3UP6A

Crystal structure of a putative cell adhesion protein (bacova_04078) from bacteroides ovatus atcc 8483 at 2.80 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
324
structure length
322
Chain Sequence
TRAQLSIDLVNNVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483] (ZP_02067074.1, SP17169A, JCSG 417104) from Bacteroides ovatus ATCC 8483 at 2.80 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Cell adhesion
molecule keywords hypothetical protein BACOVA_04078
total genus 73
structure length 322
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06321 P_gingi_FimA Major fimbrial subunit protein (FimA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A01
2.60.40.3380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3up6A02
4GPVA 4JG5A 3R4RA 3UP6A 4JRFA 5DHMC 4RDBA
chains in the Genus database with same CATH superfamily
5I24A 1OT4A 3PE9A 2ITEA 5EA0H 1QSFB 4WK0B 4X6DA 2FYYB 1Z9OA 3KWWB 3L3JB 2XPGB 1SYSB 4X5XB 5I1JL 3GI8H 5A2LH 2DJUA 3G9VA 4FZ8L 3UFIA 4CGUB 5JHLL 1JDAA 2YKKA 4H4NA 4Y4FD 2HKHL 2WQSA 1SVCP 2IQAB 2N0MA 4PR5A 5E5MA 1IKNC 2QSTA 2VM3A 5GGVH 5I1IL 4OJDH 5DHDA 2XTSA 4HWBL 5FECA 4EN3B 3HR5A 4XVJH 4WWOA 2DQCL 1ZTXE 1BYNA 1R3LB 3TN0C 1OD9A 1QSED 3Q44A 3LIUA 1PY9A 3CZNA 1CXFA 2VR7A 1K6QH 3E8UL 4PVMA 4FQQA 4RMVA 4D94A 1HNFA 3KG5A 4Z76A 3LRHA 4Y4FA 3PV6B 1I1AA 4Y2DB 5CLWA 4K8RH 3IXAA 4ODWB 2F7QA 2HH0H 1REIA 3D6GA 2OSLB 5I1LA 3VNYA 1Z5LB 5JHLH 3H3KA 3BLKA 2FZ3A 1ITCA 1AZZC 2E7CA 3BP6B 1N0XH 5FYJE 4JRYA 1I53A 1LEIB 4FULA 1A4KA 3FO2A 4R0LC 2Y7OA 3AAZA 5DHVA 5ADOL 1GYUA 5ESAA 2IV9A 4Z3IA 5JW3H 4M4PA 2EIEA 4Z23A 1CDBA 4MD4B 4XTRC 1CLYL 1GGBL 3LXAA 2K45A 5EO0A 5HHPA 4AYEC 3U30C 5KSBE 1HSBB 1QMUA 2LABA 4MDJA 4H40A 4K5MA 5C0IA 5ITFA 2ZWYA 3DTUB 4HF5L 4N5EC 1MI5A 3EO0B 1Y1UA 1JZGA 2JJTA 4PJAA 3C5XA 1SXZA 8FABA 3D50A 2OXGB 3UZEA 4DGVL 5C0GB 1KBBA 1KIRA 4PRBB 1I8LA 4PP2A 2WJ7A 4YHLH 2VDLH 3QIBC 2QTEA 3MBXL 5DJ8B 4E42B 3MGTB 1KDIA 4JY5L 5HJ3B 1UA3A 4HH8A 1M2OA 4KFZC 4L1LA 3WJJA 2UX7A 4NQED 4P2QD 3W39A 3BAEH 5CZRA 2E59A 3SDCA 5BOJA 3BIBX 4G6JH 3RKDC 4GI9A 4AYMC 2VN3A 3TPUA 1A1MA 1GGCH 4NAQA 5GHWH 4MZ3A 4HUXB 2EEXA 1HDMA 4LBEA 4KI5D 4RWHA 2H9GA 4XC1L 1LWJA 5ID0B 3C5SB 3HCVA 3LZOA 3VXMB 2TRYA 4HHGA 3EYQC 1I7TA 2ENQA 1UA7A 4UQIM 3TCLB 1HYRC 3OB0H 1L3WA 3GIZL 4AG4L 4X50A 3U6RA 2BSDA 3RVUC 3L54A 1GIGH 3Q9PA 4UTBH 2GAZB 3NOIA 5EG6C 3U7YL 2YFOA 4DP9X 2E56A 4WSKA 5LBSA 3VI3B 3HI1B 1RQ5A 1SOQA 4ZMOA 3C08H 4S0SD 5CEZL 2G0LA 2PYEA 3IJEB 4MNQE 5AW3B 3KLAA 2NQ3A 4X98A 3RLSA 5F7DB 1G43A 3AG3B 3CK0H 4N8CL 5DC0A 4Q9RL 3H9SA 3CHRA 1CMOA 3AT8A 4MVBC 4V2BA 5DQDL 4L3EE 2X4SB 3HI6L 4OZGB 5D5ME 1ZVYA 4K15A 1JHKH 4N6QA 3VG9B 4MA8H 2EUWA 3CCHB 3KJ6L 1BHGA 4O5LH 3HNVL 2XWJA 4UT9L 2FLBT 1NLBL 3S35X 4EDWH 5E9DD 3IMUA 1JGVL 3HMXA 1DZBA 3PUCA 3WLWD 2V7NA 4MNQD 1KY6A 1MFUA 2CGZA 3PWPE 1UKSA 3F7YB 4TS6A 5ISZB 4XPAL 5D1XD 1AKJD 3QEQA 4FNLH 1ED3B 4G43B 3WXVH 1XIWC 4FLRA 5D2NC 2ATPB 3STLA 2QVKA 3BPLB 3NVQA 1HHIB 4QKTA 4ZXBC 5C9KA 3VD1A 3QWNA 2XVLA 2HLFC 1KB5B 3GC3A 3L4YA 2A3TA 4OM1L 1RUMH 4UT9H 3KXFB 4JM4H 4Y5YC 2EXWD 4NQDE 4G1MB 4U6HA 5DS8A 3UP6A 1OTUD 2WBXA 3F3HA 5FO9A 4LP4A 5KS9B 2FWUA 3VH8B 2GPZA 3QDJB 1X9QA 1L5GA 5I2IB 1C5CH 3V52H 4PRHB 3NK3A 2VXVL 4A7SA 4QDGA 5C09D 3ES6A 2DQHH 2NSQA 1OCRB 3NSDA 1MNUL 4LOVA 1K9TA 5H8DA 1TZGH 5DD5L 2CRZA 1UYWL 4NO0D 3PDOB 5KWYC 3FYIB 1B4JL 3L4CA 4IU2B 5CGYD 3EOAA 4HDIA 4A38A 4O2EB 1I8IA 2BW4A 3MOQA 3TPKA 3ARVA 5K69A 2PPCA 1R5IA 3LAFA 4N9OB 2LFEA 1U4FA 1DSWA 4PTTB 3JVGA 3BRGC 1FN4A 4B9GA 3MREA 4D8OA 4U1SA 2X5PA 1JZDC 2XX1A 1R33A 2YXVA 4GAYB 4LSQH 2NSXA 1VZGA 3OPZH 4NZFA 2EABA 1UACH 1WFMA 3MRHA 2JKNA 4GT0A 1IC1A 2K8QA 3E3QE 5JYMA 2MTAA 3W11C 4TVPE 1NEPA 3I75B 4OZHE 1R5IB 4U31A 3VD9A 4JR9H 1WIPA 4XO3A 2QVIA 4WI6A 4WW2F 3MHZA 4B6ZA 5JIPA 1MRDH 1FL5A 5IROA 1KYOJ 3X12B 3P3YA 5EBWB 3EO9H 4IJ3B 1PEWA 1F90L 3CFDB 4Q56A 1EJ6A 4NZUH 1IBBA 2FECI 3UBXB 3MFGB 1S7RB 1IGTA 2JKJA 3P1VA 4K7FB 1L5GB 5I2IA 1CYWA 3DGCR 5CWSB 3K4DA 2NR6D 3MRRA 4LAQH 3PNWB 2N7BA 4PLJC 4XHQA 2VCOA 3CSBA 3ZE2B 3UAFA 4TNVF 4H13C 1P4UA 1N6QH 1INEL 3WTWA 2YGPA 3WDHA 4PV1C 3SBPA 4PJGB 1BVLB 1WYJA 5D9SB 3VSUA 4C4BA 2IPUG 4ZX4A 4BUHA 3KPOB 4Y4HA 4WU5B 3S34L 3NRFA 2VXSH 4BDVA 2P28B 5DJ8A 3BD4A 1KV7A 1YPZA 5IESL 3WHXA 1IFRA 3HKFA 2OQJB 3GMNA 1I8MB 1YHPA 3GJEB 2ZWLT 1NOAA 5ISZA 2RQEA 1RZ8B 4LEBA 4X4YA 1S5IL 3DMMC 3FT2A 3TBYA 3BC9A 3CUPB 3G04A 4NQXB 3PDGA 4C47A 5ANMA 2EC8A 4LLVB 1NDMA 5TE7L 5I1JH 4BZ1H 3FO9A 1I4FB 3EKCA 3ESMA 3CN4A 2WWMD 1XXDC 4GQQA 2ZXEB 1XAUA 3MV7D 4JY4B 3HLAA 4UOW1 4EZLA 1GYWA 4LB8A 3RWHA 3HG0A 5HJBA 4BD4A 2FECL 5IMKB 3K80A 1F8TL 2VLJD 4R7DA 4AGOA 1ILUA 2HFGL 4M6MH 4FLHA 1NTDA 1U8LA 4Z7WA 5D8JL 1AGDB 2JJTC 4AQAA 3ARFD 1BGXL 3S5LB 1QSEB 5T8IA 4HOXA 1IEAA 2ZYRA 2ESVA 3IXTA 1H15B 1UB5B 3L7EB 3S88L 2HPOA 2YZ8A 2AK4A 4QD2E 5AVTB 2IH1B 5IOPB 4RMRA 3TP4A 1NCTA 5FOBB 3MV9B 2RB8A 3WNPA 2X2HA 2G60H 2VMCA 3WUWG 1JF1A 2X4RB 3VYNA 4XXWC 4FTDA 3SBRA 3GMQA 4BKTC 4XRCA 4H5SA 3MO1A 2YD2A 3NFPB 3VU2A 2X53A 1BOYA 1IE5A 2GHZA 2R69H 5KG9A 5I19L 5SWQA 4POUB 1HL4A 2WLKA 3SGEI 5EHFA 5F89A 2PTTA 