3UPGA

Loop deletion mutant of salmonella typhi osmoporin (ompc):an outer membrane protein.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
338
structure length
311
Chain Sequence
AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGLKFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKGDGYGGSLTYAIGEGFSVGGAITTSKATVYTGGLKYDANNIYLAAQYSQTYNATRFGTSGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of osmoporin (OmpC) loop deletion mutant: an Outer membrane protein from Salmonella typhi.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
molecule keywords Outer membrane protein C
total genus 64
structure length 311
sequence length 338
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3upgA00
8PRNA 1GFQA 3POXA 2ZLDA 5PRNA 2XE2A 1OPFA 4D65A 4C69X 1GFNA 3T0SA 3VY8X 3A2SX 2XE3A 2XG6A 2O4VA 3WI5A 2FGQX 2ODJA 2OMFA 3K19A 3SYBA 4KR8A 4D5UA 4GCSA 1MPFA 2J4UP 3SZDA 1HXTA 1BT9A 3JTYA 4D64A 3VZUX 3PRNA 3T20A 1HXUA 3SY7A 3VZWX 2ZFGA 4LSFA 2XE1A 3UU2A 1E54A 3HWBA 1OSMA 3SYSA 4FSOA 4FRTA 4RJWA 4FOZA 3WI4A 4BUMX 3VZTX 1H6S1 1GFOA 6PRNA 3POUA 5DL6A 3UPGA 2QTKA 2J1NA 4LSEA 3VY9X 5DL5A 5DL7A 5JDPA 2Y2XA 3PORA 2Y0KA 4FSPA 2K4TA 3SY9A 1PHOA 4AUIA 7PRNA 4RJXA 1GFMA 1BH3A 5FVNA 3FYXA 1PRNA 3O0EA 4KRAA 2Y0HA 3HW9A 3POQA 2PORA 2FGRA 4JFBA 1HXXA 2PRNA 4LSIA 3SZVA 4FMSA 4GCPA 2XE5A 4KR4A 3NSGA 5DL8A 1GFPA 3T24A 4LSHA 2Y0LA 4FRXA 3EMNX 4GCQA 4FT6A
chains in the Genus database with same CATH superfamily
2IWVA 8PRNA 1GFQA 3AA0A 3C5OA 2ZLDA 3POXA 3AA7B 4UB6O 2M07A 5PRNA 5AFUK 4K3CA 2XE2A 1OPFA 3KVDD 3PGUA 4FZNA 5D5DA 4D65A 4AKMA 4C69X 3A0HO 2F1TA 2AXTO 1GFNA 1ZHTA 2N2MA 4Z3TA 4FZLA 2KXPA 3T0SA 5T5FA 4XNLA 4N58A 1S5LO 5G38A 3VY8X 4O49A 1QJPA 3A2SX 4N59A 4IL6O 2R88A 3KZIO 2XE3A 4G76A 1BXWA 2XG6A 4O3YA 4O4UA 2O4VA 3WI5A 4FZMA 5ADXL 3LK2B 1G90A 5B66O 2FGQX 2ODJA 3PQUA 1P4TA 2F1VA 5EE2A 2OMFA 3DWNA 5G26A 4B61A 3K19A 4AYDC 2R4LA 4AYNA 4GHBA 3SYBA 3PF1A 4KR8A 4D5UA 2KZ7B 1MPFA 4GCSA 2J4UP 5GTHO 2R4NA 3SZDA 2JMMA 3DA4A 3UAQA 1HXTA 5GV0A 1BT9A 3LK3B 1QJ8A 3JTYA 3GP6A 5TISO 4D64A 1ZHYA 4RLBA 4E1SA 3VZUX 3PRNA 3T20A 1HXUA 1ORMA 4RL9A 3AA6B 1MM4A 4U9CA 1QJ9A 4O3ZA 5G39A 3SY7A 4AFKA 4AKRB 3RBHA 2M06A 4JCHA 1YS5A 3QRCA 3AA6A 5KAFO 3VZWX 3BRZA 3LK2A 4C4VB 4O3XB 4O4XA 