3UPGA

Loop deletion mutant of salmonella typhi osmoporin (ompc):an outer membrane protein.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
338
structure length
311
Chain Sequence
AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGLKFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKGDGYGGSLTYAIGEGFSVGGAITTSKATVYTGGLKYDANNIYLAAQYSQTYNATRFGTSGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein C
publication title Crystal structure of osmoporin (OmpC) loop deletion mutant: an Outer membrane protein from Salmonella typhi.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 64
structure length 311
sequence length 338
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3upgA00
4FOZA 3HWBA 1BH3A 4FSOA 3T24A 3O0EA 3SY7A 4BUMX 3UPGA 4C69X 1OPFA 3POXA 2Y0HA 4FMSA 2XE5A 4FSPA 2K4TA 3VY8X 1PHOA 3HW9A 4GCQA 4LSIA 1HXUA 3PRNA 2ODJA 1H6S1 3SYSA 3T20A 3EMNX 4RJXA 3SZVA 3JTYA 1BT9A 4JFBA 1GFOA 5DL6A 1HXXA 1PRNA 3SY9A 3VZUX 2O4VA 3VZTX 3UU2A 3WI4A 3VY9X 5DL8A 2PRNA 5PRNA 3FYXA 3VZWX 2Y2XA 2XG6A 4GCPA 1GFMA 4LSFA 4LSHA 3PORA 1HXTA 2ZLDA 2Y0LA 5JDPA 3SYBA 3K19A 6PRNA 2J4UP 4KR8A 2XE2A 1GFPA 1E54A 1MPFA 4LSEA 4FRTA 2Y0KA 4AUIA 2FGRA 4GCSA 3NSGA 4KRAA 4FRXA 5DL7A 3T0SA 1GFQA 5DL5A 4D65A 3POUA 2ZFGA 7PRNA 2XE1A 2J1NA 3A2SX 2XE3A 8PRNA 3SZDA 4RJWA 2PORA 3WI5A 1GFNA 2QTKA 1OSMA 3POQA 2OMFA 4D64A 2FGQX 4D5UA 4KR4A 4FT6A 5FVNA
chains in the Genus database with same CATH superfamily
4AZLA 2WJQA 3DZMA 4FUVA 4FOZA 4AYMC 3HWBA 2Y7SA 4FESA 1BH3A 4FSOA 3T24A 1MM5A 3O0EA 4U9CA 2R4OA 3SY7A 4AYNA 4BUMX 4FZMA 3UPGA 3AA0B 2KZ7B 2R89A 4O3ZA 4C69X 1OPFA 3RBHA 3POXA 2J4UP 2ERVA 2Y0HA 4N59A 5B66O 4FMSA 2XE5A 1G90A 4FSPA 2K4TA 3VY8X 1IZNA 1S5LO 2N2LA 4N74A 1PHOA 3HW9A 3LK2B 4GCQA 2KXPB 3AA6B 4GF4A 4LSIA 1HXUA 3PRNA 4JCHA 3TZGA 2R4LA 4N75A 2JQYA 2ODJA 4QQ1A 5KAFO 5AFUL 4RLBA 2KDYA 2M07A 1H6S1 1T1LA 1ZHYA 3SYSA 3DWNA 3T20A 3AAEB 3EMNX 2KXPA 2WVPA 2F1VA 4RJXA 3SZVA 3AAAB 4E1TA 2R88A 2N2MA 2XMXA 3VZWX 3LK42 3JTYA 3GP6A 3UAQA 4Z3TA 4C4VA 1BT9A 4IL6O 4JFBA 1ZHZA 3PGSA 1GFOA 3WU2O 5DL6A 2F1TA 1P4TA 1HXXA 1PRNA 3QRAA 3SY9A 2LFUA 2R4PA 3VZUX 4AFKA 4G75A 4CTDA 2AXTO 1BXWA 2O4VA 4G76A 3KVDD 3VZTX 2XTQA 3HOLA 3UU2A 3LK3B 3WI4A 3VY9X 4AKRB 5KAIO 4RLCA 5DL8A 2PRNA 3AA0A 