3UPGA

Loop deletion mutant of salmonella typhi osmoporin (ompc):an outer membrane protein.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
338
structure length
311
Chain Sequence
AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGLKFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKGDGYGGSLTYAIGEGFSVGGAITTSKATVYTGGLKYDANNIYLAAQYSQTYNATRFGTSGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of osmoporin (OmpC) loop deletion mutant: an Outer membrane protein from Salmonella typhi.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
molecule keywords Outer membrane protein C
total genus 64
structure length 311
sequence length 338
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3upgA00
4AUIA 4JFBA 1GFPA 4KRAA 1OPFA 2Y0KA 4D64A 3O0EA 4KR8A 2FGQX 4GCQA 2Y2XA 4FMSA 2QTKA 3T0SA 5DL7A 4GCPA 3FYXA 3A2SX 2XE2A 3T20A 1HXTA 2XE5A 7PRNA 3VY9X 5DL6A 3SY9A 4RJXA 5DL8A 1BT9A 1GFNA 2XE1A 1HXXA 5PRNA 3UU2A 4D65A 2PORA 3SYSA 3VZTX 1GFQA 2XG6A 1PHOA 2FGRA 4FRXA 1PRNA 1GFMA 2J1NA 5JDPA 4FRTA 4FSPA 3POQA 4FSOA 2Y0HA 1MPFA 3WI5A 4LSHA 3VZWX 3VZUX 2PRNA 3K19A 1GFOA 4LSEA 4KR4A 2ZFGA 3PORA 3VY8X 4GCSA 1HXUA 3JTYA 2Y0LA 3EMNX 3HWBA 8PRNA 6PRNA 4RJWA 3PRNA 4BUMX 3POXA 4LSFA 2O4VA 2XE3A 3UPGA 3SZDA 4FT6A 3SY7A 3WI4A 4D5UA 1OSMA 2OMFA 5FVNA 2ODJA 4LSIA 1BH3A 4C69X 4FOZA 2ZLDA 3SZVA 3POUA 3T24A 2J4UP 3SYBA 5DL5A 1E54A 1H6S1 3HW9A 2K4TA 3NSGA
chains in the Genus database with same CATH superfamily
3AAEB 4XNLA 1BXWA 3HOEA 3JCUO 2R88A 2WJRA 3PQUA 4UB8O 5G26A 4AUIA 3VE1A 4JFBA 2X27X 3V8UA 1THQA 1GFPA 4AKRA 4KRAA 1OPFA 2LFUA 2Y0KA 4D64A 4RLCA 3O0EA 4KR8A 4N58A 2FGQX 2XTRA 4GCQA 4O3YA 3LK3A 2KDYA 4FZLA 2Y2XA 1ZHXA 2QTKA 3AAAA 4FMSA 4C4VA 2F1TA 3T0SA 5IYUA 5DL7A 2KZ7B 3AA7B 4PUXA 2R89A 3PF1A 4JCHA 4GCPA 1P4TA 4RL9A 3FYXA 3A2SX 2XE2A 3HOLA 1HXTA 3T20A 2XE5A 1QJ9A 4FZMA 2N2MA 2R4NA 4AYDC 2LHFA 7PRNA 3VY9X 3AA0A 3LK2A 3PGSA 4C4VB 2YPVA 4O3WA 5B66O 5DL6A 3SY9A 2K0LA 3KVDD 2W81C 3DZMA 4RJXA 4B61A 1QJ8A 2X9KA 4N59A 2R4OA 5DL8A 4AYMC 4FESA 1BT9A 4AFKA 1GFNA 2GE4A 2XE1A 4O3ZA 1HXXA 1T1LA 4N75A 2IWVA 5PRNA 3UU2A 4D65A 2PORA 3AA1A 4O4XA 3SYSA 1GFQA 3VZTX 5KAIO 2R4PA 2XG6A 3G7GA 2AXTO 2M07A 2WVPA 3AAEA 1PHOA 3KZIO 5G38A 5G3AA 2FGRA 4FRXA 5G39A 1QJPA 3AA6A 1PRNA 