2LHFA 4CTDA 2ZFGA 3HOLA 4LSFA 2XE1A 3UU2A 1T16A 3LK3A 1E54A 4AZLA 4C4VA 5AFUL 5GTIO 2XTQA 3HWBA 1OSMA 3SYSA 2R4OA 4AKRA 5B5EO 4PJ0O 4FSOA 2KZ7A 3NJTA 4FRTA 4O3WA 2K0LA 4RJWA 4FOZA 4QQ1A 1Q9FA 3WI4A 4BUMX 3AA7A 4G75A 4F4BA 2LFUA 3VZTX 2KXPB 4N74A 3HOEA 2IWWA 2XTRA 2R89A 1H6S1 2WVPA 1ZHXA 3DZMA 1GFOA 3AA1B 6PRNA 5KAIO 4E1TA 5E79O 1T1LA 1MM5A 2WJQA 3AAEB 3BRYA 3POUA 5DL6A 3TZGA 2F1CX 3UPGA 2QTKA 2J1NA 4LSEA 3VY9X 5DL5A 5DL7A 2W81C 3PQSA 2WJRA 5JDPA 1IZNA 2X9KA 2Y2XA 3T24A 3PORA 2Y0KA 2KC0A 4FSPA 2K4TA 3AA0B 3SY9A 4N75A 3BS0A 1PHOA 3AAAB 4FQEA 2MHLA 4AUIA 4C00A 2MNHA 5ADXK 4UB8O 4RJXA 3V8UA 7PRNA 1GFMA 4K3BA 1BH3A 4PR7A 3DA3A 2XMXA 5FVNA 3VE2A 2ERVA 2YPVA 3FYXA 1PRNA 3O0EA 4KRAA 2Y0HA 3HW9A 3POQA 3DWOX 2PORA 2YNKA 3A0BO 4AYEC 2FGRA 4FUVA 4JFBA 1IZNB 1HXXA 3WU2O 2PRNA 3JCUO 4LSIA 2GE4A 3SZVA 3PGSA 2W80C 4GCQA 1THQA 4FMSA 4GCPA 3G7GA 3AAAA 2XE5A 3VE1A 5H2FO 3AAEA 3QRAA 3NSGA 4KR4A 1ZHZA 5DL8A 4AYMC 2Y7SA 4AYID 5G3AA 4PUXA 2KDYA 1GFPA 4GF4A 4FESA 3AA1A 3PGRA 2R8AA 3LK41 2Y0LA 1Q9GA 2N2LA 1ZHWA 3EMNX 2R4PA 4FRXA 2X27X 4LSHA 4XNKA 2JQYA 4RLCA 5IYUA 3LK42 4FT6A
chains in the Genus database with same CATH topology
8PRNA 1GFQA 3AA0A 3C5OA 2ZLDA 3POXA 3AA7B 5PRNA 2M07A 5AFUK 2XE2A 1OPFA 3KVDD 4FZNA 5D5DA 4D65A 4AKMA 4C69X 2F1TA 2N2MA 1GFNA 1ZHTA 4Z3TA 4FZLA 2KXPA 3T0SA 5T5FA 4XNLA 4N58A 3VY8X 4O49A 1QJPA 3A2SX 4N59A 4G76A 2XE3A 1BXWA 2XG6A 4O3YA 4O4UA 2O4VA 3WI5A 4FZMA 5ADXL 3LK2B 1G90A 2FGQX 2ODJA 3PQUA 1P4TA 2F1VA 5EE2A 2OMFA 5G26A 3K19A 4AYDC 4AYNA 4GHBA 3SYBA 4KR8A 4D5UA 2KZ7B 1MPFA 4GCSA 2J4UP 3SZDA 2JMMA 3DA4A 3UAQA 1HXTA 5GV0A 1BT9A 3LK3B 1QJ8A 3JTYA 3GP6A 4D64A 1ZHYA 4RLBA 4E1SA 3VZUX 3PRNA 3T20A 1HXUA 1ORMA 4RL9A 3AA6B 1MM4A 4U9CA 1QJ9A 4O3ZA 3SY7A 4AFKA 4AKRB 4B61A 3RBHA 2M06A 4JCHA 1YS5A 3QRCA 3AA6A 3VZWX 3LK2A 4O3XB 4O4XA 2LHFA 2ZFGA 3HOLA 4LSFA 2XE1A 3UU2A 3LK3A 4AZLA 1E54A 5AFUL 2XTQA 3HWBA 1OSMA 3SYSA 4AKRA 4FSOA 2KZ7A 4FRTA 4O3WA 2K0LA 4RJWA 4FOZA 4QQ1A 1Q9FA 3WI4A 4BUMX 3AA7A 4G75A 4F4BA 2LFUA 3VZTX 2KXPB 3HOEA 2XTRA 1H6S1 1ZHXA 1GFOA 3AA1B 6PRNA 4E1TA 1MM5A 3AAEB 3POUA 5DL6A 3TZGA 3UPGA 2QTKA 2J1NA 4LSEA 3VY9X 5DL5A 5DL7A 2W81C 3PQSA 5JDPA 1IZNA 2Y2XA 3PORA 2Y0KA 2KC0A 4FSPA 2K4TA 3AA0B 3SY9A 1PHOA 3AAAB 4AUIA 2MHLA 2MNHA 5ADXK 3V8UA 