHEA 3ZVVA 3DYMA 5DO2C 1PKQB 4FS0A 4YDMA 4X80H 5IBUG 3ESUF 5JYMA 3RPIB 4A7GA 2X1WL 1ZT7A 4YDZA 4M1DL 5IEKA 4M7ZB 1XIWB 5DTFB 1QRNA 5EUOA 2HVKA 3QDMD 5J89A 1ORSA 1KENH 3ECQA 4L3ED 1ZWIA 3DTUB 4M43H 5AD0A 1DN0B 1U95A 4DPAX 4L4TB 2Y6TE 3P9LB 3TPUA 3FO1B 3EIFA 3S4SA 4CU7A 4Y4HC 3UCQA 3IJSA 5C8JA 1WS8A 3PWPB 4L0ZA 5D2NB 2OXHA 3BSZA 1G9NC 4G82A 3W2DH 4LCUB 2Y36H 1I1AB 4J1UB 1A4CA 4JZNA 5DZAA 1TPXC 4ZZFA 5IKCB 3NIDE 2GJ6B 2DQGL 2XETA 2G3ZA 5F93C 3BD4A 3MGOA 4G71B 4ZK8A 5LDUA 3S9DB 4TRPH 3DX4A 4U1GC 4PI0A 3DROB 2P47B 3G6AA 4QRPD 4Z7UF 4HWEL 2ETWA 3QJHB 4X5XB 3ZKXC 1XIWA 4K2UH 3TH3T 5INCA 4M8QB 4H44C 1ZVYA 3HBGA 3BQVA 4HJ1A 3RGBA 3I85A 1NEPA 4HXAL 3TBVA 4X6BA 1RSYA 4MSWA 2ZG3A 5K93A 2H6UA 1XD0A 4HCFA 2WYTA 3JTSB 3MGTA 4J27A 4U49A 4LLWB 2IJ0C 3P9LA 1UTDA 3P0YL 5T1MA 5HYJE 4X4YB 1U8IB 4DP2X 1A7QL 3CUPA 4P2OC 3BFOA 2H2PD 2PCYA 1Q9OA 1NGXA 4ZMVA 4Z7QB 4KQ3L 1P4LA 4EI5A 2FB4H 2ICCA 2HB0A 3POCA 3U9UB 3UIYA 1AJ7L 2V3DA 4JM2D 4JRXD 5F71A 4TTGA 4OZIE 4G9DA 4HKJA 1MEXL 4HJUA 2OMZB 4PLJC 4AXWA 3SKNA 2AABH 5IMOA 1PJ9A 1BDYA 1G7IB 2AAVA 4UQ2B 1N0LA 1JGUL 1JSYA 1XXDC 2MSPA 3DI2B 3A23A 1FRGH 3SKJH 2R59A 4LRIC 4MSWB 5BZDB 2WTPA 1SVBA 4HC1A 4ZMTA 3DX6B 4Z7OF 4XVOA 4WHTB 5EIQA 1JGVH 2KBGA 2GTWB 3AG1B 4KKBD 4HFWB 1MJ7L 3EXLA 3V55A 3QIBD 1IM3B 1FZJA 1MUJA 2HJFB 5AL8A 5FYJU 1AIFB 1E7UA 3US1A 2NYKA 3MSPA 4LVEA 3ULVD 2F8VA 5AVSB 5TFSL 2WQXA 1J5DA 1ULVA 5L2KE 4QT5A 4I5BA 4YDVB 4WW1B 5GS0C 5HPMA 1JTPA 2W0KA 3DHJA 1NZRA 2ZKYA 3QFGA 4ZNEA 2DQDH 1QYGH 3LEYH 1BD2E 2CHZA 2N7SA 2VDLB 4PJEB 1ZHLB 5HHOA 3B1UA 1GYAA 5D1XA 3RVVD 5GGSY 1CL7I 1CCZA 3W3BA 3AS1A 4NQEE 3NIDB 4R84A 2KQNA 1R33A 2A9DA 1KJ2A 3ULAB 1I7ZA 1UYWL 3IS0X 4YDIL 1CF8L 3G9VA 5D2NE 4OB5L 2X4QA 4RAUA 5EBMA 4Y4FD 1MN4A 2H7WA 3HG1D 2DLIA 3RWIA 4BRVA 7TAAA 3D05A 1PG7W 3OMAB 