4Q6IC 1ACXA 1FV1B 5I76B 1EJOH 5D7IF 2IAAC 2ZUXA 1KN2H 1P5UA 5LN4A 5C3TA 4EUPB 4WEBL 3RFZA 3L3DB 3C8DA 5IVZB 5KYXB 5I1DB 2NW2A 4GOSA 3MRLB 5DRNB 4NRZB 3K4AA 2GKIA 3FRUA 4BZ2A 5D7LB 1QBLH 4LHQB 1AH1A 2DLFL 5JZ7C 4HBCL 3QPXH 3DMMA 1CQYA 1M2VA 2BNRB 3OKNB 1KYDA 1ACCA 2NY2C 3NMEA 4RAUA 1Z5HA 1B88A 2NY6C 1YUHA 1FIEA 2R2BB 4OZFG 4PJIB 5FW6A 3ULAB 2A38A 4I7ZC 4ZMQA 5EEVA 2VSDA 4ILDA 2Q7YB 1FHNA 3AB0C 2AITA 4X99A 4NC1C 3VD3A 1A6WL 2ZOTA 5HHPB 4N20A 3LZFH 4CVXA 1GS8A 5L0QC 1FLRH 1JWUA 5F0LB 2R0LH 2ZT9C 3QZBA 3GFUA 4XOCA 1CUOA 3G7TA 1BAFL 1J7VR 2Q8AH 2F8OA 1WBYB 2Z4TA 3M8OH 1M6OB 3NJKA 5HI4D 1U95A 1K8IA 3KM2A 1G87A 4LHUA 1MI5E 2GTWB 2XWRA 4XVSH 2E9IA 3GSXA 1L7TH 5JQ6L 1NDTA 4XN7A 5J1TC 2VDNB 3GIZH 4H0HB 1WBZB 1NLBH 5E8EB 3L9RB 1JMZA 1JXGA 4JKWA 1RSYA 2QPSA 1OO2A 4GIAA 3HMWL 5C0DA 4JM0A 4FD0A 3QO0B 4KZCA 5IB4B 1MRCH 4HKBB 1MCPL 1LE9A 1CE6A 5D1XC 4BK5C 5A7BA 3T0BA 1O5PA 1NGPL 2R0LL 4D9RE 1FRGL 3UZEC 4FFYH 2IALB 4PJFB 3ULVC 3CFEB 1KCLA 1QABA 4N25A 2FBJH 2J56A 1L7TL 1IC7H 1XF4A 4X6DE 1AGCA 2QPUA 3QHTC 3TBCA 3HG3A 3PRZA 1JTTA 4E9YA 2C1PA 1TJGH 3L5HA 3NRPA 1QG3A 5L2JB 1U58A 2GW5A 3TESA 3LHPL 4JFDD 3HN5A 4FKKA 4X6DB 4Z7IA 5J3HD 2FLMA 3SKUD 1HXMA 5F1IA 4TUJA 1KC5H 4ZNCD 2WOYA 3VFGL 1OK0A 2YJLA 2JI1A 1OHQA 3GS0A 3OHXC 4FZEL 5EUOA 4ZTPL 5L88L 2Y1VA 1GGYA 2VLKA 3D2UD 1FL6B 3ESUF 4IJ3C 2DDQH 1B4JH 4K3GA 4QXVA 1P1ZA 5IK3A 5C0EA 3EAKA 2GBUA 4PWFA 3VXPA 4XO5A 4OF6A 1U8OA 2BSTB 3U9UA 3W2DL 5KYWB 3DI2B 1J48A 3QIWA 1OSEA 1IJ9A 1EDYA 1CGXA 3FQXA 1O7VA 2DY2A 4NNXA 1LL1A 1IC5L 3S8FB 5BNXD 3BYTA 5DJCA 3PLYA 2DYPB 2VLKD 3D2UA 3QUXA 4JGJA 1GC1C 3V2AR 4KJYB 1AANA 3MNWA 1HYSD 1IGIL 2VLRA 2FO8A 2Z93B 2NNAB 3FQ4A 3RWIB 3BWZA 1BYPA 3Q7JA 3QI9B 4HS3A 3UTQB 4AKOA 4RZKA 3GEWB 3DX6A 2V2TB 4P23D 3RWFA 1NANH 4U1MA 1JERA 2CO6B 4U6TA 3MLSH 4OCWL 3KM1A 1E4KA 4PJAF 3OZLA 1U4EA 3QUXD 3TLRA 4XMUA 5J6GA 1CIUA 3MRPB 3R18A 4UV4H 4U1JA 4LRIA 4X7DC 4HFWB 1NC2D 3A6OA 3ESNA 1RULL 1A66A 5H94B 1QRNE 2FT6A 2I5YH 2N3JA 3NCJH 3ZGIA 3Q13A 3GKWH 3HKZA 3VWKA 3B2VL 3J07A 5JMRA 3RIFK 3GI8L 2IOOA 1SDDA 4OBSA 3S36X 2ALWA 2DMHA 4PY7B 4ZW5A 4K73A 3QNXB 2CJSA 3QZMA 1C7SA 4NN6C 1U8MB 3F00A 4AYGA 2FR4A 5SX5H 4ZPVA 4JFEB 4FQLH 2CM5A 3SDAD 4I48B 4K7PL 2CLRB 5DD0H 4ZX3A 2EH7H 4Z8FL 1GW6A 2X3AA 1WDAA 2HMID 1QP1A 3ULVL 1Q9KB 3HEIB 2OMVB 1NCBL 5EC2B 4MNGB 1GMIA 3H55A 1XF3B 2Y6SC 1OP3K 5GRVL 3MCYA 1ZT4A 2EDMA 4BZ1L 2ADIA 3KPRB 3UADA 3SDAA 5B39B 5FWRA 4YAQA 5IB1B 4GUPB 1E9OB 2X88A 4R7XA 1JZ3A 2R1XB 3V6OE 2YR3A 3FRPA 4AIOA 5E4EC 1S7XB 1MCFA 4P99A 1P7KA 2DKMA 1T2QL 3H7BB 4N26A 2VKXA 3RWJA 1P53A 2DYPD 5GGQL 2KLSA 3H9HA 1MHCA 3HTLX 4HZ1A 5KSAD 4GG6B 4PGEA 5CILL 1XEDA 2CIKB 1MIML 4JM2A 1T22B 3DSFL 4OFYA 4YZFE 3Q1SH 2CJUL 2EDYA 1U3JA 4YHYC 4BKLA 3CIAA 5DYFA 4BRJA 3ARDA 3PWNA 4F8LA 4MTMA 4K3EL 2J6EL 3A5VA 3Q43A 4V33A 3EG9A 3LKRA 1I9RL 4JO3L 4WJ5B 4TLTA 1A3LL 2V5MA 4LCWD 4P07A 5I1EH 3HPLA 5MENE 5GRJH 1JMXA 4ZS6C 2Z9TA 3EDFA 4AGLA 1MFVA 2MKWA 3MJWA 4YZWA 3UTTB 3C87A 3A47A 4KXZH 2W95A 3KYMA 3UJJH 1CFVL 2AABH 4N2GA 5CP3A 4AEEA 2OV0A 2BIMA 3NJLA 4KUZL 5GZNA 1FNSL 3EH5B 4JPKH 4NIYE 2B8OT 1AXIB 3ZE1B 2YOCA 4X6CE 2F53B 5D72H 2VM4A 4IMKC 4JO2H 3U4EB 5DJ6A 1VACA 3F7VA 4NQQA 4DPBX 3A6CH 4CU7A 3W56A 2P5WD 1Q9OB 3CH1B 4HAGA 5AYUH 5HDBF 3TZVB 3P0VL 1VDGA 4XVUD 3B3IA 3UTQA 2NYYD 43C9B 1G1OA 3QPXL 3O0RL 4M7KL 5D7JD 3CU1A 3R1GL 4G9FE 1JF5A 3K8KA 1HI6B 3K71B 4AG4H 1OAXH 1NGZA 2XNAB 2JF1A 1NCWH 1MHCB 2B3RA 3D69B 2EJ1A 3EYVA 5SX5K 4D8PA 1I1RA 5B22A 3RIKA 4F7MB 5EWIL 3CNKA 2MSPA 1PNCA 1WBXA 1EJOL 5C08E 2CBPA 1WA2X 2Q2EB 2M8XA 3CDFA 4BUQA 3B1UA 2N4IA 1E65A 4JO1H 3QEQE 3RWCB 4BZ2H 1AZUA 4E9XA 3VSQA 3GSVA 3MRFA 4LSUL 5D96C 4QHNB 3H9SD 3WTXA 4LIQE 5C7ZA 4LRNH 2OZ4L 2RFXA 1IJNA 3NJXA 4MMZA 2X4TB 3WMSA 1W91A 2QMJA 4HUUB 4X4KA 4N1CA 2FEDC 1OAKH 4OZ4A 4PJBE 4I48A 4JFFA 1MFEL 1CDYA 2JQMA 5CP7A 1MRCL 3WNOA 1OLLA 2W81C 4HOWA 1XIWA 1UB6A 4HUWA 1LP9A 2R69A 5A16B 5EIIA 2H7WA 4LPYA 4PAZA 4HCRL 4F5CA 3QFDA 5GGUB 4AIXA 1N8ZB 4ZMZA 3QRFM 1J8KA 1OM9A 4J4PD 5E8PB 4FFWC 3VAEA 4IEFB 4U4IA 5KZCB 4KX7A 2C9XA 1X5LA 1OHZA 1AHKA 3BPCB 5CSGA 4M3KB 4NKMA 4L5FH 2R0KL 3ZKMC 5I6XC 5DWUH 1CFBA 1IBDA 2KMWA 3U0TB 1I8AA 4JPVL 4PJFE 5FPIA 1OP9A 1R9FA 3S36H 3QR2A 5GS1A 3T2LA 2B20A 4ZW6A 1T0PB 1KTBA 3EGXA 4HPOH 5E4OA 2HLFD 5HPMB 3QK0A 4WU7A 1E42A 1U95B 2DDQL 5DRXA 2ZCZA 3F8UB 3P9MA 1C1EL 1ZIBA 5ANHA 3NIDE 1KJ3L 2H6OA 4N2BA 1N2RA 3ZDYB 4BCXA 2APFA 3SGEH 4OI7A 4PBXA 3ZKNC 2EAEA 3BUDA 4GKLA 5DF0A 4G83A 4HIIA 2ORBL 3EGDA 5C6PB 1CDHA 4J3OD 3B56A 1FFQA 2VUKA 1AO7D 1EBAA 2W8CA 3QA3A 5IBUG 1TJHH 3PQYB 3CVHL 4IBTA 4GKSA 5AOMA 4RCAA 1NCOA 3W0WA 3HRZC 4HWZA 3MYJA 1ZKAA 5BMFH 1NPJA 4KRPD 4RBPH 2P24B 5I1CH 4ELME 3MCKB 4ZOCA 3LV3A 1MHHB 3WBDA 2ZUQC 1A1OA 1C1EH 5EU6A 4U1LB 3IS0X 2MRYA 3GXPA 2GT9A 4LGSB 4UBDD 2Q5BA 4G5ZL 4L1SA 2V5YA 4M93B 1UKTA 3LS5H 2HSIA 1MH5A 4PP1C 1QTSA 5HHME 2AV1A 1JHLH 2AK4E 1N64L 2R1YB 4TNEA 5F7BA 3UTPE 2H41A 2H5UA 2ZOUA 3GLEA 5H35A 2EINB 4BBWA 2X4UB 5AKVA 3QPQD 4S1DD 4XNDA 3A21A 1FZJB 3GBNL 3QWOB 2ERJB 3QDGB 5FUZH 2IQ9H 4HPYH 5A1AA 5HVHB 3N43B 2X4QB 4FLSA 1EDQA 2YAFA 4M9PA 4PJGE 4PJEE 3LIZL 