4RJXA 7PRNA 1GFMA 1BH3A 3DA3A 2XMXA 5FVNA 3VE2A 2ERVA 2YPVA 3FYXA 1PRNA 3O0EA 4KRAA 2Y0HA 3HW9A 3POQA 2PORA 2YNKA 4AYEC 2FGRA 4FUVA 4JFBA 1IZNB 1HXXA 2PRNA 4LSIA 2GE4A 3SZVA 2W80C 1THQA 4FMSA 4GCPA 3G7GA 3AAAA 2XE5A 3VE1A 3AAEA 3QRAA 3NSGA 4KR4A 1ZHZA 5DL8A 4AYMC 2Y7SA 4AYID 4PUXA 2KDYA 1GFPA 4GF4A 4FESA 3AA1A 3T24A 3LK41 2Y0LA 1Q9GA 2N2LA 1ZHWA 3EMNX 4FRXA 4LSHA 2X27X 4XNKA 5IYUA 4GCQA 4RLCA 3LK42 4FT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PRN A;  1GFQ A;  3POX A;  2ZLD A;  5PRN A;  2XE2 A;  1OPF A;  4D65 A;  4C69 X;  1GFN A;  3T0S A;  3VY8 X;  3A2S X;  2XE3 A;  2XG6 A;  2O4V A;  3WI5 A;  2FGQ X;  2ODJ A;  2OMF A;  3K19 A;  3SYB A;  4KR8 A;  4D5U A;  4GCS A;  1MPF A;  2J4U P;  3SZD A;  1HXT A;  1BT9 A;  3JTY A;  4D64 A;  3VZU X;  3PRN A;  3T20 A;  1HXU A;  3SY7 A;  3VZW X;  2ZFG A;  4LSF A;  2XE1 A;  3UU2 A;  1E54 A;  3HWB A;  1OSM A;  3SYS A;  4FSO A;  4FRT A;  4RJW A;  4FOZ A;  3WI4 A;  4BUM X;  3VZT X;  1H6S 1;  1GFO A;  6PRN A;  3POU A;  5DL6 A;  3UPG A;  2QTK A;  2J1N A;  4LSE A;  3VY9 X;  5DL5 A;  5DL7 A;  5JDP A;  2Y2X A;  3POR A;  2Y0K A;  4FSP A;  2K4T A;  3SY9 A;  1PHO A;  4AUI A;  7PRN A;  4RJX A;  1GFM A;  1BH3 A;  5FVN A;  3FYX A;  1PRN A;  3O0E A;  4KRA A;  2Y0H A;  3HW9 A;  3POQ A;  2POR A;  2FGR A;  4JFB A;  1HXX A;  2PRN A;  4LSI A;  3SZV A;  4FMS A;  4GCP A;  2XE5 A;  4KR4 A;  3NSG A;  5DL8 A;  1GFP A;  3T24 A;  4LSH A;  2Y0L A;  4FRX A;  3EMN X;  4GCQ A;  4FT6 A; 
#chains in the Genus database with same CATH topology
 2IWV A;  8PRN A;  1GFQ A;  3AA0 A;  3C5O A;  2ZLD A;  3POX A;  3AA7 B;  4UB6 O;  2M07 A;  5PRN A;  5AFU K;  4K3C A;  2XE2 A;  1OPF A;  3KVD D;  3PGU A;  4FZN A;  5D5D A;  4D65 A;  4AKM A;  4C69 X;  3A0H O;  2F1T A;  2AXT O;  1GFN A;  1ZHT A;  2N2M A;  4Z3T A;  4FZL A;  2KXP A;  3T0S A;  5T5F A;  4XNL A;  4N58 A;  1S5L O;  5G38 A;  3VY8 X;  4O49 A;  1QJP A;  3A2S X;  4N59 A;  4IL6 O;  2R88 A;  3KZI O;  2XE3 A;  4G76 A;  1BXW A;  2XG6 A;  4O3Y A;  4O4U A;  2O4V A;  3WI5 A;  4FZM A;  5ADX L;  3LK2 B;  1G90 A;  5B66 O;  2FGQ X;  2ODJ A;  3PQU A;  1P4T A;  2F1V A;  5EE2 A;  2OMF A;  3DWN A;  5G26 A;  4B61 A;  3K19 A;  4AYD C;  2R4L A;  4AYN A;  4GHB A;  3SYB A;  3PF1 A;  4KR8 A;  4D5U A;  2KZ7 