2R4LA 4RLBA 5AFUK 4O49A 1GFMA 3BS0A 4IL6O 2J1NA 4AZLA 2IWWA 2F1VA 5JDPA 4FRTA 3TZGA 2KXPB 1IZNA 3VE2A 3PGUA 4FSPA 5ADXK 3POQA 5GV0A 2MHLA 4FSOA 2Y0HA 4GF4A 5H2FO 5B5EO 2JQYA 1MPFA 3DWNA 3PGRA 5T5FA 2MNHA 3DWOX 4LSHA 3RBHA 3VZWX 3WI5A 3VZUX 4AYID 5D5DA 5GTHO 2M06A 2PRNA 3A0BO 1T16A 4PR7A 3K19A 4K3CA 1GFOA 2ERVA 2XTQA 4LSEA 1ZHYA 4UB6O 4KR4A 3BRZA 2ZFGA 1IZNB 1MM4A 2KXPA 3PORA 5E79O 2YNKA 3VY8X 1ZHWA 3WU2O 2Y7SA 2XMXA 4GCSA 3C5OA 4K3BA 1HXUA 3JTYA 4U9CA 2F1CX 1S5LO 2Y0LA 3EMNX 4GHBA 3UAQA 4AYNA 4O3XB 3AA1B 5GTIO 3HWBA 4Z3TA 1MM5A 8PRNA 5ADXL 6PRNA 1ORMA 1G90A 3GP6A 4RJWA 1ZHZA 1Q9GA 2JMMA 3BRYA 3PRNA 4G76A 4BUMX 3POXA 4CTDA 5AFUL 2R8AA 4LSFA 2O4VA 3AA0B 2XE3A 3LK2B 4AYEC 4N74A 3UPGA 3DA3A 3SZDA 4FT6A 5KAFO 3A0HO 3SY7A 3WI4A 4D5UA 1OSMA 4O4UA 2OMFA 3LK42 5TISO 2N2LA 4FUVA 2KZ7A 3AA7A 3QRAA 5FVNA 4AKMA 2ODJA 3AAAB 4E1SA 2WJQA 4LSIA 3LK3B 3QRCA 4QQ1A 1BH3A 4XNKA 3LK41 3NJTA 4C69X 4FOZA 4G75A 2ZLDA 3SZVA 3POUA 3T24A 4AKRB 4E1TA 4FZNA 2KC0A 4C00A 4F4BA 3SYBA 2J4UP 3DA4A 4FQEA 5DL5A 2W80C 5EE2A 3AA6B 1E54A 1H6S1 1Q9FA 4PJ0O 3HW9A 2K4TA 1YS5A 3PQSA 1ZHTA 3NSGA
chains in the Genus database with same CATH topology
3AAEB 4XNLA 1BXWA 3HOEA 4AUIA 5G26A 5GV0A 3PQUA 3VE1A 4JFBA 2X27X 3V8UA 1THQA 1GFPA 4AKRA 4KRAA 1OPFA 2LFUA 2Y0KA 4D64A 4RLCA 3O0EA 4KR8A 4N58A 2FGQX 2XTRA 4GCQA 4O3YA 3LK3A 2KDYA 4FZLA 2Y2XA 1ZHXA 2QTKA 3AAAA 4FMSA 2F1TA 3T0SA 5IYUA 5DL7A 2KZ7B 3AA7B 4PUXA 4JCHA 4GCPA 1P4TA 4RL9A 3FYXA 3A2SX 2XE2A 3HOLA 1HXTA 3T20A 2XE5A 1QJ9A 4FZMA 2N2MA 4AYDC 2LHFA 7PRNA 3VY9X 3AA0A 3LK2A 2YPVA 4O3WA 5DL6A 3SY9A 2K0LA 3KVDD 2W81C 4RJXA 4B61A 1QJ8A 4N59A 4AYMC 5DL8A 4FESA 1BT9A 4AFKA 1GFNA 2GE4A 2XE1A 4O3ZA 1HXXA 5PRNA 3UU2A 4D65A 2PORA 3AA1A 4O4XA 3SYSA 1GFQA 3VZTX 2XG6A 3G7GA 2M07A 3AAEA 1PHOA 2FGRA 4FRXA 1QJPA 3AA6A 1PRNA 4RLBA 5AFUK 4O49A 1GFMA 4AZLA 2J1NA 2F1VA 5JDPA 4FRTA 3TZGA 2KXPB 1IZNA 3VE2A 4FSPA 5ADXK 3POQA 2MHLA 4FSOA 2Y0HA 4GF4A 1MPFA 5T5FA 3WI5A 2MNHA 4LSHA 3RBHA 3VZWX 3VZUX 4AYID 5D5DA 2M06A 2PRNA 3K19A 1GFOA 2ERVA 2XTQA 4LSEA 1ZHYA 4KR4A 2ZFGA 1IZNB 1MM4A 2KXPA 3PORA 2YNKA 3VY8X 1ZHWA 2Y7SA 2XMXA 4GCSA 3C5OA 1HXUA 3JTYA 4U9CA 2Y0LA 3EMNX 4GHBA 4AYNA 3UAQA 4Z3TA 4O3XB 3AA1B 3HWBA 1MM5A 8PRNA 5ADXL 6PRNA 1ORMA 1G90A 3GP6A 4RJWA 1ZHZA 