1ZD6A 3QEUA 1EXGA 1T5WB 4RBPK 2LQRA 2WLIA 1MHPL 3N6YA 5KBNC 4C83B 1BF8A 5J7CC 4G6KH 2C9AA 5I66B 3N2JA 4XNQA 1T21A 3ASWA 4YDLC 4AL8C 1MVUB 2CNZA 3V6FA 4YXLH 2WGXA 1E28A 5C0DB 3HNTL 3NN8A 3NZHH 3L7FA 1ZV5A 2KLRA 2AXFA 2PCPA 3RHWF 5E8NB 5GS0H 2OMUB 5LDUA 4ANWA 2EE6A 2A6KA 1NCDL 3VJ6A 4BFRA 4Z7WB 1H3XA 2G9HB 1BQHA 2HUHA 1TYJA 4PRAB 1SHWA 3O6KH 2DQDH 4MYWB 1JZJA 3ZDXB 3ULUC 1I3VA 1NCJA 4QRTA 1BW8A 1LO4L 1PJ9A 1BFOA 3BZEA 2BWQA 2NSMA 1DL7L 3LKNA 3TTSA 2Q7YA 3BKYL 3VVVA 3RZCC 3TF7C 5DUBA 1ITBB 3MV7A 3NH7H 2OM5A 1ZT7B 2HB0A 4LLVA 5CNHA 4EBQH 4KQ3H 5BUPA 1H9DA 5DD0L 2H6PB 3D39A 3UO1L 4TUKL 1PFOA 1QHPA 4HIJB 1ONQA 5EFIA 2H6PA 4NDMA 2MJWA 4DVBA 2X44D 4K23H 4P5TC 2Q3XA 4Q2ZA 3QUGA 3VXNB 4TULH 3WJJC 4AMKH 1GSMA 2VLLB 4XMTA 1UQSB 2HG5B 2J4WL 4LSVL 4DW2L 2OTUB 3F7LA 4YIQB 2JLLA 2VRKA 5LAPA 1YY8B 1LO4H 2BZ7A 3V7MA 5AAPA 5MENA 2H3NA 1FGNH 2X0WA 2HLEB 2G5BA 1OGPA 1R5WB 2VE6B 2W0LA 4RAVA 3IBEA 3O2DL 3US1A 4CC4C 4ZUWA 1KACB 2J20A 3ROOB 2CA4A 5F9WB 1X5YA 3BE1H 1G84A 4ZO6A 1Q72H 1WEJH 4PJXB 3VW3L 5FLVA 3D30A 3DVNA 3OR7A 1PVHA 1AACA 1SVZA 1PKQB 1MIMH 5IV2A 4XMKH 3O6LH 4GKNB 3P2TA 5EBWA 2GQHA 1UM4H 3KPQB 2DL2A 3MJ7B 3ZQ9A 3ZTCC 1PD6A 1HQ4B 4NFCA 5T5NF 5HGBA 4M8VA 4XNQB 1DQJA 4KHXH 2AJZB 5JPMA 4QRQB 1FO0L 1CK0L 1JPGA 1QBAA 3MRKA 3RUGE 1T83A 2QV2A 2Z35A 2D4FA 4XCYB 2WMPB 3S4SA 1XCQB 3T1FA 1AOHA 2OMZB 4ZJ9A 3CFBA 3OKOB 5I1GL 1HOCA 2H2SC 4MCMA 4R9HA 5D1ZA 5D6DC 3M86A 1DBAL 1DLHB 4H0GA 5IHLB 3P73A 5BOZG 5LAXB 1TEYA 3GO1H 4KI1A 4HH9B 3NJJA 1ZDSA 2B1OA 2OTUA 4ZMWA 4I87A 5K9QG 3TEXA 1FNLA 3ZU8A 4WV1C 2QPFA 2HJFB 5IHBA 1NDMB 4Q2ZB 2OMUA 3VXNA 4CW1B 3MRMB 1R24A 3CUPA 1U93A 4MNGE 1D3CA 2CLVA 4MA1C 5JQ6H 5D1ZD 2C7UB 4AK2A 2O93L 2WNWA 3ZKSD 2OQJA 3GMNB 2EIDA 1X7TA 4DUVA 3MLZL 1J12A 5LCVL 3WGUB 3KPOA 3FSAA 4ZOEA 3M46A 3MV01 3VXTA 1PU0A 1NEZG 5TF1H 2DAVA 2PP9A 2PW1A 3DVNB 1F42A 3KLHD 4PLKD 5KUKA 4KH9A 1SLUA 5C97A 5CR1A 2NY6D 2IDTA 3MV11 2WWKT 4KJQC 2FVNA 1XSKA 5CEYA 3MZGB 2YD5A 2R1YA 5E8OB 3RUGF 4LBAA 3BW9A 3LRKA 3NFSH 3Q8EA 5CWSA 2HTKC 3DBXA 2YUXA 1XDTT 4NHCL 2LT9A 4L5FL 2OZ4H 3ORJA 4X6BB 4FFVD 1WIOA 3CLFH 4U1LA 2OW7A 2NY1B 1P7BA 1N7ML 3OC5A 1G7HB 1CD1A 3LMJL 1FL5B 2WVVA 5G5DA 4X9YA 3W11D 2VXTL 3MXVL 5LBSL 2QEJA 3KBPA 3ILQC 4WUUD 4EZJA 1D5XA 1NBVH 4F37K 2DOCA 4FNUA 1BQSA 2PUQT 1TEFA 2APBA 3RPBA 1RFDL 3ARBB 1P7HL 1FIGH 3CVCA 4OM0H 4PREA 4Y2LA 1D5ZA 1IFHL 4GO9A 3P2DA 5SWSB 5LWYH 1T0OA 3H9SB 3GIVA 5TF0A 2EXYD 4AENB 4YGVA 1UEMA 4K7PX 5EEYA 5HD8C 3VD7A 5F7LB 5CP7B 5HDBE 2QQQA 5D7JC 1OTTC 4RFNC 2VXTH 5GGVY 2CG9X 4R97B 4AQZA 3BT2H 2FJGA 4IBLT 1XSIA 2OMBA 2Q76B 1ZTXL 3S97C 3CXDH 1HZHL 1UCTA 5HDBB 3ARFA 6TAAA 4R4FL 2NLJB 4J3SA 2P5EE 3MYJB 4E9WA 1F3DH 2SEBB 5KBPA 4I18A 5LWYL 3IGLA 1LLAA 4CU8A 1SHMA 4ZK8A 2XWZA 2QKSA 4UDTA 5BZXA 3MOAH 3UTPD 1OGAE 1UT2A 4FXGC 1IM3D 3FSVA 2BXYA 2FJUB 2BVQA 3CFKA 1FZMA 3AG4B 4CDHA 3QNZB 3DO4A 4XCEA 3C2AL 1MNNA 1UEYA 3EZJB 1AGBB 4ISVB 4IRZA 3ZUCA 3EYUH 4D9RD 5GZOC 1EHKB 1MH5B 1FQ9C 2ADFH 5AKTA 4PY8J 5JO5A 1WA0X 2CH8A 1SJMA 5ERWA 5FAAA 5ABDE 5FGCE 1HFUA 1I3RA 4KKCD 3UTZB 3EO0A 3NIGE 4WTZA 1NWOA 4YX2L 1EO8L 4XNZB 2OR9H 5F0JB 1CR9H 3LS5L 2DTML 4XVTH 3EOBB 4U1NB 3H3PL 4H2CA 3FN0L 3BEVB 5F7KC 5BW7C 3AVEA 1J5DA 2OX5B 3ARZA 4PGCB 4UT9A 2WCPA 3PJSA 1YNTF 1IAOA 3QO1A 3QA3B 1EUUA 4R26H 3ULUF 4OZIE 1EAJA 3GZKA 4NUGH 3JV4B 1TZ8A 4CUCA 1E4XI 3II1A 1UD2A 4WJKB 2WINA 3IETB 3AY4C 4GW1A 5TDPB 4ALAC 2WBJA 2ICEC 5LGJB 1C9SA 2VTFA 4AYID 1WD9A 3BKYH 2VN4A 5IQ9A 2HAZA 4Z7VB 4ZBJA 4G7YH 2GAZA 4W9EC 4JL1A 2XC8A 1JK9A 3D9AL 2VOTA 4QWWD 5EORH 1JZ5A 1MJUH 4WTQA 5CUSH 3K6DA 3B9AA 1QVOB 4QT5A 2EECA 5IHZB 1E67A 5DD3H 2H1LM 2EP6A 2DQMA 4BWTA 5JOFB 1JZ6A 3GSVB 2R9HC 1UVQA 5JHDA 1MVFA 2VISB 4LSVH 3V52L 1P4BH 4ODVH 4KMTH 4UM9A 4QHMA 1KCSH 5I8KL 5LHDA 3EF7A 3GRWL 4NFBA 4TSCL 1ZDQA 4YDVB 5F72S 4PJAE 5A2JH 3GBDA 2L0DA 1E9QA 2XWTA 3O6FA 4X9FA 4RMSA 3SCMA 1ZT4B 5E99L 1RUAL 1YEWA 2FYYA 3QNYB 2X4OA 2HKFH 2R15A 5AVQB 4JFQB 2CR3A 5JHDD 4I89A 2GSGA 3NACL 3RX5A 3EXJA 1XIWB 3CZGA 4XMKL 2ZSVB 3IEAA 1K8DA 2D31A 5L7XL 4V1DD 3QIUA 5D2NA 3WFHB 1JPST 3SQOH 4QHKI 1E6OL 3H42H 4F2MB 3BH8A 3DYOA 3CZSA 3IMWA 3L4TA 1ND0B 4NZRH 1WUNT 2EC9U 4PIBA 4RFNB 5E51A 2LVCA 1JBJA 4MCZA 1FGNL 3NZSA 1IO4C 3WMQA 1TOXA 3D25A 2R29L 3I9IA 4F7CB 2GBTA 4DTGH 2DEXX 2F2HA 1SHXA 3ETTA 3T0EC 5HHQA 4YEEA 3J8F7 4O51A 1SVBA 4BZYA 1L9SA 3MV7E 2BCMA 5ICZA 3KYKL 3MRNB 1N6VA 3DOSA 1T2JA 3EOTL 4Y4KA 5GS2D 4PP1D 1Q9KA 1AFVH 1RIVL 4HT1L 2GBAA 5DI8B 5HGAA 2HT4C 3ARDB 2CUMA 1QWUA 2C3VB 4RFOL 1PG7X 1XCTA 1MIEH 2FQEA 4X6FA 1DVFD 2BY2A 2FR4B 2DQJL 2ZTBA 2AI0H 3GKZA 4QTFA 4X6DF 5DJ6B 3HZVA 3AQXA 1DJZA 5AW9B 3VACA 4AVKA 1C16B 2JB6B 4FI6A 3ROLB 2ZWSA 4HJSA 5CZKA 3ZDWA 4I4WA 3X2QB 2W65B 2EO7A 3GSRB 1QFPA 3H7BA 3KHQA 4GW1B 1D5MB 4NNXB 2R1XA 1A5FL 1JFQH 4Z7OF 4IRZL 3PREA 1WAPA 5GGSA 3RY5A 4G1EA 3H0TA 1G7JA 1F1GA 4W81A 4QXTA 2D0HA 5GJTH 3KWWA 3OGOE 3VWKD 4K5PA 5MHSE 2LAAA 4TUJB 1U41A 3D34A 2VJ8A 3OHMB 3QJVB 2VLME 1MCQA 1T1WA 1MCKA 3IF1A 4BE6A 3UBFA 1L9OA 4X5LA 4X6CF 3P02A 2OJEB 1GJWA 1E6JH 3OAUH 3V0WH 3WFHA 4APQD 4XPHL 3MXVH 5TH2B 5DUJA 1FVCA 1G7IA 1GOFA 4FMVA 1F86A 1A9VA 