4PMEA 5TD4A 4UU9B 5D2LE 4HFUH 2OMUA 1ZHKB 1J05A 4XXDA 2NY5L 2ICWB 2YPLD 3CFJB 1LEKA 4V11A 4GRWH 4Q9CA 2R1YB 4AV0A 3K2UH 1HHGA 1C16B 3KHOA 5HYSG 5L0QC 3D39E 4A6YH 5C1MB 3NN8A 3CXHK 2WXRA 4NN6B 4WW1A 4I3RH 4LHJB 4P5TC 2FLMA 1GJWA 2OTUA 1URZA 5JORB 4KY1L 4DEUA 4DCQB 4DZ8A 5SWZD 3QORA 3GMRB 2IG2L 3TS8A 3CVHH 3MRNA 4ZO6A 5T3ZD 1QP1A 2P8MA 3L9YA 1X9QA 2DM7A 1I7ZB 1CF1A 4M62L 4YHMH 4AIZB 3MX0B 5G5DB 3APNA 1ZE3H 5MEPA 1E28B 5MHSE 5HDWA 4M5ZL 2WWNA 1TZHB 5AEAA 3FB6A 3FT1A 1ZJBA 5LAXA 4JKNA 4Z3JA 5JW3L 2XICA 4GI9A 3WNKA 2BHZA 3C5XA 3FRPG 2XWBB 3WUWB 1U42A 3BYYA 2FEDD 1TQVA 2FIRT 2Y07H 3KEDA 1WUNT 4XX1E 3S35H 1JZ8A 4RRPG 1BEXA 5F9DC 1W0WB 1RI8A 4DWHA 3V52L 1DBBH 4F27A 4LEXL 3UGUA 1X4ZA 2CD0A 5GSRB 1A14H 2B1OA 4AVKA 3ECUA 4M43L 4UM8B 3ZE2B 1JXDA 5B8CB 1H5BC 2R56L 3AMLA 5EZJA 3WCYA 1TSHA 1KY6A 1CFBA 4PI2A 4UB0L 1T20B 3M1CA 4XNQA 3NJFA 3E3QC 4TPRH 5B38B 5DEFA 2YGNA 1M1SA 1K4DA 2E7DA 4WFHD 2Q7AA 3HNVH 2ZUVA 4ZX3A 4L4TD 3F7YA 1NM4A 1DL7H 3IJEA 4PB0H 1BPVA 1XT5A 3K3QA 2Q3XA 4JM4L 5IMKB 4NP9A 1MWAL 3NJIA 3HPJB 1OAZH 2AKRA 4RQQA 1CUOA 3NFNA 1LEIB 3NZSA 3IT8D 4MNQB 1O9WA 4P9ML 5FYJE 5BRZA 5LBSA 1SY6A 5IK3A 5FGBC 1ERNA 4KROB 3BCDA 3HPLB 1JF1B 1T0MB 1T03H 2KDGA 5TDNA 2H0FA 4DFIA 3T5WA 4N24A 2E6PA 5IBTH 3ZDZF 1BZOA 5ERWB 1TJHH 4MMXA 1X7TA 4OZHA 4WI8A 1I8UA 3U36A 4C4KO 4DGVH 4ZS6C 5DD5H 2BIHA 4NC1C 3VFRA 5LNDA 2P4AB 4X6DA 1KT2B 1QW9A 2WCPA 1ED3A 3FTGB 3L3OC 4JUTA 4K9EH 4GOSA 5J8OA 3O41B 3FTWA 4FXKA 2ALWA 3KVDD 2GSIA 1NANI 5CBAA 3EYVA 5D7IA 3CHPA 3GDCA 5DF0A 5D6CB 3NFSH 1AO7B 3NFNB 5E2WH 4JR9H 3EYFA 2PCFB 4GQ9H 3VXUE 3QUGA 1KDIA 1S7SB 3DV6B 3MXVH 3UTZA 1DQDL 3V6OC 4Q4IA 4U1GB 5KVFH 3BP5A 4M7LT 5L7XH 3SE8H 4XR8C 3BVNB 7FABL 3D85D 4PQXA 3D9AL 1RZJL 2LFEA 1T3FB 3FRPB 1QI4A 1JNHB 1RUKL 4WTXA 3AZUA 4XP1H 5D6DA 1GGCH 3L3HA 