2KZ7A 2R8AA 5PRNA 1QJPA 3AA7B 5G38A 3FYXA 2YPVA 3AA1B 5G3AA 2Y2XA 2XG6A 4GCPA 2IWVA 2M06A 3JCUO 3PQUA 4O3YA 1GFMA 3DA4A 2MNHA 4LSFA 4PR7A 4UB6O 4LSHA 3PORA 5GTIO 3VE2A 3LK2A 4XNLA 3AA6A 4B61A 4AKMA 4GHBA 3C5OA 4FZLA 1ZHXA 2X9KA 1HXTA 2ZLDA 1Q9GA 2Y0LA 3HOEA 5G26A 5JDPA 5IYUA 3SYBA 3K19A 5GV0A 5AFUK 3AAEA 6PRNA 2W81C 5TISO 4E1SA 4KR8A 4PJ0O 4XNKA 4O3XB 2XE2A 4AYEC 4F4BA 1GFPA 3AAAA 2WJRA 3LK41 1E54A 1T16A 3PF1A 3QRCA 4K3BA 2R4NA 4PUXA 4UB8O 1MPFA 2K0LA 4LSEA 4FRTA 4O3WA 2Y0KA 2LHFA 2FGRA 4GCSA 3NSGA 4KRAA 4FRXA 5DL7A 4AUIA 3G7GA 4AYID 5B5EO 5ADXK 5GTHO 2F1CX 4AYDC 5E79O 1MM4A 3A0BO 3V8UA 1ZHWA 4O4UA 1THQA 3T0SA 1GFQA 3LK3A 4RL9A 5DL5A 4AKRA 5D5DA 4D65A 3POUA 2ZFGA 7PRNA 2XE1A 2J1NA 4C00A 3PQSA 3BRYA 1QJ8A 1ZHTA 3AA7A 3A2SX 1Q9FA 2MHLA 2XE3A 4FQEA 5G39A 3AA1A 4N58A 8PRNA 1QJ9A 2XTRA 2KC0A 3PGRA 1ORMA 4FZNA 3SZDA 4RJWA 2PORA 1IZNB 5EE2A 3VE1A 3WI5A 3NJTA 2IWWA 3BS0A 3DWOX 5H2FO 2W80C 2X27X 1GFNA 3BRZA 2QTKA 4O49A 1OSMA 3POQA 3KZIO 4O4XA 2OMFA 2GE4A 2YNKA 4D64A 2FGQX 4D5UA 4KR4A 1YS5A 5T5FA 3A0HO 4FT6A 4K3CA 5FVNA 3DA3A 3PGUA 2JMMA 5ADXL 4C4VB
chains in the Genus database with same CATH topology
4AZLA 4FUVA 4FOZA 3HWBA 2Y7SA 4FESA 1BH3A 4FSOA 3T24A 1MM5A 3O0EA 4U9CA 3SY7A 4AYNA 4BUMX 4FZMA 3UPGA 3AA0B 2KZ7B 4O3ZA 4C69X 1OPFA 3RBHA 3POXA 2ERVA 2Y0HA 4N59A 4FMSA 2XE5A 1G90A 4FSPA 2K4TA 3VY8X 1IZNA 2N2LA 1PHOA 3HW9A 3LK2B 4GCQA 2KXPB 3AA6B 4GF4A 4LSIA 1HXUA 3PRNA 4JCHA 3TZGA 5AFUL 4QQ1A 2ODJA 4RLBA 2KDYA 2M07A 1H6S1 1ZHYA 3SYSA 3T20A 3AAEB 3EMNX 2KXPA 4RJXA 2F1VA 3SZVA 3AAAB 4E1TA 2XMXA 2N2MA 3LK42 3JTYA 3GP6A 3UAQA 4Z3TA 1BT9A 4JFBA 1ZHZA 1GFOA 5DL6A 2F1TA 1P4TA 1HXXA 1PRNA 3QRAA 3SY9A 2LFUA 3VZUX 4AFKA 4G75A 1BXWA 2O4VA 4G76A 3KVDD 3VZTX 2XTQA 3HOLA 3UU2A 3LK3B 3WI4A 3VY9X 4AKRB 4RLCA 5DL8A 2PRNA 3AA0A 2KZ7A 5PRNA 1QJPA 3AA7B 3FYXA 2YPVA 3AA1B 3VZWX 2Y2XA 2XG6A 4GCPA 2M06A 3PQUA 4O3YA 1GFMA 3DA4A 2MNHA 4LSFA 4LSHA 3PORA 3VE2A 3LK2A 4XNLA 3AA6A 4B61A 4AKMA 4GHBA 3C5OA 4FZLA 1ZHXA 1HXTA 2ZLDA 1Q9GA 2Y0LA 3HOEA 5G26A 5JDPA 5IYUA 3SYBA 3K19A 5GV0A 5AFUK 3AAEA 6PRNA 2W81C 2J4UP 4E1SA 4KR8A 4XNKA 4O3XB 2XE2A 4AYEC 4F4BA 1GFPA 3AAAA 3LK41 3QRCA 1E54A 4AYMC 5ADXK 4PUXA 1MPFA 2K0LA 4LSEA 4FRTA 4O3WA 2Y0KA 2LHFA 2FGRA 4GCSA 3NSGA 4KRAA 4FRXA 5DL7A 