1SMAA 3QNXA 3JTTA 4Y9CA 3V0VB 4MS8D 2VW4A 3S3DB 1SDDB 3T77A 2YARA 4QHUB 3RVVC 4Y5VC 3U79A 1PZAA 3CD4A 1CFNA 5JW4R 1DE4A 1IBZA 3HVNA 3R8BB 1LEGA 3PGCB 2Z91A 1ZANL 4YDVA 1MFMA 4KKPA 3L2NA 4UT6L 4WTZG 3LOWA 5CJ5A 1GW0A 1T6BX 1HHJA 4HKBA 1NC4A 2GIYA 3BZ5A 5DEFA 3BCDA 4GRWF 1X44A 1XAKA 4YFEA 2XBZA 2EXSA 1S9KC 4AQ1C 2IXQA 2Z4QA 1AI1H 2J44A 3GBEA 2QR0B 4LLDB 5H37H 3V0GA 5CJXA 3VFOA 1OW0C 1IBFA 4KTGA 5KSAA 4FTVB 2Q86B 1AO7A 2F1EA 4N2HA 2YBRB 1NSNL 4RESB 1U58B 4TTDD 1FIGL 1K4DA 4OM0L 5IMOB 1TQBB 3HHMA 4FQJH 2A9AA 2HRPL 3I84A 3JTBA 5FYLE 2BMKB 4S0TD 1QRND 2A83B 2R29A 3DVGB 3PWLA 1DJGA 1LWRA 4FQXB 4QCIB 1VADB 2XZQL 3HE6D 1JZ8A 1AQKL 1NJ9B 2NXZC 5CCJA 2ZKXA 1AZCA 4F8QA 2FX7L 4PG9B 4NB7A 4PV9A 3EJZC 3EYOA 4K0OA 1KF9B 3HPJB 3IDNA 4LU5H 4N0YH 3N0PB 2XIBA 1OB1A 1HHKA 4PRPA 3QQNA 2PWEA 5FOJA 4OLYL 5F6IC 3B7RL 1MHPH 3HBQA 4G42A 1AG6A 3POCA 2AEQH 4WK4B 4MJID 5KOMC 5I8EB 4UQ3B 4O9HL 3B6SB 4F1SA 4YSRA 2GTWA 4YBHA 5DVPA 3AY4A 3MRDB 1PZ2A 2XICA 1D9KB 3SJVD 2IGLA 1P2CA 3HUJB 4PRNA 3WELA 4A2FA 2XWBA 3CQFA 1RPQA 4LVEA 2BWIA 4TMPA 3UGXA 2JFCA 1UH4A 2QQNH 5HHNB 3Q2NA 5IF0B 4X5WA 4RDQF 2GCYA 4OLYH 5AVXB 1OW0A 2GUOB 2R4SH 3KDMB 3LKOA 3FOMA 2W60A 4FQ2L 4NQEA 1FRGH 1DJHA 4P5MA 3SO5A 1VEPA 3OAZH 4HAFA 3OKNA 2SEBA 4ZXBB 5EU5B 3D0VB 2YD8A 1EO8H 1ZJAA 4HOMA 4HX1A 2NLJA 3BP5A 4FYTA 3MV8D 4A7GA 2FWLB 4MMXA 3QRGH 4ZMVA 3ELQA 3BMWA 3H9SE 4EIUA 2BVTA 3BQUA 4HGWB 1WFTA 1TZIA 5E0FA 2WB7A 4KK5D 2YD0A 3K8MA 3WS6A 3MFFB 1KWGA 4KK9C 1WSST 4FABH 3O4LB 3RGBA 3P73B 3DETD 3UACA 4BSVA 1FNAA 4YBLC 1H8SA 1OCCB 1DP0A 4HEME 2LHAA 3ARWA 4K23L 4NUGL 3D33A 4WGVB 1ACZA 1NCCH 2NNRA 5FK9B 1CIDA 2FCBA 1SNRA 5DJXA 2VW6A 1E5AA 1HOCB 3VWJB 2A9ML 3RNQB 5E2WH 2FNWA 2WSPA 1OGSA 1MREL 1CFSB 1S9VB 1ZGLM 1GZQB 2CKBL 4OV6F 3JTSB 1DVXA 4E9RA 3GMQB 4LPUA 4V2CB 2ZCLL 3RUGA 3O2DH 3QR1A 1SYVA 1A9EB 3TN0A 1B6DA 5MEND 2CD0A 3RUGB 1PY0A 3TBYB 4POZC 1DVSA 1M2VB 2BNRA 4LCCB 4AZUA 1Z0NA 2UVEA 1KIPA 2IGFH 2MNUA 3GUFA 1E43A 2QGEA 1V7ML 4TPRH 5BRZE 2CIIB 3NESA 3DIFA 4KNQA 4P4KA 3SIKA 3WLBB 5KYXA 1WBZA 5E8EA 1YA5A 3FT4B 1GJUA 2BSRA 4G8AC 3VFNB 3S4SG 3OR7B 4KHXL 1A4JB 1HCFX 1CXKA 4XX5A 1INEH 1AHWC 3SKOB 3LRGA 1OPOA 1X5AA 2WO3B 4GUQA 3O9WC 1QLEB 4C59B 3CVDA 1B2WL 4QGYA 3MLSL 4Y19E 1J8SA 1KN4H 1BFVL 4MMXB 3OZ9L 4L3EA 1YY8A 4PV8A 5CXPA 3MGAA 4HIXL 2F19H 3CZUB 2BVYA 1MAML 1CZ8L 1LO0L 2E0PA 2IDQA 1PAMA 3NZ8B 3A4DA 4UUJA 5D2LB 4JZJB 2I5YL 3NCJL 2OJ1A 3MX0B 3GO1L 1AAJA 4GS7C 2XPYA 4RISL 4Y4KC 2WZPD 3WTTA 4FQPA 1U0QA 1XH1A 3PUUA 1XBRA 2E9JA 1ET5A 3EXLA 5FYLH 3MRMA 3VXRB 2DMGA 3TBSA 4ESKA 3UAJC 4PRNB 4FQCH 4K3DL 4WU5A 1P5VB 1F3DJ 4XZUA 3WS3B 1NBYA 5CCKH 1JPFA 3DOHA 2P80D 3B6SA 1PX8A 1ZV9A 4J3WA 3RZWA 2FO1A 1GHFH 2WZPA 1FN4B 1SJVA 2W88A 4LCWE 4U05A 5IMKA 5J4MA 1C7TA 1JNLL 2ZYIA 1P4IL 3X3GL 2EKSB 1UG9A 2NZ9C 3VMNA 3AJ7A 4ONFL 1EZSA 2CNYA 3KYKH 1AD0A 2P5PA 2Z1PA 2IH8A 5E4AA 3V55A 5KVEE 2V2XB 3AB0B 2JJSC 4C4KO 1IGTB 4HCFA 3WAJA 4HT1H 3MOBL 2AMUA 4UIMA 1S9XA 4MWFA 4DPRA 2BRQA 1EAPB 1W80A 4QJ5B 3QCUH 5F1NB 4ZG1A 1WG3A 4EVNA 2LLGA 4OJAA 4YS4A 4NHCH 4OKVB 4ACPA 3V5DB 1I7ZA 4X7CC 4F2ME 2WKGA 1L9MA 1OSPL 3LN4A 1JK8B 4Y4HB 3QEUB 4H8QA 2P43B 5C0BD 5C0AD 4OJFL 1IEBB 3UJIL 5JHBA 3G08B 4MAYC 4NN7C 1ASOA 4QRSA 3Q2WA 3QB7C 5DA0B 1Q0YL 2X2YA 2BZCA 2CRYA 4YQXL 3M1OA 1JWMB 4K3EH 3KPMA 3L6FA 4PWEA 1AGFB 1BF5A 1SXAA 3SE8H 4RMBA 5HDRA 2F54D 3GJFH 1F13A 1OGTA 5CKAA 3INOA 3HHSA 4R96B 1CCZA 5LQBH 4G9DB 5EEWA 3NCXA 2B5IC 3NSXA 1EGJH 1CFMA 4MXQC 5ESVB 3MCKA 2EIZA 3HE6C 4G9DA 3L17A 4FF9A 5HYJD 4H26B 1DN0A 3N1PC 2WTOA 2VIRB 4JY6A 2F1AA 3A23A 2DQTH 1VFUA 4QTHB 2R39A 3ZT7A 3BAJA 3F58H 1JGDA 1BQ5A 2J88L 4GKZA 2W38A 3KWVA 4X8CA 4NKIH 2CKBA 4OGQC 5FDYA 4U6VL 9CGTA 3WNJA 1BMZA 1GMEA 3QZWB 5FYJU 2W5PA 4QRTB 4NN6B 1F1AA 1RJLA 5F7DA 1HT6A 3F64A 4FQ1L 5T1LA 3FFOA 3SE4C 4ONHB 1MQKL 5JHAA 5DRXB 2EH8L 1T2XA 1T7XA 2WIMA 1OB0A 1ID5I 5HPMA 4OKVA 1A6TA 1NC2B 1BVNT 3CFDA 4MZ2A 1U8NA 3HNSH 4PWJA 4LDEB 4XXCA 3ZOAA 2FDBP 5FLUA 3PAUA 4JFZH 4TRPH 1UM6H 5TQ2H 2WYIA 3RGHA 3TO4A 1CLOL 3FB8A 2XN2A 4P0DA 3N9GH 3A4EA 4G8GA 5ACZA 3O3BB 4CMMB 3LS4H 4JFDE 4XC1H 3FT3A 2ZUYA 3H7LA 3SYCA 4LKCB 4KTEH 4LSUH 3GXTA 3EHBB 1S78D 3QQDA 4KTYA 3SJVE 1RIHH 4FKEA 5E4EB 3FZUD 3QNFA 2UVFA 3MRHB 3APNA 1EVTC 4KNUA 4ODUB 1WHPA 1J8HA 2N56A 5D5MB 4LVNC 3VFUA 2AVGA 3QBTB 5EZJB 3LHPH 3IAQA 1EX0A 4ZSOB 1COBA 4AL8H 2FT7A 1MW3A 4GFXA 4Z7AA 3IJ9A 4JFZL 4TRPL 4L3CA 5TQ2L 3MNZB 4JFFE 3N42B 1SUHA 3N9GL 4XBGA 5DMYA 3K81A 5CEXB 1E0OB 4G59C 4PU2A 4ZTPH 5K9OB 2GJ6E 4OF0A 1HILB 3ZK0A 2CBTA 1AYOA 4MAYB 4NN7B 1LVEA 5G2NA 4ELMF 3SE3C 2E3VA 1B0GA 2VAAA 3RDTD 1DJWA 1I9IH 3IDUA 1PPIA 4MYPA 4HSQA 1G7QB 2P52A 4PV8B 5FHBL 3ZQWA 4QRRA 4YSEA 1DANU 5FM8A 5T3ZD 4Y2DD 4LCUB 5HGGS 4MSWA 3WL9A 4HUVA 1MLBA 3TC9A 5T1MB 1SN2A 4A55A 4HPOL 1NAMA 3DROB 5AW4B 2YD6A 4TLSA 3HS0B 4M48H 3IFLH 2O6CA 3BP6A 3MGTA 2WQAA 4BQ6A 4ZTEA 3CHOA 2C5DC 5E8DH 4KY1H 5I8OH 1I1AB 4Y2DA 1J18A 1A9BA 4O4YH 4R2GC 5F7EH 4L2YA 3BSHA 3NACH 3U4EA 2J21A 3VRLF 4FABL 3DJSA 2NZIA 3VRIA 4ICXA 3JZ7A 5CU9A 1I7TB 3TCLA 2VQ1B 4WNJA 4X6CA 1OQXA 1ZHNA 3B9KD 1JV5A 2H9GB 4KXCA 3SYOA 3IRCA 4PW3A 2VXVH 3DIVA 