3V9CA 1C8PA 5C0CB 1FYTA 2F5AH 3OKYA 1CXLA 4UQIM 1THCA 1MRDL 1AC6A 2K7QA 1I1FA 3T3PE 4OKVA 3GRWH 4GNKB 2J25A 3OKNB 4MLSA 5FDWA 4X6DB 5K33A 1NFIB 3JV0A 4B5ZA 1CYGA 1UGKA 4FEMA 5H37H 3VXTB 3JWOL 4K2UL 2N1TE 2CCLA 1AYRA 4YFDB 4HK0B 1UWXH 3WKQA 1BVKA 5HDLA 1J9TA 4RGMC 3GYRA 3U1SH 4U6XB 2FGWH 1T1YB 4JJ5A 2VRKA 1M2VB 3LRKA 3L4CA 5L6YH 5B38G 5JOFB 3LV3B 5HP5A 3D4GA 3P4NB 3D87B 5CMAA 3OKDB 2UWEE 5GGTL 2H9GA 4FFVD 3V2AR 5LKNA 2CK0L 4PWEA 2JSFA 1NDMA 4GG8A 4FA7B 3DI3B 2JV6A 2QPSA 1U36A 5MERB 1CE1H 4KKLC 3V5KA 3HVDA 1RKRA 5FFOA 1BVLB 1HCFX 1A1MB 2P48B 2PKDA 1BW8A 3JV6A 2XWZA 1TQSA 3FRPA 4JFTA 4KXZH 2IGTA 5DS8A 1V7NH 2EE6A 3N6YA 3VW3L 1EV2E 1KG0A 2X2HA 3GSNL 4HDIA 2WBKA 4W70A 5F0PB 4EF3A 2BCMA 4IHOB 3WEOA 3QJXA 2ZKHL 3RL2B 1GY2A 4AK2A 1XIWD 1BEYH 2Z31A 3P30L 1TTGA 4ISVA 3LS4H 5CLZA 4M8RA 4JAMB 1BVKB 1E27A 2AQPA 4GFXA 2FATH 4UQEA 5DMGD 3P1VA 2NCMA 3KYKL 3ASWA 1RPUA 2HXAA 4ETQA 4QHUA 4F15C 2EH7L 2QPUA 3LNHA 4FQLH 4ZXBA 2P45B 5D1XB 3NK3A 3AUVA 1HFUA 1G7QB 5E6UB 3H2QA 5F3BA 4PW9A 5ADPL 3QEUA 4LOFA 2WQRA 3O2WL 5ISZB 1Y1UA 2NNCA 3B7TA 1SEQL 2E86A 3MHZA 3ABZA 3BFQG 3CBRA 4RFEB 5ITFA 3HIZA 4K3GA 4IMKA 4OLZL 3SE4C 5E4IA 4Z7VA 5K9OB 4Y1AB 2X4TB 3C5ZB 1S9YB 2HFEB 4EUPA 3RNQB 4L1LA 3RY6A 5F6HJ 3SPVB 5IW6A 1M6OB 3UPRB 1NLDL 1NMAL 4L5FE 4OLXL 4KK9C 4OLWL 5GGSB 4IHOA 2J5LB 3ABGA 1KG0B 4BZ2L 3QH3B 3RE0A 4P04A 5FUZL 4C4KT 1F4XL 1F8TH 1RIUH 3B2UD 3RGVA 4NI6A 3UTTB 4JRYD 4XVSH 3R4DA 4N2BA 4XX1G 4PBDA 1KFAH 3EO0B 3V0WH 6PAZA 4I77L 1X4YA 2K3TA 4JFED 3HCVA 2WV3A 4LCVA 1PF3A 3CDGA 4HULB 2KERA 1AMYA 5LXGL 4X42A 4S1DC 3TNNA 1Z66A 3EGDB 4G6FD 1UXLA 1ZANL 1KIQA 1BG9A 1HYSD 4WTQA 1RFDH 3MRDA 5BXFA 5JZ7D 4TM9A 4WHTA 1A9VA 1OL0A 3B9DA 2CWRA 1HC1A 2CJTA 4RBPK 2CO2A 5BRQA 3RWFB 1U92B 2NW2B 1T21A 3RUGA 1V3LA 5C8JB 1RUPL 1ZS8B 3BAKA 3EYQC 