B;  1MPF A;  4GCS A;  2J4U P;  5GTH O;  2R4N A;  3SZD A;  2JMM A;  3DA4 A;  3UAQ A;  1HXT A;  5GV0 A;  1BT9 A;  3LK3 B;  1QJ8 A;  3JTY A;  3GP6 A;  5TIS O;  4D64 A;  1ZHY A;  4RLB A;  4E1S A;  3VZU X;  3PRN A;  3T20 A;  1HXU A;  1ORM A;  4RL9 A;  3AA6 B;  1MM4 A;  4U9C A;  1QJ9 A;  4O3Z A;  5G39 A;  3SY7 A;  4AFK A;  4AKR B;  3RBH A;  2M06 A;  4JCH A;  1YS5 A;  3QRC A;  3AA6 A;  5KAF O;  3VZW X;  3BRZ A;  3LK2 A;  4C4V B;  4O3X B;  4O4X A;  2LHF A;  4CTD A;  2ZFG A;  3HOL A;  4LSF A;  2XE1 A;  3UU2 A;  1T16 A;  3LK3 A;  1E54 A;  4AZL A;  4C4V A;  5AFU L;  5GTI O;  2XTQ A;  3HWB A;  1OSM A;  3SYS A;  2R4O A;  4AKR A;  5B5E O;  4PJ0 O;  4FSO A;  2KZ7 A;  3NJT A;  4FRT A;  4O3W A;  2K0L A;  4RJW A;  4FOZ A;  4QQ1 A;  1Q9F A;  3WI4 A;  4BUM X;  3AA7 A;  4G75 A;  4F4B A;  2LFU A;  3VZT X;  2KXP B;  4N74 A;  3HOE A;  2IWW A;  2XTR A;  2R89 A;  1H6S 1;  2WVP A;  1ZHX A;  3DZM A;  1GFO A;  3AA1 B;  6PRN A;  5KAI O;  4E1T A;  5E79 O;  1T1L A;  1MM5 A;  2WJQ A;  3AAE B;  3BRY A;  3POU A;  5DL6 A;  3TZG A;  2F1C X;  3UPG A;  2QTK A;  2J1N A;  4LSE A;  3VY9 X;  5DL5 A;  5DL7 A;  2W81 C;  3PQS A;  2WJR A;  5JDP A;  1IZN A;  2X9K A;  2Y2X A;  3T24 A;  3POR A;  2Y0K A;  2KC0 A;  4FSP A;  2K4T A;  3AA0 B;  3SY9 A;  4N75 A;  3BS0 A;  1PHO A;  3AAA B;  4FQE A;  2MHL A;  4AUI A;  4C00 A;  2MNH A;  5ADX K;  4UB8 O;  4RJX A;  3V8U A;  7PRN A;  1GFM A;  4K3B A;  1BH3 A;  4PR7 A;  3DA3 A;  2XMX A;  5FVN A;  3VE2 A;  2ERV A;  2YPV A;  3FYX A;  1PRN A;  3O0E A;  4KRA A;  2Y0H A;  3HW9 A;  3POQ A;  3DWO X;  2POR A;  2YNK A;  3A0B O;  4AYE C;  2FGR A;  4FUV A;  4JFB A;  1IZN B;  1HXX A;  3WU2 O;  2PRN A;  3JCU O;  4LSI A;  2GE4 A;  3SZV A;  3PGS A;  2W80 C;  4GCQ A;  1THQ A;  4FMS A;  4GCP A;  3G7G A;  3AAA A;  2XE5 A;  3VE1 A;  5H2F O;  3AAE A;  3QRA A;  3NSG A;  4KR4 A;  1ZHZ A;  5DL8 A;  4AYM C;  2Y7S A;  4AYI D;  5G3A A;  4PUX A;  2KDY A;  1GFP A;  4GF4 A;  4FES A;  3AA1 A;  3PGR A;  2R8A A;  3LK4 1;  2Y0L A;  1Q9G A;  2N2L A;  1ZHW A;  3EMN X;  2R4P A;  4FRX A;  2X27 X;  4LSH A;  4XNK A;  2JQY A;  4RLC A;  5IYU A;  3LK4 2;  4FT6 A; 
#chains in the Genus database with same CATH homology