4X6CB 1OAQH 3B2VH 1NIAA 2PYFB 1BAGA 5HDWA 3IFLL 3JYCA 3HZMA 5FYKD 4PJBB 1WGVA 3AAZB 3NEOA 4OR1A 3UG5A 1JK9B 5B3JF 2UZIL 5HHOB 2J72A 3OMZA 5C08A 2YJQA 1DQDH 3QPKA 1BAWA 1RIUL 1LO0H 4G6AD 4Y5YA 4ZAKB 3BP5B 2HX8A 3VXUE 2F61A 1G9ML 5T1DH 3WJLC 5EF3A 4KFMA 4NQVB 4ETYA 1NCBH 1HN1A 3VB8A 2LV4A 1VZHA 3EYFA 1A7PH 3RGVA 4NQTA 5AB1A 1JOIA 2ED7A 3EJTA 3NSYA 1B0RA 4A7TA 1BF2A 1XMWA 4DQAA 1MY7A 1UJTA 5C08D 3L3GA 4GG6A 2EVIA 3U4BL 2FEDD 5D7LD 1GZHA 4HS8L 4N90E 3DK2A 4J3VA 4N9GA 3GNML 5ID1B 5I1IH 3ARSA 2O6FA 2G3XA 2YKLL 3NEEA 4AEHH 1UD5A 1LWHA 1XTMA 3MUUA 4X42A 3UBXI 3WAKA 3ZO0A 4QWWC 5FM5M 2OYPA 3EO9L 5DJYB 2OYLA 5DHVB 2G3MA 1X7QA 2VR4A 5F1OB 5BXFB 5CEXA 4EAEA 5ILTH 1XF3A 3LZNA 4OLUH 2R8SH 2TSBA 3D69A 4D8PB 1OEZW 4IRZH 5D55A 1OALA 4JRYB 4MJ4A 4HG4J 2W0PA 2JKSA 4XAKD 3CFJB 1WTGT 3TV8A 1LNUA 4Y1SA 4WGKA 3RVTD 43C9A 4U1KA 3WU1A 3MLXH 4PJIF 2QZQA 4S2SA 5CS7A 3TZVA 4XE5B 5E6IC 4DCQA 4RQQA 1BEYH 4LLQB 4XPFL 3HPJA 2DQGH 3FNKA 3QZOA 3ZZSA 4NUJA 4MQXD 3N85L 2WXFA 1UWYA 1GS7A 4AIEA 1FG2B 3B8SA 3BZ4B 1CTNA 4XVUC 5KBLA 4PJHA 1U8HA 2D3LA 5A6MA 4A6YA 2NUTA 1J05A 3N1FC 2VDOH 2GHWB 3NZUA 4NIKB 2XTJB 5EF1A 2KDYA 4K2UL 4OJCA 2XUWA 4AQEA 5H94A 1RK7A 2H4EA 4KK9D 3BLBA 3R06B 1MXDA 3HZKB 3PABB 4MQSB 3DOIA 4PLNC 4CSZA 2OK0H 1TPXC 3TTYA 4LPWA 5DZ9A 1NC2A 1UD8A 4R83A 3BAKA 5L2KB 4HULB 1UXSB 4KKZA 2FX9L 2WWMC 4MD5A 3D52A 2X2IA 2N59A 4IDJH 4IOSA 4M61B 5FF6B 4CNIA 1YY9C 2J5WA 3VCLB 3C5JB 4G8IA 1Z5LA 4YHLL 3TIDA 1LHZA 5CGBA 3ETBF 3MJ9H 3EH4B 3QUHA 3OKEB 5CZVL 5D8JH 4TNGA 1CT8A 1DCEA 3GS7A 3BDXA 3QDMA 1XGRA 1QHOA 3PGFH 5BVJA 4UWQB 2JXMB 1F02I 4MA3A 3B2PA 5E6SB 2NY0C 4CN6A 1P84J 3P0YH 1EO7A 4FN0A 5GRYA 1E8XA 3SKMB 3HG1A 3IFOA 4N8VG 2YWZA 4I3RH 4URTB 4YHPB 2BS8A 4H26A 4NKIL 5TDNA 3PWJA 4BFIA 3RWDA 5SWSD 5AW7B 4D0BA 2G60L 3SYQA 3TWCH 4ANKA 4BH8B 1KXTB 5IK3B 1YQ2A 4FFWD 1MFCL 4QHKJ 2XPGA 1AQKH 5F8QC 1OSZB 5IGXL 4UINL 1FVDB 4TQ8A 3IGUA 3KPMB 2BO0A 3MUZ1 3IDIB 3PGFL 5F3FA 5F3HA 4TL4A 3AT0A 4YSCA 3QJUB 3V79C 2H6UA 3WTYA 4Z9KB 2O5XL 4GFTB 1MFDH 4YH6A 5E94A 3ARQA 3PL6A 2YAQA 4HLZH 4WEBH 3UAAA 5DVOA 4P05A 5IEHB 5L2JA 5HHMB 3QFJA 4M02A 3SKNA 2WBKA 3D07A 3ECBA 3ZYOA 3DX2A 3O45B 5C3IA 4UYQA 3FUMA 4DP4X 2ZWZA 1H19A 1HH6A 2UV3A 3Q1EA 3N1MC 3WXWH 1UOVA 3ZQXA 3FW6A 4EIZC 2Z31C 3ZDZE 2EH8H 1AE6L 3FTWA 5DD6B 3ROLA 5FV2A 1C16A 2JB6A 2IFGA 3L1OL 4NYLA 2D2CC 1UFUA 2YRLA 4UIMB 5FX3A 1LEKA 4ZUSA 3DRTB 3QFJD 4F37F 1LE9B 3X13A 2XHNA 3VGAC 5J6GB 2ADYA 1A6WH 1NCUA 4FE9A 2WLZA 2WANA 1V7NH 5GRXG 4BHUA 1LE5A 2EKSA 4KOBA 2B15A 3C60D 3K72B 4Y7OC 1Z3RA 2VGLM 1ZK5A 2FSEA 4H8VA 4PCYA 5EOCH 3FUHA 3PXHA 3L3OA 4FI7A 4YLQT 3BQUC 2FUTA 1FH5H 3CFBB 3WSQL 2XQBL 2GJZB 2LTQC 3D18A 4W9HC 5I73B 5CD5D 1U91A 1YUKB 2WBWB 3BN9D 4N5ED 1NIBA 4KVCL 2EVHA 4CBZA 2Z64C 3WHE1 4ALAH 5MERA 3HZYA 5D1XA 3I85A 5TFSL 4QRQA 1UZ6E 8PAZA 3OLIA 1KTLA 2PNDA 2FAUA 4W9GC 1T0NA 3VI3E 1TFHA 3QW9A 2V5TA 4PIRF 3HS8A 3L3GB 3T8VA 4MFHA 3F6IA 5IQ7H 3CMOH 4O02L 1JTPA 1UZGA 3MSPA 4IK7A 2XWDA 1JHTB 2EDOA 3JV0A 3BZDA 5C0AB 4F1ZA 4NQVA 5IHUL 1D5IH 5FGSA 5JXED 5I6KA 2XQBH 3F62A 5E8DL 1J10A 5D2NB 1TT6A 1HWGB 3QUMH 1KJMB 3BWUC 3LRLA 4MD0A 3BWAA 2R23B 2EQDA 3GGWA 2P8PB 3UGUA 4ADGA 5I1DA 1KBVA 5BRZA 3ULVE 4EUPA 2Y69B 2BSRB 4UZUA 5BO1H 4Q74A 4BHUI 1RUPL 4FJZA 3OPZL 3KJ4C 2GJRA 2YGQA 3CX5J 4PJBA 3ZTJG 4LEXL 1EEZA 2I7SA 2WSDA 3DV6B 3MN8A 3OAZK 2ISDA 1X4YA 1AGCB 2FGWL 3C2SA 3L48A 1NGXA 4ZUTA 4PGDA 2HLAB 1D5IL 1YMMD 3IU3A 2EYTA 3GHEH 1N0LB 2BNQA 4JO4H 5FCUH 3VGEA 4WV1A 4LSTL 3UH8A 4KK6C 2ZXCA 4ZW8A 1U3HB 5DFWH 4P3CH 5DUBB 1NGWA 1ZGLA 4KQ0A 3GUTA 1E5CA 4AV4A 1I8KA 1A22B 4EI5A 3FTGA 4D9QD 3I2CH 2YEZB 2JKTM 1MFBL 3R19A 1X6LA 4QI3A 3GMPB 3UIYA 5D4HA 4QJ4B 4K07A 2VMFA 5HDQH 1NDGB 5D1QD 4MBOA 1AVAA 4GMTL 2WNGA 5BQ7A 3FFDB 1P6FA 2O6PA 2EYSA 1JTOA 2BFVH 4KX8A 4HJ1A 1U21A 3SE3A 1QSEE 4LDLB 1NOLA 4NNYB 4ZPTB 1FO0B 3BJ91 4MSWB 3WL9B 2JB5L 35C8H 4JHBA 5IWLA 1S9WA 5L2KE 2AXFB 2PCPB 2QBWA 4FG6D 3MZTA 1UKQA 5HGDA 3BGFB 5DUPH 1QUPA 4AEHL 3HLAB 5CLYA 4JN1H 1M6UA 4YE4L 4WW1A 5D1QA 5HI4C 3KLQA 1MCIA 1NCIA 4BH7B 2VR9A 1T1XA 4CJ0A 4NQEB 3CVHA 1FGVH 3QJZA 4P04A 2B9BA 1YN7B 4TN9A 3VXOB 4F33B 2NX5B 1HILA 1DQQA 1SM3H 3QDGA 4KKLD 2W9LA 2NY1C 2NMSA 4GRLA 3SQBA 4NSKB 2ZCHH 5MEOA 1A7BA 1ETA1 5AB2A 2QKIB 3T8XA 2LGNA 1NCAH 1O7DE 3L3DA 3RI5K 4YE4H 3RU8H 1DQMH 2C3WA 3Q2CA 4LARH 5EZPA 1ID2A 4TOYL 3L1EA 3TA4D 1Y07A 1GXEA 1WFIA 4ODBD 2YPLB 3LEVH 1MJ8L 5KSUA 4R5TA 1G7PB 2WY3B 3M88A 1AKPA 1NKRA 1INQB 1S7RA 3X14B 4G8GB 5BUGA 1D7FA 2BVEA 1NIDA 2HFTA 2NY6B 4LLYB 2XVBA 2YIHA 2APWA 1EXHA 2ZCHL 3N50A 1Z32X 3NJVA 5FOBA 2AXJA 5B1BB 4DWHA 3L4VA 1FHGA 1CK0H 3C5ZC 1ZS2A 2J55A 2D3VA 4Y1AD 4NLHA 2XV6B 4NQEE 4W9CC 3FSZA 1LDSA 2ZOOA 3K8LA 4UNUA 1DFBH 5FHAH 3OQ3B 3ZIYA 4JDVB 4NQCA 4M4RB 2O1AA 2R69L 2PLTA 4D9LL 4CDGC 5HHXL 1SEBA 5GGSY 5GS0D 5DT1H 4F15B 4NERA 1TVBA 2QFRA 5DS2A 4N1HB 1DBAH 3TYFA 3E6FA 2DPKA 3QUYB 1GTFA 1I75A 1CF8H 5D1QE 2YRZA 3UCRA 3F58L 4Y1AA 4F27A 3ML8A 1ETZB 2GY7B 1G6RL 3MUGB 2R56L 5EMYA 4DGYL 1XO8A 2HX9A 4U6VH 3U0TA 2FX9H 4A7GF 2BVUA 2VIRA 4JPQA 3IU3B 2QVMA 4HBCH 4DGIL 5G5DB 1MFCH 4H0LC 1ECZA 4HJJH 3UJJL 1A1NA 4JQXA 5IGXH 