2ZJSH 3CHXA 4OIIH 3RGHA 1SEQH 4GIPD 4MNHB 1A4KB 2WM0A 1JV5A 4G9FB 4WFFE 1R6VA 3V4PL 2E9WA 3VGGA 1HQ4A 3VVWA 5KYUB 2R0LL 3KYAA 4PCYA 4GSXA 1MAJA 2EIDA 3VAEA 3W2DL 2IANB 3LN5B 4WW2F 3G5YB 5EC2B 2KZBA 1CT8B 5KBKA 1J5HA 3C5JA 4HAKA 5JLZA 1I7TB 1XR8B 2PYFA 4OV5B 4G70B 3MBXL 2HWZL 3VE0B 4KMTL 1WD9A 3CFKB 4PLKD 4DK6A 3O3BA 4QGYA 4MA3B 3GZOA 3V0IA 4ZAKD 2W1NA 4MHHG 3R7RA 5DZ9A 1MHPH 1IE4A 1FPTL 4HCRH 4OZGF 5F3FA 2ESVA 2Y7QB 1FDLL 4JS7A 3QFJA 2F54A 2G5RA 1U8HB 2J6EL 2MFNA 4JFSA 2E27L 3UG5A 1NBYA 4KY1H 3GI8H 3IB4A 1SHXA 1T5XB 4I4WB 2X05A 5A16A 2PR9A 4Z18A 4FQ1L 3U0WH 1A9EB 5KSUB 2ZCHH 1P84J 2VZUA 2JKRM 1JYVA 3LHPL 5LG1A 3BC9A 4OIBA 1A5FL 1N70A 2G3MA 2P1YA 1WBZA 3GS4A 5ALBH 3IRZA 1PDKA 2OMZA 1SNRA 1ZPUA 3PNRB 3NK4A 4GUCA 1X44A 1ZT1A 2FT7A 1C5CL 1UCBL 4WEUD 4XPHH 3BT2L 4KUCD 2VLKE 2QQKH 3ESVF 1HVXA 4UQ9A 1UD8A 4LL9A 4L1SA 1DVFD 2ESVB 2Y7QA 1YN6A 2J21A 4OQTL 4PJ7A 3W37A 12E8L 3ARFB 1WAPA 2MNJB 1CG9A 2IDSA 3L3JB 3W0WD 1WAAE 1MI5B 2XWDA 3MTXA 1EWHA 3CLEH 2GSIB 5CBAB 2YQ3A 4TLTA 5BZXA 3WTVA 1NCDH 5JQ6H 3Q6FB 4ZPTB 3WFZA 1F1AA 5ES4B 2AQRA 2WLLA 2ZSVB 3L81A 3VSUA 4F1ZA 1T2JA 3MRIA 4A63A 1WC7A 2KKQA 5AZEL 1FZKB 3GWJA 1MHPL 4XBGA 4TULH 3TO4D 3REWA 1FFTB 1KB9K 3FHAA 4FNTA 4GAGL 1LE9A 1AGEA 1KCRL 3LVEA 3LKNA 2WKGA 4OAWA 6PCYA 4QHMB 4JRYB 3VWJA 3TCLA 2YQ2A 5D4JA 4KAQH 4C8XA 2KUTA 3MODL 3LEXA 1NFDA 1E90A 1RHFA 1LO4H 1YC7A 5E8EB 4TKWA 4QTIL 1EAJA 4I1RA 2WB1A 3JT2A 2GBTA 1XCQA 2R0ZH 5CS7A 5HGDB 3RY4A 5EDSA 2MQ0A 3KG5A 2UWEF 4Y1TA 2ZCLH 4FMVA 5FB8B 1KPUA 3GBNL 1WISA 2BWQA 2H26A 1DEEA 2HLAA 3AITA 5C09A 2OPCA 4YX2L 1JG9A 1EAPA 4OGXL 4F91B 3OSKA 4AEFA 1P4LB 3F7RA 4JRWA 2E9JA 4PRIE 2A6JA 1YEJH 1AVAA 4R26H 1VCBC 2YA2A 1PLCA 1J5OH 1YN7A 2LT9A 2AGJH 4PCSA 5I0XA 2PPFA 3FU5A 1ZLDA 1VGKB 2FTAA 5CP3A 4KNQA 3Q5OA 3BT0A 3WUWG 4JKPL 