4AUIA 3G7GA 4AYID 4AYDC 1MM4A 3V8UA 1ZHWA 4O4UA 1THQA 3T0SA 1GFQA 3LK3A 4RL9A 5DL5A 4AKRA 5D5DA 4D65A 3POUA 2ZFGA 7PRNA 2XE1A 2J1NA 3PQSA 1QJ8A 1ZHTA 3AA7A 3A2SX 1Q9FA 2MHLA 2XE3A 3AA1A 4N58A 8PRNA 1QJ9A 2XTRA 2KC0A 1ORMA 4FZNA 3SZDA 4RJWA 2PORA 1IZNB 5EE2A 3VE1A 3WI5A 2W80C 2X27X 1GFNA 2QTKA 4O49A 1OSMA 3POQA 4O4XA 2OMFA 2GE4A 2YNKA 4D64A 2FGQX 4D5UA 4KR4A 1YS5A 5T5FA 4FT6A 5FVNA 3DA3A 2JMMA 5ADXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOZ A;  3HWB A;  1BH3 A;  4FSO A;  3T24 A;  3O0E A;  3SY7 A;  4BUM X;  3UPG A;  4C69 X;  1OPF A;  3POX A;  2Y0H A;  4FMS A;  2XE5 A;  4FSP A;  2K4T A;  3VY8 X;  1PHO A;  3HW9 A;  4GCQ A;  4LSI A;  1HXU A;  3PRN A;  2ODJ A;  1H6S 1;  3SYS A;  3T20 A;  3EMN X;  4RJX A;  3SZV A;  3JTY A;  1BT9 A;  4JFB A;  1GFO A;  5DL6 A;  1HXX A;  1PRN A;  3SY9 A;  3VZU X;  2O4V A;  3VZT X;  3UU2 A;  3WI4 A;  3VY9 X;  5DL8 A;  2PRN A;  5PRN A;  3FYX A;  3VZW X;  2Y2X A;  2XG6 A;  4GCP A;  1GFM A;  4LSF A;  4LSH A;  3POR A;  1HXT A;  2ZLD A;  2Y0L A;  5JDP A;  3SYB A;  3K19 A;  6PRN A;  2J4U P;  4KR8 A;  2XE2 A;  1GFP A;  1E54 A;  1MPF A;  4LSE A;  4FRT A;  2Y0K A;  4AUI A;  2FGR A;  4GCS A;  3NSG A;  4KRA A;  4FRX A;  5DL7 A;  3T0S A;  1GFQ A;  5DL5 A;  4D65 A;  3POU A;  2ZFG A;  7PRN A;  2XE1 A;  2J1N A;  3A2S X;  2XE3 A;  8PRN A;  3SZD A;  4RJW A;  2POR A;  3WI5 A;  1GFN A;  2QTK A;  1OSM A;  3POQ A;  2OMF A;  4D64 A;  2FGQ X;  4D5U A;  4KR4 A;  4FT6 A;  5FVN A; 
#chains in the Genus database with same CATH topology
 4AZL A;  2WJQ A;  3DZM A;  4FUV A;  4FOZ A;  4AYM C;  3HWB A;  2Y7S A;  4FES A;  1BH3 A;  4FSO A;  3T24 A;  1MM5 A;  3O0E A;  4U9C A;  2R4O A;  3SY7 A;  4AYN A;  4BUM X;  4FZM A;  3UPG A;  3AA0 B;  2KZ7 B;  2R89 A;  4O3Z A;  4C69 X;  1OPF A;  3RBH A;  3POX A;  2J4U P;  2ERV A;  2Y0H A;  4N59 A;  5B66 O;  4FMS A;  2XE5 A;  1G90 A;  4FSP A;  2K4T A;  3VY8 X;  1IZN A;  1S5L O;  2N2L A;  4N74 A;  1PHO A;  3HW9 A;  3LK2 B;  4GCQ A;  2KXP B;  3AA6 B;  4GF4 A;  4LSI A;  1HXU A;  3PRN A;  4JCH A;  3TZG A;  2R4L A;  4N75 A;  2JQY A;  2ODJ A;  4QQ1 A;  5KAF O;  5AFU L;  4RLB A;  2KDY A;  2M07 A;  1H6S 1;  1T1L A;  1ZHY A;  3SYS A;  3DWN A;  3T20 A;  3AAE B;  3EMN X;  2KXP A;  2WVP A;  2F1V A;  4RJX A;  