4RH4A 1BLIA 4N85A 3PFQA 5IFJB 4QHLB 3KGSA 3ZKND 2WHVA 4FQHA 5CZXD 4E5XG 1U30A 5FKAA 1MF2L 4DP1X 1PTZA 2EDLA 2W07A 3LZFL 2QLVB 1MJJA 1IAIH 5ITBL 1QWHA 3DMMD 4I0PB 2OCJA 5I0DA 3WO4B 3IMRA 2Q8AL 1VFBA 4MLSA 4OLXL 1AHWA 3M8OL 3OAWA 3FXIC 5D7IE 4HUUA 5JXAH 3NFSL 3OTTA 4P4KD 2EVGA 1KJVA 4YDMA 1OWRM 2RFXB 1VGKB 2AI0L 2Q3AA 4OF3A 1Q1JL 4HHAA 1SJEB 4IBVA 3WHE0 3C9NB 1CI5A 3CDZB 3RB5A 2C7UA 4OV5A 4URKA 1JZFA 4R4ND 2DJSA 2W0FB 4CMHC 5JR1L 3FQ1A 1HXKA 3S2CA 5INDB 4KZEH 3RFRA 5ITBH 1S7VA 1WCBA 5DHEA 4B9IA 1OGAB 1CFQA 3GSQA 3QR0A 3TFBA 5LXGL 4Q8BA 4XNZC 1B6UA 4WFGE 4MA7H 5FYKU 4D2NA 3UAJA 5GJTL 5SX4I 3ZL4L 2FRGP 4NN5B 4DEWA 3T0EE 5GRVK 4ODSL 1Q9LB 1WUZA 4UV7H 3II2A 5I5JA 3S4SB 1BZEA 1NANI 3FTYA 2ODHA 3ARPA 3TA3C 4YHKL 1D7CA 2KYIA 1TKWA 2P80A 3SO3B 4N2IA 3IJEA 2JKXA 5MP6H 3QQ9C 4KZEL 4BFKA 4CADA 3SDYH 4CSSA 1CVSC 2AQ1A 3ZDZF 2IEPA 4G6FB 4JEGB 4YXKL 4AGMA 1UA6L 3MX0A 4CC4A 5F96L 5PCYA 1IM9B 4LE8A 4TXVB 4DETA 3M45A 1WK0A 4F2EA 2AV7B 2YQGA 3S9DB 4WHDA 1H9VA 1A0QH 3QCVL 3JV6B 5ID0A 4QRBA 2B59A 1N59B 4QR7A 2A1WH 2VR3A 4G6AC 5AOZA 5KVEH 1A1MB 1BDYA 4L9LB 3BAWA 4OUOA 5FYLD 2BIOA 4TF4A 5D2NE 1WE5A 5K93A 1IBGH 2AQPA 3C2AH 4KDWA 2CPCA 1KLGB 4BSWA 3FQNB 1TTCA 3KXFA 5H37G 3BVNA 1UWGH 1F18A 1VEOA 4HS6B 4W4NA 4P2QE 3KNBB 1K8DB 3P3TA 5IT2L 2MQ3A 1EANA 4PD4J 4PH8A 1IKOP 3QQ3B 9PCYA 5KSVA 1I1CA 4I0PC 3RIFF 1ZWIA 4PVLA 2JK5A 2OR9L 3DX9B 5IHWA 1OAYH 1YJDH 1DVFB 1HVXA 2HRGA 4N8PA 5KVDE 5DQJB 3HZYB 4L4TB 5D1XB 3ATAA 3JQOB 2AZAA 1IBGL 4WO4C 4XX1G 1U91B 4BWWA 1BD2A 2K6WA 3DUSA 1DDHB 2XV3A 4MNQB 4AJWA 3RFZC 2WN2A 3KYOA 4Z3EA 3TIDB 1PSKH 4JX0A 3F7PC 1W72B 4GBXB 4NO2B 3AY2A 5DK0A 3C09C 4M61A 3RTQD 3GHEL 5AZEL 4JREB 1BQHB 5FDWB 4UM8B 4Y19A 2OJZL 4S11A 4TVPL 2CA3A 4N87A 2EO1A 3RL2A 4JFEA 3DRTA 4LOUD 1LEKB 4ZUSB 2Y7LA 3G5YA 5KSAC 4NZTH 2O5NA 3S35H 2EH7L 4B0MB 4Z8FH 1KMGA 3NN8B 2V9RA 1PDKA 5CUSL 1ZHLB 1OTTD 3QDAA 4OGYL 4ZXBA 3SDDD 1TG8A 2ZAIA 3GSWA 5DJ0B 2G5RA 4MJ5B 2GCYB 4FX5A 5IJVA 4JFED 3WOVA 5BV7L 5F93C 4N0FA 3QJFB 5CINH 5CCGE 4L0YA 5CMAB 2C9VA 2X9YA 3POHA 1L3NA 1FZJA 3QWOA 3HN3A 4XAWL 4B9ZA 2H8PA 3MV9E 3N85H 5FA4B 1NGQL 4N22A 3QYCA 3PGDB 15C8L 5BPPA 3NCEB 5GS0L 2X6VA 3GLDA 5C07D 2HKFL 3BVTA 1BQKA 4NNPH 4AGNA 2B39A 3LQMA 4BXVA 3C6LD 2VDOL 3L3JA 1OXYA 3UXFA 1SRDA 1GPOL 2F54E 3FSOA 4BH8A 2K4WA 3NGBB 1RZGB 3D85A 3K6OA 4YFDB 3W57A 3C6SB 2NRDA 5KSBB 4AE1A 1K5NA 4OQ1A 3WNMA 4L37A 2J6EH 1KY7A 1ZSDA 2XCMC 1KULA 1KLUB 1MUJA 4PWGA 3W1ZA 4JRYE 4XMVA 1WWWX 2Y07L 2X0UA 1QNZH 3BAYA 4OI8A 4OFYD 4IDJL 4NM4L 2HJKB 4DERA 5EZIH 1QI5A 1OT2A 1B2YA 4OCLC 4R7LA 5KYWA 1SPDA 1A65A 2HJKA 1CFVH 2AABL 4PRDA 4DESA 2CJ3A 4IOSD 3RTQB 1RLBA 1QASA 1KCRL 3CFNA 4LCWA 1ZHLA 2DF3A 1NUNB 3L1GA 4DT2A 3FO0L 4ORZC 1KG0B 5J13B 3VSVA 5IMOA 4XXCC 3EJUA 3DPBB 3FO1B 5E2VH 5IR1A 3FO2B 1A4KB 4Y19B 4BEIA 2AQ3A 3DPBA 3FO1A 4HGMA 1HYSC 4QLRA 3K1DA 3ZY7A 2J8UA 3A22A 2BY0A 3HZKA 4G72B 4DFHA 3O0RH 4M7KH 4DK6A 1N4XH 3VW3H 3ZPDA 1H5BA 5CEZE 1FZKB 2XDHA 1I3GH 3FOLB 4XP1L 5K1VA 5KBDA 4WDIB 5GGVL 1DVZA 1NUFA 5DQJA 1FF5A 4ZD3H 3IB4A 1T2QH 5GGRY 3CC5A 4DEPC 1R3LA 1D5XB 3CHXA 5EBLB 3TVMB 1CF8L 2ZX9A 2K1MA 2YD9A 4QHUA 1T89A 2Q1EA 5C8JB 4HALA 4PW4A 4APXA 1RSFA 2ZNWA 3U82B 2GFBA 1LO2H 2MCPL 3VXSD 1WS7A 2G75A 5IBUB 5I15H 3VO0A 3EJQA 3IKKA 3LRMA 4LVNB 5FYKL 3CIQA 4MVBD 5IR1B 2MOVA 3O6FD 3L1OH 1WAAF 3MODL 2BWDA 1UCBH 3FQ2A 5DHVH 4NQUA 2H8PB 5SWZB 4CA4A 1DDTA 1KNOB 4J3OC 2IJ0C 3IVKB 4JN2A 2FWOB 5EPMB 2W9EL 1G7JB 5FGBA 4KVNH 1CXIA 5JUEL 3VXTB 1KCWA 3DJZA 4V1DA 3WN5A 5EOCL 3TYGH 3IGFA 1CBVH 2X10A 3L3IA 4QLWA 4AUYA 3EYFB 4NRYA 4AT6A 3QG6A 2OSYA 1ZWIB 4Z95L 4BKSC 1ZSDB 3NYKA 1SN0A 2E4TA 1NUGA 1M9WA 2JCCB 3VTMA 5DWUL 3DHUA 4LK4A 5GSVB 4J1UA 1JSYA 4TVSa 2ERJC 5LCVH 1T7YA 2PCFB 2NDFA 5TPWH 1YN6B 2DLEA 5JORA 5C0ND 1AR1B 4NX0A 3TH4T 4HXBH 2WXGA 2JTYA 1IKNA 2W9EH 1IT9L 1QBBA 2DWDB 4IKIA 5IZ7A 1Y6MR 1NCWL 1DLFL 4K94L 2V4LA 5F89B 1RP9A 2IPKA 2ADGB 32C2B 3B1TA 3JYBA 2XWXA 5FYJL 3B2UD 5IM7B 3IDXH 4YGAB 3O3BA 3VM5A 5T3XL 4CMMA 2R4RH 1RL1A 3EYSH 3ZMRA 1U8PA 4XI5D 4FC3E 4AJYV 4AV5A 3N3EA 1QYGH 3CLFL 1P6AB 3P0GB 4K9EH 3V8OA 2DZEA 1AKJA 4F7PB 4I3SL 1E27B 1KB3A 4PVBA 1IGCH 3IMTA 4KO6A 2WM0A 2UXGA 4ERSH 1S8DB 4J6RH 3P4LA 4KGJA 3ZZQA 1KELL 4OSUH 1SJEA 4LRNL 4JHWH 2I7OA 4PGJA 2I26N 5AOIA 5BRQA 1WAEA 3UL4A 4OI9A 5I1CL 2F1BA 2NQDA 1QSEA 1RHFA 5EU4A 5FO2A 2C1OB 5FYJH 3WO4C 4ZFFB 1FJ1B 1KLGA 3ECUA 4D0DB 5FB8A 4O9HH 4R90L 1I1AD 1TDQA 1XT5A 1G7LB 5KYNA 4PGEB 1KTCA 1Z5YD 4LCIH 2JQAA 1WP6A 3HI5L 3I2CL 1O0VA 2YC1A 3OSVA 4P59H 3RPKA 1IIIA 2VR5A 5FM4A 4Z3JA 3RWEB 4W9KC 2FIRT 1J9RA 3SGDI 1KCKA 1EERB 3GBNH 4MXWL 1OE3A 1QKZL 2VLLA 3CN1A 4KNTA 2ENSA 2AGJH 3T2NL 2QELA 5TK4A 1HZHH 2KKQA 3LH9A 4QHMB 4I1NB 4V11A 1EHAA 2NY4C 1PZ3A 2I07B 1KOAA 3ASOB 4P2YA 3S36L 2JCWA 3Q8CA 2OMVA 1OF2B 4LOUC 3KPLB 4BDVB 4ZSOA 5F1KC 1CI3M 4FEIA 4GG8B 1LMKA 3E6FB 3E1F1 1RHHA 4F24A 1BFOB 4Z7NF 5KUMA 5F44A 3K6IA 4XNMA 3O2VH 1MI5D 5LB1A 2D73A 2NNCA 4K8RD 4KKBD 4BSWB 2PETA 5A6IA 2MKLC 4E9QA 3S8GB 5TE6L 5A2IH 1EHXA 2KS0A 4X80H 4KBPA 4JLRB 3FH7A 1JVKA 2VERA 4L9LA 3F7KA 3FUIA 4G11A 4O2FB 4PGBA 1UJ3B 2VL5A 3ATDA 4KTDL 4RDQG 1R6VA 