4Z8FL 4JGMA 4M93C 1MZZA 3LEXB 1IGFH 2FQEA 2LLLA 4F8LA 3MLRL 3FUFA 4N8PA 2ADYA 1H3PH 1W0VA 3CPLA 3SOBL 2QKIA 4DNLA 4HALA 3B6SA 3LCYA 3H85A 4ODSL 3HG1A 4U3CA 3QIWB 1UT2A 3Q2CA 4HS6A 1JL8A 4QWWD 1J8KA 2GBVA 4BQ8A 1DJHA 2E75C 2QGBA 3SD5A 3OKOA 3AT0A 2AXGA 4LSVH 5F7BA 1L9SA 2EVJA 1FIGH 2M2DA 3V4PB 1WK0A 4AMWA 4M6NL 4Y16D 4M5YH 2BDNH 4ELME 3MA9H 3NSYA 4TL4A 5I8KL 1XQ4A 3OPUA 1FG9C 1REIA 3V8OA 4G43B 2VW4A 5HYQB 4FJ6A 4YHNB 4AGQA 2CMRH 2IFFL 4EN3D 2WHVA 1KIRA 5DRXA 5E6RB 1BVZA 3QNZB 3HG0A 2B9AA 4L23A 3BZDA 1WHPA 3IMTA 1A21A 1DQML 5DVMA 5SX5H 1BAFL 4RAVB 3L3KB 4WUKL 5ANHA 2Z92A 4RMWA 4ONOA 4OLYH 3WJJA 2AF2A 3C09B 5A40E 5KWYC 4N22A 2HRPL 1AGBB 2VE6A 2ZD0A 2NY4D 4IYKA 5IVZA 4LPXA 2E7BA 2RQEA 1ECYA 3VXNB 1FNHA 3GMLA 5EEVA 3VI4F 3ZKMC 5F1IB 1I7UA 1ZV9A 2UXVA 2ZAGA 2B3RA 3CSYA 4IKLA 3BUTA 1H3XA 2NXYC 5C0JA 5FM8A 1D5MA 5C07D 4AGPA 4C83B 4OF3A 2FSEB 1O0VA 2JCCA 4QF1A 4XCEB 1TJHL 4NQDD 4U1SB 4XN4A 4LSVL 4JM2A 4K7PL 2NT1A 4F80A 2ZOOA 2NX5E 5DK3A 9CGTA 4UDTA 1I8KA 1BBDH 3ARVA 2VLME 1T03L 5HYQA 1LP9B 3WO4B 3BE1H 5BZWB 3K1DA 4X50A 4JPIA 3VGFA 5I1LA 2WXMA 4L4VB 3OAYK 3WLBA 4LPVA 5JDJA 4JGUA 2XUWA 5J12C 3U0WL 2X2UA 1OP3H 2ZCHL 4QHUB 3PQYA 4E9SA 3C5SA 1BLIA 1G6RB 3QDMB 1CDBA 5JLZB 4LSPL 5EU6E 1F90L 4Q74A 1JZ7A 5TQ2H 3MLXL 4HISA 5GSVA 3RVUC 1KTLB 1DJXA 3DWTA 3JWDC 4KO9A 5CEZL 2V33A 3MO1B 5EFIA 5C0RH 4KVCL 4KAQL 3RX7A 5KG9A 2YJQA 2WZPA 3EJJX 5D1XC 1G94A 1OCRB 5DJYA 4EN3C 4PGEA 2L7EA 1FZMB 2YN3A 3UFIA 1E5BA 2HX7A 3EHBC 3MOBL 1AR1B 3PGCB 1MFMA 1GCFA 4FQHB 3RPBA 3RVXD 1ZDSA 1FWXA 3IDUA 4AE0A 1KXTA 3UX9B 4K23H 2BWDA 1V8HA 3UZVA 3QQXA 2ZCLL 1PTZA 4F93B 1NFIA 3QFDA 2ZOWA 2PUQT 2PWFA 2XWEA 4Z7VF 3RLSA 2AJVL 2H6PA 3P3TA 4PS3A 3CZJA 1CE6A 5GJSL 1DVYA 5C0AB 1UQSA 5IM7B 1IC4H 2W0FB 3QDMA 1J9QA 1KXHA 5GIRA 4PM1A 1RCYA 3OD3A 