 8PRN A;  1GFQ A;  3AA0 A;  3C5O A;  2ZLD A;  3POX A;  3AA7 B;  5PRN A;  2M07 A;  5AFU K;  2XE2 A;  1OPF A;  3KVD D;  4FZN A;  5D5D A;  4D65 A;  4AKM A;  4C69 X;  2F1T A;  2N2M A;  1GFN A;  1ZHT A;  4Z3T A;  4FZL A;  2KXP A;  3T0S A;  5T5F A;  4XNL A;  4N58 A;  3VY8 X;  4O49 A;  1QJP A;  3A2S X;  4N59 A;  4G76 A;  2XE3 A;  1BXW A;  2XG6 A;  4O3Y A;  4O4U A;  2O4V A;  3WI5 A;  4FZM A;  5ADX L;  3LK2 B;  1G90 A;  2FGQ X;  2ODJ A;  3PQU A;  1P4T A;  2F1V A;  5EE2 A;  2OMF A;  5G26 A;  3K19 A;  4AYD C;  4AYN A;  4GHB A;  3SYB A;  4KR8 A;  4D5U A;  2KZ7 B;  1MPF A;  4GCS A;  2J4U P;  3SZD A;  2JMM A;  3DA4 A;  3UAQ A;  1HXT A;  5GV0 A;  1BT9 A;  3LK3 B;  1QJ8 A;  3JTY A;  3GP6 A;  4D64 A;  1ZHY A;  4RLB A;  4E1S A;  3VZU X;  3PRN A;  3T20 A;  1HXU A;  1ORM A;  4RL9 A;  3AA6 B;  1MM4 A;  4U9C A;  1QJ9 A;  4O3Z A;  3SY7 A;  4AFK A;  4AKR B;  4B61 A;  3RBH A;  2M06 A;  4JCH A;  1YS5 A;  3QRC A;  3AA6 A;  3VZW X;  3LK2 A;  4O3X B;  4O4X A;  2LHF A;  2ZFG A;  3HOL A;  4LSF A;  2XE1 A;  3UU2 A;  3LK3 A;  4AZL A;  1E54 A;  5AFU L;  2XTQ A;  3HWB A;  1OSM A;  3SYS A;  4AKR A;  4FSO A;  2KZ7 A;  4FRT A;  4O3W A;  2K0L A;  4RJW A;  4FOZ A;  4QQ1 A;  1Q9F A;  3WI4 A;  4BUM X;  3AA7 A;  4G75 A;  4F4B A;  2LFU A;  3VZT X;  2KXP B;  3HOE A;  2XTR A;  1H6S 1;  1ZHX A;  1GFO A;  3AA1 B;  6PRN A;  4E1T A;  1MM5 A;  3AAE B;  3POU A;  5DL6 A;  3TZG A;  3UPG A;  2QTK A;  2J1N A;  4LSE A;  3VY9 X;  5DL5 A;  5DL7 A;  2W81 C;  3PQS A;  5JDP A;  1IZN A;  2Y2X A;  3POR A;  2Y0K A;  2KC0 A;  4FSP A;  2K4T A;  3AA0 B;  3SY9 A;  1PHO A;  3AAA B;  4AUI A;  2MHL A;  2MNH A;  5ADX K;  3V8U A;  4RJX A;  7PRN A;  1GFM A;  1BH3 A;  3DA3 A;  2XMX A;  5FVN A;  3VE2 A;  2ERV A;  2YPV A;  3FYX A;  1PRN A;  3O0E A;  4KRA A;  2Y0H A;  3HW9 A;  3POQ A;  2POR A;  2YNK A;  4AYE C;  2FGR A;  4FUV A;  4JFB A;  1IZN B;  1HXX A;  2PRN A;  4LSI A;  2GE4 A;  3SZV A;  2W80 C;  1THQ A;  4FMS A;  4GCP A;  3G7G A;  3AAA A;  2XE5 A;  3VE1 A;  3AAE A;  3QRA A;  3NSG A;  4KR4 A;  1ZHZ A;  5DL8 A;  4AYM C;  2Y7S A;  4AYI D;  4PUX A;  2KDY A;  1GFP A;  4GF4 A;  4FES A;  3AA1 A;  3T24 A;  3LK4 1;  2Y0L A;  1Q9G A;  2N2L A;  1ZHW A;  3EMN X;  4FRX A;  4LSH A;  2X27 X;  4XNK A;  5IYU A;  4GCQ A;  4RLC A;  3LK4 2;  4FT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...