2XN9E 4FCAA 4QHLA 2AP2A 1FE8H 3O2DA 4LDOB 1TNNA 1A1NB 3SPVA 1KV3A 1TTAA 1JPTL 2WYZA 1S9XB 3V4VH 3V4UL 5J13C 3DRQB 1U3ZA 2H0FA 2K3HA 1RPUA 1QRNA 1TYEB 2V8LA 3B5HA 2VZTA 2YPLA 2XZAH 1MJ8H 4AGPA 3GBLA 3HE6A 3I6KB 3OX8B 1I3RB 4GQPH 4K5LA 5EO9A 3LKPB 4KXAA 4XBPA 1UM5H 5E2UL 1VFMA 1SY6L 2O26U 2FYVA 3QH3A 3CVBA 2QLYA 5CSZA 3IAGC 4XOBA 1RV6X 3WS3A 3WFBH 3GS4A 5E6IB 2EDKA 1XL6A 3MNWB 3ARDC 1T1YB 4DIXA 3KEDA 3L13A 4KAQH 2F7RA 4QF1A 2A9DA 4AV0A 4KKNA 1DQQB 3V4UH 3LIZH 4Q58C 3BKJH 2BRRH 5KANI 4JHAH 1BFVH 2GT9B 1KGIA 2IBBA 4MNHA 4WI4A 1FZOB 2E86A 3FQTA 5EDXA 1AZVA 1MHHA 5E6ZA 1FNFA 2CSPA 1U8OB 2BSTA 2P5WE 5LGHL 3HHSB 3L9BA 2FEEI 2ZP0T 3SJVA 3AITA 2Y3NA 1UM5L 5E2UH 2ZF8A 3CDZA 4ODVL 4PJ9C 2HKAA 1DQLH 7PAZA 5IW6A 7PCYA 5GRUL 3KBEA 4OZFH 5DR5L 3SY0A 4WNQB 3H9YA 1TZOA 5K9KA 3V0AC 1FZOA 3FQTB 4GIOA 4O2CA 4BQBA 2IC2A 1U3HD 1TVBB 2WC7A 3U2JA 2ZIDA 1ZT1B 4LASH 3R8QA 4NO5A 3E0GA 3TJPA 1NFDB 1YMMB 2J57A 1LK2A 4KX9A 1UWEH 3LN4B 5C0RH 5E6IA 1MF2H 3FONB 3CDGA 4ZO7A 4B41A 1Z7JA 3EFDL 4KKQA 1B9ZA 3NH7L 1FP5A 5EO9B 3IDJB 3ARBA 2A7BA 1A7PL 4XP4L 1G4MA 5T5NG 3LEYL 3PV7A 5JNYB 5HDLA 5DGQA 4EN3C 3V6ZB 4A68A 4MDIA 4RGOH 4QPEA 2Q2LA 3U4BH 1XF5A 4O58L 1A7OL 1I1YA 1R5VB 4MDIB 4PJ7B 4C56D 3DETC 1WA1X 1QLEH 4NPYA 4ZUTB 3E9TA 1OTUC 1V3KA 4JDZA 5J1SC 4Z6AT 3CAFA 1JN6A 1I3GL 1KBWA 1QLRB 3VFTA 3QDME 3P9WB 3TT1H 4O2FA 1ERNA 2GC4C 3AGVA 1J1OL 3D0LB 1D7BA 1UB6B 2A9NH 2C34A 3BQUB 4HUWB 3B2XA 2OMYA 1AXTL 3ARGA 4KDTC 3VWKC 1NFDA 1C5DA 3ZE0E 3IJHB 3LEYH 2P7TB 5FYJD 4ZS6D 4HLZG 5FO8A 4UNVA 3CZKA 2OPCA 2DWSA 2VDQB 1L9QA 1CDIA 3KPRE 3NSCA 5DD1H 4XPFH 3GUTB 2PPAA 4PN6A 5ALCL 4AYBA 4M03A 1NH6A 3UDWC 1BLNB 1P9MA 1R3KA 1X9LA 1E2ZA 3ZDXF 2GJJA 4JS7A 4I8DA 2VDPB 4ENED 2JIXB 4PJ9A 1U93B 1BJ1J 1MCOL 2HRLA 2CCWA 1G7PA 3QARA 1XB6A 2H2PD 2QGCA 2E6PA 4LCCC 1YCSA 3VQMA 3PJNA 4YHNB 4NLAA 5LAXA 2EYSB 5BRZB 1FYHB 2DTSA 3VXMD 1AOZA 2B0SL 5KW9H 4Z5RB 1QQDA 5DDHB 2WZ5A 1M7IB 3EYSL 3GYRA 3Q8FA 4E42A 2IBZY 1BZDA 1X6NA 3DURB 5KG9B 3OJDB 1KJ2L 2OXGA 5C0GA 1USQA 2Z35B 4P2QB 3OAYH 3H85A 3JT2A 1CU4H 4YMPA 3GD1C 2G2PA 1YDPA 2DI9A 1YN7A 5FV1L 3S96A 2AJZA 3ULUE 1NJ9A 2N7SA 3UOAB 3KS0J 5IW1A 3P0YL 4XGZA 1I8LC 5HGBB 2WXOA 1FLTX 4PJEB 5DQ9A 1ZSHA 1BXAA 3I74A 1GYAA 5AZ2L 4OH2A 2P8MB 1EEZB 2PWGA 5MERB 3DX8A 5LGYA 4F15C 1CGSL 2H26A 3BUYA 4QRPA 4LPXA 4YDJB 4AXWB 2YA2A 3VG0H 1L6XA 3WE1A 2VN5A 4P3WA 4A6YL 1OY3B 1YEKL 1FAIL 3HHRB 2IPKB 5KVGH 2VSKB 1A7RH 5F3HB 1IGML 2DM7A 4X7SH 5F7AA 2VDML 3SYAA 2ICWJ 3WTUA 4ZX5A 2VDPL 5FKPA 1GCYA 4LGPB 4YIQA 4D0CA 2GY5A 2DWTA 2CDFB 2PCFA 1JYWA 2LTQB 5GGTA 5IVOA 2Y7QA 1BWMA 1J0HA 2J2ZB 2X3BA 1RY7B 1WISA 1MCPH 4LLWA 2CBOA 3RL1A 4PY8I 4LKXA 5HHNA 3V5KA 5C0NC 3E1ZA 1K3ZA 3G6DL 2VLRD 1KB9J 3QJQB 5F2FA 3REVB 4FHBD 3BWUF 1BQLL 2Y5QA 4PJEF 4APQB 1T20B 1G5GA 2FBJL 4LSRH 2EICA 4W6YB 4MJHA 1TEGA 2QHRH 2QSQA 3RDJA 1HJBC 3BZFB 1B9KA 3CSPA 3DXAD 4XPTH 2CAKA 4KUCF 4WWPA 4G8FB 1N26A 1G7LA 4FA7B 4LFHD 3UMNA 4DPCX 1XEUA 4TSBH 3TVMD 3CBJB 2BHUA 5L2KA 2V17L 2UXFA 1G0XA 3Q5OA 1I7UB 4J3XA 3SHSA 5I0YA 4PTUA 5DZNA 1FCGA 3R06A 4TQHA 3U9PL 4CSTA 2UXVA 1H6TA 3EH1A 3DXAA 3X12A 1F4XH 2WPGA 5C8JA 2K9UA 4DN4H 1U36A 2VH5L 4OGXH 5J9PA 5EBLA 5EUKA 2CRIA 4X4ME 4WVRA 1KZYA 3T4AC 3ECBB 1J0YA 4NJ9H 4X4ZA 3G5ZA 5E70A 5LKNA 3LQZA 4Q6IA 3WKMH 3OV6A 3TNNB 3LXBA 1XCTB 1HJCA 1CGWA 5DLML 1D5BA 4KAQL 1A3ZA 1GJIA 3W9EB 1EMTH 4QRPE 2Y7SA 4NAJA 2ADFL 2IXQB 2J8UB 3U2SA 4UM9D 5E9AA 2D03L 1OSZA 4P57A 1DUZB 4R3SB 2QPDB 3HC4H 4YPGB 5C70A 1RZJC 3AU1B 1KG0A 5I6PA 3LKQA 3H42L 4J3UA 1AR1D 4ZDHA 4RWYH 1D2OA 3OWRA 3ECQA 5EIVA 2DYRB 3RHWK 1M4KA 4OCSH 3WG7B 3DK0A 3G5VA 4NRYB 3KJ4B 5F7YC 4GKSB 2PWHA 4MCZB 3SGKC 4WSJA 3NDYE 2DMBA 4LSTH 1BPVA 1FC1A 5FGBC 2KQMA 5D6DA 3VXQB 3BGAA 1G5AA 3VGDA 4UU9B 3GRGA 4FXLA 5G4NA 2WN3A 3T2PA 2Z31A 4PGZA 5KSBA 3GXNA 4H8HA 1CL7L 2ZCKL 5F9WC 1NBCA 3ZT6A 4MA8L 1G0DA 1HXMB 4QRRD 2C9PA 1Q1PA 4AYFA 4PMFA 3ZGHA 1ILSA 1MJUL 2ICEB 4JB9H 4WI9A 3T4AA 4P46D 1DJXA 4KJPC 1C08A 2XWTB 3O6FB 2EDHA 4G7VH 1U3YA 2D7PA 3ZRCC 2GFBB 1J5IA 2YPKB 4XMXA 2Z31D 4POYA 4Z0BH 1B2WH 3VB9A 1XH3A 3MLVL 2HFFB 4WQOA 1TO4A 5TDNB 5IFAL 3DA0A 3OZ9H 1D5MA 4WI7A 2YK1L 3A3YB 1VPOL 1PKQE 4LOEA 1BEXA 5B4MC 3WY4A 3HN8A 2AQQA 5BVJB 5GZOA 4JFYA 3L2MA 4HU2A 4I0CC 3JWOH 2F5AL 5GGUA 1F4WH 1OIOA 2HRHA 4GG6F 3J7HA 4HBQA 4JB9L 4P3DB 3DJRA 2I9TA 3CFJA 1CURA 3GJFB 4N0UA 1A4AA 1PQZA 2XLLA 1MFAH 4PLKC 3K7UA 3VI3A 5HHOA 2VZSA 4Z95H 5DMGC 5D7SH 3ZE0B 2MHAB 1DQML 1U9KA 4O51B 2OBGA 3MR9A 1DBML 4NKQB 3TU6A 4Y19D 5HHQB 5LBGA 4AQEB 2XZZA 3BP7A 2ARWA 1H3VA 5ID1A 1U8KB 4JJHA 2Y7NA 3RWCA 1V55B 4CVXB 1F4WL 1BD2B 1RZQA 4IK6A 1AD9A 3BPLC 3OKYA 1DLFH 4K94H 4OCXH 4HJUA 4IRSC 1B0RB 1WFJA 1YYCA 4ZXBD 4PJ8D 4W4OC 3Q06A 4JFOB 1DBKH 3IDXL 2E75C 1P7QB 4ZI8A 3IE9A 3IM1A 4WO4D 1WFNA 4NKOB 3FPXA 1AZRA 5HJ3A 5BV7H 4YOKA 5EIQA 2V9QA 1HE8A 1S7UA 3O3AB 5C3LD 5DHYB 5CCHE 4DZ8B 5HTSA 2EO9A 2BK8A 4WTWA 4YJZL 5C2UB 5IFHH 4DZ8A 4FMFA 1QFHA 1KGCE 2APSA 1KELH 2ICES 2OMNA 4OSUL 2Z8RA 3L5XH 1OAXL 5C07A 3EHBC 2FE0A 1UC6A 3F7VB 5E5UB 4E9LA 2VDKH 4OD1H 3TIEA 5FYKE 4Y7MA 2R2EB 1NC4D 2PWFA 2OMWA 1AQ8A 1QSFD 2DIJA 3Q2LA 5FA3B 3T9WA 3R0NA 5BS0A 