4W9EC 2OKMA 1ES0A 4IOFC 1LK2A 4N0YH 2GCYB 3KBEA 2YK1L 4GKZB 2OSYA 1TCRB 4RGMB 4RMQA 2WQ8A 4EI6B 3QT2A 4X80L 1M3IA 1UYWH 4YDIH 4M7JH 5EBGA 4HXBH 1OF0A 1A5FH 5DJZA 1HSAA 3SDDC 4HDIB 1ZLSL 2W59A 4F24A 4XB8A 4YOKA 2JJSC 4YQXL 3T6ZA 4G1MB 1FH5H 2BW5A 1FFPA 4Y4KC 4XVSL 2B2XH 1XSKA 3MRIB 3ASOB 1QSVA 1SPDA 1XAKA 2JB5H 1JWSA 1AGDB 3D25A 3GSWA 1KXVC 3MXVL 3O4OC 3EADA 2FEEI 4MVBD 1AS6A 1L9TA 4NNXA 4YL9A 5HJGA 2E6JA 4AGNA 1IGIL 2F74A 1K6QH 2QPDB 4N25A 1NJ9A 3KPPA 3L4TA 4IBUA 4NBYB 1XIWC 4HFUL 4YN3A 1A6ZA 1XHHA 4OUOA 1RY7B 1N3NA 3G08A 3HAEB 4YS4A 3ZTCC 2XZCH 4UILH 1MCPL 4PCKA 4EI6A 4YNYA 4PJXE 4J3VA 4ZOBA 4LARL 4KU1A 3WE1A 4HUWB 2EAEA 5KJRH 1AOZA 4Y9GA 2BS8A 2EDFA 2OMYA 3VD4A 4FI8A 1ZA6B 3QJOA 5IROA 2WQSA 2V3FA 4NQCA 4DH2A 3DMMB 2OX5B 5DD3L 5E6SB 4MMZC 2DJSA 2XTJD 3QH3A 4P5RA 2HLAB 5C09B 4TUOB 3S7GA 1GAFL 1AD0A 1QFWL 4P46A 3TBWB 3S3CB 4YXLH 3F05A 1SN5A 1G1YA 1JVLA 2R51A 4NT6A 2MHAB 4Q8BA 4N68A 3QI9A 3DJZA 2J8UA 5GISH 3O6KL 4F7PB 1NCJA 3QJZA 3FAWA 3CFIC 4YLQT 2D7QA 4FQCH 4BFFA 4NC1E 1ZT1B 1INQB 3PXJA 5HDQH 4K9EC 5LGJA 3T0XA 2OYMA 3TA3A 3L95B 1WLHA 3WUZA 5J6GB 1L9MA 1N6QL 1ZTXL 4W9ZA 3AS0A 4NN6C 3MLUL 5IV2B 4BXSV 5I19L 5ITBL 3M86A 5AW4B 4UOJA 3ARRA 1B4JL 4BJLA 4MNGE 1IGCL 1SVZA 4JUSA 4HPHA 1S9WB 4YGAB 4B9JA 1OZUA 4HSCX 4RIRA 4PWGA 5ACZB 5GS2D 2CGRH 1HYRC 2J73A 1GJUA 3BAIA 1GCYA 5JYLA 5AOZA 1TETH 4LCWB 3TZVC 5JORA 4P46B 1FFQA 2VDKH 3TBWA 4LL4A 1FZKA 3KBFA 3WFDH 4KK5C 1OWWA 4QJ5B 2GHZA 5D1QE 3MODH 3ES6B 4NZJA 2VDNB 4QRSA 3DX3A 4YVUA 2NSMA 4KKAD 4AE1A 3UPCA 1ZLVH 4AIZA 4M9OA 5DT1H 5LGJB 4XC3H 4APXB 4Q14A 4YHPB 1N4XL 2DLTA 1H6TA 2I24N 4XNYL 4FKEA 4GKNB 1ZLWK 1PGRB 2ZXBA 4NKQB 2XIBA 4H8HA 3WNOA 3RVVC 2F1BA 3CZEA 2AJ3B 3NQIA 4XPGH 3FXIC 3O3EB 1FO0A 1W6LA 2EIEA 3H6JA 3I75B 1BYPA 3IK2A 1G6RL 2DMBA 3FFCA 1UOVA 2D3VA 