1Q9GA 2JMMA 3PRNA 4G76A 4BUMX 3POXA 5AFUL 4LSFA 2O4VA 3AA0B 2XE3A 3LK2B 4AYEC 3UPGA 3DA3A 3SZDA 4FT6A 3SY7A 3WI4A 4D5UA 1OSMA 4O4UA 2OMFA 3LK42 2N2LA 4FUVA 2KZ7A 3AA7A 3QRAA 5FVNA 4AKMA 2ODJA 3AAAB 4E1SA 4LSIA 3LK3B 3QRCA 4QQ1A 1BH3A 4XNKA 3LK41 4C69X 4FOZA 4G75A 2ZLDA 3SZVA 3POUA 3T24A 4AKRB 4E1TA 4FZNA 2KC0A 4F4BA 2J4UP 3SYBA 3DA4A 5DL5A 5EE2A 2W80C 3AA6B 1E54A 1H6S1 1Q9FA 3HW9A 2K4TA 1YS5A 3PQSA 1ZHTA 3NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUI A;  4JFB A;  1GFP A;  4KRA A;  1OPF A;  2Y0K A;  4D64 A;  3O0E A;  4KR8 A;  2FGQ X;  4GCQ A;  2Y2X A;  4FMS A;  2QTK A;  3T0S A;  5DL7 A;  4GCP A;  3FYX A;  3A2S X;  2XE2 A;  3T20 A;  1HXT A;  2XE5 A;  7PRN A;  3VY9 X;  5DL6 A;  3SY9 A;  4RJX A;  5DL8 A;  1BT9 A;  1GFN A;  2XE1 A;  1HXX A;  5PRN A;  3UU2 A;  4D65 A;  2POR A;  3SYS A;  3VZT X;  1GFQ A;  2XG6 A;  1PHO A;  2FGR A;  4FRX A;  1PRN A;  1GFM A;  2J1N A;  5JDP A;  4FRT A;  4FSP A;  3POQ A;  4FSO A;  2Y0H A;  1MPF A;  3WI5 A;  4LSH A;  3VZW X;  3VZU X;  2PRN A;  3K19 A;  1GFO A;  4LSE A;  4KR4 A;  2ZFG A;  3POR A;  3VY8 X;  4GCS A;  1HXU A;  3JTY A;  2Y0L A;  3EMN X;  3HWB A;  8PRN A;  6PRN A;  4RJW A;  3PRN A;  4BUM X;  3POX A;  4LSF A;  2O4V A;  2XE3 A;  3UPG A;  3SZD A;  4FT6 A;  3SY7 A;  3WI4 A;  4D5U A;  1OSM A;  2OMF A;  5FVN A;  2ODJ A;  4LSI A;  1BH3 A;  4C69 X;  4FOZ A;  2ZLD A;  3SZV A;  3POU A;  3T24 A;  2J4U P;  3SYB A;  5DL5 A;  1E54 A;  1H6S 1;  3HW9 A;  2K4T A;  3NSG A; 
#chains in the Genus database with same CATH topology
 3AAE B;  4XNL A;  1BXW A;  3HOE A;  3JCU O;  2R88 A;  2WJR A;  3PQU A;  4UB8 O;  5G26 A;  4AUI A;  3VE1 A;  4JFB A;  2X27 X;  3V8U A;  1THQ A;  1GFP A;  4AKR A;  4KRA A;  1OPF A;  2LFU A;  2Y0K A;  4D64 A;  4RLC A;  3O0E A;  4KR8 A;  4N58 A;  2FGQ X;  2XTR A;  4GCQ A;  4O3Y A;  3LK3 A;  2KDY A;  4FZL A;  2Y2X A;  1ZHX A;  2QTK A;  3AAA A;  4FMS A;  4C4V A;  2F1T A;  3T0S A;  5IYU A;  5DL7 A;  2KZ7 B;  3AA7 B;  4PUX A;  2R89 A;  3PF1 A;  4JCH A;  4GCP A;  1P4T A;  4RL9 A;  3FYX A;  3A2S X;  2XE2 A;  3HOL A;  1HXT A;  3T20 A;  2XE5 A;  1QJ9 A;  4FZM A;  2N2M A;  2R4N A;  4AYD C;  2LHF A;  7PRN A;  3VY9 X;  3AA0 A;  3LK2 A;  3PGS A;  4C4V B;  2YPV A;  4O3W A;  5B66 O;  5DL6 A;  3SY9 A;  2K0L