2ZPKH 4YFLF 5JHDB 5I75C 5F0PB 3N41F 4N0FB 4P2CG 4K8RL 3FQWA 4GUCA 2HT3D 3DX7B 2BNUB 2IAMC 3WXWL 2AC0A 3G9AB 2LLLA 3KW7A 5D7IA 5CN2A 3QULA 5E1HB 2ODIA 4XBMA 2VQUA 2AK4B 1MY5A 1WJ3A 3FFCB 3FTXA 2JELH 3FK3A 3CBRA 3WFDH 2EDEA 5KTEH 4LU5L 4MB3A 4FLQA 2I85A 4Y5YB 1E8WA 2Y1ZA 1GZHC 1JWSA 4HKZB 2X6AA 5JW3L 3V4VB 4JJ5A 4IGBB 3O9WD 4AENA 4GW5B 2XI9A 1QOKA 1T4KA 1CL7I 3IXAB 5C09E 4RIRB 3IETA 4I2XB 4WY7H 3SGJC 4UQBA 3QQ9D 3G5XA 3SDAC 5KJ4A 3JUZA 5TE7H 3TA3D 4JRXB 3AMKA 3NA9H 5JIHA 3SY6A 5DURB 4EI0A 2KZBA 5IG7A 3MRQA 5EU7E 5BRPA 4FXTA 2W59A 1XD1A 5EU6D 5JQIB 5FA3A 1DN0B 3Q8BA 4MJIA 3SBWA 2VQ1A 4XBEL 3DYMA 3T3PB 2PW2B 4JFVA 4XPTL 5INDA 3DGDA 3TZVC 4PB0H 3HFFA 5F9DC 2R2HA 4BA8A 3QWRA 3FMGL 3OKKA 3P3SA 4X5XA 4AQ8A 5DJDB 5K39B 3PAVA 4MA7L 1BBJA 1UXWB 4IBYA 3B2UC 3BW9B 3LDBB 3COOA 4YK4C 2MPAL 4RGMC 2AMGA 1E4WL 2ICWI 4QRSB 3BSGA 3U9PH 3ILPB 4P5KA 4W9IC 3RVVD 1IEBA 1FZMB 5IQLA 3JWNG 4YNYA 3VXSA 5AL8A 3WFEL 4YHIB 2NY7L 2P5WA 4I0PA 4OLWH 1FNGB 3FB6B 1GY2A 1F1DA 2AKRB 3MRRB 4FG6C 4LKCA 1U6AL 1AQMA 3E3QC 2XZQH 3KDPB 4AM0B 4CKQA 1GKEA 1Y7VA 2CLVB 1H3PL 3TL5A 3FB8B 1DO6A 4UTBL 2J5LC 2YSSA 5IIEB 2X3CA 1RURH 2N01B 3PL6D 4NP4L 2NUPA 1E4WH 2AK1L 3QFJE 3BYYA 5DGRA 1H6EA 2I27N 3WJLA 3HC0A 2FJGB 3ARBC 4YPGA 3QHFL 1HEHC 1I9IL 1RUQL 4PCKA 1BX2A 4XBGB 1OM3H 3TNMB 3DV4A 1PGRB 2VZ3A 4Z78A 1JNNH 3HE7B 3MUGA 2B1HL 2MWCA 1OCZB 5L8JB 3QUYA 3MLUL 4QO1A 4P3DA 3WMPA 5AW8B 1JYVA 3CSFA 3RJOA 3QUZD 4L8SC 3TN0D 4L23A 1UGKA 4F2FA 4HW6A 4EDWL 4OF8A 3DTDA 4B7IA 1VCBC 5I18L 4Y8AA 3PPEA 3KL3A 2JJVA 2A6IB 3MI6A 4WFFE 3V0HA 1RMFH 2IO5A 2P8LA 3UZQA 2JB5H 35C8L 3JVGC 1EMTL 2EADA 3HUJF 2QQNL 3QORC 1OAZH 2PYED 3IDYC 3FU3A 4QAWA 4AK1A 5I71C 5E2JA 3GSQB 4Z7OB 3U30B 4JZJA 3U4KA 3CE1A 2BSSA 3VVWA 2YAHA 5FO7A 4JFDB 2XY1A 1HAUA 3OG6B 2X1XR 2C9RA 5AKRA 2DH2A 1TMCB 1DO5A 1X7SA 5TK2A 4TUOA 3PHAA 1INQA 4XT1C 3CZFB 4UCFA 4JGUA 2NTFA 3L6FB 3FUNA 2KPWA 4RAVB 3ZW3A 1FL3B 4HP5A 4LCYB 3IJ7A 5EH1A 1HQRA 5MENB 2XFGB 4EQ2A 4NCC2 2UZIH 4NRXB 4PHZA 1WWBX 1JPFB 3RA7H 2YS4A 1XGZA 2YK1H 4QHPA 4W9ZA 1HHIA 5J89A 4EI6B 4ZO8A 1VPOH 4GRLB 3ZDYF 4BFNA 1FBIH 1QBMH 2A6DB 4TOYH 3REVA 4QTHA 1W8OA 2DMKA 3GRWA 4EBQL 4KNSA 5LN8A 12E8H 4L3AA 5I16B 1MJ7L 2IALA 3IFPA 2WQRA 4NAMA 5T3ZH 4WF7A 2EIZB 1JNHB 3GHBL 5GS1C 2APTA 4MWFB 3ZKQD 3IDGB 3VH8G 4D9QE 1BXUA 5DVKA 4EE2A 1U3NA 1WITA 3GDCA 4JKPH 1EH9A 4U2YA 1HCYA 1CDUA 1KC5L 1W0WA 2VT0A 4DW2H 5I1KH 4H25B 3VFGH 3N43F 2APXA 5D1ZB 4JCLA 4HUCA 3Q01A 4KQ4H 4ODXA 5IMMB 1D7DA 4L1HA 2JVUA 2MIZA 2JI3A 4S1SH 3AM8C 4DKFH 1DQKA 1CC3A 4NNPL 4ZW3A 1NEUA 1X3DA 1QFUH 3BPNB 4N90D 3ABMB 2R8SL 3N91A 1M6OA 4U2ZA 4X98B 3EH2A 4XC3H 4Y89A 1NIEA 3GHBH 2F54B 4PJ9D 1HTYA 4QRRE 2GUYA 4DAGH 4NZUL 3MLXL 3ZHLA 3UBHA 5J9PB 1WS8A 1P4LB 2ICWB 2B0SH 2P42B 1U8CB 2C7FA 2PR9A 3MTXA 4R97C 3AS3A 4S1DC 5AUMA 5DRWA 3DJ9A 3MXWL 1N3NA 1EDHA 1MN4A 1ODUA 5D7SL 4M5ZL 3N5AA 2Z92B 3SDXF 3VXMA 5BZZA 3N1GC 3E6HB 3AS2A 5BZWA 3U7AA 2VMDA 2ATKB 2FEJA 3GBMH 2NTSP 3LQAC 1M05B 4ICWA 2YA0A 4Z5RA 2NW2B 2WLLA 1EV2E 2QQKH 3K6SB 2DWEA 4JJOA 4MMYA 5FS5A 4AH2B 1GCFA 1O9WA 5DEGB 2YPLD 3JWDH 4M5SA 5CJXC 4AKQA 2P1YA 3E8VA 3QUZC 4Z77A 1P4IH 1UQSA 2HG5A 3ZMEA 2QJDA 3K6NA 2NY0D 5EZOL 4FQ1H 1BVZA 1YEIL 2ZUUA 3QAZC 2DKUA 3PQYD 2BOCA 4W1TA 1UTDA 1GGIH 1T7VA 2XBDA 1JRHI 1K72A 2A99A 4QRPD 3D39B 5I6XB 3FB7A 5KVGL 3BVXA 1HSAB 4PW9A 1FFOA 3GBML 4KMLB 2WZ6A 3RQ3A 4ETQA 4UUJB 1U8CA 2Y7QB 3MV9A 5JR1H 2WXHA 4UTBA 5T5FA 5T33L 1T0NB 2K7QA 5ADOH 2IG2H 4MHHI 1RZKH 4AE0A 1HCVA 1A47A 4QOKA 3QP3A 4GSQA 3BP4B 3L3KA 2XWBB 3KW8A 2PWDA 3ARGB 3HC3L 4WAFA 1PG7H 1DUYA 2HN7B 4LMQI 2LOEA 2AVFA 4UMGA 4Y8DC 4EF3A 5DCCA 1YQVL 1MCLA 3A0OA 3VFOB 1FI8C 1L9NA 1JN6B 4R7DB 4G8GD 4RA3A 2F6AA 4MDRA 2NXYC 3K72A 3VFWB 1W0WB 4HSCX 5EU7C 25C8L 3AREC 4EI5C 4Z3GA 3AXHA 2DQCH 4PB0L 4N2EA 5F7WC 1SXNA 1U2HA 2VR6A 1LK3L 5E6ID 1BOGA 5FCSH 3P30L 2WO2B 4XHJC 1E5BA 4PRHE 1JNHA 5DRWB 1J8HD 4FLOA 5DFVC 5F96H 1A6ZB 3I02A 2CJUH 4RGNC 4XN2A 3PFUA 4BIKA 2O61A 5FECB 4QCIA 1QRKA 2CHDA 2UUDK 2NY5C 3G5WA 1JYXA 3IDYB 5I71B 2X4UA 1M1SA 2A83A 3BI9X 1WO2A 4P9HC 3TBVB 1U92B 2F8XC 4I18C 3EZ8A 3QHZL 2WIIA 5I6NA 2DBLH 1QBLL 4A67A 3QZWG 3UIZA 1L9RA 3KH4A 2XG5B 4LCYA 2MQCA 3RDTA 2X70B 2Z4QB 2G2RA 2I25N 3T4YB 4F7EB 2WLMA 2WWNA 2ATKA 4F3FB 1GIGL 5AYQA 5J0BA 2DLHA 2EIJB 2XU9A 3MJ9A 5FGRA 2FLRT 3MRGB 3GF8A 3MBEC 3QUYC 4OQTL 2AK1H 3B5GA 5I8OL 3LH8A 4LSPL 3MVSA 5HYQA 4M7JH 4OIFA 4LVHB 4BJLA 1AXSB 4YO0B 5BV7B 3HI6H 1UWXK 2LLNA 1BCIA 4Q7DA 4AIZB 2DLTA 3BRFA 2EACA 4R4NC 4K3JL 5T1KB 2W94A 4CU6A 1RIHL 3BDYL 2P8LB 3LNDA 4XN9A 3IJHA 2O6EA 5A6LA 3BCFA 4ZUUB 3D0LA 4KRMB 5LNEA 3M17A 4H44C 5TH2A 5EWIH 1IQDA 1KGYE 3O0LA 5AW5B 1KGCD 4OQTH 1I9EA 4YBQC 3EYUL 1T1WB 3IF1B 4KXBA 2F53D 4Q52A 4ODXB 5IJKC 2FSEB 4H25A 5EZLA 2YEQA 3MJ8A 5E1AB 3E2HB 3KLDA 1XGYH 3CPLB 3EOAB 4X6EB 2DTMH 3BDYH 3UTTD 2BDNL 5EC1A 2GSMB 3K0YA 5HY9B 2DB8A 5IVXE 3ABZA 1PLGL 3CV5A 3KD4A 3KYMB 3BKMH 1J05B 2XWCA 3BHBA 1N8ZA 2KT6A 4GW4B 5I18H 4PRHA 3CDGB 2IDCA 2I60L 4GSUA 1BZ7A 4MQ7B 3HFML 1CGVA 3NIFB 5D7HA 2WP3O 3DPDA 1ZS8A 2IFFH 2YKLH 3BRDA 4W70A 4TLKA 4RQQB 5HYJE 1AP2A 4PYGA 4Z7UF 4DO6A 3VTAA 4KV5E