4ZW5A 4UQBA 3OJVC 2HPOA 1W16A 3N41B 2X1OA 3LKRB 3DNKA 5AKVA 3CSTA 5DYOB 3B2MA 3FTSA 2CJUL 1OW0A 2HG5A 2WNXA 3MOAL 3TNNB 1QFWI 1IGML 2VN4A 4KI5F 1R0AL 2DPKA 5F21B 2KZKA 1G9NH 4ZUUB 4XBMA 4LESA 4XNQB 3ZRFC 3GBMH 3AG4B 3RX5A 3X1BA 4AL8L 1D5IH 1J9RA 2BSBA 2GIMA 3VXOA 5CD5C 4PJDE 1QWNA 1QFUH 4BM7A 4NNPH 4ENZA 5HXMA 1Y18A 3ARFD 4XXWC 1U92A 3W0WB 2E4TA 3NVQA 2IAAC 5L2JB 3QG7L 2EDQA 4PJCF 4R7LA 1OTUC 3ETTA 1YUKB 2CM6A 3AB0B 4OI9A 4Q7DA 4YHYB 5JOPE 3O3EA 4A6YL 2DQUL 1JUFB 2VB5A 1HNFA 3MBEA 4XNMA 2I9LB 4LKCB 1DUZA 2HT4D 4YO0B 3ZE0E 2FR4B 1SYSB 2K7PA 1KJ3L 5EC2A 1M3JA 3UTPD 1AQKH 4YDNA 2IPKA 3L5HA 2H0PA 3US9A 5DEJA 3Q3GB 3BKYL 2DI7A 5KN5B 3TF7C 3EYVB 5D7IB 1XGQA 4UCFA 2WQWA 1V3KA 3QNZA 5L6YL 4HUXB 3KLHC 1PQZA 5EF2A 4BK5A 5C0AE 3KGRA 1AZRA 2F7OA 1PY4A 3KLKA 5D7HA 2R0WH 3TV3L 4EI0A 5KS9B 4GLRH 4PWKA 3I6GA 2ZWZA 2YWZA 2FX8H 4X7SH 3ZE1B 4X7TB 1QNZH 4XPTL 3T4AB 4MXVF 3GI9H 1JF5A 1SXAA 4E5XB 2K6WA 3PWPE 3KYKH 3MBEB 1DJIA 3UTOA 1N18A 3VYPA 1HZKA 5HVHB 2IPKB 2ZKHH 2CNZA 3CXDL 2O1AA 5K39B 2DH2A 5F0LB 2ZF8A 5JXEC 1AQKL 4LOEA 5SV3A 1HHHB 3DHUA 2YD6A 1LD9B 3MYJA 4PJ8D 5D7LE 1KBWA 4LF3A 3HE7D 4KJYB 4MFHA 1VENA 3BUBA 1BJ1H 3RAJL 5GPRA 3PQYB 3QR0A 5MENE 5KS9A 5LGHH 2GB2A 3GJEB 1HWGB 5KUKA 5DCCA 4BCZA 1V05A 3U4KA 2HLFD 3KXFB 4FFZL 4GG6B 4PJ9A 5DDHA 4FTVA 5HGGS 4AVJA 3KZ8A 2ENQA 3KNBB 2Y4SA 4K15A 5J1AB 2WB7A 2V2WA 5GGVY 3FSOA 4U0QB 4MMZB 1LO0H 3EH3B 3GMMB 1PD6A 1U8NA 5EULV 1NCUA 2AAAA 1NIFA 2JXMB 3GRBA 1J8HA 1OOWA 4OQTA 4OZIB 4J5VA 4Y4HB 1A8JH 3AACA 4XXCC 1TVBB 4C56A 4OCMC 1G6RH 1IEBB 1TZIB 3NSCA 1OT1A 4LHUA 3O81A 4MXVE 4JVWA 4KJYA 5H94B 1PFOA 3PWUB 1NWOA 3IGKA 2OMTA 4S11A 4WUKH 2CA4A 1ZDQA 3HN8A 3KLQA 1KIUA 4XPFH 2R7EB 3C5ZD 5T3XL 3S4SB 2AQ1A 2XFXA 3SDXB 1I7UB 5EF3A 1I9RH 4Z7UA 4KROC 2XN9B 3CDFA 5FOJA 3KPQB 1KACB 4ODUB 