A;  3KVD D;  2W81 C;  3DZM A;  4RJX A;  4B61 A;  1QJ8 A;  2X9K A;  4N59 A;  2R4O A;  5DL8 A;  4AYM C;  4FES A;  1BT9 A;  4AFK A;  1GFN A;  2GE4 A;  2XE1 A;  4O3Z A;  1HXX A;  1T1L A;  4N75 A;  2IWV A;  5PRN A;  3UU2 A;  4D65 A;  2POR A;  3AA1 A;  4O4X A;  3SYS A;  1GFQ A;  3VZT X;  5KAI O;  2R4P A;  2XG6 A;  3G7G A;  2AXT O;  2M07 A;  2WVP A;  3AAE A;  1PHO A;  3KZI O;  5G38 A;  5G3A A;  2FGR A;  4FRX A;  5G39 A;  1QJP A;  3AA6 A;  1PRN A;  2R4L A;  4RLB A;  5AFU K;  4O49 A;  1GFM A;  3BS0 A;  4IL6 O;  2J1N A;  4AZL A;  2IWW A;  2F1V A;  5JDP A;  4FRT A;  3TZG A;  2KXP B;  1IZN A;  3VE2 A;  3PGU A;  4FSP A;  5ADX K;  3POQ A;  5GV0 A;  2MHL A;  4FSO A;  2Y0H A;  4GF4 A;  5H2F O;  5B5E O;  2JQY A;  1MPF A;  3DWN A;  3PGR A;  5T5F A;  2MNH A;  3DWO X;  4LSH A;  3RBH A;  3VZW X;  3WI5 A;  3VZU X;  4AYI D;  5D5D A;  5GTH O;  2M06 A;  2PRN A;  3A0B O;  1T16 A;  4PR7 A;  3K19 A;  4K3C A;  1GFO A;  2ERV A;  2XTQ A;  4LSE A;  1ZHY A;  4UB6 O;  4KR4 A;  3BRZ A;  2ZFG A;  1IZN B;  1MM4 A;  2KXP A;  3POR A;  5E79 O;  2YNK A;  3VY8 X;  1ZHW A;  3WU2 O;  2Y7S A;  2XMX A;  4GCS A;  3C5O A;  4K3B A;  1HXU A;  3JTY A;  4U9C A;  2F1C X;  1S5L O;  2Y0L A;  3EMN X;  4GHB A;  3UAQ A;  4AYN A;  4O3X B;  3AA1 B;  5GTI O;  3HWB A;  4Z3T A;  1MM5 A;  8PRN A;  5ADX L;  6PRN A;  1ORM A;  1G90 A;  3GP6 A;  4RJW A;  1ZHZ A;  1Q9G A;  2JMM A;  3BRY A;  3PRN A;  4G76 A;  4BUM X;  3POX A;  4CTD A;  5AFU L;  2R8A A;  4LSF A;  2O4V A;  3AA0 B;  2XE3 A;  3LK2 B;  4AYE C;  4N74 A;  3UPG A;  3DA3 A;  3SZD A;  4FT6 A;  5KAF O;  3A0H O;  3SY7 A;  3WI4 A;  4D5U A;  1OSM A;  4O4U A;  2OMF A;  3LK4 2;  5TIS O;  2N2L A;  4FUV A;  2KZ7 A;  3AA7 A;  3QRA A;  5FVN A;  4AKM A;  2ODJ A;  3AAA B;  4E1S A;  2WJQ A;  4LSI A;  3LK3 B;  3QRC A;  4QQ1 A;  1BH3 A;  4XNK A;  3LK4 1;  3NJT A;  4C69 X;  4FOZ A;  4G75 A;  2ZLD A;  3SZV A;  3POU A;  3T24 A;  4AKR B;  4E1T A;  4FZN A;  2KC0 A;  4C00 A;  4F4B A;  3SYB A;  2J4U P;  3DA4 A;  4FQE A;  5DL5 A;  2W80 C;  5EE2 A;  3AA6 B;  1E54 A;  1H6S 1;  1Q9F A;  4PJ0 O;  3HW9 A;  2K4T A;  1YS5 A;  3PQS A;  1ZHT A;  3NSG A; 
#chains in the Genus database with same CATH homology