3SZV A;  3AAA B;  4E1T A;  2R88 A;  2N2M A;  2XMX A;  3VZW X;  3LK4 2;  3JTY A;  3GP6 A;  3UAQ A;  4Z3T A;  4C4V A;  1BT9 A;  4IL6 O;  4JFB A;  1ZHZ A;  3PGS A;  1GFO A;  3WU2 O;  5DL6 A;  2F1T A;  1P4T A;  1HXX A;  1PRN A;  3QRA A;  3SY9 A;  2LFU A;  2R4P A;  3VZU X;  4AFK A;  4G75 A;  4CTD A;  2AXT O;  1BXW A;  2O4V A;  4G76 A;  3KVD D;  3VZT X;  2XTQ A;  3HOL A;  3UU2 A;  3LK3 B;  3WI4 A;  3VY9 X;  4AKR B;  5KAI O;  4RLC A;  5DL8 A;  2PRN A;  3AA0 A;  2KZ7 A;  2R8A A;  5PRN A;  1QJP A;  3AA7 B;  5G38 A;  3FYX A;  2YPV A;  3AA1 B;  5G3A A;  2Y2X A;  2XG6 A;  4GCP A;  2IWV A;  2M06 A;  3JCU O;  3PQU A;  4O3Y A;  1GFM A;  3DA4 A;  2MNH A;  4LSF A;  4PR7 A;  4UB6 O;  4LSH A;  3POR A;  5GTI O;  3VE2 A;  3LK2 A;  4XNL A;  3AA6 A;  4B61 A;  4AKM A;  4GHB A;  3C5O A;  4FZL A;  1ZHX A;  2X9K A;  1HXT A;  2ZLD A;  1Q9G A;  2Y0L A;  3HOE A;  5G26 A;  5JDP A;  5IYU A;  3SYB A;  3K19 A;  5GV0 A;  5AFU K;  3AAE A;  6PRN A;  2W81 C;  5TIS O;  4E1S A;  4KR8 A;  4PJ0 O;  4XNK A;  4O3X B;  2XE2 A;  4AYE C;  4F4B A;  1GFP A;  3AAA A;  2WJR A;  3LK4 1;  1E54 A;  1T16 A;  3PF1 A;  3QRC A;  4K3B A;  2R4N A;  4PUX A;  4UB8 O;  1MPF A;  2K0L A;  4LSE A;  4FRT A;  4O3W A;  2Y0K A;  2LHF A;  2FGR A;  4GCS A;  3NSG A;  4KRA A;  4FRX A;  5DL7 A;  4AUI A;  3G7G A;  4AYI D;  5B5E O;  5ADX K;  5GTH O;  2F1C X;  4AYD C;  5E79 O;  1MM4 A;  3A0B O;  3V8U A;  1ZHW A;  4O4U A;  1THQ A;  3T0S A;  1GFQ A;  3LK3 A;  4RL9 A;  5DL5 A;  4AKR A;  5D5D A;  4D65 A;  3POU A;  2ZFG A;  7PRN A;  2XE1 A;  2J1N A;  4C00 A;  3PQS A;  3BRY A;  1QJ8 A;  1ZHT A;  3AA7 A;  3A2S X;  1Q9F A;  2MHL A;  2XE3 A;  4FQE A;  5G39 A;  3AA1 A;  4N58 A;  8PRN A;  1QJ9 A;  2XTR A;  2KC0 A;  3PGR A;  1ORM A;  4FZN A;  3SZD A;  4RJW A;  2POR A;  1IZN B;  5EE2 A;  3VE1 A;  3WI5 A;  3NJT A;  2IWW A;  3BS0 A;  3DWO X;  5H2F O;  2W80 C;  2X27 X;  1GFN A;  3BRZ A;  2QTK A;  4O49 A;  1OSM A;  3POQ A;  3KZI O;  4O4X A;  2OMF A;  2GE4 A;  2YNK A;  4D64 A;  2FGQ X;  4D5U A;  4KR4 A;  1YS5 A;  5T5F A;  3A0H O;  4FT6 A;  4K3C A;  5FVN A;  3DA3 A;  3PGU A;  2JMM A;  5ADX L;  4C4V B; 
#chains in the Genus database with same CATH homology