4HC1H 1CFSB 1H3GA 1X9UA 2UV3A 3V6OE 3X14B 1Y6KR 4J39A 4L3EE 1AR1D 4H88H 5IQNA 4ICWA 4DO4A 4G8IA 2MPAL 2ZUWA 4KRNA 4L4JA 4XOCA 2R1XA 1CFNA 5AVRB 4F8OA 4M1CC 3QIUB 1N64H 5HVWA 4JO5A 1LXMA 3X1FA 5FYJD 2B16A 4C56B 3D12B 4IEFB 3QYNA 4TVUA 4L8SB 2PNDA 2XBDA 4K7FA 3Q0HA 3WKYA 1XAUA 4RAUB 1ZD6A 3V9EA 3ZZQA 4R3SB 3F7PC 2FJHB 5B39G 3T3PF 5F6IB 1OANA 2QV2A 4PJGE 2Q86B 1D5XA 1B6DA 1JD9A 3MLUH 3HJ0A 4CVXA 5ITBH 1A4AA 2YGQA 4ZO8A 3Q1SL 3CMOH 4X4YA 3TV8A 1U3HA 3UBHA 3CFNA 4KUCF 3C75A 3CVHB 1FV1B 3K7UA 4ALAC 2H8PB 3Q9PA 3Q5YA 3ARSA 1ILSA 3PLYA 4R96A 4ZQTA 1QASA 2DQCH 5CLXA 5I6XC 1LO5B 2G9KA 2WNWA 3GLAA 4XPAL 3HMWH 2HP4A 5DA0B 2BSDA 3U9UA 4ABUA 4HZLB 2PYFB 5FS5A 1DQDH 3EO1A 2O6DA 2ADGB 1N0XL 1UXMA 2X0UA 3BPNC 2GAZB 1HAWA 1EZVX 3OKMA 3QJQB 1IFHH 1UXSA 3KPRE 3FBQA 4AENA 3L7EA 5A3ID 2VDQH 2DQGH 4IEFA 1KXQA 1ZGLB 3FW6A 4MJJA 1GZPB 3QS2A 1NMAH 2AI0H 2R4RL 1RZGB 3O45B 4OJDH 4OLXH 3D2UD 4PG9A 5GRUL 3SYPA 3TGXA 4HWUA 4NIKB 3U7WH 4CU8A 4LKXA 5ESQB 2VDPH 3SBWA 3PL6D 4J3OH 3AT9A 3HNSH 3ILQD 1F13A 3P73B 4HGWA 3QRGL 1K4CB 1BOGB 2FSDA 1GGCL 1S7QA 2BXYA 4U4IA 4JFVA 4ZUVB 3IFOA 5KSUA 3TC9A 4AUUA 4GAGH 2BIOA 3IDIB 2CLRA 4G8EB 2ADIA 4HWBA 2YARA 3UZEC 2F9BT 3OZ9L 5D96B 1TZGL 3QRLA 4HZLA 3NBNA 3QXDA 4XMLL 1DDHB 4JX0A 4CDGC 1VF5C 5MP6L 2X09A 3AJ7A 3JWNH 5HY9B 4L1DA 5DRNB 4PGBB 5EU6D 1HYSC 4M1GH 2I9LA 1RZGA 2FJSA 3F04A 4P2RB 5FHAL 1P5UA 2B77A 5B3JF 1NQBA 4R90H 3ARFA 3L3JA 4M3JA 2ZUXA 1IBGH 1P84K 4AJWA 4D2NA 1F97A 4IKNA 1ODUA 3G5XB 1YVLA 2ENPA 4PJ8B 2FZ3B 3FZUD 4CRPA 4PMFA 3WL9B 2FECI 4WO4C 3HAEA 3QZBA 1R0AH 2UYLB 4K3EL 3U48A 4FQQA 5IT2H 3P40A 4CBZA 2QSCH 3DUUA 1QO3A 3WNJA 1KBVA 1NOLA 4IBSA 2BCKA 3ARXA 3ISWA 3Q2NA 3RIAK 2IGFL 3ESMA 4BWWA 2RIKA 1Z5YD 3M07A 3RWGB 2VN7A 1EO8H 4QJ3B 1B4JH 1F4WL 1UD2A 4AXWB 4Z95H 3CZKA 1CGWA 3ILPA 5EEWA