 3AAE B;  4XNL A;  1BXW A;  3HOE A;  4AUI A;  5G26 A;  5GV0 A;  3PQU A;  3VE1 A;  4JFB A;  2X27 X;  3V8U A;  1THQ A;  1GFP A;  4AKR A;  4KRA A;  1OPF A;  2LFU A;  2Y0K A;  4D64 A;  4RLC A;  3O0E A;  4KR8 A;  4N58 A;  2FGQ X;  2XTR A;  4GCQ A;  4O3Y A;  3LK3 A;  2KDY A;  4FZL A;  2Y2X A;  1ZHX A;  2QTK A;  3AAA A;  4FMS A;  2F1T A;  3T0S A;  5IYU A;  5DL7 A;  2KZ7 B;  3AA7 B;  4PUX A;  4JCH A;  4GCP A;  1P4T A;  4RL9 A;  3FYX A;  3A2S X;  2XE2 A;  3HOL A;  1HXT A;  3T20 A;  2XE5 A;  1QJ9 A;  4FZM A;  2N2M A;  4AYD C;  2LHF A;  7PRN A;  3VY9 X;  3AA0 A;  3LK2 A;  2YPV A;  4O3W A;  5DL6 A;  3SY9 A;  2K0L A;  3KVD D;  2W81 C;  4RJX A;  4B61 A;  1QJ8 A;  4N59 A;  4AYM C;  5DL8 A;  4FES A;  1BT9 A;  4AFK A;  1GFN A;  2GE4 A;  2XE1 A;  4O3Z A;  1HXX A;  5PRN A;  3UU2 A;  4D65 A;  2POR A;  3AA1 A;  4O4X A;  3SYS A;  1GFQ A;  3VZT X;  2XG6 A;  3G7G A;  2M07 A;  3AAE A;  1PHO A;  2FGR A;  4FRX A;  1QJP A;  3AA6 A;  1PRN A;  4RLB A;  5AFU K;  4O49 A;  1GFM A;  4AZL A;  2J1N A;  2F1V A;  5JDP A;  4FRT A;  3TZG A;  2KXP B;  1IZN A;  3VE2 A;  4FSP A;  5ADX K;  3POQ A;  2MHL A;  4FSO A;  2Y0H A;  4GF4 A;  1MPF A;  5T5F A;  3WI5 A;  2MNH A;  4LSH A;  3RBH A;  3VZW X;  3VZU X;  4AYI D;  5D5D A;  2M06 A;  2PRN A;  3K19 A;  1GFO A;  2ERV A;  2XTQ A;  4LSE A;  1ZHY A;  4KR4 A;  2ZFG A;  1IZN B;  1MM4 A;  2KXP A;  3POR A;  2YNK A;  3VY8 X;  1ZHW A;  2Y7S A;  2XMX A;  4GCS A;  3C5O A;  1HXU A;  3JTY A;  4U9C A;  2Y0L A;  3EMN X;  4GHB A;  4AYN A;  3UAQ A;  4Z3T A;  4O3X B;  3AA1 B;  3HWB A;  1MM5 A;  8PRN A;  5ADX L;  6PRN A;  1ORM A;  1G90 A;  3GP6 A;  4RJW A;  1ZHZ A;  1Q9G A;  2JMM A;  3PRN A;  4G76 A;  4BUM X;  3POX A;  5AFU L;  4LSF A;  2O4V A;  3AA0 B;  2XE3 A;  3LK2 B;  4AYE C;  3UPG A;  3DA3 A;  3SZD A;  4FT6 A;  3SY7 A;  3WI4 A;  4D5U A;  1OSM A;  4O4U A;  2OMF A;  3LK4 2;  2N2L A;  4FUV A;  2KZ7 A;  3AA7 A;  3QRA A;  5FVN A;  4AKM A;  2ODJ A;  3AAA B;  4E1S A;  4LSI A;  3LK3 B;  3QRC A;  4QQ1 A;  1BH3 A;  4XNK A;  3LK4 1;  4C69 X;  4FOZ A;  4G75 A;  2ZLD A;  3SZV A;  3POU A;  3T24 A;  4AKR B;  4E1T A;  4FZN A;  2KC0 A;  4F4B A;  2J4U P;  3SYB A;  3DA4 A;  5DL5 A;  5EE2 A;  2W80 C;  3AA6 B;  1E54 A;  1H6S 1;  1Q9F A;  3HW9 A;  2K4T A;  1YS5 A;  3PQS A;  1ZHT A;  3NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...