 4AZL A;  4FUV A;  4FOZ A;  3HWB A;  2Y7S A;  4FES A;  1BH3 A;  4FSO A;  3T24 A;  1MM5 A;  3O0E A;  4U9C A;  3SY7 A;  4AYN A;  4BUM X;  4FZM A;  3UPG A;  3AA0 B;  2KZ7 B;  4O3Z A;  4C69 X;  1OPF A;  3RBH A;  3POX A;  2ERV A;  2Y0H A;  4N59 A;  4FMS A;  2XE5 A;  1G90 A;  4FSP A;  2K4T A;  3VY8 X;  1IZN A;  2N2L A;  1PHO A;  3HW9 A;  3LK2 B;  4GCQ A;  2KXP B;  3AA6 B;  4GF4 A;  4LSI A;  1HXU A;  3PRN A;  4JCH A;  3TZG A;  5AFU L;  4QQ1 A;  2ODJ A;  4RLB A;  2KDY A;  2M07 A;  1H6S 1;  1ZHY A;  3SYS A;  3T20 A;  3AAE B;  3EMN X;  2KXP A;  4RJX A;  2F1V A;  3SZV A;  3AAA B;  4E1T A;  2XMX A;  2N2M A;  3LK4 2;  3JTY A;  3GP6 A;  3UAQ A;  4Z3T A;  1BT9 A;  4JFB A;  1ZHZ A;  1GFO A;  5DL6 A;  2F1T A;  1P4T A;  1HXX A;  1PRN A;  3QRA A;  3SY9 A;  2LFU A;  3VZU X;  4AFK A;  4G75 A;  1BXW A;  2O4V A;  4G76 A;  3KVD D;  3VZT X;  2XTQ A;  3HOL A;  3UU2 A;  3LK3 B;  3WI4 A;  3VY9 X;  4AKR B;  4RLC A;  5DL8 A;  2PRN A;  3AA0 A;  2KZ7 A;  5PRN A;  1QJP A;  3AA7 B;  3FYX A;  2YPV A;  3AA1 B;  3VZW X;  2Y2X A;  2XG6 A;  4GCP A;  2M06 A;  3PQU A;  4O3Y A;  1GFM A;  3DA4 A;  2MNH A;  4LSF A;  4LSH A;  3POR A;  3VE2 A;  3LK2 A;  4XNL A;  3AA6 A;  4B61 A;  4AKM A;  4GHB A;  3C5O A;  4FZL A;  1ZHX A;  1HXT A;  2ZLD A;  1Q9G A;  2Y0L A;  3HOE A;  5G26 A;  5JDP A;  5IYU A;  3SYB A;  3K19 A;  5GV0 A;  5AFU K;  3AAE A;  6PRN A;  2W81 C;  2J4U P;  4E1S A;  4KR8 A;  4XNK A;  4O3X B;  2XE2 A;  4AYE C;  4F4B A;  1GFP A;  3AAA A;  3LK4 1;  3QRC A;  1E54 A;  4AYM C;  5ADX K;  4PUX A;  1MPF A;  2K0L A;  4LSE A;  4FRT A;  4O3W A;  2Y0K A;  2LHF A;  2FGR A;  4GCS A;  3NSG A;  4KRA A;  4FRX A;  5DL7 A;  4AUI A;  3G7G A;  4AYI D;  4AYD C;  1MM4 A;  3V8U A;  1ZHW A;  4O4U A;  1THQ A;  3T0S A;  1GFQ A;  3LK3 A;  4RL9 A;  5DL5 A;  4AKR A;  5D5D A;  4D65 A;  3POU A;  2ZFG A;  7PRN A;  2XE1 A;  2J1N A;  3PQS A;  1QJ8 A;  1ZHT A;  3AA7 A;  3A2S X;  1Q9F A;  2MHL A;  2XE3 A;  3AA1 A;  4N58 A;  8PRN A;  1QJ9 A;  2XTR A;  2KC0 A;  1ORM A;  4FZN A;  3SZD A;  4RJW A;  2POR A;  1IZN B;  5EE2 A;  3VE1 A;  3WI5 A;  2W80 C;  2X27 X;  1GFN A;  2QTK A;  4O49 A;  1OSM A;  3POQ A;  4O4X A;  2OMF A;  2GE4 A;  2YNK A;  4D64 A;  2FGQ X;  4D5U A;  4KR4 A;  1YS5 A;  5T5F A;  4FT6 A;  5FVN A;  3DA3 A;  2JMM A;  5ADX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...